1IRPA

Solution structure of human interleukin-1 receptor antagonist protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-1 RECEPTOR ANTAGONIST
publication title Solution structure of human interleukin-1 receptor antagonist protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 34
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1994-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1irpA00
4IONA 4USPA 1OQLB 4OEGA 4LO3C 1ISWA 1YBIA 1FMZA 1HCEA 3WA1A 1AVXB 3HOMA 4I4PA 1PUMB 4QC4A 1TOOA 1GGPB 4OW4A 3O44A 5FZUA 5F8YA 1CVSA 2Y9FA 1WBAA 4G1RA 3FJIA 4ENDA 3OBRA 3BB2A 3BAVA 3P6JA 3SNVA 1QQKA 4EFPA 1IILA 1SZ6B 1MC9A 4X39A 4DCKC 3V0AB 4R6UB 3ILAA 3WINC 4GP3A 2Q3NB 3A07A 4QO3A 3VT0A 1K5VA 2VXTI 3ZC8A 3FJKA 2Y9GA 1DQGA 3IAGC 1XZZA 3S8KA 4IZXA 2MLLB 3CRGA 1V6VA 4FGFA 2K43A 1TP0A 1S0GA 3WO4A 3WMUA 1BFGA 3Q7YA 1Z2VA 4LO3A 1DFCA 2AQZA 2NVHA 3MALA 3FJDA 21BIA 41BIA 2D7IA 3FUOA 3JRRA 4D0ZA 5DVHA 3AKFA 4ZFWB 2IWTB 5DZUA 1HCDA 1RG8A 4EEEB 4QBCA 1XG6A 3MPPG 3A23A 3NBDA 1TFMB 8I1BA 5F8SA 3RTIB 4FVVA 3AZWA 4KC3A 1ONKB 2KI6B 3BAQA 4JP0A 1TIEA 5HPZA 4ZGRB 4Q9GA 4GOYA 4I8MA 2KH2A 5DSSB 4LO7B 4ZFUB 3W9TA 2P39A 1BARA 1CE7B 2VSEA 1Q04A 4II0A 5G00A 4I4VA 3UD7A 1IJTA 1EYLA 2YUGA 3E8LC 3O5WB 2GZBA 2ERMA 3AKIA 2LIQA 4G6MA 3N0KA 3NBEA 2KI4A 5D62A 4HR6C 3NBCA 4ZOTA 3PHZA 4H9WA 4I96A 1S0LA 4LO8B 3O4OA 2NZ9A 4G9NA 5D61A 4XFUA 1ITBA 3AH4A 4IYBA 3O49A 4A7YA 3AKHA 1MD6A 4I0YA 1ISVA 2KKIA 4I4UA 5BP5C 5BXRA 4JAWA 1RY7A 2F2FA 4TLPA 1ISZA 1M2TB 3CRIA 3CA3A 1FN0A 4ZFYB 1JT7A 3UD9A 1BLAA 1TWMA 4P6AA 2K8RA 3IIRA 1M16A 1XHBA 3QYDA 1W3GA 3CA0A 1D0HA 3NJ5A 4X37A 1IHKA 2D44A 1V6UA 1IRAX 2DREA 2RQ9A 3O4DA 2NYYA 4I4OA 2D24A 4OEEA 1WD3A 3HMYA 3AKGA 4IY9A 1FV2A 4I1EA 1HIBA 2FGFA 4G9MA 1V6WA 2RSTA 2Z49A 5FNXA 4OUJA 2VXRA 1DLLA 1IT0A 3IM6A 1S0EA 1QQLA 3V0BA 3AJ5A 3CA1A 4X3AA 4I3NA 4P0KA 6I1BA 3O4CA 4A7ZA 1WBCA 2D43A 3CQAA 4G6JA 1S0FA 5BP5A 4JRAA 1ILR1 4F34A 1G9DA 3F1RA 4P0JA 1TWEA 1EV2A 2L5XA 2R9KB 4Z8SB 3RTJB 4KEIA 1FV3A 3VSFA 3FJAA 1N4KA 1YYNA 2BFHA 3BA7A 1FMMS 2ZQOA 4ZA3B 3P53A 3O3QA 3BA4A 1AVAC 3VUOA 4L4IA 3ZXDA 4Q9PA 4WBCA 1VCLA 4I4SA 2Y9WC 3OJ2A 3V0AA 5B2HA 3S8JA 1IOBA 2AAIB 3VEQA 5BQUC 3CU1B 3OJVA 2BEBA 3FUQA 2ZR1B 3FFZA 4XFSA 1SR4A 4QD2C 4H04A 3IM5A 1HWMB 2VLCA 1DJSB 3R4UA 4EB2B 4EFQA 4KEJA 4IHZA 5BXSA 3CAHA 4J2SA 3BAGA 1PZZA 3N7JA 2WBCA 4LO1C 2E4MC 3WMVA 5DUYA 2FFVA 2F2FC 1EPWA 4JPZA 1R8NA 4OWJA 2Y9XE 4GOVA 3HN1A 1HWNB 3ZXGA 2NTDA 2FDBM 1ABRB 4QKRA 3CA5A 3R4SA 5BQUA 2QN4A 2HWMA 4J2XA 3H6RB 4YOLA 3UD8A 2J3PA 3BX1C 3A21A 1DIWA 3PMEA 1AF9A 4PC4A 4I4XA 4I4RA 2D1ZA 3FJEA 1AVUA 1I1EA 1AXMA 3BTAA 3C9ZA 3IM7A 3A22A 1PC8B 3H6SE 4LO1A 2E4MA 1NUNA 4ZLBB 5BVPI 3UJ0A 4I1BA 2M49A 3PG0A 3FJBA 5I1BA 2NP0A 1BA7A 3D7WB 3H6QA 3FJ9A 4Z9WB 1KNMA 1JY0A 3O4BA 4EFRA 3I2XA 3FGMA 9ILBA 5JLVA 4HJJA 3OBTA 1JT5A 3BADA 4I6IA 4IZEA 3OJMA 3FJFA 4GAIA 4OEFA 2I1BA 2BEAA 3WO3A 3BRDA 5E24E 1EVTA 3V0BB 1QXMA 1S0DA 1Q1UA 3LTQA 3N7KA 3AH2A 4LO0C 1ISYA 2DRZA 5D63A 2P23A 1IRPA 1FGAA 4D0TA 3POKA 2LIEA 4ISQA 4QALA 2XOAA 3BRFA 1P63A 2FO1A 4KBBA 1I1BA 1SR4C 4D8HA 1BFCA 2D20A 3HBWA 1HWPB 1J0SA 5JMCA 1UPSA 4QBVA 4DEPA 1BFBA 4AN7B 4AN6A 3AH1A 1JQZA 2D7RA 2VUAA 3PUBA 3RSJA 2HZ9A 1HWOB 1HKNA 3I29B 1S0CA 2ESUA 3BA5A 5EG6C 1JLYA 1T9FA 5FNWA 1AVWB 3FJJA 1WD4A 5F90A 2QYIB 3V79C 4J2YA 4JKQA 3BAOA 3EF2A 1BLDA 2RG9B 4LO0A 2ET2A 1A8DA 4P0LA 1XYFA 1G9CA 1L2HA 3Q7XA 1FWVA 3BAUA 1K5UA 3CA4A 4ISRA 1FWUA 1F31A 4CJMA 1DQOA 2D23A 5BOWA 3AJ6A 1Z0HA 4X38A 3WO2A 4LO7C 4KEKA 3P6IA 3ZX7A 3ZC9A 2FFUA 2UUSA 4OWLA 2AFGA 5GAQA 1V6XA 4QKSA 1E0OA 1PWAA 1R8OA 4I37A 1W3FA 3HALA 31BIA 1W3AA 3UDAA 2X2SA 4OWKA 4GAFA 4USOA 2KLLA 5F8WA 3WINA 3K1XA 3VWCA 2MIBA 5FZYA 2WRYA 5BXPA 4F83A 3Q7WA 3AZVA 4LO2C 4Q91A 1DFQA 3OGFA 3NBNA 3N7MA 1G9BA 1RMLA 1YXWA 5EHAA 3N7LA 4HA2A 1PUUB 3LLPA 4QD2B 2VSAA 3CA6A 2GO2A 1JTCA 4EKXB 2MC2A 4XFTA 1JLXA 2DRYA 1Z4SA 3VT1A 3F62B 3I2AA 5EC5A 1YTOA 3BRGC 4ZBVB 4DENA 3VSZA 3KMVA 3OGGA 4I2SA 2HW9A 1DZCA 2DS0A 3UJ4A 7I1BA 2NM1A 1AFCA 3HSMA 3B9UA 1II4A 4JKXB 2Q9XA 3TC2A 1TTUA 2X2TA 2Z48A 3H6RA 1NZKA 2AXMA 4XKIA 4IQPA 3CRHA 1FQ9A 2ZQNA 3QR5A 3FJCA 2VU9A 3VT2A 3FJ8A 4IY8A 1G9AA 4LO2A 4I4QA 4I7IA 5FZZA 4I4YA 1G82A 5BXTA 1JT3A 1S0BA 3RMXA 4GP0A 1BFFA 3JUTA 1Q03A 3RMYA 4JQ0A 1RZOB 2D22A 3FJHA 2IHOA 3BAHA 4J23B 3T8SA 4J2KA 1BASA 2K4AB 2HWAA 3O4AA 1T4QA 1YF8B 2F8XC 1DZDA 4L4HA 4A7KA 1ISXA 1JT4A 4ZKTB
