1IS4A

Lactose-liganded congerin ii
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
134
structure length
134
Chain Sequence
DRAEVRNIPFKLGMYLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Conger Eel Galectin (Congerin II) at 1.45 A Resolution: Implication for the Accelerated Evolution of a New Ligand-Binding Site Following Gene Duplication
pubmed doi rcsb
source organism Conger myriaster
molecule tags Sugar binding protein
molecule keywords CONGERIN II
total genus 27
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1is4A00
4XE9A 2VU9A 3IMNA 3VKNA 3V65A 2EAKA 2WSUA 1JYIA 4Q8KA 1DGLA 4YG3A 1N3PA 3USUA 4R9BA 2ZA9A 1HQLA 5JOZA 5JMCA 2UWCA 2A5ZA 1WLWA 1QKQA 1QNYA 2R49A 4FPJA 5IT6A 1MACA 4Q2FA 5DUWA 5GZGA 3A4UA 4SLIA 2A6ZA 4YLZA 3SH4A 2EXKA 1ULEA 4Y20A 4YGBA 2DV9A 4XXPA 5GM0A 1DZQA 3LSDA 4XDQA 2ZGPA 3A0KA 1GBGA 4FPLA 1N1TA 1N1VA 3PVOA 2GDFA 3FBYA 1AXYA 4YZ5A 3PMEA 4P9YA 1S0DA 3O12A 2CWMA 1QOOA 1S0GA 3GALA 3INAA 4FPEA 2EIGA 4HANA 5T5OA 1BYHA 2UWAA 1WLCA 2P3JA 4CZSA 1LOBA 4LBMA 1W6PB 4C1XA 2A70A 3KM5A 4P14A 3AP4A 1DQ0A 3AP7A 4FPGA 2JECA 4YG6A 1S1AA 4Z8BA 3N7LA 5EWSA 2VH9A 1DQ5A 1NXD1 5T55A 4BLIA 1LGNA 2PHRA 1C57A 1ENRA 2H0BA 1SFYA 4XOGA 1CN1A 1MS3A 2A6YA 2ENRA 1GNHA 1MVQA 2E6VA 2GALA 2JD4A 2WQZC 3ZVXA 4DFSA 3RG0A 3T1LA 4ASMB 5GLZA 1AX0A 1YI7A 3WVJA 1G7YA 4CRQA 3AZZA 3FLPA 4YM3A 4K20A 1S0IA 4XJ9A 4HL0A 2P3KA 1W6PA 1CESA 2GNDA 4XJUA 1N3OA 2EXJA 5GZCA 1KDMA 4FPHA 4Q1RA 4GWNA 3WG1A 1UZZA 1KRIA 3AJYA 3AX4A 4Y1YA 1WCSA 2ZGTA 1U0AA 2SBAA 1UAIA 1HQWA 4XTPA 3RS6A 3HMYA 3VKLA 1ENSA 1JHNA 1GSLA 1H30A 1N3QA 1N1YA 2NP0A 1GZWB 2PHWA 5DZFA 4FPKA 1LOAA 2R0HA 1W0PA 1ONAA 1GV9A 3WZ1A 1Q8SA 1FAYA 4GALA 3POWA 1KQRA 2JKBA 5IK7A 2XG3A 2ZKNA 4FOWA 5T54A 3RSJA 1G8WA 1LHOA 3ZSKA 1C4RA 4XJAA 4ATEA 1V6NA 3RRDA 1F31A 4Y22A 1FV3A 2C5DA 1IKPA 5CB7A 2CTVA 3BTAA 1Q8PA 5JVVA 3RMXA 4M3CA 5GALA 2Q5TA 2DUOA 4FOQA 1CJPA 1LCLA 2D6PA 2ZACA 3I4IA 3SH5A 5H9QA 2GNBA 4PBOA 2ZZJA 4AGGA 2DVAA 4Q27A 2GNTA 1YXWA 3B00A 3POSA 1CR7A 2ZMLA 4LBOA 1N1SA 1C1LA 1LHNA 3AFKA 4FPFA 3I8TA 3M3EA 5GZEA 3SH3A 3ZSJA 2PHUA 4I30A 1CVNA 3MW4A 2EXHA 2R1DA 1DIWA 3V0AA 1Q8QA 5GLUA 1IS6A 1AX2A 2UWBA 3IN9A 1DHKB 1HLCA 1SLLA 2V5YA 2E7QA 1B09A 3R4UA 1WUVA 4Y22B 3VKOA 1DBNA 1S0CA 2WT2A 3POYA 3AP9A 4YM2A 1QOSA 4M01A 5GLVA 5FRAA 1GNZA 4NOTA 1SLCA 1LECA 2KM2A 4UW5A 1D2SA 4XBQA 3USUB 1LOFC 1DQ2A 3ZXJA 5GJ6A 1JOJA 3NV4A 2WNEA 4AGRA 1W6QB 3U4XA 3O0WA 1I3HA 2ZGQA 1AZDA 1F9KA 1LOFA 3NWKA 4XJWA 1DFQA 5SV8A 3W58A 4BOWA 4XMIA 1A78A 4Y20B 2AGSA 1LU2A 4MYEA 3NV2A 3AYCA 2EALA 1VAVA 4YW2A 4BPZA 5GZDA 4PF5A 1BXHA 3FFZA 2GMEA 3ZPYA 2VUAA 3MPPG 4DRVA 1CONA 2DVGA 2OVUA 2ZHKA 3N7KA 4YG0A 2CY6A 2GMPA 4Y26A 1IS3A 2LALA 1IS4A 4YW5A 3ZXLA 1ENQA 2ZABA 5EYXA 3DUIA 2W68A 1HKDA 3WCRA 4DPNA 4Y24A 1G9BA 4ISRA 2AR6A 2A6WA 1LGBA 1A8DA 4ZKTB 2D3SA 2P37A 2D44A 3ENRA 2FHRA 2YV8A 5GLWA 1FYUA 1XQNA 3T2TA 3A0NA 1O4YA 1VALA 4Y1ZA 3VKMA 4YW3A 3QCWA 3ZSMA 2PHFA 2V73A 2B7YA 3UK9A 1WW6A 1G86A 3AK0A 2D6LX 1W0OA 1A3KA 3OYWA 4GKYA 3V64A 1Z0HA 2DYCA 1LJ7A 2P34A 2C9AA 4BMBA 4YZ1A 2AYHA 2A3XA 3AZXA 1RINA 1AF9A 1SLTA 2ZHLA 3WG3A 2AUYA 1WW5A 1DLLA 2EF6A 1V6OA 4K21A 3KQRA 4FOYA 3ILFA 2DUQA 4FQZA 3PVEA 3BIWE 2YMZA 1G9DA 5H9PA 2E7TA 3AJZA 1Q8VA 1KJRA 1JBCA 2ERFA 3WG2A 1SACA 3IPVA 1GANA 3WUDA 4ITCA 4XIKA 2DUPA 2DVFA 5IK5A 4W65A 4U2AA 4FP3A 2ZMNA 1KJLA 1IKQA 4XHBA 1LU1A 4YZ3A 2DU0A 4GWMA 4FOVA 5HCBA 1FNYA 2R16A 2A71A 5GLTA 3WNXA 3N7MA 4LBKA 2WSVA 1ZM1A 4JC1A 5DG1A 5T52A 1J1TA 2D43A 3ASIA 2VXRA 4YGDA 1VLNA 3O0XA 4R9AA 4Y1XA 3AXDA 5H9SA 5CA6A 1WBLA 1JYCA 1OFSA 2WT1A 3WHTA 4YM1A 1NLSA 2HYKA 5T50A 3ZSLA 1LHUA 4LBQA 1AJKA 2AREA 2OUHA 1V6LA 2ZGOA 3OY8A 3R05A 4AWDA 4BLJA 3FLRA 1UMZA 4RA0A 1SLBA 3DGTA 2ZMKA 1MZ5A 1UKGA 1WW7A 3APBA 3ILNA 5DXDA 1LOCA 1W6NA 4TZDA 1F5FA 1OQ1A 4R9CA 3NV3A 1WD4A 1V00A 3WDUA 4XMAA 5E89A 2ZHNA 3LSEA 3JU9A 3RMYA 2ZGSA 3SISA 2ES3A 2ZHMA 4CTEA 1S0JA 3T1MA 1O4ZA 2JE7A 1GYKA 1RIRA 3B01A 1BZWA 3WLUA 5IK4A 4JRAA 2A6VA 2AH2A 4WVVA 1MS4A 2P2KA 2W39A 2D6OX 2W08A 1APNA 2SLIA 5T5JA 3C2UA 3PVNA 3ZXEA 4AGVA 2ZGMA 3V0AB 2E53A 1V6JA 4YGEA 3B9CA 2D6MA 2WT0A 3UJQA 3OY8B 2G4IA 3M3CA 3BOPA 4U36A 4XBNA 4Y1UA 3HR9A 3OBTA 4FPYA 4M00A 1W6MA 3N7JA 3UL2A 3WDVA 4LBNA 1I1EA 2A7AA 2GN7A 1URXA 4M3CF 3BODA 5IUQA 5EXOA 4PBPA 1UZYA 4AVTA 3GNEA 1YO8A 2XB6C 1UX6A 2NMOA 4PCRA 3W59A 1MS1A 1DQ6A 1W6OB 3M1HA 1AXZA 2DU1A 2GMMA 3AP6A 2YXSA 4YW4A 1SBDA 1DYKA 3AYAA 2DWRA 1ULGA 2FMDA 3ZYRA 4K1ZA 2ZGLA 3B3QE 5GZFA 1LTEA 2OUJA 3VUOA 3OJBA 1KITA 1DYPA 2UU8A 5T5LA 3SITA 2CNAA 4UW4A 3WCSA 5DUXA 4FVVA 2CWSA 4AVSA 2D3RA 1UL9A 1GZ9A 3L2YA 2NZ9A 1V6MA 4Q8LA 3AZVA 3N3HA 1IS5A 3D5OA 3QLQA 3D4KA 4XHXA 2EXIA 5T5PA 1MZ6A 3WV6A 1Z78A 3JUUA 1H9PA 4ATFA 3V0BA 1ZA4A 1GICA 2GN3A 4DS0A 1ULCA 1QOTA 3M3OA 3WHUA 2VW1A 1DQ1A 2A75A 4UW6A 4D69A 3OGGA 4OZXA 1LULA 4GXLA 4PQ9A 1LGCA 1BQPA 2E51A 3AZYA 1PZ8A 3HN1A 2OW4A 5KXEA 1CPMA 1Q8OA 4XTMA 1G9CA 3WDYA 2JDZA 4XYXA 1OKQA 4YZ4A 3TB0A 5BYNA 2CYFA 1FNZA 2VW0A 2Z42A 2A3WA 4YFWA 1ULFA 3H0OA 4C1WA 1DQ4A 1QNWA 1MVEA 1BJQA 4K1YA 2DVDA 3O5SA 4Q1PA 4XILA 1MR5A 4F83A 4YZ2A 