1IS4A

Lactose-liganded congerin ii
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
134
structure length
134
Chain Sequence
DRAEVRNIPFKLGMYLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONGERIN II
publication title Crystal Structure of a Conger Eel Galectin (Congerin II) at 1.45 A Resolution: Implication for the Accelerated Evolution of a New Ligand-Binding Site Following Gene Duplication
pubmed doi rcsb
source organism Conger myriaster
molecule tags Sugar binding protein
total genus 27
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1is4A00
1WD3A 1UX6A 1UZZA 1MS0A 1N3OA 1UN1A 3BIWE 4XTPA 1G9DA 2A6WA 1SLCA 1YI7A 2SLIA 3FBYA 4HANA 3M2MA 5SV8A 5IT6A 1W6MB 4AGRA 1DBNA 3ILRA 1H9PA 5H9QA 4I30A 3WDWA 5HCAA 1BQPA 4P9WA 1B09A 5F9TA 2D6PA 3O12A 2ZHLA 3D4KA 2AR6A 3N3HA 3IPVB 2OUHA 2ZBJA 1DQ5A 1SCSA 4Y26A 1PZ7A 3POSA 3AZWA 1AXYA 2EXHA 2PHFA 1S0GA 2A3XA 2ZHKA 1SLBA 3M3EA 4FPYA 4M00A 4PBOA 2DVGA 2AYHA 3WUDA 2DUOA 3ZXFA 5AVAA 2JDZA 3ZSLA 4RA0A 3BODA 3OJBA 4CZSA 5T5OA 4FQ4A 2JE9A 3PVEA 2ZMNA 1PZ8A 4TYSA 2YY1A 3M3CA 3AZVA 4XYXA 3PMEA 5GLTA 5JOZA 1S0IA 1LEDA 1LOGA 1V6JA 4UW6A 1NLSA 5JOXA 2AH2A 5BYNA 1QGLA 4YW4A 5IK8A 4FOWA 4HL0A 2DTYA 4UW4A 1PZ9A 2ZGQA 1GNZA 3Q9OA 1VAMA 4F83A 1O4YA 3L2YA 4PBPA 1AJOA 1IS6A 1WW6A 4PCRA 1CVNA 3JUUA 2ES3A 1VIWB 2CNAA 1TEIA 1S0CA 2P3KA 4TZDA 1GZCA 4XMAA 2DVDA 3AYCA 3WDYA 1WD4A 2YZ4A 4XJWA 5JMCA 4Y1XA 1WW4A 2D43A 3DGTA 1QOOA 5E89A 5GLZA 3HR9A 4Y20B 5HCBA 1LHVA 2GDFA 4YGEA 1KRIA 1FYUA 2NM1A 3FFZA 1MS4A 4R9BA 3O0XA 2EF6A 2GN3A 1LJ7A 3AYAA 4Y22A 5GZFA 3VKMA 1Q8VA 1W6QA 4AGGA 3SNMA 1G9AA 1W6PB 2A7AA 3W58A 4YLZA 4FPCA 1F31A 1YRZA 5LK5A 4YZ3A 4MYEA 2E6VA 5GJ6A 2UU8A 2A3WA 2WT1A 3WCRA 4C1WA 5E8AA 4YG6A 5GZGA 2OVUA 3O0VA 2AENA 1DGLA 2RHPA 1GV9A 3ENRA 2GN7A 3WDUA 1LHOA 2VU9A 1S1AA 1WLDA 1W6NA 3ZSMA 2NMOA 2FHRA 1SFYA 4XJ8A 3WG3A 3NV1A 5CNAA 5T52A 4XXPA 2P34A 5T54A 2SBAA 4XBLA 3FUOA 3AK0A 4FPHA 5DXDA 1KDMA 1LGCA 2CL2A 2D3PA 5DG1A 3SISA 4FVVA 3T1MA 2PHTA 1CR7A 1JUIA 4GALA 1CIWA 1Q8PA 1DYKA 3RQ0A 1GZ9A 1D2SA 1GNHA 3A0NA 3ILNA 2ENRA 3DUIA 3UJQA 5F5QA 4YZ2A 1OFSA 1CESA 3MEPA 3VUOA 3V0BB 4FPEA 4AGVA 3V0AA 3RMXA 2NZ9A 5CAZA 4XHXA 1W6OB 3WHUA 4FPKA 3UL2A 4BOWA 3D6EA 3BOPA 3A4UA 1LENA 2A6XA 4GKYA 1DHKB 1Q8QA 1Z0HA 2BQPA 2JKBA 1MACA 3APBA 3SH4A 2R49A 2ZGPA 3AFKA 4Y1VA 3ZXLA 1IOAA 4SLIA 3V65A 2E51A 1F5FA 4U36A 5GZDA 1SLLA 4DQAA 5T55A 1W6MA 1I1EA 1YO8A 1NXD1 2PELA 1LESA 2WKKA 2VY0A 4FOVA 1X50A 5FRAA 1OKQA 2B7YA 2CYFA 3IPVA 3NV3A 3WG4A 1QMJA 4YW3A 4Y1UA 4GXLA 3QCWA 1CN1A 1JBCA 2DV9A 1O4ZA 1H9WA 2DVAA 3ASIA 5T50A 4OZXA 1WCSA 4ITCA 2P37A 1LOBA 5T5LA 1D0HA 1HLCA 2P3IA 3HMYA 2A3YA 1DFQA 2H0BA 1AJKA 2D6OX 2YV8A 3D5OA 3USUB 1QDOA 4XBNA 2LTNA 3GNEA 3WV6A 1UPSA 2E7QA 3KM5A 2ZGKA 2ZMLA 3FLTA 4CTEA 5EWSA 1KITA 1G7YA 2ZGTA 2ZAAA 1DLLA 3N36A 4M3CF 4AVTA 2GNDA 2GNMA 4P9XA 2D44A 5H9RA 2AREA 3VV1A 3WNXA 1AXZA 2CWMA 1V00A 2TEPA 3V64A 1FNZA 2GNTA 4PF5A 4WV8A 1LECA 5E88A 3RG0A 1G9FA 2GMPA 2A5ZA 2A70A 2EXJA 1KJRA 1GSLA 3WUCA 1F9KA 4YGBA 4ZXKA 1AF9A 2E53A 1DQ4A 2A75A 1S0EA 4XMIA 1ZM1A 4LBOA 1JYIA 2PHUA 3WHTA 1QF3A 1XQNA 1AZDA 1V6OA 1HKDA 1W0OA 2R1BA 4BPZA 4DPNA 1SACA 4KBBA 4ATFA 4YZ4A 4Q8KA 4YM1A 2VW2A 4K21A 5JDBA 1MS8A 2A6ZA 3SLIA 1QNWA 4FPLA 5GALA 4YM3A 2GMMA 3FUQA 4Y20A 1C4RA 3AZXA 4GWMA 4XJAA 3WOGA 2W39A 3MW2A 1DQ1A 5CA6A 1IS3A 3AJYA 5DUXA 5T5JA 3AJZA 3OYWB 2ZGNA 5H9SA 1V6NA 3IM0A 1QDCA 1MS9A 2EALA 4LBQA 4R9DA 1KDKA 3R4SA 4LBQD 1W6PA 4JRAA 2D6KA 3AYDA 4BMEA 3HN1A 3JU9A 1MS3A 4Q27A 4AVVA 1UMZA 4Q2FA 1GANA 2DTWA 4JCKA 4Z8BA 4DRRA 1ULDA 4Y1ZA 5T5PA 4LBNA 1G9BA 2WNEA 4XBQA 1ZA4A 2DYCA 4P9YA 4XOGA 1N3QA 4Y24A 1SLTA 1RINA 3SH5A 1FX5A 3WLUA 5IK7A 4LBLA 2CWSA 3NWKA 1CONA 5DZGA 3OBRA 2WJSA 5H9PA 3ZYPA 5CBLA 4BQ1A 5CB7A 1V6LA 1DQ0A 2ZHNA 5EXOA 2FMDA 2ZMKA 4XE9A 1CQ9A 5L73A 1JXNA 1GICA 2DU1A 2I2SA 1LOEA 2GMEA 2YMZA 1WBFA 3WDVA 3AZYA 1ENRA 3PJQA 3VKNA 1MS1A 5DUUA 4YM2A 1LGBA 3AP7A 2Q5TA 2CY6A 1ULFA 2EIGA 2ZKNA 3R05A 2ZGUA 2V73A 4K1ZA 1CPNA 4YM0A 1Q8SA 5KXBA 1Z78A 2JJ6A 1LULA 3R4UA 1DQ6A 3V0BA 