chains in the Genus database with same CATH superfamily
4IONA 4USPA 1OQLB 4OEGA 4LO3C 1ISWA 1YBIA 1FMZA 1HCEA 3WA1A 1AVXB 3HOMA 4I4PA 1PUMB 4QC4A 1TOOA 1GGPB 4OW4A 3O44A 5FZUA 5F8YA 1CVSA 2Y9FA 1WBAA 4G1RA 3FJIA 4ENDA 3OBRA 3BB2A 3BAVA 3P6JA 4MZHA 3SNVA 1QQKA 4EFPA 1IILA 1SZ6B 1MC9A 4X39A 4DCKC 3V0AB 4H75A 4R6UB 3ILAA 3WINC 4GP3A 2Q3NB 3A07A 4QO3A 3VT0A 1K5VA 2VXTI 3ZC8A 3FJKA 2Y9GA 1DQGA 3IAGC 1XZZA 3S8KA 4IZXA 2MLLB 3CRGA 1V6VA 4FGFA 2K43A 1TP0A 1S0GA 3WO4A 3WMUA 1BFGA 3Q7YA 1Z2VA 4LO3A 1DFCA 2AQZA 2NVHA 3MALA 3FJDA 21BIA 41BIA 2D7IA 3FUOA 3JRRA 4D0ZA 5DVHA 3AKFA 4ZFWB 2IWTB 5DZUA 1HCDA 1RG8A 4EEEB 4QBCA 1XG6A 3MPPG 3A23A 3NBDA 1TFMB 8I1BA 5F8SA 3RTIB 4FVVA 3AZWA 4KC3A 1ONKB 2KI6B 3BAQA 4JP0A 1TIEA 5HPZA 4ZGRB 4Q9GA 4GOYA 4I8MA 2KH2A 5DSSB 4LO7B 4ZFUB 3W9TA 2P39A 1BARA 1CE7B 2VSEA 1Q04A 4II0A 5G00A 4I4VA 3UD7A 1IJTA 1EYLA 2YUGA 3E8LC 3O5WB 2GZBA 2ERMA 3AKIA 2LIQA 4G6MA 3N0KA 3NBEA 2KI4A 5D62A 4HR6C 3NBCA 4ZOTA 3PHZA 4H9WA 4I96A 1S0LA 4LO8B 3O4OA 2NZ9A 4G9NA 5D61A 4XFUA 1ITBA 3AH4A 4IYBA 3O49A 4A7YA 3AKHA 1MD6A 4I0YA 1ISVA 2KKIA 4I4UA 5BP5C 5BXRA 4JAWA 1RY7A 2F2FA 4TLPA 1ISZA 1M2TB 3CRIA 3CA3A 1FN0A 4ZFYB 1JT7A 3UD9A 1BLAA 1TWMA 4P6AA 2K8RA 3IIRA 1M16A 1XHBA 3QYDA 1W3GA 3CA0A 1D0HA 3NJ5A 4X37A 1IHKA 2D44A 1V6UA 1IRAX 2DREA 2RQ9A 3O4DA 2NYYA 4I4OA 2D24A 4OEEA 1WD3A 3HMYA 3AKGA 4IY9A 1FV2A 4I1EA 1HIBA 2FGFA 4G9MA 1V6WA 2RSTA 2Z49A 5FNXA 4OUJA 2VXRA 1DLLA 1IT0A 3IM6A 1S0EA 1QQLA 3V0BA 3AJ5A 3CA1A 4X3AA 4I3NA 4P0KA 6I1BA 3O4CA 4A7ZA 1WBCA 2D43A 3CQAA 4G6JA 1S0FA 5BP5A 4JRAA 1ILR1 2NS2A 4F34A 1G9DA 3F1RA 4P0JA 1TWEA 1EV2A 2L5XA 2R9KB 4Z8SB 3RTJB 4KEIA 1FV3A 3VSFA 3FJAA 1N4KA 1YYNA 2BFHA 3BA7A 1FMMS 2ZQOA 4ZA3B 3P53A 3O3QA 3BA4A 1AVAC 3VUOA 4L4IA 3ZXDA 4Q9PA 4WBCA 1VCLA 4I4SA 2Y9WC 3OJ2A 3V0AA 5B2HA 3S8JA 1IOBA 2AAIB 3VEQA 5BQUC 3CU1B 3OJVA 2BEBA 3FUQA 2ZR1B 3FFZA 4XFSA 1SR4A 4QD2C 4H04A 3IM5A 1HWMB 2VLCA 1DJSB 3R4UA 4EB2B 4EFQA 4KEJA 4IHZA 5BXSA 3CAHA 4J2SA 3BAGA 1PZZA 3N7JA 2WBCA 4LO1C 2E4MC 4MZFB 3WMVA 5DUYA 2FFVA 2F2FC 1EPWA 4JPZA 1R8NA 4OWJA 2Y9XE 4GOVA 3HN1A 1HWNB 3ZXGA 2NTDA 2FDBM 1ABRB 4QKRA 3CA5A 3R4SA 5BQUA 2QN4A 2HWMA 4J2XA 3H6RB 4YOLA 3UD8A 2J3PA 3BX1C 3A21A 1DIWA 3PMEA 1AF9A 4PC4A 4I4XA 4I4RA 2D1ZA 3FJEA 1AVUA 1I1EA 1AXMA 3BTAA 3C9ZA 3IM7A 3A22A 1PC8B 3H6SE 4LO1A 2E4MA 4MZGB 1NUNA 4ZLBB 5BVPI 3UJ0A 4I1BA 2M49A 3PG0A 3FJBA 5I1BA 2NP0A 1BA7A 3D7WB 3H6QA 3FJ9A 4Z9WB 1KNMA 1JY0A 3O4BA 4EFRA 3I2XA 3FGMA 9ILBA 5JLVA 4HJJA 3OBTA 1JT5A 3BADA 4I6IA 4IZEA 3OJMA 3FJFA 4GAIA 4OEFA 2I1BA 2BEAA 3WO3A 3BRDA 5E24E 1EVTA 3V0BB 1QXMA 1S0DA 1Q1UA 3LTQA 3N7KA 3AH2A 4LO0C 1ISYA 2DRZA 5D63A 2P23A 1IRPA 1FGAA 4D0TA 3POKA 2LIEA 4ISQA 4QALA 2XOAA 3BRFA 1P63A 2FO1A 4KBBA 1I1BA 1SR4C 4D8HA 1BFCA 2D20A 3HBWA 1HWPB 1J0SA 5JMCA 1UPSA 4QBVA 4DEPA 1BFBA 4AN7B 4AN6A 3AH1A 1JQZA 2D7RA 2VUAA 3PUBA 3RSJA 2HZ9A 1HWOB 1HKNA 3I29B 1S0CA 2ESUA 3BA5A 5EG6C 1JLYA 1T9FA 5FNWA 1AVWB 3FJJA 1WD4A 5F90A 2QYIB 3V79C 4J2YA 4JKQA 3BAOA 3EF2A 1BLDA 2RG9B 4LO0A 2ET2A 4UY4A 1A8DA 4P0LA 1XYFA 1G9CA 1L2HA 3Q7XA 1FWVA 3BAUA 1K5UA 3CA4A 4ISRA 1FWUA 1F31A 4CJMA 1DQOA 2D23A 5BOWA 3AJ6A 1Z0HA 4X38A 3WO2A 4LO7C 4KEKA 3P6IA 3ZX7A 3ZC9A 2FFUA 2UUSA 4OWLA 2AFGA 5GAQA 1V6XA 4QKSA 1E0OA 1PWAA 1R8OA 4I37A 1W3FA 3HALA 