1H9WA 1CQ9A 3R4SA 1G9FA 4KBBA 3MW3A 2ZGUA 1MS5A 5JDBA 5JOXA 2ZGNA 1AVBA 3IKWA 4FP2A 5LK5A 3V0BB 4GKXA 1BKZA 4XZPA 2NN8A 1R1ZA 3O0VA 4H55A 4WZFA 5E8AA 3LCPA 4AYUA 1YYNA 3IM0A 1TEIA 4AVVA 3SNMA 5AVAA 3WDWA 1C1FA 1UPSA 1EPWA 4M3CB 5JLVA 3CNAA 1MS0A 5KXCA 2ARXA 2BQPA 3AXEA 1YIFA 1AX1A 3FLTA 3FUQA 3B69A 1KDKA 1LOEA 1LEMA 2UURA 3AYDA 2R0FA 4YM0A 4JCKA 3WUCA 1SBFA 1LOGA 2DVBA 3VKFC 2RHPA 2JE9A 4LBLA 2NM1A 1JN2P 1WLDA 3MEPA 3WDTA 1V6KA 2D3PA 1FATA 2ZBJA 4UW3A 1RITA 1W6NB 2JJ6A 1LODA 3FUOA 3M3QA 5EYYA 1D0HA 4R9DA 4DRRA 3AYEA 4TYSA 5JOWA 1QDCA 5CBLA 5KXDA 2LTNA 3M2MA 4ZXKA 1SLIA 1V6IA 1LHWA 1PZ9A 1YRZA 3TAYA 4FPCA 3RQ0A 1S0BA 1WW4A 1X50A 2R1BA 1WBFA 1Y7BA 4BQ1A 3D6EA 1FX5A 1LEDA 1ULDA 5F9TA 1GZWA 4LBQD 4WV8A 2W52A 2A6XA 1QDOA 2A3YA 5DUUA 2WLQA 5JOYA 4P9XA 1S0EA 4FPOB 5DG2A 1PZ7A 2YZ4A 3N35A 1SCSA 2DTWA 1JXNA 1N47A 4XJ8A 4XXAA 2PELA 2TEPA 5E88A 1G9AA 3UJOA 3WOGA 2DTYA 3ATGA 4GA9A 4Y1VA 4YGCA 3VV1A 3IPVB 5DZGA 2ZGRA 4YFZA 2AENA 1JW6A 2NYYA 4IQPA 4WVWA 1CPNA 3OBRA 4L8QA 3PJQA 4NO4A 1HDKA 1W6MB 4XIOA 1W6OA 5HCAA 4BM8A 4P9WA 4DQAA 3Q9OA 1FV2A 3SLIA 1GLHA 4ISQA 1VAMA 3ZXFA 1QGLA 1S0FA 1Q56A 3N36A 2P3IA 1QMJA 4XBLA 2D7FA 1JUIA 1QU0A 2GNMA 5L73A 1SCRA 2VW2A 1GKBA 2ARBA 5CNAA 4FQ4A 1MS8A 2YY1A 3ZXKA 2PHXA 4Q26A 5DZEA 2ZAAA 3ZYPA 1MS9A 5HCFA 5IK8A 2D6KA 2YROA 1AXKA 3NV1A 1SBEA 3OYWB 4LBQB 4RL7A 5DUVA 4BMEA 2VY0A 4LBJA 4YW1A 5H9RA 2WJSA 1QF3A 4M3CE 1GZCA 2ZGKA 2DURA 3WG4A 1AJOA 1VIWB 5FREA 1UN1A 3MW2A 1SLAA 2WKKA 3AP5A 1LHVA 1LESA 3WDXA 1CIWA 5F5QA 3OPZA 2PHTA 2D6NA 5CAZA 2I2SA 2NMNA 1IOAA 1LENA 1WD3A 3ILRA 4XJZA 2CL2A 5KXBA 1W6QA 3AZWA
chains in the Genus database with same CATH superfamily
1PO22 2VU9A 4NUBA 5AC92 2EAKA 2WYFA 2WWUA 4Q8KA 5JXGA 3USUA 2Y33A 3RI8A 2A73B 4KGQA 3BI3A 1QKQA 4FPJA 1MACA 4MHUA 1PGL2 5GZGA 3A4UA 3OPTA 2WN3A 3NAPC 1XNBA 4RS5C 1GBGA 4CCNA 2VBDA 2GDFA 4IEWA 5C9AC 4FBFA 4V2VA 5L9BA 1J3QA 4XFCA 2B42B 3PMEA 1S0DA 2QKDA 3LKJA 1SMVA 4I3PA 3Q8AA 4HANA 2EIGA 2VZ3A 1ZRIA 5ACA2 2FDHA 1LOBA 5FUIA 2HEYF 3CF6E 4I0BA 4IE5A 3HAGA 5JXJA 3UV9A 1PO12 3A21A 1TNRA 3AP4A 4P14A 3ZOIA 3N9PA 2DFCA 5LY2A 1PMHX 3AP7A 4LHLA 3BKZA 1VBD3 3GCXA 3EB7A 4QPGA 4QM9A 5BNPA 2WWJA 5IVYA 2BJSA 2CU5A 3VDDC 4KG0A 2H0VA 4GIQA 5CZKA 1CD3G 5LZ6A 1WCKA 1CN1A 1MS3A 3E6DA 2JD4A 3Q8BA 1C8M3 1NXMA 5JIAA 4WM8C 5DN2A 4MLOA 3RG0A 2YU2A 4B8EA 4CPBA 4LUKA 5FZHA 2CSGA 2G9GA 3WVJA 3SEEA 5JZGB 4CRQA 2N7GA 3PIJA 4Q4W2 1F4HA 3FLPA 3ZN6A 4YM3A 4M0NA 3WNKA 3GBGA 4HL0A 4AOCA 3MFCA 3HOBA 2RMU2 2GNDA 1XRUA 1JZ2A 1RJ8A 4FFIA 5A70A 3KVAA 3CJIA 5LA2A 3WQBA 5KWRA 1UZZA 3WF1A 3AX4A 3LOIA 4I3GA 2W1WA 5FAXA 1AR63 4CP2A 2SBAA 3CQOA 4XTPA 3VKLA 2GC0A 1MZFA 1N3QA 1H30A 1UF2C 4H7LA 3I54A 3SCFA 1D4VB 5J1XA 3WZ1A 2ET1A 1EPZA 1FAYA 4O7XA 4AVCA 3POWA 3VDCA 5IK7A 5FZ1A 1RC6A 3RSJA 4EZHA 1LHOA 3KV5A 5I0DA 1RUI1 1F31A 1O4TA 2VOWA 1H8TB 2PAMA 5CU1A 3MV11 4AQ6A 5CB7A 4AFCA 2CTVA 2JENA 2DBIA 3ACLA 5JVVA 3RMXA 5GALA 1RUF1 3OGRA 3JZVA 4EROA 4BQWA 1TE1B 2C9KA 1RMU2 4IXLA 4JAAA 3OUHA 3DF0A 4COYA 1RUG3 1SPPA 1CAWB 1DF0A 3NW4A 2GNBA 3WQ0A 4PBOA 4CCCA 2RVAA 1W2UA 5C7GA 1K12A 3POSA 1YXWA 2A1XA 4JGYC 4LJHA 3LA3A 4D69A 1N1SA 1YFXA 1TME1 3M3EA 4I0AA 1NCQB 4EWEA 4I30A 5CIRA 1JYTA 4RQPA 2BBVA 3V0AA 1AUYA 1GWMA 3FL7A 3KF3A 5CEHA 2WC2A 3IN9A 3VDDA 5JMOA 1SLLA 4LHSA 4AI1A 1U5ZA 4C0BA 1UOGA 4NR1A 5ABJC 1WUVA 2HEWF 2DFBA 1EYBA 1VBA2 1S0CA 2WT2A 3POYA 4JHZA 5A32B 3USSA 4YM2A 3BTZA 4M01A 3PVBB 3C3VA 4IGPA 1SLCA 2Y26A 4QX5A 5FKBA 2KM2A 4XBQA 1LOFC 1XJAA 5KHIA 1DQ2A 4GH4C 2TNFA 2HWB3 1DCSA 2J1TA 2RDNA 1YWKA 1ZBE2 1W6QB 3NNFA 2WFF1 1I3HA 3O0WA 4GB32 3W58A 1LOFA 3U4XA 4MOAA 1X36A 5SV8A 5A3UA 1K42A 3VHNA 2AGSA 2GAUA 3JCIA 4MYEA 2IWGB 1M06G 2G9FA 2JG9A 3AYCA 3H3LA 4B4PA 3B02A 3JQXA 4OULA 1ZRDA 1VB2A 3KCXA 4OI4A 3IAQA 5LBCA 2Z2SB 3MPPG 3AB0A 1B35B 4XFAA 5C70A 2CY6A 3MLKA 2XVKA 1F2NA 1GR3A 1IS4A 1ENQA 5JSRA 1MEC1 3ZPOA 5EYXA 2WQ8A 2W1UA 5KBFA 3RJRA 4JGZC 3T08A 4R4ZA 1FMD1 3FWEA 5FXZA 1ZYBA 4CDUA 4ISRA 3DECA 5KC5A 2P3YA 2D3SA 2P37A 5FWJA 1OH3A 2WA4A 2YC2A 2Y6KA 1WGPA 3MFAA 1O4YA 5IW0A 4OCTA 4Y1ZA 3G7DA 5LA9A 5C4WA 3MIBA 3ZSMA 4AI8A 2PHFA 4IEQA 4MGQA 4PIYA 1WW6A 1NT0A 5CKQA 4I2OA 3CZJA 4G9SB 1PK6A 4LIVA 3V64A 2XGXA 4CP9B 1JTZX 2VGDA 4EN7B 3N9QA 1A6CA 3PUAA 5A7WB 2P34A 5A3PA 3T2PA 2VUDA 1CJDA 3SKJE 2A3XA 1BBT1 1ASJ2 4Y3OA 5FPBA 3OGSA 1OI6A 3PURA 3WEZA 2RJKA 2EF6A 4QDSA 2O14A 2PLV1 1YHFA 4FQZA 5C5TA 3PVEA 1RUJ2 3NQHA 5E16A 2E7TA 1GFF2 4OHXA 5H9PA 3U4SA 3UGHA 2WA3A 2ERFA 2VNOA 3EJKA 4A6OA 4D6QA 3K48A 3J8F1 3ZN6B 1I6XA 1OF3A 2DUPA 2DVFA 3CJIC 3HEIA 2HEVF 3KQ4B 4IEOA 4U2AA 2RE9A 1GNYA 2QJVA 3I2JA 3I3DA 1AR83 2FCVA 5LATA 4DOUA 4ARYA 1RJ7A 3ACGA 3D0SA 2E7AA 4MGKE 4TXWA 5M0TA 5DG1A 1ZM1A 1H2NA 2NLRA 5FPLA 2EICA 4QT6A 1H1IA 5A6YA 2JDPA 1AR72 1FOD1 1NLSA 1NUKA 4XF3A 5FZ3A 1ENXA 5A1LA 2AREA 3RYRA 1O5LA 3OY8A 4MO3M 3AVRA 2GP3A 4RA0A 1CZSA 2RJLA 4QKNA 3DGTA 1BEV1 1WW7A 5DAPA 4FSJA 4Q4X2 1ASJ1 4KU7A 1W6NA 2Q8OA 3CDZB 2B8MA 4A2UA 4TZDA 2WZR3 4AAXA 1OQ1A 2VM9A 2VNGA 1OOPA 3H3ZA 3MPBA 4LULA 5FYCA 2ZHNA 3LSEA 1Y9GA 4PDWC 4CSWA 4D3WA 3RZMA 2RS13 3EBRA 2ES3A 1W8WA 