2UURA 4H55A 3M3OA 3M3QA 1IS5A 5GZCA 1Q56A 1W6OA 5DG2A 2ARBA 2WT0A 3WDXA 2DURA 5HCFA 3A0KA 3OY8B 4LBKA 2JE7A 2VXRA 4Q26A 2PHWA 4YG0A 1LHUA 1SBEA 1CPMA 4ATEA 1QOSA 2DUQA 5JOWA 2D6MA 3AYEA 2R0FA 1W6QB 1G86A 3ZSKA 3C2UA 1IKQA 1KJLA 4XXAA 1S0JA 3TB0A 1SCRA 2XB6C 2C9AA 2E7TA 4CRQA 2DUPA 2OW4A 1HQLA 2D3RA 4R9AA 1YXWA 3T2TA 4FPFA 4FPJA 4M3CB 3W59A 3ZPYA 3WZ1A 2JD4A 3NV2A 1ONAA 2ARXA 1LCLA 1GKBA 1LU1A 2A71A 2D6NA 4K20A 4Q1PA 4W65A 1W6NB 1DIWA 2G4IA 4WVVA 4DS0A 2EAKA 2ZZJA 1VALA 1S0DA 1N3PA 2WSUA 3M1HA 3H0OA 3LCPA 3MW4A 3RMYA 1DQ2A 3AXDA 3POWA 4AWDA 1W0PA 3WG2A 4D69A 4BM8A 3TAYA 1LODA 1KQRA 3AXEA 3OBTA 1A3KA 1DZQA 4NO4A 1JYCA 1HQWA 2UWCA 5EYXA 2R1DA 1JN2P 1SLIA 2KM2A 5DZEA 1AX1A 1S0FA 2NP0A 1FV3A 3MW3A 5GLVA 2JECA 1WW7A 1N47A 1N1TA 1UZYA 2AGSA 2NYYA 1DYPA 3ILFA 1WW5A 4XTMA 1MZ6A 1JOJA 4UW5A 3N7MA 4FP3A 2VW0A 3B69A 2EXKA 2XG3A 1S0BA 3I8TA 2ERFA 1ENSA 3AP4A 3T1LA 4XJUA 1LEMA 1V6MA 1UKGA 1WLWA 4BLJA 1I3HA 1GBGA 4DFSA 1OQ1A 3FLPA 1GZWB 1U0AA 3OYWA 1LTEA 3PVNA 5GZEA 5KXEA 3AP5A 1IS4A 4GKXA 1FAYA 2WQZC 2NMNA 4FPGA 1A78A 1LOFA 5DUWA 1LU2A 2VUAA 2CTVA 4XIOA 1QU0A 3RS6A 1BKZA 1N1YA 2LALA 4Q1RA 1ULGA 2DVBA 2WSVA 3FLRA 1N1VA 1VAVA 3GALA 4R9CA 5IK4A 4BMBA 1SBFA 2UWBA 1BJQA 1WLCA 1C57A 1R1ZA 4ISRA 1JHNA 1CJPA 2Z42A 1V6KA 2P3JA 3LSDA 1LOFC 4L8QA 1Q8OA 1Y7BA 1LOAA 4RL7A 5GLWA 1URXA 3VKFC 2C5DA 2HYKA 2WLQA 2V5YA 3I4IA 4YGCA 5GLUA 5FREA 3B3QE 2ZGLA 3WVJA 2W08A 2D6LX 4M3CE 1QNYA 3AZZA 4FPOB 4XDQA 2VW1A 1ULCA 1SLAA 1EPWA 3ZSJA 2DWRA 1FNYA 3B9CA 2PHRA 1N1SA 4FQZA 3N7JA 3VKOA 4P14A 1G8WA 1BZWA 1WBLA 2DU0A 2P2KA 1MZ5A 2VH9A 4AYUA 4DRVA 2ZABA 2ZGOA 4XHBA 1MR5A 4WVWA 3ZYRA 3PVOA 2YROA 3SITA 3OY8A 1FATA 3N35A 4JC1A 1AVBA 3CNAA 3OPZA 4LBJA 4YW5A 3O5SA 3U4XA 3N7LA 4WZFA 1LHNA 3AP6A 3AX4A 3UJOA 4FOYA 2W52A 3ZXJA 2NN8A 2PHXA 3NV4A 1G9CA 3BTAA 2ZHMA 4GA9A 1V6IA 4YW1A 3IMNA 4LBQB 2D3SA 1ULEA 2DVFA 4XJ9A 1AX2A 4ZKTB 1VLNA 1C1FA 1GYKA 4BLIA 3IKWA 1C1LA 2AUYA 2EXIA 1APNA 1LGNA 3B01A 1JW6A 1SBDA 2A6YA 4K1YA 1WUVA 4ASMB 3INAA 5JOYA 4M3CA 4XJZA 4Q8LA 5KXDA 1UL9A 3ZVXA 3POYA 3QLQA 3MPPG 3ZXEA 1RIRA 1MVEA 5IK5A 1IKPA 1ENQA 4IQPA 4NOTA 4Y22B 2R16A 4XZPA 5JLVA 1J1TA 3N7KA 2A6VA 2R0HA 4YFZA 4PQ9A 4YW2A 3O0WA 4YG3A 1MVQA 4XILA 4Y1YA 1LHWA 3RRDA 3RSJA 2ZGSA 1AX0A 2ZA9A 3SH3A 1H30A 1YYNA 4UW3A 5IUQA 2YXSA 5GM0A 3WDTA 4YGDA 2ZGRA 1QKQA 1RITA 3WG1A 3USUA 3VKLA 3OGGA 3ZXKA 2GALA 4LBMA 4YFWA 4FP2A 4GWNA 3WCSA 4YZ5A 1UAIA 3KQRA 4C1XA 1A8DA 3LSEA 1MS5A 5EYYA 3ATGA 1QOTA 5KXCA 1BYHA 3B00A 2W68A 3IN9A 4FOQA 5JVVA 1GZWA 5DZFA 1LOCA 1BXHA 2GNBA 2OUJA 3AP9A 1FV2A 5DUVA 3V0AB 1YIFA 1GLHA 2D7FA 4M01A 4AVSA 4U2AA 2ZGMA 1AXKA 2ZACA 3UK9A 4ISQA 2WT2A 4XIKA 2UWAA 1HDKA 4YZ1A
chains in the Genus database with same CATH superfamily
4TXWA 5G04L 1UZZA 3UGGA 1ASJ1 1MS0A 1N3OA 1RTVA 1G9DA 2A6WA 2QQWA 1SLCA 1YI7A 2VL4A 3AKRA 3FBYA 4HANA 5FZBA 1OQEA 4HPKA 1W6MB 5B4XA 5AC93 3WDWA 5ACA2 4N9HA 4KWLA 4RHV1 5FZLA 1YUDA 5F9TA 4IEUA 1H6XA 4AI2A 1DQ5A 4QX3A 5FYVA 5FY0A 5A33B 2HWC2 4CP0A 1AXYA 4QXBA 5CKNA 2RR11 3AMPA 2IXJA 1S0GA 2FMYA 4XF0A 4LO5B 3OBAA 2AZ5A 1YFXA 4Q0QA 4R4ZA 2DVGA 3WUDA 1UF2C 4JTNA 5A7WA 4CCMA 2WNVB 4QPGA 4D7SA 1SEFA 5T5OA 5A1LA 3ZR5A 3RZKA 3C7FA 4HK8A 4FCAA 1RUE3 2ILMA 1HB4A 4FXKB 5DPNA 5JI7A 3TEYA 4XF4A 4RQPB 1NLSA 2P3YA 4OUMA 3DEMA 5JR2A 1QGLA 1UZVA 5IK8A 4HL0A 3LA2A 2Y6JA 3H42B 4QAWA 5ANNA 2FQPA 1ENXA 2ZGQA 1R1A1 3Q9OA 2R063 1KGYA 3DYPA 3UGHA 1IS6A 1WW6A 4IEXA 3JUUA 2GU9A 5F32A 2JEMA 4TLFA 2CNAA 5J09A 2XLGA 3ZFGA 5KWRA 5FZEA 2DVDA 2IZWA 3POJA 1YLLA 2YC2A 4XJWA 4PDWB 1W0NA 2BRTA 4FAGA 1QOOA 1TG7A 5E89A 3IAQA 1NA1A 1CJDA 1QJY2 2JDKA 4Z07A 1KRIA 2NM1A 2PHLA 3FFZA 3NNFA 5FY9A 4D3WA 1K5MB 2GAUA 2J1EA 4QKDA 4Y22A 1V9U3 4R8HA 2BV4A 5A3OA 2ET7A 5FCCA 1W6QA 1AL23 3H8OA 1ZNPA 1V70A 4HOOA 3W58A 4XUNA 1NLRA 5LK5A 1K12A 3PU8A 3OGJA 4B3NA 2OQ7A 3M70A 4MGKE 3B02A 4YG6A 2AENA 1ULPA 3M8LA 1DGLA 1JYXA 3ENRA 2GN7A 4M4PA 4N9IA 4Y5Z0 5FZ1A 3WDUA 1S1AA 3HJRA 3VD4A 2DDUA 1W6NA 1QEXA 2OIIA 1SFYA 2PLV1 2CGPA 2X29A 5EJZB 2HBTA 4XJ8A 4L9BA 4CUCA 1WMFA 1K45A 2G1MA 