31BIA 1W3AA 3UDAA 2X2SA 4OWKA 4GAFA 4USOA 2KLLA 5F8WA 3WINA 3K1XA 3VWCA 2MIBA 5FZYA 2WRYA 5BXPA 4F83A 3Q7WA 3AZVA 4LO2C 4Q91A 1DFQA 3OGFA 3NBNA 3N7MA 1G9BA 1RMLA 1YXWA 5EHAA 3N7LA 4HA2A 1PUUB 3LLPA 4QD2B 2VSAA 3CA6A 2GO2A 1JTCA 4EKXB 2MC2A 4XFTA 1JLXA 2DRYA 1Z4SA 3VT1A 3F62B 3I2AA 5EC5A 1YTOA 3BRGC 4ZBVB 4DENA 3VSZA 3KMVA 3OGGA 4I2SA 2HW9A 1DZCA 2DS0A 3UJ4A 7I1BA 2NM1A 1AFCA 3HSMA 3B9UA 1II4A 4JKXB 2Q9XA 3TC2A 1TTUA 2X2TA 2Z48A 3H6RA 1NZKA 2AXMA 4XKIA 4IQPA 3CRHA 1FQ9A 2ZQNA 3QR5A 3FJCA 2VU9A 3VT2A 3FJ8A 4IY8A 1G9AA 4LO2A 4I4QA 4I7IA 5FZZA 4I4YA 1G82A 5BXTA 1JT3A 1S0BA 3RMXA 4GP0A 1BFFA 3JUTA 1Q03A 3RMYA 4JQ0A 1RZOB 2D22A 3FJHA 2IHOA 3BAHA 4J23B 3T8SA 4J2KA 1BASA 2K4AB 2HWAA 3O4AA 1T4QA 1YF8B 2F8XC 1DZDA 4L4HA 4A7KA 1ISXA 1JT4A 4ZKTB
chains in the Genus database with same CATH topology
4IONA 4USPA 1OQLB 4OEGA 4LO3C 1ISWA 1YBIA 1FMZA 1HCEA 3WA1A 1AVXB 3HOMA 4I4PA 1PUMB 4QC4A 1TOOA 1GGPB 4OW4A 3O44A 5FZUA 5F8YA 1CVSA 2Y9FA 1WBAA 4G1RA 3FJIA 4ENDA 3OBRA 3BB2A 3BAVA 3P6JA 4MZHA 3SNVA 1QQKA 4EFPA 1IILA 1SZ6B 1MC9A 4X39A 4DCKC 3V0AB 4H75A 4R6UB 3ILAA 3WINC 4GP3A 2Q3NB 3A07A 4QO3A 3VT0A 1K5VA 2VXTI 3ZC8A 3FJKA 2Y9GA 1DQGA 3IAGC 1XZZA 3S8KA 4IZXA 2MLLB 3CRGA 1V6VA 4FGFA 2K43A 1TP0A 1S0GA 3WO4A 3WMUA 1BFGA 3Q7YA 1Z2VA 4LO3A 1DFCA 2AQZA 2NVHA 3MALA 3FJDA 21BIA 41BIA 2D7IA 3FUOA 3JRRA 4D0ZA 5DVHA 3AKFA 4ZFWB 2IWTB 5DZUA 1HCDA 1RG8A 4EEEB 4QBCA 1XG6A 3MPPG 3A23A 3NBDA 1TFMB 8I1BA 5F8SA 3RTIB 4FVVA 3AZWA 4KC3A 1ONKB 2KI6B 3BAQA 4JP0A 1TIEA 5HPZA 4ZGRB 4Q9GA 4GOYA 4I8MA 2KH2A 5DSSB 4LO7B 4ZFUB 3W9TA 2P39A 1BARA 1CE7B 2VSEA 1Q04A 4II0A 5G00A 4I4VA 3UD7A 1IJTA 1EYLA 2YUGA 3E8LC 3O5WB 2GZBA 2ERMA 3AKIA 2LIQA 4G6MA 3N0KA 3NBEA 2KI4A 5D62A 4HR6C 3NBCA 4ZOTA 3PHZA 4H9WA 4I96A 1S0LA 4LO8B 3O4OA 2NZ9A 4G9NA 5D61A 4XFUA 1ITBA 3AH4A 4IYBA 3O49A 4A7YA 3AKHA 1MD6A 4I0YA 1ISVA 2KKIA 4I4UA 5BP5C 5BXRA 4JAWA 1RY7A 2F2FA 4TLPA 1ISZA 1M2TB 3CRIA 3CA3A 1FN0A 4ZFYB 1JT7A 3UD9A 1BLAA 1TWMA 4P6AA 2K8RA 3IIRA 1M16A 1XHBA 3QYDA 1W3GA 3CA0A 1D0HA 3NJ5A 4X37A 1IHKA 2D44A 1V6UA 1IRAX 2DREA 2RQ9A 3O4DA 2NYYA 4I4OA 2D24A 4OEEA 1WD3A 3HMYA 3AKGA 4IY9A 1FV2A 4I1EA 1HIBA 2FGFA 4G9MA 1V6WA 2RSTA 2Z49A 5FNXA 4OUJA 2VXRA 1DLLA 1IT0A 3IM6A 1S0EA 1QQLA 3V0BA 3AJ5A 3CA1A 4X3AA 4I3NA 4P0KA 6I1BA 3O4CA 4A7ZA 1WBCA 2D43A 3CQAA 4G6JA 1S0FA 5BP5A 4JRAA 1ILR1 2NS2A 4F34A 1G9DA 3F1RA 4P0JA 1TWEA 1EV2A 2L5XA 2R9KB 4Z8SB 3RTJB 4KEIA 1FV3A 3VSFA 3FJAA 1N4KA 1YYNA 2BFHA 3BA7A 1FMMS 2ZQOA 4ZA3B 3P53A 3O3QA 3BA4A 1AVAC 3VUOA 4L4IA 3ZXDA 4Q9PA 4WBCA 1VCLA 4I4SA 2Y9WC 3OJ2A 3V0AA 5B2HA 3S8JA 1IOBA 2AAIB 3VEQA 5BQUC 3CU1B 3OJVA 2BEBA 3FUQA 2ZR1B 3FFZA 4XFSA 1SR4A 4QD2C 4H04A 3IM5A 1HWMB 2VLCA 1DJSB 3R4UA 4EB2B 4EFQA 4KEJA 4IHZA 5BXSA 3CAHA 4J2SA 3BAGA 1PZZA 3N7JA 2WBCA 4LO1C 2E4MC 4MZFB 3WMVA 5DUYA 2FFVA 2F2FC 1EPWA 4JPZA 1R8NA 4OWJA 2Y9XE 4GOVA 3HN1A 1HWNB 3ZXGA 2NTDA 2FDBM 1ABRB 4QKRA 3CA5A 3R4SA 5BQUA 2QN4A 2HWMA 4J2XA 3H6RB 4YOLA 3UD8A 2J3PA 3BX1C 3A21A 1DIWA 3PMEA 1AF9A 4PC4A 4I4XA 4I4RA 2D1ZA 3FJEA 1AVUA 1I1EA 1AXMA 3BTAA 3C9ZA 3IM7A 3A22A 1PC8B 3H6SE 4LO1A 2E4MA 4MZGB 1NUNA 4ZLBB 5BVPI 3UJ0A 4I1BA 2M49A 3PG0A 3FJBA 5I1BA 2NP0A 1BA7A 3D7WB 3H6QA 3FJ9A 4Z9WB 1KNMA 1JY0A 3O4BA 4EFRA 3I2XA 3FGMA 9ILBA 5JLVA 4HJJA 3OBTA 1JT5A 3BADA 4I6IA 4IZEA 3OJMA 3FJFA 4GAIA 4OEFA 2I1BA 2BEAA 3WO3A 3BRDA 5E24E 1EVTA 3V0BB 1QXMA 1S0DA 1Q1UA 3LTQA 3N7KA 3AH2A 4LO0C 1ISYA 2DRZA 5D63A 2P23A 1IRPA 1FGAA 4D0TA 3POKA 2LIEA 4ISQA 4QALA 2XOAA 3BRFA 1P63A 2FO1A 4KBBA 1I1BA 1SR4C 4D8HA 1BFCA 2D20A 3HBWA 1HWPB 1J0SA 5JMCA 1UPSA 4QBVA 4DEPA 1BFBA 4AN7B 4AN6A 3AH1A 1JQZA 2D7RA 2VUAA 3PUBA 3RSJA 2HZ9A 1HWOB 1HKNA 3I29B 1S0CA 2ESUA 3BA5A 5EG6C 1JLYA 1T9FA 5FNWA 1AVWB 3FJJA 1WD4A 5F90A 2QYIB 3V79C 4J2YA 4JKQA 3BAOA 3EF2A 1BLDA 2RG9B 4LO0A 2ET2A 4UY4A 1A8DA 4P0LA 1XYFA 1G9CA 