1RVF1 3BCWA 1F35A 4CTEA 1O3SA 3RFRA 1O4ZA 2X09A 3VHPA 5I8SA 4WM7C 4DUVA 4CEWA 1ZZCA 4JRAA 4AEDA 3KCYA 2AH2A 4WVVA 3I2GA 4F8AA 1ND2B 2SLIA 4DUWA 1D2QA 1VMHA 4TTGA 4C91A 3V0AB 2E53A 3BIEA 3MV01 5JI9A 3B9CA 5FTTC 2D6MA 1XNCA 4UFIA 5DPNA 3HVDA 3HD8B 2BNNA 1YUDA 2ZXQA 3DCQA 3OY8B 4NIAA 1GOFA 4U36A 3PU8A 2J1VA 3N7JA 4RS5A 1I1EA 4QPGC 3LGRA 1QJX2 2QDRA 3TEWA 4XF0A 1OD3A 2HYXA 5EXOA 2UYBA 2ZEWA 4PBPA 5F8PA 3CKHA 4AVTA 1YO8A 2V4VA 4IEUA 4FO9A 3NNGA 1PNGA 4PCRA 4QQOA 1DZRA 2PMWB 4PDWB 3SXWA 1W6OB 3D0JA 5FO8B 2B9UA 2E26A 2WFF2 1H6YA 3M70A 1ULGA 1QJU1 2B5HA 2FMDA 4K1ZA 2ZGLA 5F3GA 5BNOC 2ZKLA 3FJSA 1CAXB 3OF1A 3VUOA 3OJBA 1DYPA 1H8TC 5ACA3 4AHXA 4UW4A 5KHKA 3S57A 1QJEA 4FVVA 1MQTA 1CWPA 1JOBA 4XQWA 3GBWA 4YW6A 2D3RA 2HWD3 1UL9A 1GZ9A 3GZEA 5FPVA 5C8CA 4XCBA 1J59A 4Q8LA 1XYPA 5FLIA 3N3HA 2PAKA 3BU7A 3ETPA 3WV6A 1MZ6A 5ABJB 4DINB 5JXIA 1ZZ9A 2GN3A 2WL1A 3CBNA 5F2SA 5FOJB 1VMFA 3GYDA 2E33A 1DQ1A 3KMHA 2A75A 1LULA 4PQ9A 1C8M2 4QU1A 1LGCA 1BQPA 2E51A 3AKSA 3RJ2X 4QPWA 2BGOA 3UESA 3ZM8A 5KXEA 2VQUA 1O3RA 2ZS6B 3WDYA 1US2A 1FT9A 1AR93 2VO5A 3SHRA 4XYXA 4CP9A 4YZ4A 5C8WA 3TB0A 4Z92B 1MEC3 3URFA 3ECQA 2HKXA 2CYFA 3OEAA 4N43B 5C4WB 1IHMA 4CP1A 1KXGA 4P08A 5FY0A 1MVEA 4ET7A 4JDNA 2VMHA 2ZX4A 5FZ6A 4XILA 2WZR2 3WP5A 4KQ7A 3WSOA 4K8RB 1H9WA 2YU1A 4HVRA 1IG0A 3A22A 4YARA 3VBSC 4EJRA 2W92A 1RYYA 4V2WA 1AR91 1MS5A 3VBUC 2FDIA 2BOIA 3PUIA 4XFIA 5LK5A 5FR3A 2JWPA 5FPXA 4YRDA 2W9XA 1V70A 4AI2A 4DXRA 2J1SA 1OSGA 1I5ZA 2XVGA 1OT5A 2W3JA 1JU4A 2ILMA 1TME3 1S2BA 1UY2A 1YYNA 1Y43B 3IM0A 3N4MA 1C28A 3UGFA 5FYHA 5A3WA 5I0UA 1EPWA 4M3CB 1R1A1 5FCCA 2LM3A 1LAJA 3CNAA 3HQUA 2ZTNA 5KXCA 1UD1A 4N43A 1YIFA 2HWC2 3JD71 5IAXA 2Y0IA 4GWIA 1AL22 3TEYA 5EZWA 5ACA1 4UFLA 2AEYA 2R041 4BA6A 2YC4A 4IV3A 1LOGA 3VKFC 3KGZA 3IAPA 3OBAA 3BALA 2JE9A 4IERA 2NM1A 4LBLA 1QJU3 1VJ2A 3MEPA 4NAMA 4F3JA 1JZ7A 2ZCWA 2D3PA 4P5YA 1W8TA 1FATA 4DRRA 5CKNA 1LODA 5LK7B 1D0HA 1RUG1 3GCWA 4HG6B 4R9DA 4N7UA 1PVC2 4EZ4A 3BPSA 3D8CA 5G05L 2LTNA 1RUF3 4H14A 5JUVA 5FYMA 1SLIA 3L9JT 2Y6GA 4FPCA 1PGL1 2FQPA 4CCKA 3D6EA 1FX5A 3K4ZA 2I07B 4JKKA 4A3ZA 3AMQA 3FHIB 4N90A 5JSOA 2QVSB 1GZWA 1VMJA 1XPWA 4HVQA 1VBA3 3LB9A 1OPMA 3RI9A 2XOMA 4WV8A 2Y8KA 1VAKA 2D40A 5JOYA 4Q4Y1 4Z2WA 1M4WA 4FPOB 1QHDA 2YZ4A 4PJYA 5DG2A 1SCSA 3UYJA 5I0SA 1OA4A 1VRBA 3ACHA 4XJ8A 4I02A 2TEPA 1HRI2 4XXAA 1GOHA 4FI9A 4W8JA 5CADA 1H8TA 4HZFA 4OYUA 3ATGA 3BOWA 5CYYA 1US3A 1H8VA 4Y1VA 1ZBE1 2YC0A 4MX3A 4PLMA 5DZGA 1C8M1 3FFQA 2QQMA 4IQPA 3W9AA 3ZYHA 1CPNA 2K9ZA 3PJQA 3CLPA 4RS5B 4UFKA 3U37A 1SPPB 3R4DB 5C6CA 1JS9A 1VAMA 3OUJA 4EE2A 4IE7A 3H8XA 4SBVA 3LPFA 1K3IA 2P3IA 4K40A 3AKPA 3AKQA 1QQP2 4PDWA 4M0HA 1R1A2 2ARBA 2VW2A 1MS8A 4XVHA 2WUHA 1IQAA 2ZAAA 3HQRA 3K75B 1BVP1 4OQ9A 2D6KA 1K45A 4CYDA 4KI5M 1AXKA 3NV1A 1WMXA 5K0UC 3O1UA 5F6LB 2HWB2 3C7GA 1V9U1 2PLV3 4LMFA 4GMP0 4RQPB 5F5IA 4JVAA 1XXNA 3OBZA 2OQ7A 5ANQA 3KVBA 2BDRA 4ZONA 3VDDB 4AEDC 1DU3D 1LNSA 4CEWC 5F7UA 1BLZA 1PIV1 4UAPA 1IOAA 1LENA 1WD3A 2XVLA 1RXGA 5FUPA 4BU2A 2CL2A 5FZ7A 4AI9A 4OUMA 4XE9A 3BPZA 3NMBA 1RUH3 5A33B 1UPIA 2PAEA 1DGLA 1N3PA 1ACCA 5FZKA 4ORFA 1HQLA 1SDDB 2VMFA 2RDSA 1EV13 4XFFA 5JMCA 1X8EA 4CEYC 2A5ZA 1WLWA 1ZRFA 1REFA 2R49A 4Q2FA 5DUWA 4OHWA 4SLIA 4MXVA 4UFJA 1ULEA 3O1RA 3I59B 3OD0A 2K2SA 3CZUA 3LSDA 1ODNA 3TN92 4FPLA 4KWKA 1J3RA 1UCXA 3A7QA 4UYBA 5FBJA 1NQJA 5FKCA 3FBYA 1UYPA 3SKVA 1A34A 2C1FA 4YZ5A 3O12A 2CWMA 1QOOA 1OFNA 3I7DA 1HB2A 5D21A 2BWAA 3TEZA 3INAA 4FPEA 2W0XA 3DPRA 5T5OA 3PLQA 2QTWB 4JV4A 1BYHA 2UWAA 4GJZA 4QX1A 4CZSA 3QBQA 5IAVA 4LBMA 3VBFA 4FAGA 1Q5OA 4P5HA 3MHZA 3ZFFB 1MPXA 2GC1A 5FZGA 4DB5A 3AMPA 4YG6A 1S1AA 2WINB 5LY1A 4AZZA 3ZXDA 3I3EA 3N7LA 1W3XA 5FO9B 1DQ5A 3TOJA 4Q4X3 2JG8C 3POEA 1NXD1 2BVBA 4QXKA 3ZIWA 5FQ0A 4E4ZA 3I3MA 1F8VA 1F4AA 1JODA 1W8UA 3T09A 4CUGA 2UY8A 4RFRB 4E4SA 4TLGA 4CCLA 4MV2A 3ZDVA 3H50A 5I8YA 4DFSA 4ZU7A 1JZ3A 4X8PA 4NIGA 3WF2A 2MEV2 2KD7A 1AR82 4ASMB 1XOYA 3POGA 4QQLA 1H1AA 2OPKA 2P1BA 3ZIXA 4QXCA 2PN5A 3CMGA 1KS5A 4K20A 5C4WC 1ND3C 3ABZA 4FTEA 3HBZA 4PI2A 1N3OA 5BNOA 2EXJA 1QJY3 2X5IC 3B94A 4FPHA 2C24A 1L7LA 2J22A 4Q1RA 4AE2A 2X29A 4Y5TA 3AJYA 1ZZ7A 1AYN1 4Y1YA 1WCSA 1YQ5A 2XONA 4QPIC 4QHZA 1U0AA 1HQWA 3RS6A 4W6WA 1N1YA 3WD5A 1RHI2 2XJSA 3HNYM 3HQXA 2ZEYA 3PHMA 5A3NA 2VL4A 2KXLA 3H7JA 1KQRA 2JKBA 2IVIB 2QNKA 2J1EA 4HFSA 4XZUG 5T54A 4UFMA 3ZSKA 3H1WA 4ATEA 4QB6A 4XJAA 5FLHA 2YYOA 4YVSB 2Y34A 3MBWA 1FXZA 1FV3A 2I74A 1AR71 3N9OA 3P3NA 4S2GA 5C71A 2EVXA 2XBO2 4INDA 3T30A 2Q5TA 2B45X 5DABA 2X5IB 3POIA 5FY8A 4CCJA 1BCXA 5FMOL 1DYOA 1K5JA 2VCBA 5FMOS 3IBMA 4ES8A 5B2GB 2DUOA 4QKDA 1CJPA 2D6PA 5JIUA 4OZOA 4WM8B 4JGZB 1XBFA 3JBG2 1CX1A 2VZPA 4AGGA 3O1MA 4I01A 4XAEA 4NHMA 2HWE2 2GNTA 1CR7A 2ZMLA 4LBOA 4Y4RA 5GZEA 4FPFA 5JPNB 4RHV3 5EV7A 4E2GA 3L2HA 3FE5A 3RZLA 2PHUA 3GZTB 2YPDA 5DDJ1 1AYN2 2VC9A 5GLUA 2D93A 3ZO0B 1AX2A 3FZ3A 1HLCA 1KD7A 3ZSEA 5CFDB 2JG8B 1B09A 3SCGA 3VKOA 1DBNA 4URTA 3AP9A 3ZMOA 5GLVA 5FRAA 3RZGA 4AAPA 1GNZA 3OUIA 2YFZA 4NOTA 4QX2A 1VBD1 4XUNA 4FAHA 2RS32 3MZHA 1JOJA 3NV4A 4EWDA 2XLFA 4PIZA 4OFGA 2ZGQA 4D7YA 1AZDA 4ASKA 4KGGA 2MEV3 