3NV1A 5T52A 3VBSC 5ISLA 3J26N 3JZVA 4G9SB 4UBGA 4BQ3A 1NKGA 2HJIA 5T54A 4D6SA 3KGZA 4EZHA 3FUOA 5FP9A 1KDMA 4QXKA 2CL2A 2D3PA 3SISA 5EPAA 1C8M3 5A7OA 5J36A 5J7MA 3HT1A 2ZXQA 1CIWA 4PIYA 1PVC2 1D0GA 1Q8PA 4BISA 2HWB2 1XYPA 5FYCA 2VGDA 4AR2A 1GNHA 2VZRA 3FWEA 1O8PA 2IVJA 1QJU1 2RM23 4YZ2A 1YHFA 3Q8BA 3VUOA 1UYPA 2V4VA 5E16A 3IBMA 1WA6X 2VQAA 2VVEA 5L19A 3T0BA 5C9AA 1W6OB 4DZGA 3MV11 3UL2A 4URAA 3D6EA 1R093 3A4UA 3BOPA 1LENA 1YQ5A 1X9PA 3VBHB 3NAPC 1DHKB 1GMMA 3VBOC 3SH4A 2XJPA 1NCRC 3AL6A 1RUH3 4CDWC 5C3QA 3MZHA 3FFQA 3TEWA 3AFKA 4Y1VA 4PT6A 1GUIA 2AEYA 3G6JB 1AR93 3V65A 1F5FA 3VL8A 5JZGC 4M0HA 1W6MA 3VHPA 2EA7A 1YO8A 1NXD1 2WKKA 2VY0A 1GFF2 1ASJ3 1H4GA 3POGA 4FOVA 1QJEA 4XQDA 3DPRB 1NOVA 3O1RA 2WFF1 5A33A 1CX1A 3LFMA 1M06G 2XOMA 4YW3A 2VMFA 2HWE1 3GBFA 3QCWA 5FYSA 1CN1A 1XRUA 1PO12 3EYPA 3FE5A 1HV1A 2CGNA 2DVAA 3ASIA 4RHV3 4EN7B 2VZQA 3MIHA 5T5LA 4RSUA 3VZNA 1DFQA 3VBUB 2H0BA 2DFCA 2D6OX 3USUB 5F6KA 5FO9B 2LM3A 2LTNA 3WV6A 1UPSA 2RR13 1AUYA 2ZGKA 2ZMLA 4QPIC 4COYA 2XLFA 5EWSA 1KITA 4CYDA 1G7YA 4RQPA 1XNKA 1JUHA 4A45A 2HWF1 2GNMA 2D44A 4D8MA 1AXZA 2CWMA 1V00A 2TEPA 4QKBA 4DXSA 2XLAA 1G9FA 4QT6A 4KBZA 2EXJA 1NCQC 4QX5A 4GQ7A 1HN1A 4ZXKA 2E53A 3A23A 4NAMA 4S2FA 3FMGA 1HX6A 2JB8A 4XMIA 1ZM1A 4E9KA 2R7EB 3NL1A 2XVGA 1WLTA 4LBOA 4DEQA 3BCWA 1QF3A 3SMHA 4DMIA 3WNNA 1AZDA 2R1BA 1HKDA 5C3RA 4XUQA 5J3UA 1JZ7A 1SACA 2OPKA 4Q4V3 4XAEA 4YZ4A 1E5RA 3HEIA 4K21A 2BOIA 1GWLA 4PDWA 2YU2A 1H8VA 2ID4A 4PLOA 4RYDA 2E31A 3GZAA 3WOGA 1PGL2 2RS12 3H1MA 4Y5SA 3MW2A 1UW8A 5CA6A 5F5CA 1RC6A 4Y3OA 5DUXA 5T5JA 1PGSA 3AJZA 2BDRA 4F7ZA 2FDGA 1K5MA 3OTFA 2HLEA 3M4FA 1V6NA 4LBQA 3CF6E 2OA2A 5FPVA 1B35B 4LBQD 5LA1A 1U5XA 4QM9A 2LUWA 1PNFA 1HQNA 2UY9A 3VGIA 5IVJA 2C26A 4PLMA 1W28A 3RVHA 2VO5A 3H1YA 1ZA4A 3KS7A 4XOGA 5J98B 1Q3EA 1V0AA 1ZRFA 1VJ2A 2W1QA 5FYTA 4I3PA 1CONA 2QDNA 5A70A 1QHDA 5CEHA 5CBLA 2XKOA 3AB0A 3POFA 5FIXA 2ZHNA 5EXOA 5DDJ2 2XJQA 4QKFA 4AVAA 1JXNA 2I2SA 4A6SA 2CAUA 3WDVA 3AZYA 2ORXA 4XUOA 4EROA 1ENRA 3T4HB 3PJQA 4AXOA 3LAGA 5C8CB 5HV4A 1DDLA 1REFA 2PLV3 1H8TC 4JQRA 3VB9A 4YM2A 1RUC2 4JAAA 4NIIA 4Q0PA 1HXS1 5C33A 2BERA 2EIGA 4P9IA 3MIEA 3VBFC 3R05A 1RUNA 4LO6B 1REDA 4BE3A 3Q8AA 5KXBA 3R4UA 2UURA 4DXZA 4JKLA 1XNAA 4QXCA 3M3QA 1HB3A 1SDWA 1AR81 1UOJA 2CDPA 4LO4B 1W6OA 3RJ2X 1VBC1 4CEWA 2ARBA 3CO2A 5F3GA 1QH6A 2FBEA 2R32A 3OY8B 4XF3A 3TRSB 3VBHA 4XW3A 2JE7A 3J9SA 1ZRRA 4KU7A 3MIFA 4QPWA 3H1WA 4K8FA 4F3JA 4OI2A 5JWPA 2XQRA 3UKNA 1OA3A 5FXZA 2WS91 4ATEA 1CPMA 4CP9B 3ST7A 4RR3B 3UETA 2D6MA 3JD71 4MXVA 4A7ZA 5FZCA 2O1QA 5FXWA 1G86A 2JE8A 3DPRA 1S0JA 2XB6C 2C9AA 2XJRA 2OW4A 4R9AA 1RUI1 3NNLA 2JD9A 4M3CB 3W59A 1HRI1 1AYN2 1IGOA 3WP4A 4OUEA 4RS5C 2WFF3 2OXBA 1FPN2 4K20A 3VBUA 2RVAA 3OGRA 4AF9A 2HWE3 2XDVA 4MADA 1FOD2 3ZYFA 4YVWA 2P4EA 2EAKA 4LEJA 1AR71 5G05L 4WM7B 3W5MA 4MO3M 3TOJA 2FD8A 4CDUC 2IXKA 3M3IA 1H2LA 3FHIB 3LB9A 1DQ2A 4Q4Y2 4YYOA 3RMYA 2AEZA 4DXTA 3TAYA 1LODA 4NAOA 4HT1T 2UWCA 4IE7A 5A6ZA 3HNYM 1JN2P 2VOXA 4FFFA 2Y8KA 1VBE3 5DZEA 1S0FA 5TSWA 1FV3A 2BW8A 2NYYA 2AGSA 4AI9A 2A1XA 1JOJA 2ZX1A 2ZEZA 1I5PA 4UW5A 4ES9A 5FP4A 4W6WA 5CFDC 5LBEA 5FTTC 3JBG2 4KG0A 2EIDA 3I3MA 3BGAA 1S0BA 2Y34A 1QIQA 1ENSA 4D6QA 3DF0A 2CHHA 3T1LA 2GH8A 2C4XA 4I0AA 4P02B 5JUVA 2Q8CA 1GBGA 5T3NA 1OQ1A 5DABA 4I2OA 1BBT1 1GZWB 5L7OB 5EQUA 4D7YA 3PVNA 3JB8A 4BK4A 4CU9A 2HKXA 2QKDA 2WQZC 2EIEA 4DNYA 1A78A 4QU1A 4MXWB 3RZMA 5F2WA 3BU0A 3VZLA 4KGQA 3I2HA 3K75B 5E1RA 3LA7A 3NMBA 1M4WA 4AE2A 4Z2WA 4UFIA 2HEVF 2DVBA 2WSVA 3LFIA 3S5AA 1VAVA 2C1FA 4FFGA 4LXLA 2PQSA 2DF7A 2PYTA 2UWBA 5A32B 3VDDC 1WLCA 3DCQA 4AK3A 1PO21 1JYNA 1R1ZA 2X53S 4GIQA 4PF1A 2XVLA 2W1WA 1QJFA 2BYVE 2VOVA 4RL7A 4LQRA 4XACA 1LOAA 3A7QA 5GLWA 4HSJA 4CCDA 4KWJA 1ALYA 3VKFC 2C5DA 3KCXA 2E63A 1AHSA 4RGGA 5DMYA 4I09A 3T0DA 1RHI1 5F5IA 5FREA 2W2IA 4MGSA 5C8CA 1W8HA 5BY5A 1EP0A 3CJXA 1ODNA 3S6PA 1QY4A 3WVJA 3O1TA 4FTBA 2D6LX 2R041 5BNPA 1POQA 3BOWA 4MV2A 3SKVA 5I0UA 2WNOA 5FZ3A 3EXUA 1UYZA 1PIV1 2QQIA 4MGYE 4ZS3A 2B46X 1UXZA 3I2FA 5FAXA 3IZOA 3N7JA 3VKOA 4IGOA 1VPHA 