1L2HA 3Q7XA 1FWVA 3BAUA 1K5UA 3CA4A 4ISRA 1FWUA 1F31A 4CJMA 1DQOA 2D23A 5BOWA 3AJ6A 1Z0HA 4X38A 3WO2A 4LO7C 4KEKA 3P6IA 3ZX7A 3ZC9A 2FFUA 2UUSA 4OWLA 2AFGA 5GAQA 1V6XA 4QKSA 1E0OA 1PWAA 1R8OA 4I37A 1W3FA 3HALA 31BIA 1W3AA 3UDAA 2X2SA 4OWKA 4GAFA 4USOA 2KLLA 5F8WA 3WINA 3K1XA 3VWCA 2MIBA 5FZYA 2WRYA 5BXPA 4F83A 3Q7WA 3AZVA 4LO2C 4Q91A 1DFQA 3OGFA 3NBNA 3N7MA 1G9BA 1RMLA 1YXWA 5EHAA 3N7LA 4HA2A 1PUUB 3LLPA 4QD2B 2VSAA 3CA6A 2GO2A 1JTCA 4EKXB 2MC2A 4XFTA 1JLXA 2DRYA 1Z4SA 3VT1A 3F62B 3I2AA 5EC5A 1YTOA 3BRGC 4ZBVB 4DENA 3VSZA 3KMVA 3OGGA 4I2SA 2HW9A 1DZCA 2DS0A 3UJ4A 7I1BA 2NM1A 1AFCA 3HSMA 3B9UA 1II4A 4JKXB 2Q9XA 3TC2A 1TTUA 2X2TA 2Z48A 3H6RA 1NZKA 2AXMA 4XKIA 4IQPA 3CRHA 1FQ9A 2ZQNA 3QR5A 3FJCA 2VU9A 3VT2A 3FJ8A 4IY8A 1G9AA 4LO2A 4I4QA 4I7IA 5FZZA 4I4YA 1G82A 5BXTA 1JT3A 1S0BA 3RMXA 4GP0A 1BFFA 3JUTA 1Q03A 3RMYA 4JQ0A 1RZOB 2D22A 3FJHA 2IHOA 3BAHA 4J23B 3T8SA 4J2KA 1BASA 2K4AB 2HWAA 3O4AA 1T4QA 1YF8B 2F8XC 1DZDA 4L4HA 4A7KA 1ISXA 1JT4A 4ZKTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ION A;  4USP A;  1OQL B;  4OEG A;  4LO3 C;  1ISW A;  1YBI A;  1FMZ A;  1HCE A;  3WA1 A;  1AVX B;  3HOM A;  4I4P A;  1PUM B;  4QC4 A;  1TOO A;  1GGP B;  4OW4 A;  3O44 A;  5FZU A;  5F8Y A;  1CVS A;  2Y9F A;  1WBA A;  4G1R A;  3FJI A;  4END A;  3OBR A;  3BB2 A;  3BAV A;  3P6J A;  3SNV A;  1QQK A;  4EFP A;  1IIL A;  1SZ6 B;  1MC9 A;  4X39 A;  4DCK C;  3V0A B;  4R6U B;  3ILA A;  3WIN C;  4GP3 A;  2Q3N B;  3A07 A;  4QO3 A;  3VT0 A;  1K5V A;  2VXT I;  3ZC8 A;  3FJK A;  2Y9G A;  1DQG A;  3IAG C;  1XZZ A;  3S8K A;  4IZX A;  2MLL B;  3CRG A;  1V6V A;  4FGF A;  2K43 A;  1TP0 A;  1S0G A;  3WO4 A;  3WMU A;  1BFG A;  3Q7Y A;  1Z2V A;  4LO3 A;  1DFC A;  2AQZ A;  2NVH A;  3MAL A;  3FJD A;  21BI A;  41BI A;  2D7I A;  3FUO A;  3JRR A;  4D0Z A;  5DVH A;  3AKF A;  4ZFW B;  2IWT B;  5DZU A;  1HCD A;  1RG8 A;  4EEE B;  4QBC A;  1XG6 A;  3MPP G;  3A23 A;  3NBD A;  1TFM B;  8I1B A;  5F8S A;  3RTI B;  4FVV A;  3AZW A;  4KC3 A;  1ONK B;  2KI6 B;  3BAQ A;  4JP0 A;  1TIE A;  5HPZ A;  4ZGR B;  4Q9G A;  4GOY A;  4I8M A;  2KH2 A;  5DSS B;  4LO7 B;  4ZFU B;  3W9T A;  2P39 A;  1BAR A;  1CE7 B;  2VSE A;  1Q04 A;  4II0 A;  5G00 A;  4I4V A;  3UD7 A;  1IJT A;  1EYL A;  2YUG A;  3E8L C;  3O5W B;  2GZB A;  2ERM A;  3AKI A;  2LIQ A;  4G6M A;  3N0K A;  3NBE A;  2KI4 A;  5D62 A;  4HR6 C;  3NBC A;  4ZOT A;  3PHZ A;  4H9W A;  4I96 A;  1S0L A;  4LO8 B;  3O4O A;  2NZ9 A;  4G9N A;  5D61 A;  4XFU A;  1ITB A;  3AH4 A;  4IYB A;  3O49 A;  4A7Y A;  3AKH A;  1MD6 A;  4I0Y A;  1ISV A;  2KKI A;  4I4U A;  5BP5 C;  5BXR A;  4JAW A;  1RY7 A;  2F2F A;  4TLP A;  1ISZ A;  1M2T B;  3CRI A;  3CA3 A;  1FN0 A;  4ZFY B;  1JT7 A;  3UD9 A;  1BLA A;  1TWM A;  4P6A A;  2K8R A;  3IIR A;  1M16 A;  1XHB A;  3QYD A;  1W3G A;  3CA0 A;  1D0H A;  3NJ5 A;  4X37 A;  1IHK A;  2D44 A;  1V6U A;  1IRA X;  2DRE A;  2RQ9 A;  3O4D A;  2NYY A;  4I4O A;  2D24 A;  4OEE A;  1WD3 A;  3HMY A;  3AKG A;  4IY9 A;  1FV2 A;  4I1E A;  1HIB A;  2FGF A;  4G9M A;  1V6W A;  2RST A;  2Z49 A;  5FNX A;  4OUJ A;  2VXR A;  1DLL A;  1IT0 A;  3IM6 A;  1S0E A;  1QQL A;  3V0B A;  3AJ5 A;  3CA1 A;  4X3A A;  4I3N A;  4P0K A;  6I1B A;  3O4C A;  4A7Z A;  1WBC A;  2D43 A;  3CQA A;  4G6J A;  1S0F A;  5BP5 A;  4JRA A;  1ILR 1;  4F34 A;  1G9D A;  3F1R A;  4P0J A;  1TWE A;  1EV2 A;  2L5X A;  2R9K B;  4Z8S B;  3RTJ B;  4KEI A;  1FV3 A;  3VSF A;  3FJA A;  1N4K A;  1YYN A;  2BFH A;  3BA7 A;  1FMM S;  2ZQO A;  4ZA3 B;  3P53 A;  3O3Q A;  3BA4 A;  1AVA C;  3VUO A;  4L4I A;  3ZXD A;  4Q9P A;  4WBC A;  1VCL A;  4I4S A;  2Y9W C;  3OJ2 A;  3V0A A;  5B2H A;  3S8J A;  1IOB A;  2AAI B;  3VEQ A;  5BQU C;  3CU1 B;  3OJV A;  2BEB A;  3FUQ A;  2ZR1 B;  3FFZ A;  4XFS A;  1SR4 A;  4QD2 C;  4H04 A;  3IM5 A;  1HWM B;  2VLC A;  1DJS