3P6BA 4QGMA 4BOWA 2JDAA 4XMIA 1YFUA 2CAUA 1LU2A 4Y5SA 3NNJA 5FP9A 1GWKA 4YW2A 2K46A 2WNUC 5GZDA 3FFZA 1PM7A 2YPJA 1XB9A 4DRVA 1UNBA 5AC93 2OVUA 1MQTB 3RNSA 5I93A 5A6XA 4S2FA 4BHPA 3BTYA 1IS3A 4QXHA 2VMEA 1J83A 4AFBA 5IVEA 2X05A 3WCRA 1K5MB 2RG4A 1OVSA 2AR6A 2PHLA 4KWJA 1REEA 4EYUA 1A8DA 2DCYA 4LO4B 1EUUA 2D44A 2ZZQA 3E5QA 4P02B 1FYUA 1ZRRA 4MG2A 3B9IA 1QXJA 1L7RA 1D7PM 3J7LA 4IEPA 5BV6A 4DXSA 2C6SA 3W21A 2B7YA 1G86A 1W39A 3KT1A 5A1FA 4ZS3A 2VR4A 1A3KA 3OYWA 3ZYBA 3LFMA 5BNNC 3OSDA 3H9AA 4LK6A 4BMBA 4YZ1A 3KT7A 4K6BA 1OH4A 3K3OA 4CDUC 1TZOA 3WF4A 4A41A 5A1AA 1B35A 1FMD3 1J1LA 2AUYA 2VTXJ 4CUAA 1W28A 1V6OA 3K4DA 3J7NA 3T0DA 2DUQA 3BIWE 4AQ2A 2YMZA 2QQPA 5JCTA 1UMHA 1Q8VA 2XLAA 1KJRA 2PYTA 1JBCA 2WAOA 1SACA 3NSTA 4O9EA 4XQ4A 4MADA 4LE4A 4XIKA 4CCEA 3R0RA 4W65A 1PGSA 5ANNA 2VMDA 2ZMNA 4XHBA 2WNVB 1H0BA 1WKYA 3WW1A 1LU1A 4B3NA 4GWMA 4CXYA 5HCBA 2JDKA 1DDLA 2Q8EA 2R16A 3OD4A 2BW8A 5GLTA 3WNXA 4Z82A 4QX3A 4JC1A 4CDXC 5F39A 1ND2A 2D43A 2XKOA 4RHV1 5FMDA 3I49A 5LEKA 4Y1XA 2HWF2 3AMMA 2PHDA 1RUC3 4DEQA 1JYCA 1OFSA 3WHTA 1NCRA 3MUY1 4UF0A 4YM1A 2HYKA 5T50A 5A7QA 1AJKA 4CA9A 2OUHA 1RUI2 3BTXA 1QQP3 3UNPA 2W2IA 1UMZA 5F37A 4DY5A 3LEKA 3BUCA 2ZMKA 2DBNA 2H6BA 1UKGA 1CAUA 1CX4A 2D5HA 4YW7A 4XABA 4IUGA 4S2DA 3W5MA 1PMIA 1WA4A 3MUZ1 5FV3A 3NV3A 1WD4A 3BVCA 2Y6JA 3DEMA 3JU9A 5J37A 1OA3A 3RMYA 1JZ4A 4L97A 2ZGSA 5CVRA 1Y9QA 1ND3A 4BCUA 4IE4A 5FJKA 4LE3A 1GYKA 4COVA 3B01A 5FYVA 1OQEA 1Y3TA 4OHYA 3LD8A 2VMCA 2A6VA 5D1IA 4LR4A 1MS4A 1UY0A 2P2KA 4P9GA 1COV3 4IEZA 4BIFA 5CFCA 3HPNA 2E9QA 1QJX3 1RUOA 3RWKX 1V6JA 1DGWX 4JZRA 4AVAA 5A3TA 4XDOA 2WT0A 3TNQA 4LPLA 5BNQA 5HI0A 1W9WA 3UJQA 3J7HA 4LO5B 3BOPA 4XBNA 4YVSC 2V5DA 2JG8A 4LBNA 1HN1A 1URXA 2V4AA 5HV0A 5DDJ2 4PLNA 5AC91 3AKTA 1XU2A 4Q29A 1LKNA 3GNEA 1UX6A 4LT5A 2NMOA 1DGRN 3U14A 1MS1A 4BYYA 1DQ6A 1GP5A 4WBBA 1HXS3 4GH4B 3AP6A 4HLTA 1X9TA 4QU2A 2QQOA 3AYAA 1SFPA 2AC1A 2WBKA 3ACIA 5EFUA 3ZYRA 4NMIA 5GZFA 1W05A 2RJ2A 4RSUA 2R042 2FDJA 4IV1B 1KITA 2BNMA 2R32A 2WO7A 3G6JB 3I3QA 4LHKA 5FP7A 4HMZA 3SITA 4XUTA 2P6CA 3HNBM 4Y5Z0 5DUXA 2BUKA 2G19A 2XBO1 2F4LA 2HLEA 2CWSA 3OGJA 2HWC1 4CCOA 1IPKA 3L2YA 2AZ5A 3U07A 3WW4A 2W1QA 3AZVA 2EIBA 1IS5A 2WO1A 3D5OA 3QLQA 4XHXA 5T5PA 4BE3A 4EV0A 1H9PA 1RUE1 4GMP1 5FZ9A 4CE8A 1ZA4A 5E6HA 4K7JA 4AF9A 1W8FA 5HPOA 1ULCA 1W2AX 3MGUA 2XJRA 4R4XA 3WHUA 4HN1A 4AFDA 4FFFA 2TUNA 3UETA 4FTBA 2FDKA 1S2KA 3OGGA 4E4DX 3KHBA 3WP3A 4QX8A 5I91A 2XDVA 1Q8OA 3B93A 4NN0A 1KS4A 4AVBA 1HRV2 5A7WA 1XNDA 2VW0A 1UOFA 5J3UA 3WQ7A 1QNWA 5L7OB 3ALQA 1NY71 2ORZA 4Q1PA 4YZ2A 1UIKA 3CJXA 5F3IA 1EV11 1G9FA 1YNAA 4QB1A 1W0NA 1WWYA 5C9AA 5K7PA 1MEC2 4CDQB 2XUMA 1YFYA 5JDBA 4DEVA 5JOXA 5FP4A 4L99A 3O1TA 3DKWA 4BQXA 1W8HA 1OD5A 1BKZA 3ZKYA 2OYZA 1RHI3 4DY3A 1PIV3 3C7FA 2FZ1A 5E8AA 2BP6A 2FDFA 4A7ZA 4AYUA 1PGW2 1H6XA 2J1UA 3IMMA 3M3IA 2O8OA 3NJVA 3SNMA 4GQ7A 3WDWA 1C1FA 2QE3A 2P17A 5FZDA 4N9IA 4CCMA 1MS0A 5FYYA 3R6SA 1SHWB 2ARXA 1OXCA 5FZOA 3FLTA 5FFOC 1Z7S1 1NX9A 1KDKA 2DDUA 5L19A 1UKRA 1OLQA 1LOEA 1LEMA 2UURA 4E4HA 1JZ6A 4ASLA 3FBMA 5A6ZA 1WLTA 5A3OA 5C9AB 3WUCA 1LB2A 3E97A 2VZ1A 2RHPA 5LA1A 1JN2P 1WLDA 4NAOA 3WDTA 3S7EA 4OVEA 2VZUA 3C7EA 4Q4V1 1RVF3 3LEMA 4JQTA 4TN7A 3KLSA 4JDMA 5DMYA 4JGYB 3WNPA 4L11A 3FX3A 2JIJA 4RR3A 4COZA 5C3OA 4N43C 2D98A 3M2MA 4QXBA 1LHWA 2JEMA 4Q4X1 3TAYA 3O1VA 1W8OA 3T3YA 3GHNA 1EY2A 1WW4A 1VBE1 1WZXA 2BYVE 4GWJA 4AEDB 4FXGB 1L3JA 1NLRA 5A80A 2IXIA 1HRI3 1PVC3 1RMU1 2Y6HA 2R062 4LBQD 5LB6A 1AHSA 2W52A 2A6XA 1F5JA 1QIQA 3WX5A 1FOD2 3DPRC 3VZMA 2XBO3 4QX7A 3MIGA 1OURA 2DTWA 1N47A 3DXTA 4YVSA 4P00B 3LPGA 5D8AC 5E88A 1O91A 3I2HA 2XUEA 3UJOA 4AHWA 5IWFA 4CU7A 1W03A 2E31A 4YNIA 2AACA 1HV0A 3IPVB 3VV1A 4BWOA 4YFZA 4QPYA 2NYYA 1JW6A 4L9BA 5FIXA 5FZEA 1WMEA 3OBRA 2ADDA 2YGLA 1HDKA 1W6MB 1W6OA 2DCJA 2Q1MA 1FV2A 3MDPA 4ISQA 3UKVA 4NRMA 4W6XA 2WO3A 5FPUA 1POV1 1POQA 1S0FA 3N36A 2BRTA 4XFBA 1JUIA 2GNMA 2PLV2 1PM4A 2XR4A 3H3UA 1GKBA 1F15A 1JOPA 1R093 2B46X 2J1AA 3N9NA 5CNAA 5FPAA 2QDNA 5DZEA 3DV8A 4D0QA 4W6YA 5F3EA 1BBT2 1PGW1 3POFA 3AL5A 5DUVA 2VNVA 1PIV2 3ZFGC 1DP0A 4UOJA 1AJOA 4ZU5A 2OXBA 1UN1A 1R1A3 4W50A 5A7SA 3AP5A 2OS2A 3PUHA 4RGKA 2QUOA 3NNMA 1POV0 4JKMA 1XYNA 1AR62 2VUJA 5F5QA 5IJRA 1VRH2 2Q1ZB 4JTOA 4OHVA 2YGMA 5BXXA 4CDXA 1W6QA 2RS53 4A45A 3JQWA 1NCQC 3NL1A 3VKNA 2RR11 3I2IA 5K4LA 2IFWA 2HWD2 1RUJ1 4RFT0 4YG3A 5FZ8A 2ZA9A 4D7SA 4YVWA 3GGLA 3K77A 5IVJA 3H7YA 5K9YA 2Y38A 5IT6A 2CDOA 4HKLA 3QH7A 3KV9A 4YLZA 2EXKA 2QCSB 2H6CA 4YGBA 3VBHC 2R072 4W4ZA 3DYOA 4XXPA 5IVFA 1PVC1 1RMU3 5EP9A 1MQTC 2ZGPA 3A0KA 5B4XA 3VBRA 2VAUA 2AEZA 1ZBA1 4GB31 1NYWA 3CEWA 4P9YA 1W9TA 4BZ4A 5IFTA 1S0GA 2Y6FA 4N9HA 1RUD2 5BPXA 2VULA 1HW5A 2VVEA 2ZJCA 4LO8A 1R082 5FO7B 3A23A 4AHYA 4TWTA 4E2SA 3TBDA 2HWF3 5BNNA 2DF7A 2P3JA 4IEVA 5A33A 4XC9A 1W6PB 3LOBA 1FMD2 4UT5A 2ZAHA 3KM5A 3TRSB 4URAA 3T2OA 4BQ3A 2HBTA 4Z8BA 5FMBA 1NE4A 4DXTA 3KF5A 5JXHA 4Q4V3 5EWSA 2L9LA 2V72A 2WZ8A 3LF7A 3T4HB 4DZGA 3MLJA 5T55A 4DMIA 3AC0A 2VQAA 1LGNA 2PHRA 4TLFA 4CEWB 3VBHB 2H0BA 2K0GA 1SFYA 4UFHA 4XOGA 3HIFA 1B35C 1LRHA 2A6YA 2ENRA 2WQZC 1GNHA 1MVQA 