1MZ5A 4LTAA 1RUF2 2DFBA 4IE4A 4XHBA 2YROA 1PK6C 3OY8A 4JGZB 1HN0A 1UO9A 3N35A 3USSA 1GU3A 1T6BX 1J59A 2YFZA 1I9RA 4WZFA 1DYOA 4BXSV 4FOYA 3TN92 4AEDB 4CP9A 2PHXA 3HIFA 4RR3A 4BWOA 2ZHMA 5APAA 5FOBB 2ARAA 4CP2A 4XJ9A 1AX2A 2H0VA 2WNUC 2WN2A 2AUYA 5F6LB 1APNA 2HWD1 1SFNA 2WS93 4JVAA 3LWCA 4IEQA 1JW6A 1SBDA 4GULA 4JDNA 3WINE 4Q5OA 3JD73 5JOYA 3N9OA 4M3CA 1AR62 1R082 1UL9A 4Q0UA 2IFWA 3MPPG 4N7IA 4OHYA 1IKPA 1W39A 2OT7A 1RUI3 2XJTA 4XZPA 5JIAA 3U0ZA 3N7KA 1X9TA 4MX3A 1HRI3 4QHOA 1ZRDA 4YW2A 4CDQA 3N9MA 4L92A 3GZUC 4WM7A 1H1IA 4YG3A 3WP5A 3SC7X 4Q4W2 1LHWA 3J8F2 2FZ2A 3OPTA 2ZA9A 5KHJA 2CGOA 1ZREA 3WDTA 1AR73 2JXAA 2RMU2 2LW8A 3AMHA 3NVCA 3PURA 1XOYA 1QKQA 1VBB1 3ROUA 2F4PA 3VKLA 3ZXKA 2Z2SB 4LBMA 5FZ4A 1PHMA 1S2BA 1WCDJ 4GWNA 4LKEA 4CEYB 1HJFA 5LBCA 3WP3A 3KF3A 5L9BA 1NG0A 4A6OA 1ZX5A 4HXCA 1JZ6A 3SCFA 4HN1A 4JGYB 3ATGA 4JRLA 4AHWA 1QWRA 2H6CA 3B00A 3PU3A 3SKJE 3WX5A 5IHRA 2W68A 1BLZA 4LHKA 1UWWA 1NUKA 1UXXX 5JVVA 5A80A 1GZWA 4NHKA 5ANQA 3CJIA 4IEOA 5JXIA 3H8XA 3FC0A 1PMHX 1OD3A 2GNBA 3GYDA 4M01A 4A2UA 4MXWA 4AVSA 2PN5A 4CCJA 4CU7A 2ZGMA 2ZACA 5FBZA 1CZVA 3UK9A 1RVF1 4ISQA 4FTSA 1BBT3 3TYJA 2UWAA 1HDKA 3I4IA 4XTPA 3MICA 3BIWE 3WF2A 2BVBA 2QQMA 3WT3A 3ZXGA 4E8DA 1JODA 2SLIA 3ZMNA 5A32A 1QXRA 5K8SA 2VMCA 4O9EA 2DCZA 3CL1A 4QPYA 1MQTA 2JB4A 4P9WA 4COWA 1RUG2 2P6CA 3WNMA 5FKCA 4YWAA 3TEXA 2AR6A 3UESA 4QGNA 4QX7A 1ZZ9A 2A73B 3GBGA 4QKNA 1PO23 2FDJA 4IETA 2JG8C 4RFT0 1HRV1 5ABJB 4X6RB 1H2MA 2EXHA 2RJ2A 2CV6A 1TNFA 4MVTA 2ZHKA 3SCGA 3ZMOA 5BV6A 5FLIA 1SLBA 3M3EA 4FPYA 3LDKA 2RS52 3NW4A 4KU8A 4AI1A 2ZX2A 5CFCA 3U11A 2JDZA 4XC9A 3ZSLA 1SHWB 4ZPIA 1U5IA 4RA0A 3OJBA 1EAH1 2JE9A 2XBO1 4TYSA 2JICA 2VOTA 3J7LA 1AL0G 4LIVA 4ES8A 3AZVA 4XYXA 3VZMA 5JOZA 1BMV2 4IV3C 1LEDA 2R043 1V6JA 3PHMA 5FP8A 5JOXA 2P5BA 4YW4A 1PIV3 1RUJ1 2KA3A 2JX9A 1VAKA 4AEJA 4JGZA 5I8SA 1MEC1 2CSGA 1YFYA 3D82A 3KV4A 3Q8FA 2ZOEB 3L2YA 1F5JA 2ZAHA 4FFHA 4AEDA 2YYOA 1VIWB 3OBZA 2GH2A 4GZ9A 4OI1A 3ALQA 4LE3A 3OUJA 1GZCA 3NQHA 2WUHA 3GCWA 2YC0A 1ZYBA 4LKSA 5FWEA 5IVBA 1O3QA 4CCOA 3WDYA 1WD4A 4XETA 3I3EA 4A44A 2J1AA 3GM8A 1WW4A 2D93A 2Y33A 2D43A 1IQDC 3IIIA 4Y20B 4HZFA 5HCBA 4E4ZA 1LHVA 2GDFA 3HAGA 3B7MA 3OF1A 4YGEA 5KHGA 5FZFA 1YI9A 1QQP3 1MS4A 1W90A 2HWD3 4R9BA 1OVPA 2EF6A 4ZHNA 1NY71 1REEA 2QE3A 4ZU5A 3VKMA 4D0QA 2VNVA 2P17A 1UY2A 3P1IA 4XFHA 3ZFGC 4AGGA 4BH9A 1VB4A 4N43B 2RG4A 1TMF2 4FPCA 2PHDA 3E97A 2E6VA 3MGUA 5GJ6A 2UU8A 2A3WA 4B1LA 3EQEA 2QCSB 5GZGA 5C6CA 4K3UA 5J37A 5ACA1 1GV9A 3WXPA 2WO1A 2G9GA 2VU9A 3ORJA 4BQ4A 5FUIA 1WLDA 4J6GA 2NMOA 2HWC1 1XNTA 5LRSA 4AVCA 2OX0A 4HMZA 4OHZA 5CIRA 1OLMA 5FFOC 3GHNA 1TME2 4LNVA 4OVEA 1JHJA 1EV12 2WLPA 1VBB3 3AK0A 4FPHA 1UMHA 5DXDA 3MF6A 3T1MA 3ACHA 4JGYA 3LZZA 2DCYA 3HQRA 1KEXA 2ZZQA 2TNFA 4HKWA 5FZ7A 1I5ZA 3ZFEB 1CIYA 2R30A 3RQ0A 4ZONA 4CPBD 1DLCA 5AC92 3A0NA 4IEZA 4NR1A 4Y4YA 1VRH1 4W8JA 1FT9A 5F5QA 2W0XA 1KFUL 1OFSA 2VUCA 3MEPA 3ZFFB 2HEYF 4A3ZA 3V0BB 4FPEA 4XFIA 5FYZA 2XGXA 4XFAA 1O3SA 4HONA 4LPLA 5CAZA 1GOHA 1H4HA 1YJKA 5LEJA 1A6CA 1BEV3 3DN7A 4FPKA 1NZIA 1OPMA 2JENA 2MPFA 4CU8A 2N7GA 2X10A 3VLBB 1J83A 1UOFA 2A6XA 3T08A 4GKYA 1Q8QA 1Z0HA 3CZUA 4E27A 4QQ2A 3KV6A 4LULA 3ZXLA 3IAPA 3MFAA 2P6HA 4M4RA 4EE2A 3N9NA 3ITQA 3MLLA 1BK0A 4LOTA 4MGIE 5T55A 4AFDA 1U5YA 2PELA 2TUNA 3Q8CA 3JQWA 3S0MA 4QDRA 1D7PM 2CYFA 2VD7A 5C9AC 1OH4A 4S2HA 1UU6A 2W94A 2BNOA 1RMU2 4Y1UA 2XUMA 1LAJA 1W8FA 5ABJA 3D0JA 3E1F1 3LPGA 4NWVA 3UV9A 4AI8A 1KXGA 1LOBA 2R062 2P3IA 1HLCA 3HMYA 5FZAA 3RWKX 5FP7A 1OF4A 3ETPA 3MYXA 1W2AX 1HRV3 4XBNA 5A1AA 4KGGA 2E7QA 4KWUA 1YQ2A 4GAZA 5C4WC 2X09A 1T6GC 4IEYA 4RN5A 5FYHA 1PVXA 5FQ0B 5FBJA 2G19A 4NPLA 1H2KA 5H9RA 3WNXA 1EAH3 1OPOA 3H7JA 2XBO3 3VV1A 4AEKA 2VCAA 5FP3A 4GH4B 4AW7A 2A5ZA 1NXMA 1KJRA 4GWJA 1F9KA 4YGBA 5CVRA 1AF9A 1RUJ3 4DIQA 4E2GA 2B5HA 1AL22 4W50A 1MEC3 4QB2A 4RQPC 4AAXA 4BPZA 2VULA 2WZEA 2XL7A 3KF5A 4QM8A 2Y6GA 2ZEXA 4KBBA 1ND2C 1PVC1 4ATFA 2HWB1 4N7UA 4YM1A 5JDBA 2B8MA 1UKRA 4COUA 2VNGA 1W3VA 5GALA 4YM3A 1X36A 4Y20A 1ZZ6A 4Q4X2 4IERA 3SQOA 4LHNA 5CYYA 4ZZ8A 