B;  3R4U A;  4EB2 B;  4EFQ A;  4KEJ A;  4IHZ A;  5BXS A;  3CAH A;  4J2S A;  3BAG A;  1PZZ A;  3N7J A;  2WBC A;  4LO1 C;  2E4M C;  3WMV A;  5DUY A;  2FFV A;  2F2F C;  1EPW A;  4JPZ A;  1R8N A;  4OWJ A;  2Y9X E;  4GOV A;  3HN1 A;  1HWN B;  3ZXG A;  2NTD A;  2FDB M;  1ABR B;  4QKR A;  3CA5 A;  3R4S A;  5BQU A;  2QN4 A;  2HWM A;  4J2X A;  3H6R B;  4YOL A;  3UD8 A;  2J3P A;  3BX1 C;  3A21 A;  1DIW A;  3PME A;  1AF9 A;  4PC4 A;  4I4X A;  4I4R A;  2D1Z A;  3FJE A;  1AVU A;  1I1E A;  1AXM A;  3BTA A;  3C9Z A;  3IM7 A;  3A22 A;  1PC8 B;  3H6S E;  4LO1 A;  2E4M A;  1NUN A;  4ZLB B;  5BVP I;  3UJ0 A;  4I1B A;  2M49 A;  3PG0 A;  3FJB A;  5I1B A;  2NP0 A;  1BA7 A;  3D7W B;  3H6Q A;  3FJ9 A;  4Z9W B;  1KNM A;  1JY0 A;  3O4B A;  4EFR A;  3I2X A;  3FGM A;  9ILB A;  5JLV A;  4HJJ A;  3OBT A;  1JT5 A;  3BAD A;  4I6I A;  4IZE A;  3OJM A;  3FJF A;  4GAI A;  4OEF A;  2I1B A;  2BEA A;  3WO3 A;  3BRD A;  5E24 E;  1EVT A;  3V0B B;  1QXM A;  1S0D A;  1Q1U A;  3LTQ A;  3N7K A;  3AH2 A;  4LO0 C;  1ISY A;  2DRZ A;  5D63 A;  2P23 A;  1IRP A;  1FGA A;  4D0T A;  3POK A;  2LIE A;  4ISQ A;  4QAL A;  2XOA A;  3BRF A;  1P63 A;  2FO1 A;  4KBB A;  1I1B A;  1SR4 C;  4D8H A;  1BFC A;  2D20 A;  3HBW A;  1HWP B;  1J0S A;  5JMC A;  1UPS A;  4QBV A;  4DEP A;  1BFB A;  4AN7 B;  4AN6 A;  3AH1 A;  1JQZ A;  2D7R A;  2VUA A;  3PUB A;  3RSJ A;  2HZ9 A;  1HWO B;  1HKN A;  3I29 B;  1S0C A;  2ESU A;  3BA5 A;  5EG6 C;  1JLY A;  1T9F A;  5FNW A;  1AVW B;  3FJJ A;  1WD4 A;  5F90 A;  2QYI B;  3V79 C;  4J2Y A;  4JKQ A;  3BAO A;  3EF2 A;  1BLD A;  2RG9 B;  4LO0 A;  2ET2 A;  1A8D A;  4P0L A;  1XYF A;  1G9C A;  1L2H A;  3Q7X A;  1FWV A;  3BAU A;  1K5U A;  3CA4 A;  4ISR A;  1FWU A;  1F31 A;  4CJM A;  1DQO A;  2D23 A;  5BOW A;  3AJ6 A;  1Z0H A;  4X38 A;  3WO2 A;  4LO7 C;  4KEK A;  3P6I A;  3ZX7 A;  3ZC9 A;  2FFU A;  2UUS A;  4OWL A;  2AFG A;  5GAQ A;  1V6X A;  4QKS A;  1E0O A;  1PWA A;  1R8O A;  4I37 A;  1W3F A;  3HAL A;  31BI A;  1W3A A;  3UDA A;  2X2S A;  4OWK A;  4GAF A;  4USO A;  2KLL A;  5F8W A;  3WIN A;  3K1X A;  3VWC A;  2MIB A;  5FZY A;  2WRY A;  5BXP A;  4F83 A;  3Q7W A;  3AZV A;  4LO2 C;  4Q91 A;  1DFQ A;  3OGF A;  3NBN A;  3N7M A;  1G9B A;  1RML A;  1YXW A;  5EHA A;  3N7L A;  4HA2 A;  1PUU B;  3LLP A;  4QD2 B;  2VSA A;  3CA6 A;  2GO2 A;  1JTC A;  4EKX B;  2MC2 A;  4XFT A;  1JLX A;  2DRY A;  1Z4S A;  3VT1 A;  3F62 B;  3I2A A;  5EC5 A;  1YTO A;  3BRG C;  4ZBV B;  4DEN A;  3VSZ A;  3KMV A;  3OGG A;  4I2S A;  2HW9 A;  1DZC A;  2DS0 A;  3UJ4 A;  7I1B A;  2NM1 A;  1AFC A;  3HSM A;  3B9U A;  1II4 A;  4JKX B;  2Q9X A;  3TC2 A;  1TTU A;  2X2T A;  2Z48 A;  3H6R A;  1NZK A;  2AXM A;  4XKI A;  4IQP A;  3CRH A;  1FQ9 A;  2ZQN A;  3QR5 A;  3FJC A;  2VU9 A;  3VT2 A;  3FJ8 A;  4IY8 A;  1G9A A;  4LO2 A;  4I4Q A;  4I7I A;  5FZZ A;  4I4Y A;  1G82 A;  5BXT A;  1JT3 A;  1S0B A;  3RMX A;  4GP0 A;  1BFF A;  3JUT A;  1Q03 A;  3RMY A;  4JQ0 A;  1RZO B;  2D22 A;  3FJH A;  2IHO A;  3BAH A;  4J23 B;  3T8S A;  4J2K A;  1BAS A;  2K4A B;  2HWA A;  3O4A A;  1T4Q A;  1YF8 B;  2F8X C;  1DZD A;  4L4H A;  4A7K A;  1ISX A;  1JT4 A;  4ZKT B; 
#chains in the Genus database with same CATH topology
 4ION A;  4USP A;  1OQL B;  4OEG A;  4LO3 C;  1ISW A;  1YBI A;  1FMZ A;  1HCE A;  3WA1 A;  1AVX B;  3HOM A;  4I4P A;  1PUM B;  4QC4 A;  1TOO A;  1GGP B;  4OW4 A;  3O44 A;  5FZU A;  5F8Y A;  1CVS A;  2Y9F A;  1WBA A;  4G1R A;  3FJI A;  4END A;  3OBR A;  3BB2 A;  3BAV A;  3P6J A;  4MZH A;  3SNV A;  1QQK A;  4EFP A;  1IIL A;  1SZ6 B;  1MC9 A;  4X39 A;  4DCK C;  3V0A B;  4H75 A;  4R6U B;  3ILA A;  3WIN C;  4GP3 A;  2Q3N B;  3A07 A;  4QO3 A;  3VT0 A;  1K5V A;  2VXT I;  3ZC8 A;  3FJK A;  2Y9G A;  1DQG A;  3IAG C;  1XZZ A;  3S8K A;  4IZX A;  2MLL B;  3CRG A;  1V6V A;  4FGF A;  2K43 