2E6VA 3CO2A 4XJUA 3ZVXA 5FZOB 1ST8A 4EN8B 1SDWA 4JTNA 3T1LA 5C3QA 4IV3C 5FZAA 4CXXA 1VR3A 4LOTA 4Z07A 1YI7A 1W9YA 3DPRB 1ZZ8A 4WM7A 3I2DA 2Y60A 1S0IA 2JB4A 4XJ9A 2PFWA 2W46A 4OUSA 3VD4A 1AL23 1AL21 2VJXA 1W6PA 4Q5OA 1BBT3 3JD72 4MGYE 4J1WA 1KDMA 2PXJA 2FMYA 2BTVC 4GWNA 3VD7A 4BJ0A 5EJ1B 2PA7A 4QPGB 1H2MA 2GU9A 4ZPIA 2ZGTA 3CU7A 2JDNA 2NQYA 3U78A 5FYUA 3HMYA 4ZHNA 1ENSA 1JHNA 1GSLA 1ZRCA 2X8KA 2YUEA 1UY3A 1GZWB 1NLQA 3LFIA 1LOAA 2R0HA 1W0PA 4LO7A 4WVMB 1HQNA 3VBUA 4KWLA 1GV9A 1NKGA 1Q8SA 5JR2A 3LA2A 4IESA 4LLOA 1I5PA 4XF1A 4FOWA 2WNOA 4FCAA 1G8WA 1C4RA 2QQVA 1UZVA 1O3TA 1RTVA 5F1RA 1QWRA 2HWC3 5GKAC 3ZN5A 1UQXA 4HSLA 2C5DA 4QKBA 5DAQA 3GXUA 2RM21 3ZDSA 1PK6C 4M3CA 3PTYA 2PQQA 3BGAA 2MNGA 4O65A 1LCLA 1ZBA3 2ZX0A 2ZACA 3VN4A 1QJU2 1K5MC 3WP4A 5DDJ3 4Q27A 3LEGA 4LQRA 4YWAA 2EIDA 3C8XA 3KCCA 4AK3A 1C1LA 3AFKA 4MXWA 2YDEA 4NE9A 2OPWA 5KHHA 3S6PA 2XH6A 2Z69A 3SH3A 3ZYGA 3ZSJA 2G1MA 4MHRA 1CVNA 1WA6X 1UXZA 2ID4A 3MW4A 5K0UB 4MGTA 1PMJX 2EXHA 1OBNA 3K2OA 4A7KA 1Q8QA 4BQYA 5EJ3A 4BDVB 1C5HA 4OQ8A 1IS6A 1DHKB 2BU9A 1NA1A 3TWIA 1JHJA 2V5YA 2E7QA 3VZOA 2E32A 3R4UA 4A44A 4Y22B 3THTA 2RS31 4CDUB 4CU8A 4B7EA 1ND2C 1QOSA 2VTFA 4BK5A 3NAPB 4EN9B 1YFWA 2IZWA 2RS51 4R52A 4AEJA 4TSVA 1EAH3 2Y0OA 1YJKA 5BY5A 4UW5A 3USUB 5F32A 4Q4W1 2ZOEB 4J25A 4XW3A 5GJ6A 3OGVA 3ZXJA 3WNOA 5L9RA 3LE0A 2WNEA 1JUHA 4AGRA 3IDAA 1FPN2 4BK4A 4GH4A 4XJWA 1F9KA 1YQ6A 3NWKA 1DFQA 5FZFA 4B4RA 4C90A 1NOVA 4FFHA 2G9ZA 4Y20B 2CGPA 3MICA 2R6QA 4RGGA 5ISLA 1COV1 3O7OA 1J3PA 1VAVA 2JDUA 4OMCA 2R071 4QD2A 5ABJA 5L36A 2GMEA 1VE0A 4Q4Y2 2VUAA 2HWE1 1CONA 2WR9A 2ZHKA 3N7KA 2RMU3 4ZY9A 4Y26A 1UMIA 3ZXLA 4BXFA 4JX0A 1HRV3 2ZABA 1BK1A 4IV3B 4GULA 3DUIA 4Q0PA 1HKDA 2OZJA 3LAGA 3Q8CA 3GJAA 1G9BA 2B39A 4YVWC 1TMF3 4WVZA 1EP0A 2Q8CA 1W2NA 2WO2A 3D82A 4E8DA 2FHRA 2YV8A 2W91A 1YQ8A 1XQNA 2JIGA 2YHJA 3T2TA 2QQKA 5JSPA 4RR3B 2IVJA 1IGOA 3VKMA 4BQ4A 5FZCA 4PI0A 5FOBB 2P6HA 3AK0A 4B7KA 1BHGA 2EAAA 2QQLA 4XF9A 1RUC1 5FP8A 4HONA 1NA1C 2GP5A 4KH9A 2DYCA 5LRRA 1LJ7A 2BERA 2C9AA 1TG7A 5EQUA 1UZ0A 3VZJA 5F6KA 2AYHA 1RINA 1O59A 1SLTA 2ZHLA 3HT2A 3ZFGA 1D4M3 1YC61 1WW5A 2XL7A 4K21A 3VZKA 4MUVA 3ILFA 1D0GA 4LHNA 3BN6A 2VBBA 2E63A 1BK0A 1K5MA 1T2XA 4LNVA 1FOD3 1Q3EA 2O0OA 2XHKA 4RGAA 1Z7S3 3W20A 1E57A 3QD6A 1UOJA 5A7PA 3WQ1A 1YLLA 2IC1A 3WUDA 3VBFC 3SEPA 4ITCA 2FDGA 1VRH1 5HV4A 4M4PA 4NRQA 1S4CA 4FP3A 5C3RA 5DAWA 1KJLA 4ZU4A 3NO8A 5DAVA 1RUC2 5FMCA 4YZ3A 2DU0A 1AR81 3KT4A 2D5FA 1HIXA 5G04L 1JI6A 1UY1A 3N7MA 4LBKA 4DIQA 3ASIA 4YGDA 3GZAA 4COWA 4PT6A 5CA6A 4O9GA 3H8OA 4NHLA 2WT1A 1OF4A 5FZ4A 2IXHA 5FPZA 1W99A 4JHTA 1QJY2 1LHUA 4LBQA 5T3NA 3S0MA 1V6LA 2ZGOA 4AWDA 3IIIA 1ULPA 4R8HA 4DO0A 5J98B 3APBA 5DXDA 3OOXA 3F2ZA 1LOCA 2XMLA 1XSQA 1NG0A 1F5FA 1C3HA 4R9CA 4N8MA 1RHI1 1COV2 1WMFA 1XSRA 3ELNA 3I3BA 3VL8A 4AEMA 1S0JA 4FXKB 3T1MA 2X53S 3WP6A 1BZWA 3WLUA 5IVVA 2WAAA 5IK4A 1GP4A 2W39A 1W90A 4YVWB 2VZQA 2D6OX 3MI8A 3OCPA 5JR7B 5T5JA 4WM8A 4JGZA 5J36A 1PO23 1HB4A 4EN0A 1TMF2 2ZGMA 3JXSA 1RUE3 2OT7A 4GMP3 1DGWA 4YGEA 3POBA 3ME2A 3Q8FA 2G4IA 3M3CA 4NJ4A 4J1XA 3H8RA 3OBTA 4M00A 3DYPA 3VBRC 1T6GC 3TEXA 3VB9A 3UKTA 3F95A 3E5XA 3HBKA 3LDBA 2FD8A 3BODA 1UZYA 4D8MA 4FTSA 1SZBA 5IFPA 3DL3A 3W59A 3NJYA 1X7NA 4AG4A 4HN0A 2PTMA 3M1HA 4IDZA 1V0AA 4NHYA 2VZTA 2GMMA 2YXSA 4ZZ5A 4YW4A 1U12A 1SBDA 1VBC2 4LOSA 3WINE 4DUXA 1JU3A 4GZ9A 1BMV1 3OTFA 5FK7A 3ZXGA 3KZ4C 1C5IA 2GH8A 3P3PA 3VDAA 4X6QB 1R083 3GHMA 2UU8A 5T5LA 3WNLA 3WCSA 4CDWC 3LIHA 4KU8A 4LKEA 3WXPA 2WNUB 2XJVA 1OLME 1KFXL 1XNAA 4IE0A 3T2QA 3VBHA 4PIXA 3QH6A 4B4QA 1Q43A 3E6BA 4QPIA 2EXIA 1HRV1 3JUUA 3U10A 2BV4A 1HXS1 4DS0A 1QOTA 2DCKA 2HWE3 1UW8A 1UYYA 3PJYA 5FYTA 2KA3A 2R073 2JKXA 2VW1A 4Y33A 2LROA 3T0AA 4LKSA 4GXLA 5FBZA 1J84A 5HXMA 1PZ8A 3OB8A 2OW4A 1CPMA 3MIEA 4AQSA 4HKWA 1AR73 4OLLA 1G9CA 3IDEA 2BVVA 4LA3A 2OX0A 4XAAA 2JDZA 3U1XA 5BNOB 2ET7A 3I59A 3HNMA 1OMIA 3GJBA 3ZFEA 2WIIB 5BYNA 2NPIA 3GZUC 4IV1A 4P9LA 1FNZA 4E2QA 1QJY1 3RPQA 5B4NA 5CG9A 4YFWA 4I09A 1ULFA 3S30A 4C1WA 1UU5A 1O8PA 1BJQA 4K1YA 2GC2A 2QQJA 3O5SA 4Z1VA 5I0RA 5KHJA 3AM2A 1CQ9A 2I45A 1PO13 2JD9A 2RS33 3GBFA 4KBBA 4Q0QA 4CUCA 3MW3A 3VBSA 2IFRA 4NPMA 2ZGUA 1JH5A 2QQWA 2VD7A 1GZTA 2ZGNA 3IKWA 5FUNA 3EO6A 3T0BA 4NROA 1QEXA 1UYXA 2J1RA 4XZPA 2NN8A 4XEZA 5A7NA 1DLCA 3O0VA 4IV1C 4WZFA 1OUSA 3LCPA 2IXJA 4NIDA 1L7QA 4YSFA 1TEIA 3I2KA 4AVVA 3ZKUA 3RZJA 4QKFA 2ZX2A 1RUE2 5AVAA 4COUA 3ZFFA 1XNKA 1QQP1 4XDPA 2LUWA 2BQPA 3AXEA 1IG3A 2VNRA 4LLFA 1AX1A 2CDPA 2VMGA 3B69A 4PHZA 1HJGA 2GZWA 1U5IA 3AYDA 4XFGA 4PQQA 2R0FA 1UIJA 3KD4A 1R64A 2PQSA 4YM0A 2ETEA 2QZ2A 4RN5A 4JCKA 3VBSB 4CDQA 1WMDA 3OG2A 3UGGA 4A42A 3WF3A 4AR2A 2W87A 5K0UA 3HT1A 2BPA2 4CPBD 4KBZA 4AXOA 3O1SA 4UW3A 1RITA 4FT8A 2JJ6A 5EYYA 3HJRA 4RYDA 4B1LA 1H4GA 2XWBB 3AYEA 4TYSA 4CDWB 5JOWA 3U0ZA 1QDCA 5CBLA 4LKFA 3CJIB 3WW2A 4ZXKA 1E5IA 1YRZA 2QBXA 2LRPA 3RQ0A 1XC6A 2BGPA 1X50A 2R1BA 4H2AA 1NZIA 3KSCA 4BQ1A 5F9TA 3AMNA 4XUQA 4IGQA 4E9KA 4XQDA 3KS7A 3LZZA 1OPOA 1GU3A 1QDOA 2A3YA 4WVMA 1XYOA 3QACA 5KC6A 3J4UH 5L9VA 3PNAA 1PO21 1I9RA 4LORA 4P9IA 1S0EA 4N53A 1PZ7A 3N35A 4AEKA 3H8UA 