2VTXJ 5FZOA 5JSRA 1MS9A 3T3YA 4LMFA 1F4AA 5FJKA 5LBFA 5C5UA 3PUAA 4N43A 2D6KA 3AYDA 4B8EA 4OULA 3JU9A 1MS3A 4Q27A 4XZUG 1UMZA 1GANA 1L7LA 4R52A 3VHOA 3T4VA 3ZLIA 1ULDA 4Y1ZA 3V56A 4LBNA 5LWBA 1ND3C 1YFWA 2DYCA 1OF3A 4B4RA 5HPOA 1SLTA 3SH5A 1EUTA 1FX5A 3P3NA 3KHCA 4ZXEA 4LBLA 3LEMA 3NWKA 4O7XA 5A7SA 3OBRA 4IV1A 3N9LA 5H9PA 5CB7A 4XFGA 1V6LA 3Q8EA 1PO11 1OT5A 2FMDA 4XE9A 4DY5A 2BFUS 5ACA3 3K46A 4YVSC 1XYNA 2GMEA 4O9GA 2AACA 1S55A 2VECA 4IESA 3S57A 2HWC3 1RUH2 4LKFA 4XF1A 1CWPA 3VKNA 3PIJA 1MS1A 2BOJA 1NAEA 3ZR6A 5DUUA 3C8XA 2MEV3 5JPNB 5KC5A 1LGBA 2BBVA 3RYKA 2Q5TA 2CY6A 3ZFEA 1ULFA 5K4LA 2PQQA 4CCNA 4D6RA 2ZKNA 2ZGUA 2Y6KA 3U4SA 3LPFA 4XCAA 1OI6A 4YM0A 1S4CA 2JJ6A 2YBKA 1LULA 1SG3A 3PUHA 1JZ3A 5DAQA 4NPRA 4DB5A 3V0BA 2VBBA 3JXSA 5AFEA 5FY7A 1VRH3 4DUVA 2ZX3A 1ZZCA 3WD5A 3GXUA 1ULOA 4QB6A 1K3IA 1LHUA 4UFHA 1J1LA 1RUD3 1SBEA 4JKKA 2VE1A 3VDDB 4GB32 2DUQA 1CZTA 1F35A 4YW7A 5JOWA 4HKLA 3RDIA 1YNAA 4BDVB 1COV1 3WW4A 4LJHA 1CAVB 2VXJA 4META 3ZSKA 4P08A 1J3RA 4CEWC 1IKQA 4XXAA 3TB0A 4AQ6A 2MNGA 3VBSB 2E7TA 2VMGA 2D3RA 1YXWA 3T2TA 3VD5A 1JYVA 2BGPA 1D4M1 2I74A 1LU1A 3I54A 4K7JA 3THTA 1X8MA 5F5AA 3WR0A 2RJKA 1DIWA 4A4AA 2GP3A 2XMLA 5J96B 3CU7A 3WW1A 4C91A 3D0SA 3DPRC 2Y6HA 1UY1A 2ZZJA 1W04A 5D1IA 5ERLA 1SDDB 3POEA 1OVSA 4Q4V2 4FFIA 3ZO0B 3H0OA 3AM2A 3MW4A 4HVRA 5BNOC 3N4MA 3POWA 5FZMA 1PNGA 4GH4A 3NAPB 4D69A 3VBOB 1XC6A 1ZZ8A 1KQRA 1NCRB 1H2NA 1A3KA 2ARCA 3U37A 4CDWB 1PX3A 1JYCA 2XL9A 1HQWA 5DDJ1 1W8TA 3S7IA 2WNVA 4KMQA 4B4PA 4CXXA 2VZ3A 1SLIA 1W05A 3A21A 5C71A 5JZGB 1AX1A 5IVVA 3KGLA 3UKVA 4N53B 3NKTA 4YVWC 5J1XA 2JECA 1WW7A 3AKSA 4YPJA 2YU1A 1DYPA 1WW5A 2W95A 3IDEA 3W9AA 1MZ6A 2J1TA 5I0TA 4BCUA 3WQBA 4YARA 3W20A 2WDBA 4FP3A 5EJ3A 2XG3A 4PIXA 5FY8A 1L7RA 3I8TA 4LUMA 4IEPA 5BNNC 1XU2A 4LHLA 3WQ1A 1XXNA 4EN6B 3HD8B 3KT1A 5BPXA 4XF9A 1I3HA 3I3BA 2QZ3A 3QBQA 3FLPA 3T0AA 2J7MA 4Z82A 1KD7A 4WVMB 1FAYA 2NMNA 1JMUB 1LOFA 1R1A3 4QPIB 2VUAA 2ZEWA 1QU0A 3W21A 3ECQA 4OUSA 1UIJA 4Q1RA 1N1VA 1UMIA 5JAXA 3GALA 1F8VA 2IXCA 4N8MA 4G3YC 2HYXA 5I0RA 1HB1A 5LASA 1LKNA 3PUSA 3WF4A 1E5IA 4P5YA 4ISRA 1JHNA 5B2GB 3LSDA 2QNKA 2P3JA 2BU9A 1O3RA 4UT5A 5FWJA 3JQXA 3PUQA 4H2AA 2RDNA 1URXA 3VHRA 4CUBA 4QX0A 1IPKA 2HYKA 4BHPA 2V5YA 2X8KA 4CUGA 3HOBA 1FPN1 1GR3A 1XE8A 2OKXA 5L36A 2ZGLA 2QQNA 4I0WB 1TVGA 4M3CE 1PO13 5CG8A 4Z92B 3CHXA 1FOD1 1NQDA 1ULCA 2ATFA 2GC2A 3CMGA 1EPWA 3K4ZA 3O1PA 2QDRA 2DWRA 1FNYA 3B9CA 4BYYA 2PHRA 3BB6A 5K7PA 4CCKA 1X82A 2K0GA 2RS32 5I8YA 2ZKLA 4OMCA 4Q4Y1 3DL3A 2LRPA 5CISA 4AYUA 1IHMA 2ZABA 2ZGOA 3OGVA 1MR5A 2QTWB 2YBPA 2QJVA 3PVOA 1XNBA 5LA2A 3SITA 2VC9A 2VPVA 1W2UA 2VNRA 2O8OA 5IJRA 3CNAA 5BNPC 5JIUA 2WFF2 2XQXA 1W8UA 2XWJB 3ZIXA 3AP6A 2DBIA 3AX4A 2HWE2 3WP6A 3ZXJA 1OD5A 2C6SA 3VDDA 2D40A 4GA9A 4CP1A 1O4TA 3OEAA 3IMNA 3EBRA 1ULEA 2DVFA 1CAVA 3ES1A 4XDOA 4UF0B 4BLIA 5IVEA 3LF7A 2EXIA 1LGNA 1BVP1 3I2JA 1IG0A 2EIBA 2YG0A 2FZ1A 4CU6A 5K0UB 1QJU3 4K1YA 4K40A 1AYM2 1COV3 1XNCA 1JI6A 1H8TB 2CDOA 3INAA 2NLRA 5KXDA 3ZVXA 3POYA 1T2XA 3IWZA 1RIRA 2X5IC 1MVEA 4J25A 1VBE2 4UXAA 1OUSA 5IK5A 3VBFB 4IW3A 2JDAA 3AL5A 3AKTA 1D4M3 2A6VA 4LLOA 2FDKA 1O59A 4XEZA 3ELNA 4NWWA 4QB1A 3O1OA 1GOGA 1GP5A 1K5JA 1LNSA 3RZGA 4OI0A 2HH9A 2ZGSA 3MUY1 1YYNA 4C90A 2XJVA 3MIGA 3NAPA 5F3IA 3RNSA 3VBOA 5GM0A 4CDWA 1KS5A 4JV4A 4TTGA 2ZGRA 1RITA 3WG1A 5FZDA 1OMIA 3USUA 3FHAA 3E5QA 2J1RA 4HG6B 5JZGA 4NRMA 3K4AA 1DGRN 4NRQA 3NNJA 4N53A 2UYAA 2WZR1 4Q0SA 4CDQC 5AVPA 1SQ4A 3WCSA 4WM7C 1ZRCA 1UAIA 2WQ4A 3KQRA 1XSRA 4OI4A 4C1XA 4AHXA 1E5HA 3BTXA 5EYYA 1GQPA 3SHRA 5KXCA 4OHVA 2EVXA 1ZBA1 1XSQA 3QH7A 5FOJB 1Y9MA 4W6XA 3AKQA 2HWF3 1RL3A 4IEWA 3NNMA 4RS5B 3LDRA 1RUF1 4FAHA 5DZFA 4CDXC 3OEBA 3AC0A 4XDPA 3VBRC 1XYOA 2K9ZA 1GWKA 2WWJA 3KHBA 3QH6A 4WVMA 5DUVA 3V0AB 2D7FA 1JZ4A 3KMHA 2CAVA 4U2AA 1D2QA 3KD4A 5A3MA 1L7QA 3NJYA 3TN91 4XAAA 4CDUB 1WD3A 3KZ4C 4YZ1A 3BTZA 5FV3A 4AQSA 3TWIA 2QQOA 2WYFA 4QX2A 2J22A 3S30A 1X7NA 1Z7S2 3UT0A 3M2MA 5SV8A 3WNOA 1Y4WA 5IT6A 3BIEA 3CJIC 5F8PA 1DBNA 3ILRA 5H9QA 1TE1B 4I30A 5HCAA 1BQPA 3MBWA 3MDPA 5HI0A 5LY1A 