A;  1TP0 A;  1S0G A;  3WO4 A;  3WMU A;  1BFG A;  3Q7Y A;  1Z2V A;  4LO3 A;  1DFC A;  2AQZ A;  2NVH A;  3MAL A;  3FJD A;  21BI A;  41BI A;  2D7I A;  3FUO A;  3JRR A;  4D0Z A;  5DVH A;  3AKF A;  4ZFW B;  2IWT B;  5DZU A;  1HCD A;  1RG8 A;  4EEE B;  4QBC A;  1XG6 A;  3MPP G;  3A23 A;  3NBD A;  1TFM B;  8I1B A;  5F8S A;  3RTI B;  4FVV A;  3AZW A;  4KC3 A;  1ONK B;  2KI6 B;  3BAQ A;  4JP0 A;  1TIE A;  5HPZ A;  4ZGR B;  4Q9G A;  4GOY A;  4I8M A;  2KH2 A;  5DSS B;  4LO7 B;  4ZFU B;  3W9T A;  2P39 A;  1BAR A;  1CE7 B;  2VSE A;  1Q04 A;  4II0 A;  5G00 A;  4I4V A;  3UD7 A;  1IJT A;  1EYL A;  2YUG A;  3E8L C;  3O5W B;  2GZB A;  2ERM A;  3AKI A;  2LIQ A;  4G6M A;  3N0K A;  3NBE A;  2KI4 A;  5D62 A;  4HR6 C;  3NBC A;  4ZOT A;  3PHZ A;  4H9W A;  4I96 A;  1S0L A;  4LO8 B;  3O4O A;  2NZ9 A;  4G9N A;  5D61 A;  4XFU A;  1ITB A;  3AH4 A;  4IYB A;  3O49 A;  4A7Y A;  3AKH A;  1MD6 A;  4I0Y A;  1ISV A;  2KKI A;  4I4U A;  5BP5 C;  5BXR A;  4JAW A;  1RY7 A;  2F2F A;  4TLP A;  1ISZ A;  1M2T B;  3CRI A;  3CA3 A;  1FN0 A;  4ZFY B;  1JT7 A;  3UD9 A;  1BLA A;  1TWM A;  4P6A A;  2K8R A;  3IIR A;  1M16 A;  1XHB A;  3QYD A;  1W3G A;  3CA0 A;  1D0H A;  3NJ5 A;  4X37 A;  1IHK A;  2D44 A;  1V6U A;  1IRA X;  2DRE A;  2RQ9 A;  3O4D A;  2NYY A;  4I4O A;  2D24 A;  4OEE A;  1WD3 A;  3HMY A;  3AKG A;  4IY9 A;  1FV2 A;  4I1E A;  1HIB A;  2FGF A;  4G9M A;  1V6W A;  2RST A;  2Z49 A;  5FNX A;  4OUJ A;  2VXR A;  1DLL A;  1IT0 A;  3IM6 A;  1S0E A;  1QQL A;  3V0B A;  3AJ5 A;  3CA1 A;  4X3A A;  4I3N A;  4P0K A;  6I1B A;  3O4C A;  4A7Z A;  1WBC A;  2D43 A;  3CQA A;  4G6J A;  1S0F A;  5BP5 A;  4JRA A;  1ILR 1;  2NS2 A;  4F34 A;  1G9D A;  3F1R A;  4P0J A;  1TWE A;  1EV2 A;  2L5X A;  2R9K B;  4Z8S B;  3RTJ B;  4KEI A;  1FV3 A;  3VSF A;  3FJA A;  1N4K A;  1YYN A;  2BFH A;  3BA7 A;  1FMM S;  2ZQO A;  4ZA3 B;  3P53 A;  3O3Q A;  3BA4 A;  1AVA C;  3VUO A;  4L4I A;  3ZXD A;  4Q9P A;  4WBC A;  1VCL A;  4I4S A;  2Y9W C;  3OJ2 A;  3V0A A;  5B2H A;  3S8J A;  1IOB A;  2AAI B;  3VEQ A;  5BQU C;  3CU1 B;  3OJV A;  2BEB A;  3FUQ A;  2ZR1 B;  3FFZ A;  4XFS A;  1SR4 A;  4QD2 C;  4H04 A;  3IM5 A;  1HWM B;  2VLC A;  1DJS B;  3R4U A;  4EB2 B;  4EFQ A;  4KEJ A;  4IHZ A;  5BXS A;  3CAH A;  4J2S A;  3BAG A;  1PZZ A;  3N7J A;  2WBC A;  4LO1 C;  2E4M C;  4MZF B;  3WMV A;  5DUY A;  2FFV A;  2F2F C;  1EPW A;  4JPZ A;  1R8N A;  4OWJ A;  2Y9X E;  4GOV A;  3HN1 A;  1HWN B;  3ZXG A;  2NTD A;  2FDB M;  1ABR B;  4QKR A;  3CA5 A;  3R4S A;  5BQU A;  2QN4 A;  2HWM A;  4J2X A;  3H6R B;  4YOL A;  3UD8 A;  2J3P A;  3BX1 C;  3A21 A;  1DIW A;  3PME A;  1AF9 A;  4PC4 A;  4I4X A;  4I4R A;  2D1Z A;  3FJE A;  1AVU A;  1I1E A;  1AXM A;  3BTA A;  3C9Z A;  3IM7 A;  3A22 A;  1PC8 B;  3H6S E;  4LO1 A;  2E4M A;  4MZG B;  1NUN A;  4ZLB B;  5BVP I;  3UJ0 A;  4I1B A;  2M49 A;  3PG0 A;  3FJB A;  5I1B A;  2NP0 A;  1BA7 A;  3D7W B;  3H6Q A;  3FJ9 A;  4Z9W B;  1KNM A;  1JY0 A;  3O4B A;  4EFR A;  3I2X A;  3FGM A;  9ILB A;  5JLV A;  4HJJ A;  3OBT A;  1JT5 A;  3BAD A;  4I6I A;  4IZE A;  3OJM A;  3FJF A;  4GAI A;  4OEF A;  2I1B A;  2BEA A;  3WO3 A;  3BRD A;  5E24 E;  1EVT A;  3V0B B;  1QXM A;  1S0D A;  1Q1U A;  3LTQ A;  3N7K A;  3AH2 A;  4LO0 C;  1ISY A;  2DRZ A;  5D63 A;  2P23 A;  1IRP A;  1FGA A;  4D0T A;  3POK A;  2LIE A;  4ISQ A;  4QAL A;  2XOA A;  3BRF A;  1P63 A;  2FO1 A;  4KBB A;  1I1B A;  1SR4 C;  4D8H A;  1BFC A;  2D20 A;  3HBW A;  1HWP B;  1J0S A;  5JMC A;  1UPS A;  4QBV A;  4DEP A;  1BFB A;  4AN7 B;  4AN6 A;  3AH1 A;  1JQZ A;  2D7R A;  2VUA A;  3PUB A;  3RSJ A;  2HZ9 A;  1HWO B;  1HKN A;  3I29 B;  1S0C A;  2ESU A;  3BA5 A;  5EG6 C;  1JLY A;  1T9F A;  5FNW A;  1AVW B;  3FJJ A;  1WD4 A;  5F90 A;  2QYI B;  3V79 C;  4J2Y A;  4JKQ A;  3BAO A;  3EF2 A;  1BLD A;  2RG9 B;  4LO0 A;  2ET2 