3MIDA 1JXNA 2W95A 1UY4A 1HJFA 5CFCB 2YB7A 4Z2AA 2R063 1G9AA 3WOGA 2DTYA 1O5UA 2ADEA 4YGCA 3P1IA 1LR5A 2AENA 3ZR6A 4WVWA 1T6BX 1XE7A 2TBVA 1R092 2OQ6A 4L8QA 4NO4A 1P8JA 4NPRA 5I0TA 3SC7X 1CZVA 4BM8A 4DQAA 2VECA 3SLIA 1GLHA 2HJIA 4MH0E 2V09A 3ZXFA 1DG6A 2J7MA 4A4AA 1O7FA 1QMJA 3JB4C 4XBLA 1QU0A 4AW7A 1NCQA 5L73A 3IB3A 2B9VA 5DAXA 5EIYB 3D3AA 1HN0A 4FQ4A 3MF9A 2VZVA 4KG8A 2VCCA 5HCFA 3ZYPA 5IK8A 3K51A 5FZBA 2YROA 4HT1T 4RL7A 4LBQB 1EAH2 2BWCA 3VLBB 5JOZA 4LBJA 1VBB1 1YQ2A 4QHBA 2DURA 5CFDA 1DZTA 3WG4A 5FREA 5IVCA 2WS93 2XJTA 3CHXA 4YYOA 1HX6A 3AL6A 4GB33 2P5BA 3VD9A 3MLLA 5FZMA 3WDXA 3DXUA 3W5NA 1CIWA 3M7AA 1UYZA 1OOPB 2I2SA 4QMAA 4QPIB 4XJZA 3ILRA 4HSJA 3FHQA 2R30A 1HV1A 3AZWA 5IATA 3IMNA 2RDQA 3B7MA 3V65A 5E1RA 2WSUA 1JYIA 3ZFFC 4R9BA 5JZGC 4HOOA 1RXFA 1C8NA 4XUPA 3RWNA 4META 2UWCA 3LWCA 3VHRA 5JWPA 2VCMA 2WDBA 3IT8A 1QNYA 3EQEA 3EMRA 4D6RA 2RR13 1TMF1 2A6ZA 4ES9A 2F17A 3SH4A 4C8DA 4Y20A 1VP6A 3UKNA 2CV6A 2DV9A 5GM0A 5CG8A 1DZQA 2BEOA 4XDQA 3IZOA 2XQXA 2GSYA 5FY1A 2ZX1A 3ACFA 4BXSV 1N1TA 2FCUA 1HXS2 1N1VA 3PVOA 1H2KA 2JXAA 2R7EB 1AXYA 2ZX3A 3V56A 4UXAA 4NIHA 3E5UA 3FHAA 2WRAA 4NIIA 3GALA 4JQRA 1VB4A 2R043 4IEXA 4ONUA 1VBD2 1SFNA 5FXXA 2RMU1 4PF1A 1WLCA 2VG9A 2QQUA 3DKQA 3ZFEC 3CL1A 1AYN3 4KL1A 2A70A 1H2LA 1W2OA 4C1XA 1AYM1 1O3QA 4AFMA 2IXLA 1DQ0A 1X8MA 1UU4A 3CIHA 1S55A 2X10A 4FPGA 2JECA 4QHOA 1BMV2 3NKTA 1GMMA 1VBC1 2F6BA 1YQCA 2VH9A 2VVFA 4L2NA 1TNFA 3C7OA 4BLIA 5SV5A 5FY7A 3DYMA 3ON7A 1RUNA 1C57A 1ENRA 3GF6A 5KXBA 1GQHA 2B4KA 3WR0A 4N7IA 2GALA 1W8NA 2XKPA 4KMQA 4IW3A 1TQ5A 4OUEA 3LDKA 4PLOA 3VBUB 4Q4V2 1CIYA 2YFUA 5BUVA 2Q0AA 4HBNA 3C7HA 3JD73 3B5LB 5FYZA 3JBG1 3RYPA 5CFCC 1J58A 1QJZA 5GLZA 3O1PA 4OI0A 1AX0A 1E5SA 2VOXA 5KR7A 4JDOA 1G7YA 1G6NA 4RD7A 1W9SA 3AZZA 1Y9MA 4CDWA 5A3LA 3ST7A 2JDHA 3ZLIA 1TVGA 3N9MA 5BNNB 2P3KA 3VBFB 2BFUS 1CESA 4HK8A 2WN2A 1R081 2VZOA 3NRUA 3VZLA 5GZCA 4NRPA 1OLMA 2LW8A 3WG1A 4K8FA 4BQ2A 2W5FA 3MO4A 1KRIA 4UBHA 5L7OA 4Q0UA 2BOJA 5K8SA 5BNPB 1QXRA 4HETA 1RVF2 4QM8A 1RB8G 2BFUL 4B29A 1UAIA 1GUIA 3ITQA 3POJA 5AFBA 2JICA 4AHZA 2NP0A 2PHWA 5DZFA 1UX7A 4FPKA 1QY4A 4WZCA 3THPA 3DN7A 4MGZE 1RUH2 1CAUB 1BEV2 1ONAA 2JG9C 1NCRB 2JE8A 4UF0B 3ZXAC 4GALA 2Q30A 5EJZB 2XG3A 2ZKNA 4RQPC 3PU3A 1ZNPA 1V6NA 4QB2A 4DPNA 3RRDA 3NNLA 4NVPA 2QQNA 4NPLA 2HWD1 2XXZA 4QDQA 4Y22A 1ND3B 1IKPA 2FCTA 1YIPA 2RM23 3BTAA 5FXWA 1Q8PA 4M4RA 1NQDA 5IYYA 5FJHA 2OIIA 2VOTA 4FOQA 3I4IA 3ROUA 3SH5A 5H9QA 5J48A 5APAA 1OOPC 3KWVA 1RUH1 2ZPXA 2ZZJA 1PVXA 2DVAA 3B00A 2RV9A 3GDBA 1LHNA 3I8TA 3ZFEB 1IQDC 1W04A 5C33A 3BU0A 1RUG2 4LITA 2R1DA 1DIWA 1ZA7A 3RGBA 2C0ZA 3VD5A 1YEWA 5LA0A 1W2TA 2VTXA 2UWBA 2YBKA 4JGYA 4XUOA 1H4HA 1WCUA 5FYIA 3IWZA 5D2AA 1Y4WA 1AYM2 2XLGA 2D97A 3K4AA 2MHFA 4CDXB 4X8NA 4IETA 3BYWA 2BGCA 2LS6A 4S2HA 5HCHA 3KHCA 1LECA 5J09A 3VD3A 5FDBA 1D2SA 3MYXA 4HKOA 4OI2A 2XHNA 4HVOA 2QZ3A 1U5XA 2KR2A 5FWEA 1DGRA 3OPWA 1V9U3 1A78A 3KV4A 3I2OA 1VRH3 4EN6B 3TN91 3NV2A 2EALA 4BPZA 4AFAA 1TME2 4PF5A 1BXHA 4BQ5A 1ZBE3 4D7TA 3ZPYA 1FPN3 2XJPA 2DVGA 3ZYIB 2WNUA 3K3NA 4YG0A 5J7MA 2ZEXA 2GMPA 1AR92 2JB8A 2LALA 2OZ6A 4YW5A 5C8CC 1ALYA 5F2WA 4CEYA 2W68A 1IPSA 2Z79A 3NVCA 3WF0A 1GP6A 5FY9A 4Y24A 2DCZA 4Q4Y3 3ZYFA 3ZN4A 4E8CA 5IHRA 2XPJA 2A6WA 1LGBA 3H1MA 4ZKTB 3PL0A 3ENRA 4XETA 5GLWA 3A0NA 3ZR5A 4XFHA 1EUTA 1VALA 5JAXA 4AI0A 2WNVC 1ASJ3 1OA2A 3QCWA 4YW3A 2WFPA 3OEBA 3S5QA 1XNTA 1GWLA 2Q4SA 2V73A 3UK9A 2D6LX 1FPN1 1W3VA 1W0OA 5EHDA 3U11A 4GKYA 1Z0HA 1WCQA 1RUD3 4ARXA 1JMUB 1VBB2 4HPKB 1RUJ3 4LA2A 4XACA 2C26A 2RS52 3AZXA 3QOPA 3UT0A 1Z7S2 5HXVA 1AF9A 3WG3A 2OA2A 5FZLA 5A6QA 1VBA1 1DLLA 4K3UA 4QQHA 3KQRA 4FOYA 4GD4A 4N53B 4IEYA 5FLJA 5LEJA 1CGPA 1NCRC 5BNPC 1GOGA 5C8CB 1REDA 4CEYB 3THCA 4CCDA 5LCWL 4CXWA 1G9DA 3AJZA 1IPJA 3WG2A 1SQ4A 3ORJA 5FZ0A 2QQIA 3IPVA 2BNOA 3GM8A 1GANA 5L7OC 3RYKA 1R091 1VPHA 2VPVA 4RHV2 4DNYA 1MZEA 5IK5A 4QGLA 1PX3A 4NHKA 3WNMA 1IKQA 1UZWA 1IZ3A 2VQ0A 1JZ8A 4FOVA 2JDYA 4QQ2A 5A3MA 1FNYA 1JYNA 2A71A 2VVDA 3WW3A 1H1MA 3SCHA 1UU6A 2WSVA 1GQGA 4Q4W3 5CKMA 5T52A 1J1TA 2VXRA 1VLNA 1POV3 3O0XA 1EAH1 1GQPA 3LDRA 4R9AA 5C5UA 2ARAA 3AXDA 5H9SA 2BZDA 1WBLA 5FP3A 3ZSLA 3E1F1 2HBUA 3R05A 4J6GA 4BLJA 1UWWA 3FLRA 4UI9L 3U75A 3S7IA 1SLBA 1ODMA 1MZ5A 4IL7A 4OHZA 3ILNA 3ZX7A 2HH9A 1YCIA 2Y64A 4YPJA 5AFEA 1PNFA 2X5IA 1V00A 3NKGA 3WDUA 4XMAA 5E89A 4BB3A 1RUD1 3SISA 5LW9A 2WNVA 1S2EA 2ZHMA 1JYWA 1X33A 1VBE3 3PMSA 5FQ0B 2JE7A 4BIOA 3IDBB 3FC0A 5A7OA 2RDRA 1RIRA 3K46A 3VL9A 2Y6LA 3THDA 1HRI1 2FZ2A 2ORXA 2XWJB 4ZXEA 5TSWA 3RVHA 2DCTA 4Q0VA 4LIUA 2F4PA 2W08A 1APNA 3LEIA 3HN3A 3C2UA 3PVNA 3ZXEA 4AGVA 1YI9A 2GC3A 2VOKA 2O8QA 1HB1A 3H1YA 4BH9A 5FXVA 2XQRA 4JKLA 3TYJA 3VBOB 1XE0A 3J9SA 4Y1UA 3HR9A 4FPYA 3UL2A 3WDVA 1W6MA 3RZHA 2A7AA 2GN7A 3PTRB 4M3CF 3Q8EA 1ZZ6A 2RR12 2Q1FA 5IUQA 2XJQA 2ATFA 2WS91 2XB6C 1KEXA 1VBB3 3ES4A 3TN93 4NWWA 4WM7B 1KGYA 4MVTA 1AXZA 4LO6B 2DU1A 2UYAA 4LKDA 1DYKA 2WQ4A 2DWRA 4D94A 3B3QE 1PX4A 1LTEA 5LASA 2OUJA 1PO11 2J42A 4EQVA 1ZX5A 2Z4FA 2BBAA 5D8AA 4F7ZA 2CNAA 1RGSA 4JRLA 1W9FA 2CGOA 1VBC3 4AVSA 1OC1A 1OUXA 2VMIA 2WYSA 4LUMA 2VQTA 1KFUL 