1B35A 3RYPA 2D6PA 4AI0A 1OA4A 3D4KA 4PHZA 3N3HA 4UFLA 3OSDA 1MZFA 3IPVB 2ZBJA 1QXJA 1KS4A 1SCSA 4L0PA 1AR61 2XHKA 2KR2A 3POSA 3AZWA 5CFDB 2W92A 2C0ZA 2ZPXA 3ACIA 3VL9A 3ZN5A 2G9FA 3AKPA 2RDRA 1PM4A 4EN9B 2VQ0A 5AVAA 4MGTA 5FZ8A 3GJAA 3VZKA 4CZSA 1FPN3 4FQ4A 2JG9B 1MQTC 5DAPA 4Q4W1 4LA2A 2YY1A 2OYZA 3J8F1 3ZN4A 3C3VA 5GLTA 2WN3A 4GWIA 1HW5A 5E6HA 4AEMA 1LOGA 1Q43A 4UW6A 4HKOA 4FOWA 5A7NA 1HIXA 3UGFA 3WSOA 2DTYA 2WO2A 3KWVA 3AFGA 4OHXA 3J4UH 4WM8B 4EYUA 2Y6FA 4I02A 1BK1A 5CFCC 1W2NA 1VAMA 4F83A 3ZOIA 1O4YA 3ZYJB 3OUIA 1AJOA 1RGSA 5B4NA 4PCRA 4YNIA 3O1MA 3IDBB 1WA4A 1J3PA 1OLME 2FCUA 2GP5A 1S0CA 4LK6A 3ZDVA 2VOWA 2Z5WA 4AQ2A 1HXS3 2VQUA 3THDA 5FPUA 1YIPA 1W8OA 3I3DA 2YZ4A 2E26A 5K0UA 5LY2A 3DGTA 3LEKA 2Y26A 4AHZA 5GLZA 3HR9A 1H8TA 2ZS6B 1AR83 4ARXA 1VBC3 3KLSA 1VBD1 3VBFA 1LJ7A 5GZFA 5D8AC 5JCTA 1OOPB 4MLOA 1O5UA 1W6PB 3OD4A 2A7AA 3DV8A 1JU3A 2IXIA 4ARYA 4YLZA 2Y60A 1YRZA 2WAAA 5K9YA 3BPZA 4PIZA 4MYEA 4H3WA 3VD3A 2IC1A 3BVCA 4COVA 3NJXA 5C70A 2C24A 4C1WA 3O0VA 4PI2A 2VG9A 1OURA 4BK5A 5A1FA 2WR9A 1OC1A 2BZDA 4D7TA 1RUG1 1QJX1 2D5HA 4A41A 3FN9A 2WINB 3GZTB 4IEVA 4XABA 3ZSMA 2QQLA 5C5TA 3T30A 3J7MA 4NRPA 3WG3A 2H6BA 4LIUA 5CNAA 2P34A 2UYBA 1BBT2 1WMEA 2SBAA 2RS51 4NPMA 2KXLA 5IW0A 3IB3A 1LGCA 2O0OA 5DG1A 1CZSA 1CR7A 1JUIA 2WZR3 1BMV1 3IIAA 1VBA2 4OQ9A 2PFWA 4I3GA 3ZKYA 1DYKA 3H50A 1GZ9A 3OCPA 2JG8A 3PDQA 3DUIA 1G6NA 2MHFA 3GCXA 1CESA 3OG2A 1ZBA3 5I8TA 3RMXA 4NROA 3WF1A 5A6QA 3V0AA 1PO22 1ST8A 2NZ9A 2W5FA 5FYYA 3K77A 4KWKA 3ZIWA 3IMMA 3ZSEA 4BOWA 3O1UA 5DN2A 5IFPA 4JGYC 1SZBA 2BQPA 4CDUA 4MHUA 1XE7A 2R49A 2WQ8A 1IOAA 2E51A 4QQOA 4U36A 5GZDA 1SLLA 2E7AA 1QH7A 5L7OA 4NJ4A 1NZCA 4EWDA 1I1EA 5KHKA 2XXZA 2R042 2KD7A 4HVOA 5FRAA 1YEWA 3M7AA 2B7YA 4O61A 4X8NA 3IPVA 3NV3A 5JPMB 3WG4A 4NHYA 3VD9A 1QMJA 1VR3A 2ET1A 3PIGA 5KHIA 3KV5A 2FCVA 3OUHA 3MLJA 3QOPA 1JBCA 2DV9A 1O4ZA 3SEPA 1VMFA 4R4XA 1W03A 5T50A 4OZXA 1WCSA 3KVAA 5FMOL 3NRUA 4ONUA 2P37A 2IUWA 1O6UA 2PTMA 1CD3G 1YQ8A 1WCQA 3GGLA 4UFKA 3PTRB 1TMF1 1AJKA 2YV8A 3D5OA 1S2KA 3I2KA 5BXXA 5HBAA 3ZYGA 2ADDA 2JG9A 4YRDA 2GSYA 3VDCA 3RZZA 4CTEA 4Y33A 5FYMA 2FDFA 1W9SA 4YW6A 1A8MA 1O3TA 2VBDA 1JTZX 5I91A 3RPQA 4AFAA 4BU2A 2ZAAA 5A6XA 3PJYA 4LE4A 2OQ6A 3N36A 4M3CF 4AVTA 2GNDA 4QDSA 4P9XA 1O8SA 5ABJC 3EB7A 5D21A 1XE0A 4Q4W3 4JHTA 3V64A 2GNTA 2R072 3J8F3 4P9LA 1LECA 4WV8A 2GMPA 4FO9A 4WM8A 2A70A 1FMD2 3BALA 2Q8EA 1QQP2 1GSLA 2WA3A 1RHI3 1XB9A 1TME1 1S0EA 2GZWA 2RJLA 2EICA 3AMNA 2PHUA 3WNPA 2B4KA 1OH3A 2Q0AA 3MV01 3WHTA 1JYIA 1DF0A 1W0OA 4Y5TA 5BUVA 1H1AA 4DPNA 2Y38A 4E4SA 1W8NA 4AFBA 1MS8A 2A6ZA 4FPLA 1OQDA 2R6QA 4XJAA 4QPGC 2WIIB 1DQ1A 1ZA7A 2VMDA 4P00B 4J1XA 2ZGNA 3DXTA 5H9SA 3K2OA 2PA7A 1QDCA 4R9DA 1KDKA 1OOPA 2WA4A 3R4SA 1W6PA 5F2SA 3TNQA 2Z69A 4IV3B 4JRAA 4BMEA 1UQXA 4Q2FA 4JCKA 4Z8BA 4I0BA 4QD2A 1DU3D 1VBD3 3LEIA 4DRRA 5T5PA 1D4VB 3G7DA 2WNEA 4B29A 2OS2A 4XBQA 2YPJA 4CXYA 4P9YA 2F17A 4Z1VA 1N3QA 4Y24A 5IK7A 2XWBB 3U14A 2QQPA 2VOKA 3U75A 3ZYPA 4BQ1A 2W3JA 1RMU1 1DQ0A 4NHXA 5D2AA 2ZX0A 1GQGA 4K6BA 4OFGA 2ZMKA 5L73A 1BEV2 1RUG3 1GICA 4XCBA 5EFUA 1LOEA 1QJX3 5DAXA 4IUGA 2R061 4QX1A 1GZTA 4LO8A 5JSOA 1NA1C 1GQHA 1OLRA 2VZ1A 4QDQA 5JXGA 3AP7A 4NIGA 4DUWA 2ORZA 4IV1C 4UFMA 2ADEA 5C7GA 1IZ3A 2RS53 2BGCA 4HLTA 1H0BA 4K1ZA 1CPNA 1Q8SA 1GOFA 1Z78A 2BEOA 2J1SA 1DQ6A 3SXWA 3K48A 2W9XA 1ZBE2 3GHMA 1WMXA 4H55A 3M3OA 4CEYA 1IS5A 5GZCA 5CG9A 2XJSA 4JQTA 5FJHA 2WT0A 2FDIA 2DURA 3EJKA 3GBWA 3PMSA 3ACGA 2VXRA 3KQ4B 2WWSA 1AL21 4MGZE 5FMBA 5C3OA 3ZFEC 4YG0A 4OLLA 1XBFA 4N90A 5F7UA 2YGLA 1IG3A 1PGW2 2OZ6A 1VMHA 2V09A 2B42B 3FJSA 2R0FA 1W99A 1W6QB 3ACFA 3DYMA 3C2UA 5DAWA 1KJLA 3BUCA 1QXPA 4Q4X1 2B9UA 2VMEA 2Q4SA 2W1SA 2DUPA 1HQLA 3WY6A 2FCTA 3AVRA 5IAVA 2O8QA 4S2DA 4AI3A 4FPJA 2J42A 1I6XA 3I7DA 3WZ1A 4XFBA 2ARXA 1GKBA 2A71A 2D6NA 1VP6A 4GJZA 1RVF3 3QD6A 1RUJ2 4Q1PA 3ZX7A 4UFJA 1RUE2 3ZPOA 1W6NB 2QQJA 2G4IA 4DS0A 3RI9A 1ZRIA 3WQ0A 2Z4FA 1VALA 1S0DA 1N3PA 1QJY1 3IT8A 4AFMA 2W46A 1TMF3 5GKAC 3LCPA 3AXDA 4DO0A 2WFPA 4QGLA 4AWDA 2WYSA 3T2QA 3WF0A 4RFRB 2J1UA 3AXEA 