A;  4UY4 A;  1A8D A;  4P0L A;  1XYF A;  1G9C A;  1L2H A;  3Q7X A;  1FWV A;  3BAU A;  1K5U A;  3CA4 A;  4ISR A;  1FWU A;  1F31 A;  4CJM A;  1DQO A;  2D23 A;  5BOW A;  3AJ6 A;  1Z0H A;  4X38 A;  3WO2 A;  4LO7 C;  4KEK A;  3P6I A;  3ZX7 A;  3ZC9 A;  2FFU A;  2UUS A;  4OWL A;  2AFG A;  5GAQ A;  1V6X A;  4QKS A;  1E0O A;  1PWA A;  1R8O A;  4I37 A;  1W3F A;  3HAL A;  31BI A;  1W3A A;  3UDA A;  2X2S A;  4OWK A;  4GAF A;  4USO A;  2KLL A;  5F8W A;  3WIN A;  3K1X A;  3VWC A;  2MIB A;  5FZY A;  2WRY A;  5BXP A;  4F83 A;  3Q7W A;  3AZV A;  4LO2 C;  4Q91 A;  1DFQ A;  3OGF A;  3NBN A;  3N7M A;  1G9B A;  1RML A;  1YXW A;  5EHA A;  3N7L A;  4HA2 A;  1PUU B;  3LLP A;  4QD2 B;  2VSA A;  3CA6 A;  2GO2 A;  1JTC A;  4EKX B;  2MC2 A;  4XFT A;  1JLX A;  2DRY A;  1Z4S A;  3VT1 A;  3F62 B;  3I2A A;  5EC5 A;  1YTO A;  3BRG C;  4ZBV B;  4DEN A;  3VSZ A;  3KMV A;  3OGG A;  4I2S A;  2HW9 A;  1DZC A;  2DS0 A;  3UJ4 A;  7I1B A;  2NM1 A;  1AFC A;  3HSM A;  3B9U A;  1II4 A;  4JKX B;  2Q9X A;  3TC2 A;  1TTU A;  2X2T A;  2Z48 A;  3H6R A;  1NZK A;  2AXM A;  4XKI A;  4IQP A;  3CRH A;  1FQ9 A;  2ZQN A;  3QR5 A;  3FJC A;  2VU9 A;  3VT2 A;  3FJ8 A;  4IY8 A;  1G9A A;  4LO2 A;  4I4Q A;  4I7I A;  5FZZ A;  4I4Y A;  1G82 A;  5BXT A;  1JT3 A;  1S0B A;  3RMX A;  4GP0 A;  1BFF A;  3JUT A;  1Q03 A;  3RMY A;  4JQ0 A;  1RZO B;  2D22 A;  3FJH A;  2IHO A;  3BAH A;  4J23 B;  3T8S A;  4J2K A;  1BAS A;  2K4A B;  2HWA A;  3O4A A;  1T4Q A;  1YF8 B;  2F8X C;  1DZD A;  4L4H A;  4A7K A;  1ISX A;  1JT4 A;  4ZKT B; 
#chains in the Genus database with same CATH homology
 4ION A;  4USP A;  1OQL B;  4OEG A;  4LO3 C;  1ISW A;  1YBI A;  1FMZ A;  1HCE A;  3WA1 A;  1AVX B;  3HOM A;  4I4P A;  1PUM B;  4QC4 A;  1TOO A;  1GGP B;  4OW4 A;  3O44 A;  5FZU A;  5F8Y A;  1CVS A;  2Y9F A;  1WBA A;  4G1R A;  3FJI A;  4END A;  3OBR A;  3BB2 A;  3BAV A;  3P6J A;  4MZH A;  3SNV A;  1QQK A;  4EFP A;  1IIL A;  1SZ6 B;  1MC9 A;  4X39 A;  4DCK C;  3V0A B;  4H75 A;  4R6U B;  3ILA A;  3WIN C;  4GP3 A;  2Q3N B;  3A07 A;  4QO3 A;  3VT0 A;  1K5V A;  2VXT I;  3ZC8 A;  3FJK A;  2Y9G A;  1DQG A;  3IAG C;  1XZZ A;  3S8K A;  4IZX A;  2MLL B;  3CRG A;  1V6V A;  4FGF A;  2K43 A;  1TP0 A;  1S0G A;  3WO4 A;  3WMU A;  1BFG A;  3Q7Y A;  1Z2V A;  4LO3 A;  1DFC A;  2AQZ A;  2NVH A;  3MAL A;  3FJD A;  21BI A;  41BI A;  2D7I A;  3FUO A;  3JRR A;  4D0Z A;  5DVH A;  3AKF A;  4ZFW B;  2IWT B;  5DZU A;  1HCD A;  1RG8 A;  4EEE B;  4QBC A;  1XG6 A;  3MPP G;  3A23 A;  3NBD A;  1TFM B;  8I1B A;  5F8S A;  3RTI B;  4FVV A;  3AZW A;  4KC3 A;  1ONK B;  2KI6 B;  3BAQ A;  4JP0 A;  1TIE A;  5HPZ A;  4ZGR B;  4Q9G A;  4GOY A;  4I8M A;  2KH2 A;  5DSS B;  4LO7 B;  4ZFU B;  3W9T A;  2P39 A;  1BAR A;  1CE7 B;  2VSE A;  1Q04 A;  4II0 A;  5G00 A;  4I4V A;  3UD7 A;  1IJT A;  1EYL A;  2YUG A;  3E8L C;  3O5W B;  2GZB A;  2ERM A;  3AKI A;  2LIQ A;  4G6M A;  3N0K A;  3NBE A;  2KI4 A;  5D62 A;  4HR6 C;  3NBC A;  4ZOT A;  3PHZ A;  4H9W A;  4I96 A;  1S0L A;  4LO8 B;  3O4O A;  2NZ9 A;  4G9N A;  5D61 A;  4XFU A;  1ITB A;  3AH4 A;  4IYB A;  3O49 A;  4A7Y A;  3AKH A;  1MD6 A;  4I0Y A;  1ISV A;  2KKI A;  4I4U A;  5BP5 C;  5BXR A;  4JAW A;  1RY7 A;  2F2F A;  4TLP A;  1ISZ A;  1M2T B;  3CRI A;  3CA3 A;  1FN0 A;  4ZFY B;  1JT7 A;  3UD9 A;  1BLA A;  1TWM A;  4P6A A;  2K8R A;  3IIR A;  1M16 A;  1XHB A;  3QYD A;  1W3G A;  3CA0 A;  1D0H A;  3NJ5 A;  4X37 A;  1IHK A;  2D44 A;  1V6U A;  1IRA X;  2DRE A;  2RQ9 A;  3O4D A;  2NYY A;  4I4O A;  2D24 A;  4OEE A;  1WD3 A;  3HMY A;  3AKG A;  4IY9 A;  1FV2 A;  4I1E A;  1HIB A;  2FGF A;  4G9M A;  1V6W A;  2RST A;  2Z49 A;  5FNX A;  4OUJ A;  2VXR A;  1DLL A;  1IT0 A;  3IM6 A;  1S0E A;  1QQL A;  3V0B A;  3AJ5 A;  3CA1 A;  4X3A A;  4I3N A;  4P0K A;  6I1B A;  3O4C A;  4A7Z A;  1WBC A;  2D43 