2NZ9A 1V6MA 2VZRA 3T4VA 5LWBA 1QXPA 4QWNA 4QAWA 2W1SA 3D4KA 3PDQA 1X9PA 4XPVA 4CUBA 1ZBA2 4CU6A 2W94A 1Z78A 4X6RB 3I97A 5CFDC 5LBBA 4ATFA 2VBPA 3V0BA 5FYSA 4IE6A 5FYBA 3RZKA 1GICA 1SEFA 3AFGA 3M3OA 5F3CA 4L0PA 5JZGA 2P4EA 5IVBA 3HWJA 4GJYA 4UW6A 2CGNA 1BVVA 3P5BA 2VE1A 4OZXA 1CZTA 5FY5A 4DXZA 5JPMB 4CP0A 1CAWA 3AZYA 4G4FA 3ES1A 3HN1A 2WZEA 3VGIA 4D6SA 4RR3C 3ETQA 1OLRA 4XTMA 5ERLA 3FN9A 5JI7A 4HK9A 1OKQA 1RUI3 2CAVA 4KWUA 3AVSA 4ZS2A 2JDMA 2UY9A 4HPKA 2VXJA 4H7MA 4IGOA 2ARCA 4LK7A 4UWDA 2Z42A 2W47A 2WZR1 3VBRB 2A3WA 4H3WA 4O61A 3H0OA 1DQ4A 2C4XA 1UXXX 3ZFGB 2HWF1 3LA7A 4MZUA 2DVDA 3NJXA 3BB6A 1MR5A 4A3XA 4F83A 3R4SA 4OI1A 1UO9A 4K9SA 4MGIE 2VZSA 3TNPB 1AR61 5A32A 1VBE2 3JB8A 3V0BB 1AVBA 4FP2A 3NAPA 2MEV1 2MPFA 4GKXA 1O6UA 2RS11 1UOBA 1NE6A 3H42B 2Q8DA 1OQDA 1AL0G 4GAZA 4XF4A 1ZREA 2WWSA 3LIGA 2O1QA 1R1ZA 4H55A 1NAEA 5DQ0A 5LBFA 3RDIA 4AQTA 2QFEA 1BEV3 3EYPA 4B1MA 1D4M2 2IUWA 5I8TA 1UPSA 3X29B 3N9LA 4FFGA 4QGNA 1XU1A 2FBEA 3MIHA 5JLVA 3MIFA 2VUCA 4UBGA 1RL3A 3RZZA 4ZZ8A 3J8F3 1STMA 1SG3A 3IIAA 4XCAA 4XURA 2EA7A 3FUQA 1HB3A 1QH7A 4G3YC 1U5YA 5LBEA 2Z5WA 1NZCA 5AVPA 2JX9A 1OVPA 1W06A 4N53C 5F5CA 3VZNA 1SBFA 2DVBA 1W8ZA 3WY6A 4CDQC 4CU9A 1ULOA 5F5AA 3JBG3 1V6KA 4QX0A 1YJLA 3WT3A 2ZBJA 5FK8A 3NJZA 1W6NB 3M3QA 4LXLA 3ZMNA 3FUOA 5C3SA 2CHHA 4Y4YA 3M8LA 5KXDA 2VOVA 4NHXA 1E5HA 1A8MA 3E6CC 1V6IA 4I0WB 5KHGA 4NWVA 1PZ9A 3PIGA 4LTAA 3KB5A 1QJX1 1PK6B 1S0BA 3KV6A 2WLPA 2R061 1WBFA 3VDBA 1Y7BA 2VCAA 1LEDA 1ULDA 4QDRA 3O1OA 4Q0SA 1PHMA 1AYM3 1RUF2 4L92A 2IXKA 1NY72 4V1PA 1O8SA 2WLQA 5DUUA 3J7MA 2RM22 4P9XA 3WNNA 5C3PA 2XJUA 4KNCA 2GH2A 3VBOA 2YBSA 5FY4A 2JG9B 3KGLA 2PELA 4AI3A 1ZVFA 4MGSA 2WZPP 2WABA 4C0HA 3EXUA 4OMDA 2YBPA 2EIEA 4GA9A 4EWAA 3PUSA 2ZGRA 3PUQA 4A7YA 2IXCA 4XIOA 3I2FA 5EPAA 5HCAA 4CVUA 4P9WA 3Q9OA 1CAVA 3IDCB 1X82A 1QGLA 1QJFA 4LEJA 1Q56A 4MXWB 2D7FA 1CAXA 3O14A 5FZIA 5J96B 1SCRA 5CISA 2YG0A 5HBAA 1FI2A 4E27A 3FMGA 2YY1A 1D4M1 2PHXA 3AMHA 4Q26A 3EHKA 3ZXKA 1JZ5A 5LRSA 1E5RA 1MS9A 3J26N 3ZYJB 4QQPA 1QH6A 1SBEA 3OYWB 4BMEA 2VY0A 4YW1A 4A6SA 5H9RA 2WJSA 1QF3A 3VBOC 2XL9A 1GZCA 2ZEZA 2ZGKA 4HXCA 4M3CE 3VHOA 4AL9A 1OKOA 1VIWB 3SQOA 2RS12 1ZZBA 3MW2A 5D8AB 1SLAA 2OKXA 2WKKA 1OHFA 1LHVA 1LESA 2WFF3 1XE8A 4P9JA 3M4FA 4MSVA 1JYVA 1V9U2 1JYXA 2HWB1 3MF6A 1NA1B 2PHTA 2D6NA 3OPZA 3SMHA 3AKRA 5CAZA 3S5AA 2NMNA 1EV12 1WCDJ 3J8F2 4BISA 1CAVB 2WS92 3LQCA
chains in the Genus database with same CATH topology
1PO22 2VU9A 5AC92 2EAKA 4Q8KA 3USUA 3RI8A 2A73B 4KGQA 1QKQA 4FPJA 1MACA 1PGL2 5GZGA 3A4UA 3NAPC 1XNBA 4RS5C 1GBGA 2GDFA 4IEWA 5C9AC 4FBFA 1J3QA 4XFCA 2B42B 3PMEA 1S0DA 2QKDA 3LKJA 1SMVA 4I3PA 4HANA 2EIGA 5ACA2 1LOBA 2HEYF 3CF6E 4I0BA 3HAGA 3UV9A 1PO12 1TNRA 3AP4A 4P14A 2DFCA 3AP7A 4LHLA 1VBD3 4QPGA 4QM9A 5BNPA 3VDDC 4KG0A 2H0VA 4GIQA 1CD3G 1WCKA 1CN1A 1MS3A 3E6DA 2JD4A 1C8M3 1NXMA 5JIAA 4WM8C 4MLOA 3RG0A 4B8EA 4LUKA 2G9GA 3WVJA 5JZGB 4CRQA 2N7GA 4Q4W2 3ZN6A 3FLPA 4YM3A 4M0NA 3GBGA 4HL0A 3MFCA 2RMU2 2GNDA 1XRUA 1RJ8A 3CJIA 5KWRA 1UZZA 3AX4A 3LOIA 4I3GA 5FAXA 1AR63 4CP2A 2SBAA 4XTPA 3VKLA 2GC0A 1MZFA 1N3QA 1H30A 1UF2C 4H7LA 3I54A 3SCFA 1D4VB 3WZ1A 2ET1A 1EPZA 1FAYA 4AVCA 3POWA 5IK7A 1RC6A 3RSJA 1LHOA 1RUI1 1F31A 1O4TA 2VOWA 1H8TB 2PAMA 5CU1A 4AQ6A 5CB7A 4AFCA 2CTVA 2JENA 3ACLA 5JVVA 3RMXA 5GALA 1RUF1 4EROA 3JZVA 1TE1B 4IXLA 1RMU2 4JAAA 4COYA 3DF0A 1RUG3 1CAWB 1DF0A 3NW4A 2GNBA 3WQ0A 4PBOA 1W2UA 3POSA 1YXWA 4JGYC 3LA3A 4D69A 1N1SA 1YFXA 1TME1 3M3EA 4I0AA 1NCQB 4EWEA 4I30A 5CIRA 4RQPA 2BBVA 3V0AA 1AUYA 2WC2A 3IN9A 3VDDA 1SLLA 4AI1A 1U5ZA 4C0BA 4NR1A 5ABJC 1WUVA 2HEWF 2DFBA 1EYBA 1VBA2 1S0CA 2WT2A 3POYA 5A32B 3USSA 4YM2A 4M01A 3PVBB 3C3VA 1SLCA 2Y26A 4QX5A 2KM2A 4XBQA 1LOFC 5KHIA 1DQ2A 4GH4C 2TNFA 2HWB3 1YWKA 1ZBE2 1W6QB 3U4XA 2WFF1 1I3HA 3O0WA 4GB32 3W58A 1LOFA 5SV8A 1X36A 3VHNA 2AGSA 2GAUA 3JCIA 4MYEA 2IWGB 1M06G 2G9FA 2JG9A 3AYCA 4B4PA 3B02A 3JQXA 4OULA 1ZRDA 1VB2A 3KCXA 4OI4A 2Z2SB 3MPPG 3AB0A 1B35B 4XFAA 2CY6A 3MLKA 2XVKA 1F2NA 1GR3A 1IS4A 1ENQA 5JSRA 1MEC1 5EYXA 5KBFA 3RJRA 4JGZC 4CDUA 4R4ZA 1FMD1 3FWEA 1ZYBA 4ISRA 5KC5A 2D3SA 2P37A 2WA4A 3MFAA 1WGPA 1O4YA 4Y1ZA 3G7DA 5C4WA 3MIBA 3ZSMA 4AI8A 2PHFA 4IEQA 4PIYA 1WW6A 4I2OA 4G9SB 1PK6A 3V64A 4EN7B 2XGXA 1JTZX 2VGDA 1A6CA 2P34A 1CJDA 2A3XA 1BBT1 1ASJ2 1OI6A 2RJKA 2EF6A 2PLV1 1YHFA 4FQZA 3PVEA 1RUJ2 5H9PA 5E16A 2E7TA 1GFF2 4OHXA 2WA3A 2ERFA 2VNOA 3EJKA 3K48A 3J8F1 3ZN6B 1I6XA 2DUPA 2DVFA 3CJIC 4U2AA 2HEVF 4IEOA 2RE9A 2QJVA 1AR83 4DOUA 1RJ7A 3D0SA 2E7AA 4MGKE 5DG1A 1ZM1A 1H2NA 2NLRA 4QT6A 1H1IA 1AR72 1FOD1 1NLSA 4XF3A 1ENXA 2AREA 3RYRA 1O5LA 3OY8A 4RA0A 2RJLA 3DGTA 1BEV1 1WW7A 4FSJA 4Q4X2 1ASJ1 4KU7A 1W6NA 2Q8OA 4A2UA 2B8MA 4TZDA 2WZR3 1OQ1A 2VNGA 1OOPA 3H3ZA 3MPBA 4LULA 2ZHNA 3LSEA 4PDWC 4D3WA 2RS13 3EBRA 2ES3A 3BCWA 1RVF1 4CTEA 1O3SA 1O4ZA 3VHPA 5I8SA 4WM7C 4CEWA 1ZZCA 4JRAA 4AEDA 3KCYA 2AH2A 4WVVA 4F8AA 1ND2B 2SLIA 1D2QA 4C91A 3V0AB 2E53A 5JI9A 3B9CA 5FTTC 2D6MA 1XNCA 3HD8B 2BNNA 1YUDA 3OY8B 4U36A 3N7JA 4RS5A 1I1EA 4QPGC 3LGRA 1QJX2 2QDRA 4XF0A 5EXOA 2UYBA 4PBPA 4AVTA 1YO8A 4IEUA 4FO9A 1PNGA 4PCRA 