3MIBA 4WVZA 3LIHA 3URFA 5LCWL 5EYXA 2R1DA 1XNDA 2KM2A 5KBFA 4JHZA 1STMA 3MW3A 5GLVA 1N47A 1N1TA 1UZYA 3ILFA 4YSFA 4XTMA 3F2ZA 4KH9A 3ME2A 1JZ8A 1HV0A 5FO7B 4K9SA 4DUXA 2VW0A 1UOBA 2EXKA 3CLPA 1SPPB 4IE0A 5FY4A 4BXFA 3AP4A 3CBNA 4E8CA 4XJUA 2WNVC 1V6MA 4Z2AA 2VM9A 3HPNA 1V9U2 2K2SA 2L9LA 1U0AA 5GZEA 1LTEA 2VR4A 2YDEA 4AVBA 1IS4A 4GKXA 2BUKA 5DUWA 4FPGA 1LU2A 4NVPA 2CTVA 5L9RA 4XIOA 5C4WB 4IV3A 1LB2A 3MFCA 4KG8A 4BZ4A 3RS6A 4AQTA 5JSPA 1DP0A 2JDUA 1N1YA 2LALA 4UYBA 4ZU4A 1ULGA 2Q1MA 1E5SA 3FLRA 2MEV2 4GB31 4COZA 4R9CA 4CXWA 3GJBA 5IK4A 4BMBA 2QVSB 3LE0A 4H14A 4BQWA 3RZLA 3K51A 1ZVFA 3NJZA 4NMIA 1C57A 2WWUA 2VNOA 3KT7A 1CJPA 4P5HA 4E4DX 1V6KA 1XU1A 4JTOA 1LOFC 4L8QA 1Q8OA 1Y7BA 3DXUA 3DECA 1Y3TA 3C7OA 5DAVA 2BNMA 5LATA 4EQVA 1VRH2 4PDWC 4EZ4A 1C8M2 1C3HA 1HJGA 2GC3A 5FPAA 1ND2B 5GLUA 4DINB 4EN8B 5A3LA 1RMU3 3ZYBA 3SCHA 5M0TA 3FBMA 4QU2A 5JR7B 1QNYA 1VE0A 3GZEA 4XVHA 4FPOB 3H8RA 1FI2A 1RUD2 2LROA 5HCHA 5L9VA 1K5MC 1OFNA 2RM22 1SLAA 3ZSJA 1VMJA 5FLHA 1UZWA 4NE9A 2E32A 4Q4V1 5KHHA 2Y6LA 4FQZA 5FY5A 2BFUL 4P14A 1WBLA 1BZWA 2DU0A 2VH9A 4DRVA 1K42A 1MZEA 1R092 2PAMA 2XJUA 4WVWA 3L2HA 3ZXDA 5IFTA 4EJRA 1OBNA 1PM7A 2JKXA 1FATA 4E2QA 4HVQA 2WBKA 1AR92 1AVBA 3OPZA 1ND3B 3H3UA 4LBJA 4YW5A 3O5SA 3VZJA 5LW9A 2VMIA 2VVDA 1UU5A 3N7LA 3U4XA 3A22A 2W52A 2NQYA 2AC1A 5A6YA 2NN8A 1ASJ2 3NV4A 1G9CA 3BTAA 2VUJA 1V6IA 4PQQA 4LBQB 2IWGB 3ZFFA 1KFXL 2Q1FA 5BNQA 1VLNA 1C1FA 5A7PA 4MHRA 1C1LA 1OUXA 3RJRA 4YVSB 4FTEA 5IVCA 2VTFA 1J84A 3B01A 3KSCA 3ON7A 4RHV2 4EWEA 4NUBA 5DQ0A 3IDAA 3EO6A 1UCXA 3CKHA 1ZZ7A 3QLQA 3ZXEA 2VCBA 3IDCB 2JDPA 4IL7A 1W8ZA 1UD1A 4KL1A 1W2OA 1U5ZA 2RR12 4IQPA 4Q4X3 3E6CC 2YC4A 3BTYA 4WBBA 4HN0A 5JLVA 3HN3A 1J1TA 1H1MA 3O14A 2R0HA 4X6QB 1EPZA 4YFZA 3ZN6B 3O0WA 4UBHA 1MVQA 1PGL1 2RS11 3VBHC 3VDAA 2E33A 2K46A 3LD8A 1AX0A 3SH3A 2P1BA 3ZYHA 4UW3A 4V2VA 1E57A 4PLNA 2BVVA 1QJY3 2XR4A 4HSLA 2XHNA 2XUEA 2VQTA 4FSJA 2RDQA 1R1A2 3LOBA 4LT5A 1CAWB 1Y9QA 1IPSA 4FP2A 4YZ5A 1GP4A 5FQ0A 3MLKA 3I59B 5FZIA 1F15A 4CEWB 1A8DA 4LKDA 4S2GA 3I2DA 3LSEA 1MS5A 3P5BA 3B9IA 1SPPA 1QOTA 3TEZA 1RXGA 2Y0IA 2RS31 3VBUC 3IN9A 4FOQA 3I2OA 2WZPP 5EZWA 1BXHA 4N53C 1OSGA 5KC6A 2GC1A 2WABA 3K4DA 1GLHA 1X8EA 2HEWF 5C4WA 1AXKA 2QQKA 1RUC1 5A7QA 4G4FA 4QQLA 2WL1A 2WT2A 4XIKA 3CDZB 5BNOB 1JYWA 1UX6A 5SV5A 1DG6A 1UN1A 3D8CA 4FXGB 1POV1 1VB2A 3NSTA 1W9FA 2BGOA 4HBNA 4QQHA 2ETEA 5A3TA 4XQWA 1PVC3 4HETA 2HWB3 4AGRA 1H9PA 3ES4A 4V1PA 5LA0A 2JDNA 4LORA 3O7OA 4GB33 3HVDA 1B09A 1NYWA 1RXFA 3O12A 2ZHLA 4YVWB 1AYM1 2OUHA 4LR4A 4Y26A 3RZJA 1PZ7A 1WGPA 1YC61 2PLV2 2JDHA 3RFRA 2D97A 1VBE1 1ND2A 1YQCA 3HBKA 4RGKA 4B7KA 2PHFA 2A3XA 2ZJCA 5BNNB 3KT4A 4M00A 4PBOA 4DOUA 1NCQB 2AYHA 2DUOA 3ZXFA 4URTA 4DQAA 3BODA 4FI9A 4BIFA 3PVEA 2ZMNA 1PZ8A 2XVKA 3PVBB 1B35C 3M3CA 5EHDA 3PMEA 1S0IA 2DCTA 3KCCA 1UOGA 5FR3A 1AYN1 2AH2A 5BYNA 2YGMA 2VCMA 1S2EA 1QJU2 3I2GA 3ZKUA 1MPXA 4QMAA 2QBXA 1COV2 3LGRA 3MO4A 4EWAA 1WZXA 3E6BA 3K3OA 3N9PA 4UW4A 1PZ9A 1UY3A 2PAKA 2WO3A 5FXXA 1ND3A 4K8RB 3S5QA 1GNZA 3HQXA 4XQ4A 4Y4RA 2BJSA 1EUUA 5FYBA 3LOIA 4PBPA 4AG4A 1CVNA 2ES3A 3VN4A 1D4M2 1TEIA 4ZY9A 3HWJA 2P3KA 2XKPA 3RGBA 3VD7A 4TZDA 4XMAA 1WCKA 1OA2A 4LITA 4CE8A 5F1RA 3AYCA 4YVSA 5C8CC 1POV0 5FXVA 4BIOA 5HXMA 5FYIA 5JMCA 4Y1XA 3POIA 4OMDA 3WW2A 4AAPA 3POBA 4P9GA 5FZHA 2YPDA 4OQ8A 2RE9A 2YUEA 2JDYA 4MH0E 2VTXA 1FYUA 3KCYA 4JDMA 2QQVA 4LOSA 2Y64A 3O0XA 4ZU7A 2GC0A 2GN3A 3AYAA 3FX3A 1UPIA 3JBG1 1Q8VA 5IVFA 1G9AA 3SNMA 4FBFA 4CSWA 3THPA 3ZN6A 2F6BA 1F31A 3VBSA 2VZOA 4P9JA 4YZ3A 5K0UC 1ACCA 2WT1A 1Z7S1 2G9ZA 3K3NA 1C5HA 2TBVA 4JX0A 4QX8A 3TNPB 5E8AA 5FUNA 3WCRA 2OVUA 4L11A 3MPBA 2RHPA 2ZX4A 4NIAA 2DCJA 2HWF2 1LHOA 2C9KA 5BNPB 1TQ5A 4MG2A 2RS13 5FLJA 4RR3C 1PMIA 2FHRA 3I2IA 1CAWA 3N9QA 3T2PA 4PJYA 4GD4A 4TSVA 5CU1A 4XXPA 3I59A 4M0NA 4XBLA 2JIGA 4ZZ5A 5I0DA 4FVVA 4UOJA 2PHTA 4NHMA 4GALA 1NCRA 3LEGA 2QUOA 4UWDA 4AHYA 4KI5M 2IFRA 4GH4C 4Q0VA 5IVYA 5A3WA 3RYRA 1JZ5A 1D2SA 2W47A 2X5IB 4B1MA 3I3QA 2ENRA 3ILNA 3UJQA 4J1WA 4O65A 4QQPA 1UYYA 5EIYB 2BWCA 4AGVA 2RS33 5DDJ3 2JIJA 