A;  3CQA A;  4G6J A;  1S0F A;  5BP5 A;  4JRA A;  1ILR 1;  2NS2 A;  4F34 A;  1G9D A;  3F1R A;  4P0J A;  1TWE A;  1EV2 A;  2L5X A;  2R9K B;  4Z8S B;  3RTJ B;  4KEI A;  1FV3 A;  3VSF A;  3FJA A;  1N4K A;  1YYN A;  2BFH A;  3BA7 A;  1FMM S;  2ZQO A;  4ZA3 B;  3P53 A;  3O3Q A;  3BA4 A;  1AVA C;  3VUO A;  4L4I A;  3ZXD A;  4Q9P A;  4WBC A;  1VCL A;  4I4S A;  2Y9W C;  3OJ2 A;  3V0A A;  5B2H A;  3S8J A;  1IOB A;  2AAI B;  3VEQ A;  5BQU C;  3CU1 B;  3OJV A;  2BEB A;  3FUQ A;  2ZR1 B;  3FFZ A;  4XFS A;  1SR4 A;  4QD2 C;  4H04 A;  3IM5 A;  1HWM B;  2VLC A;  1DJS B;  3R4U A;  4EB2 B;  4EFQ A;  4KEJ A;  4IHZ A;  5BXS A;  3CAH A;  4J2S A;  3BAG A;  1PZZ A;  3N7J A;  2WBC A;  4LO1 C;  2E4M C;  4MZF B;  3WMV A;  5DUY A;  2FFV A;  2F2F C;  1EPW A;  4JPZ A;  1R8N A;  4OWJ A;  2Y9X E;  4GOV A;  3HN1 A;  1HWN B;  3ZXG A;  2NTD A;  2FDB M;  1ABR B;  4QKR A;  3CA5 A;  3R4S A;  5BQU A;  2QN4 A;  2HWM A;  4J2X A;  3H6R B;  4YOL A;  3UD8 A;  2J3P A;  3BX1 C;  3A21 A;  1DIW A;  3PME A;  1AF9 A;  4PC4 A;  4I4X A;  4I4R A;  2D1Z A;  3FJE A;  1AVU A;  1I1E A;  1AXM A;  3BTA A;  3C9Z A;  3IM7 A;  3A22 A;  1PC8 B;  3H6S E;  4LO1 A;  2E4M A;  4MZG B;  1NUN A;  4ZLB B;  5BVP I;  3UJ0 A;  4I1B A;  2M49 A;  3PG0 A;  3FJB A;  5I1B A;  2NP0 A;  1BA7 A;  3D7W B;  3H6Q A;  3FJ9 A;  4Z9W B;  1KNM A;  1JY0 A;  3O4B A;  4EFR A;  3I2X A;  3FGM A;  9ILB A;  5JLV A;  4HJJ A;  3OBT A;  1JT5 A;  3BAD A;  4I6I A;  4IZE A;  3OJM A;  3FJF A;  4GAI A;  4OEF A;  2I1B A;  2BEA A;  3WO3 A;  3BRD A;  5E24 E;  1EVT A;  3V0B B;  1QXM A;  1S0D A;  1Q1U A;  3LTQ A;  3N7K A;  3AH2 A;  4LO0 C;  1ISY A;  2DRZ A;  5D63 A;  2P23 A;  1IRP A;  1FGA A;  4D0T A;  3POK A;  2LIE A;  4ISQ A;  4QAL A;  2XOA A;  3BRF A;  1P63 A;  2FO1 A;  4KBB A;  1I1B A;  1SR4 C;  4D8H A;  1BFC A;  2D20 A;  3HBW A;  1HWP B;  1J0S A;  5JMC A;  1UPS A;  4QBV A;  4DEP A;  1BFB A;  4AN7 B;  4AN6 A;  3AH1 A;  1JQZ A;  2D7R A;  2VUA A;  3PUB A;  3RSJ A;  2HZ9 A;  1HWO B;  1HKN A;  3I29 B;  1S0C A;  2ESU A;  3BA5 A;  5EG6 C;  1JLY A;  1T9F A;  5FNW A;  1AVW B;  3FJJ A;  1WD4 A;  5F90 A;  2QYI B;  3V79 C;  4J2Y A;  4JKQ A;  3BAO A;  3EF2 A;  1BLD A;  2RG9 B;  4LO0 A;  2ET2 A;  4UY4 A;  1A8D A;  4P0L A;  1XYF A;  1G9C A;  1L2H A;  3Q7X A;  1FWV A;  3BAU A;  1K5U A;  3CA4 A;  4ISR A;  1FWU A;  1F31 A;  4CJM A;  1DQO A;  2D23 A;  5BOW A;  3AJ6 A;  1Z0H A;  4X38 A;  3WO2 A;  4LO7 C;  4KEK A;  3P6I A;  3ZX7 A;  3ZC9 A;  2FFU A;  2UUS A;  4OWL A;  2AFG A;  5GAQ A;  1V6X A;  4QKS A;  1E0O A;  1PWA A;  1R8O A;  4I37 A;  1W3F A;  3HAL A;  31BI A;  1W3A A;  3UDA A;  2X2S A;  4OWK A;  4GAF A;  4USO A;  2KLL A;  5F8W A;  3WIN A;  3K1X A;  3VWC A;  2MIB A;  5FZY A;  2WRY A;  5BXP A;  4F83 A;  3Q7W A;  3AZV A;  4LO2 C;  4Q91 A;  1DFQ A;  3OGF A;  3NBN A;  3N7M A;  1G9B A;  1RML A;  1YXW A;  5EHA A;  3N7L A;  4HA2 A;  1PUU B;  3LLP A;  4QD2 B;  2VSA A;  3CA6 A;  2GO2 A;  1JTC A;  4EKX B;  2MC2 A;  4XFT A;  1JLX A;  2DRY A;  1Z4S A;  3VT1 A;  3F62 B;  3I2A A;  5EC5 A;  1YTO A;  3BRG C;  4ZBV B;  4DEN A;  3VSZ A;  3KMV A;  3OGG A;  4I2S A;  2HW9 A;  1DZC A;  2DS0 A;  3UJ4 A;  7I1B A;  2NM1 A;  1AFC A;  3HSM A;  3B9U A;  1II4 A;  4JKX B;  2Q9X A;  3TC2 A;  1TTU A;  2X2T A;  2Z48 A;  3H6R A;  1NZK A;  2AXM A;  4XKI A;  4IQP A;  3CRH A;  1FQ9 A;  2ZQN A;  3QR5 A;  3FJC A;  2VU9 A;  3VT2 A;  3FJ8 A;  4IY8 A;  1G9A A;  4LO2 A;  4I4Q A;  4I7I A;  5FZZ A;  4I4Y A;  1G82 A;  5BXT A;  1JT3 A;  1S0B A;  3RMX A;  4GP0 A;  1BFF A;  3JUT A;  1Q03 A;  3RMY A;  4JQ0 A;  1RZO B;  2D22 A;  3FJH A;  2IHO A;  3BAH A;  4J23 B;  3T8S A;  4J2K A;  1BAS A;  2K4A B;  2HWA A;  3O4A A;  1T4Q A;  1YF8 B;  2F8X C;  1DZD A;  4L4H A;  4A7K A;  1ISX A;  1JT4 A;  4ZKT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...