4QQOA 1DZRA 4PDWB 3SXWA 1W6OB 3D0JA 5FO8B 2B9UA 2WFF2 4BIOA 3M70A 1ULGA 1QJU1 2B5HA 2FMDA 4K1ZA 2ZGLA 5BNOC 2ZKLA 3FJSA 1CAXB 3OF1A 3VUOA 3OJBA 1DYPA 1H8TC 5ACA3 4AHXA 4UW4A 5KHKA 4FVVA 1MQTA 4XQWA 3GBWA 2D3RA 2HWD3 1UL9A 1GZ9A 1J59A 4Q8LA 1XYPA 5FLIA 3N3HA 2PAKA 3BU7A 3WV6A 1MZ6A 5ABJB 4DINB 1ZZ9A 2GN3A 2WL1A 5FOJB 3GYDA 1DQ1A 3KMHA 2A75A 1LULA 4PQ9A 1C8M2 1LGCA 1BQPA 2E51A 3AKSA 3RJ2X 5KXEA 1O3RA 2ZS6B 3WDYA 1FT9A 1AR93 3SHRA 4XYXA 4YZ4A 5C8WA 3TB0A 4Z92B 1MEC3 3URFA 3ECQA 2HKXA 2CYFA 4N43B 5C4WB 1IHMA 4CP1A 1KXGA 1MVEA 4JDNA 2VMHA 2ZX4A 3WP5A 4XILA 2WZR2 4KQ7A 1H9WA 4HVRA 4YARA 3VBSC 4EJRA 1AR91 1MS5A 3VBUC 4XFIA 5LK5A 5FPXA 4YRDA 1V70A 4AI2A 1OSGA 1I5ZA 2XVGA 2ILMA 1TME3 1S2BA 1YYNA 1Y43B 3IM0A 3N4MA 1C28A 5I0UA 1EPWA 4M3CB 1R1A1 5FCCA 2LM3A 3CNAA 2ZTNA 5KXCA 1UD1A 4N43A 1YIFA 2HWC2 3JD71 2Y0IA 1AL22 5EZWA 5ACA1 2R041 4BA6A 4IV3A 1LOGA 3VKFC 3KGZA 4WM7B 4IERA 3BALA 2JE9A 4LBLA 2NM1A 1QJU3 1VJ2A 3MEPA 4F3JA 2ZCWA 2D3PA 1FATA 4DRRA 1LODA 5LK7B 1D0HA 1RUG1 4R9DA 4N7UA 1PVC2 3D8CA 2LTNA 1RUF3 4H14A 1SLIA 3L9JT 4FPCA 1PGL1 2FQPA 3D6EA 1FX5A 2I07B 3AMQA 3FHIB 4N90A 5JSOA 2QVSB 1GZWA 4HVQA 1VBA3 3LB9A 1OPMA 3RI9A 4WV8A 1VAKA 2D40A 5JOYA 4Q4Y1 4Z2WA 1M4WA 4FPOB 1QHDA 2YZ4A 4PJYA 5DG2A 1SCSA 5I0SA 1OA4A 4XJ8A 4XXAA 4I02A 2TEPA 1HRI2 5CADA 1H8TA 4HZFA 3ATGA 3BOWA 1H8VA 4Y1VA 1ZBE1 2YC0A 4MX3A 4PLMA 5DZGA 1C8M1 3FFQA 4IQPA 3W9AA 1CPNA 2K9ZA 3PJQA 3CLPA 4RS5B 3R4DB 5C6CA 1VAMA 4SBVA 2P3IA 4K40A 3AKPA 3AKQA 1QQP2 4PDWA 4M0HA 1R1A2 2ARBA 2VW2A 1MS8A 1IQAA 2ZAAA 1BVP1 2D6KA 4CYDA 1AXKA 3NV1A 5K0UC 5F6LB 2HWB2 1V9U1 2PLV3 4GMP0 4RQPB 4JVAA 1XXNA 3VDDB 4AEDC 1DU3D 4CEWC 1PIV1 1IOAA 1LENA 1WD3A 2XVLA 2CL2A 4OUMA 4XE9A 3BPZA 1RUH3 5A33B 1UPIA 2PAEA 1DGLA 1N3PA 4ORFA 1HQLA 1EV13 4XFFA 5JMCA 1X8EA 4CEYC 2A5ZA 1WLWA 1ZRFA 1REFA 2R49A 4Q2FA 5DUWA 4OHWA 4SLIA 4MXVA 1ULEA 3I59B 3OD0A 2K2SA 3LSDA 3TN92 4FPLA 4KWKA 1J3RA 1UCXA 1NQJA 3FBYA 2C1FA 4YZ5A 3O12A 2CWMA 1QOOA 1OFNA 3I7DA 2BWAA 3INAA 4FPEA 2W0XA 3DPRA 5T5OA 3PLQA 4JV4A 1BYHA 2UWAA 4CZSA 3QBQA 4LBMA 3VBFA 4FAGA 1Q5OA 4P5HA 3ZFFB 4DB5A 2GC1A 3AMPA 4YG6A 1S1AA 2WINB 3ZXDA 3N7LA 5FO9B 1DQ5A 3TOJA 4Q4X3 2JG8C 5FQ0A 1NXD1 2BVBA 4QXKA 3ZIWA 1F8VA 4E4ZA 2UY8A 4E4SA 4MV2A 3H50A 5I8YA 4DFSA 4ZU7A 4X8PA 2MEV2 1AR82 4ASMB 4QQLA 1H1AA 2OPKA 3ZIXA 2PN5A 1KS5A 4K20A 5C4WC 1ND3C 4FTEA 3HBZA 1N3OA 5BNOA 2EXJA 1QJY3 2X5IC 3B94A 4FPHA 4Q1RA 4AE2A 2X29A 3AJYA 1ZZ7A 1AYN1 4Y1YA 1WCSA 4QPIC 1U0AA 1HQWA 3RS6A 4W6WA 1N1YA 3WD5A 1RHI2 2XJSA 3HQXA 3PHMA 2KXLA 3H7JA 1KQRA 2JKBA 4HFSA 2QNKA 3ZSKA 5T54A 4ATEA 3H1WA 4XJAA 5FLHA 2YYOA 4YVSB 1FXZA 1FV3A 2I74A 1AR71 3P3NA 4S2GA 2EVXA 2XBO2 4INDA 2Q5TA 2B45X 2X5IB 1BCXA 5FMOL 5FMOS 3IBMA 4ES8A 5B2GB 2DUOA 5JIUA 1CJPA 2D6PA 4WM8B 4JGZB 3JBG2 4AGGA 4I01A 4NHMA 2HWE2 2GNTA 1CR7A 2ZMLA 4LBOA 5GZEA 5JPNB 4FPFA 4RHV3 5EV7A 4E2GA 3L2HA 3FE5A 2PHUA 3GZTB 5DDJ1 1AYN2 5GLUA 2D93A 3ZO0B 1AX2A 3FZ3A 1HLCA 1KD7A 3ZSEA 5CFDB 1B09A 2JG8B 3SCGA 3VKOA 1DBNA 4URTA 3AP9A 3ZMOA 5GLVA 5FRAA 1GNZA 4NOTA 1VBD1 4FAHA 2RS32 3MZHA 1JOJA 3NV4A 4EWDA 2XLFA 4PIZA 4OFGA 2ZGQA 4D7YA 1AZDA 4KGGA 2MEV3 4QGMA 4BOWA 4XMIA 1YFUA 2CAUA 1LU2A 4YW2A 2WNUC 5GZDA 3FFZA 1PM7A 2YPJA 4DRVA 5AC93 5I93A 2OVUA 1MQTB 3RNSA 4S2FA 4BHPA 1IS3A 4AFBA 3WCRA 1K5MB 2AR6A 2PHLA 4KWJA 1REEA 1A8DA 2DCYA 4LO4B 2ZZQA 2D44A 3E5QA 1FYUA 1ZRRA 3B9IA 1QXJA 4IEPA 5BV6A 2B7YA 1G86A 1W39A 3KT1A 1A3KA 3OYWA 5BNNC 3H9AA 4BMBA 4YZ1A 3KT7A 4K6BA 4CDUC 1B35A 1FMD3 1J1LA 2AUYA 1V6OA 2DUQA 3BIWE 4AQ2A 2YMZA 2QQPA 5JCTA 1Q8VA 2XLAA 1KJRA 2PYTA 1JBCA 1SACA 3NSTA 4O9EA 4XQ4A 4LE4A 4XIKA 3R0RA 4W65A 1PGSA 2ZMNA 4XHBA 2WNVB 1H0BA 3WW1A 1LU1A 4B3NA 4GWMA 5HCBA 1DDLA 2R16A 3OD4A 2BW8A 5GLTA 3WNXA 4Z82A 4JC1A 4CDXC 1ND2A 2D43A 2XKOA 4RHV1 5LEKA 4Y1XA 2HWF2 3AMMA 2PHDA 1RUC3 1JYCA 1OFSA 3WHTA 1NCRA 4YM1A 5T50A 2HYKA 1AJKA 2OUHA 1RUI2 1QQP3 1UMZA 4DY5A 2ZMKA 2H6BA 1UKGA 1CAUA 1CX4A 2D5HA 4S2DA 1PMIA 1WA4A 3NV3A 1WD4A 3JU9A 5J37A 1OA3A 3RMYA 4L97A 2ZGSA 5CVRA 1Y9QA 1ND3A 4BCUA 4LE3A 1GYKA 4COVA 3B01A 1OQEA 1Y3TA 4OHYA 2A6VA 5D1IA 4LR4A 1MS4A 2P2KA 4P9GA 1COV3 4IEZA 4BIFA 5CFCA 2E9QA 1QJX3 1RUOA 1V6JA 1DGWX 4AVAA 5BNQA 2WT0A 3TNQA 5HI0A 3UJQA 4LO5B 3BOPA 4XBNA 4YVSC 2JG8A 4LBNA 1URXA 5DDJ2 4PLNA 5AC91 3AKTA 1XU2A 4Q29A 1LKNA 3GNEA 1UX6A 4LT5A 2NMOA 1DGRN 1MS1A 4BYYA 1DQ6A 4WBBA 1HXS3 4GH4B 3AP6A 4HLTA 4QU2A 3AYAA 5EFUA 3ZYRA 5GZFA 4RSUA 2R042 4IV1B 1KITA 2BNMA 2R32A 4LHKA 3G6JB 4HMZA 3SITA 4Y5Z0 5DUXA 2BUKA 2XBO1 2CWSA 3OGJA 2HWC1 1IPKA 3L2YA 2AZ5A 3U07A 3WW4A 3AZVA 5T5PA 1IS5A 3D5OA 3QLQA 4XHXA 4BE3A 4EV0A 1H9PA 1RUE1 4GMP1 1ZA4A 4K7JA 4AF9A 1ULCA 3MGUA 2XJRA 4R4XA 3WHUA 4HN1A 4AFDA 2TUNA 4FTBA 1S2KA 3OGGA 4E4DX 3WP3A 5I91A 1Q8OA 3B93A 4NN0A 1KS4A 4AVBA 1HRV2 1XNDA 2VW0A 5J3UA 3WQ7A 1QNWA 5L7OB 3ALQA 1NY71 4Q1PA 4YZ2A 1UIKA 3CJXA 1EV11 1G9FA 1YNAA 5C9AA 5K7PA 1MEC2 4CDQB 2XUMA 1YFYA 5JDBA 5JOXA 4L99A 3DKWA 1OD5A 1BKZA 4DY3A 2OYZA 1RHI3 1PIV3 2FZ1A 5E8AA 4A7ZA 4AYUA 1PGW2 3M3IA 2O8OA 3SNMA 4GQ7A 3WDWA 1C1FA 2QE3A 2P17A 4N9IA 1MS0A 3R6SA 2ARXA 3FLTA 5FFOC 1Z7S1 1KDKA 5L19A