4QGMA 3R4DB 4XHXA 3EMRA 3H7YA 3WHUA 4LA3A 2BWAA 5A3PA 4KQ7A 4QXHA 2JKBA 4XUPA 3APBA 5F3EA 3ETQA 1MACA 5FPZA 5BNOA 3ZYIB 1PX4A 2ZGPA 4MUVA 5JXHA 2IXHA 4SLIA 2Q30A 1RUC3 4W6YA 4B4QA 1SFPA 3MUZ1 4XFCA 1JOBA 3H8UA 1LESA 5FPXA 2BPA2 1X50A 4QPIA 1UNBA 2IVIB 5HV0A 1OKQA 3J7HA 1POV3 4CDQB 5JXJA 1BCXA 1P8JA 3ZXAC 3B94A 1XPWA 1JS9A 4GXLA 2Q8OA 3OPWA 4OHWA 1H9WA 2J1VA 1US3A 2CU5A 4ITCA 5BNNA 1AYM3 1D0HA 1NCQA 2A3YA 5L7OC 2NPIA 5CADA 4LO7A 1QDOA 4E4HA 1Q5OA 1XJAA 3ACLA 3GNEA 3KM5A 4QHBA 1O5LA 2VZPA 3FLTA 2PXJA 3VBRB 4CDXB 1HXS2 4PI0A 2UY8A 2ZGTA 4IDZA 4BQ5A 5C3SA 1DLLA 4CCCA 1R081 2D98A 3VDBA 1CAXB 2AREA 4IXLA 3W5NA 1FNZA 2VCCA 4OYUA 4PF5A 5E88A 5FZ6A 3RG0A 4C0BA 1TZOA 1AR82 3WF3A 1VBC2 3NJVA 1W3XA 4LUKA 3U10A 1AYN3 2IXLA 5LA9A 3WUCA 1GWMA 2VAUA 2JG9C 1DQ4A 1NE6A 1W06A 2A75A 3CJIB 4CA9A 2D5FA 1XQNA 1V6OA 2WS92 1FOD3 3HBZA 3NKGA 5FK7A 3RWNA 1PMJX 3D3AA 1YCIA 1VBA1 1UY0A 2RMU1 2YHJA 3BPSA 1L3JA 3JD72 1SMVA 4HK9A 4Q8KA 2VW2A 5A3NA 1CAUB 4NIDA 4Q4Y3 4WM8C 3SLIA 1QNWA 4I01A 2E9QA 2GMMA 1DGWA 3FUQA 1C4RA 3AZXA 4GWMA 3SEEA 1EYBA 2W39A 3E6DA 1IS3A 3AJYA 1RUI2 2Z79A 4RD7A 3UNPA 3P6BA 2RDSA 3OYWB 4MOAA 3UYJA 5F37A 1J3QA 1HRI2 1YFUA 1J58A 3IM0A 1MQTB 2BP6A 2EALA 1DCSA 5CKQA 1X33A 4UAPA 3F95A 4UF0A 5LBBA 3L9JT 2PAEA 3HN1A 4QHZA 4AVVA 1RJ8A 4JZRA 2DTWA 4TLGA 4JGZC 1WCUA 2WZR2 2VZTA 3GF6A 4IE6A 3JBG3 1AR72 1NQJA 2DBNA 4XUTA 3U78A 1G9BA 1RINA 3WLUA 4AEDC 2CWSA 5CFCB 3HQUA 5DZGA 2WJSA 1Z7S3 5FMCA 2OPWA 2V4AA 1OOPC 1ZBA2 4INDA 1IQAA 1CQ9A 1Y43B 3JB4C 2DU1A 3FL7A 4LHSA 5JMOA 2YMZA 1WBFA 2BTVC 1BHGA 4ASKA 1PK6B 4EN0A 5I93A 2W87A 1W9YA 3AVSA 1YJLA 1LRHA 3PUIA 4C8DA 4XURA 3S7EA 2JWPA 2V73A 2X5IA 3VZOA 4L2NA 3PLQA 2VZSA 5D8AB 5FUPA 4L99A 3R6SA 5IYYA 2VVFA 2R071 2WZ8A 2WNUB 4IE5A 4AFCA 1FMD1 1Q56A 1W2TA 5DG2A 1QQP1 3B5LB 3WDXA 1BVVA 4DEVA 4CVUA 5HCFA 2LS6A 3A0KA 3OGSA 4LBKA 3CQOA 1DGWX 3MI8A 4Q26A 4L97A 4ET7A 2PHWA 2ZTNA 5IAXA 1WKYA 4RS5A 1RUOA 1QOSA 4BQ2A 3O1VA 3CIHA 5F3CA 3AYEA 2ZEYA 4MZUA 4CEYC 3BYWA 1C8NA 2XPJA 1JH5A 4BQXA 3MIDA 1LR5A 5J48A 1SCRA 1RUF3 2VMHA 4JDOA 4UI9L 4CRQA 2V72A 5FYUA 4CCEA 3LDBA 4FPFA 4MGQA 2X05A 3ZPYA 3P3PA 2JD4A 3NV2A 1ONAA 3DYOA 1LCLA 1UYXA 3JCIA 1RHI2 4IGPA 2VZVA 4W65A 1UU4A 3TN93 4WVVA 2ZCWA 4GMP1 2VJXA 2V5DA 4CDXA 3VBRA 1NX9A 2OZJA 2YBSA 1PIV2 5IWFA 1JOPA 2WSUA 3M1HA 4A42A 4A7YA 4CCLA 1UX7A 1CAXA 5CFDA 1W0PA 3WG2A 4DXRA 5JI9A 4BM8A 1UIKA 1JU4A 3OBTA 3E5UA 2HBUA 3LKJA 1DZQA 2WC2A 4NO4A 5FZ9A 1OLQA 5FZKA 1AR63 4ASLA 1R083 2YB7A 4H7MA 1BEV1 1CGPA 5EV7A 3OB8A 2W1UA 3OD0A 1HB2A 1ZZBA 2NP0A 4GJYA 3LQCA 3WQ7A 3TBDA 2B39A 3R0RA 1F4HA 4F8AA 5LZ6A 4X8PA 1VBD2 1UZ0A 2XH6A 3N7MA 5FK8A 4DY3A 3B69A 3T09A 4MSVA 1CAUA 1OKOA 2ERFA 3U07A 1TNRA 3WNLA 2I07B 2HWD2 3RZHA 1LEMA 1WLWA 1UKGA 5FMOS 4BLJA 4DFSA 1DZTA 1ZBE1 1WWYA 1VBA3 3CZJA 2RMU3 1JZ2A 2Y0OA 2Q1ZB 3OYWA 4OZOA 1EV11 5KXEA 4BQYA 2BBAA 3MF9A 3AP5A 5HXVA 2WO7A 4QWNA 3WNKA 4D94A 4NIHA 3CEWA 3ZDSA 1QJX2 3DKWA 3I97A 4E2SA 5FZ0A 4NHLA 1R64A 1BKZA 5IATA 1QJZA 3BU7A 5AC91 2JG8B 1PGW1 4BJ0A 4C0HA 1EY2A 3BKZA 3T2OA 3H9AA 1SBFA 2RV9A 4GMP0 1BJQA 4HPKB 5C3PA 1IPJA 3H3ZA 3KB5A 4V2WA 3EHKA 3PTYA 2Z42A 5FO8B 5LRRA 3E5XA 3NNGA 1VBB2 5LEKA 2WLQA 3BI3A 1O91A 4YGCA 2VUDA 3VHNA 2EAAA 5FY1A 3B3QE 3WEZA 1A34A 1PK6A 1RUE1 4B7EA 1DZRA 2W08A 3ABZA 3AZZA 4AL9A 5A7WB 3U1XA 4XDQA 2VW1A 5FKBA 3LIGA 4QPGB 1VRBA 3WW3A 3ZM8A 4BA6A 2B45X 4IGQA 1Y9GA 1N1SA 3C7HA 3BN6A 1NE4A 5D8AA 4N43C 3FHQA 1G8WA 4WZCA 2P2KA 1ODMA 5FDBA 2WNUA 5EP9A 1CX4A 3ZYRA 2QQUA 5EJ1B 1H6YA 4RGAA 4LK7A 3NO8A 1UY4A 1C28A 4JC1A 5CZKA 2R073 1RVF2 4W4ZA 1LHNA 5A3UA 1FMD3 2O14A 2WAOA 3UJOA 1W9TA 5F39A 1U12A 2JDMA 5FZOB 4YW1A 2D3SA 3ZFGB 5FZGA 4ZKTB 3HNMA 1FXZA 1GYKA 4OCTA 3UKTA 3IKWA 1DGRA 2DCKA 1OHFA 2BNNA 1YQ6A 3THCA 1GP6A 4EV0A 5LB6A 5AFBA 5I0SA 1C5IA 2A6YA 3MHZA 1V9U1 4ORFA 4A3XA 4FT8A 1WUVA 3J7NA 4ASMB 4Q29A 1NA1B 4XJZA 5FMDA 4Q8LA 4ZS2A 3HT2A 1HRV2 3LA3A 2I45A 4IV1B 1ENQA 4NOTA 4Y22B 2R16A 3ZFFC 2FDHA 1NLQA 1OXCA 2QFEA 1RB8G 1JYTA 4AZZA 4HFSA 3KV9A 4PQ9A 2MEV1 3C7EA 1EAH2 2XBO2 1YWKA 4XILA 4Y1YA 3RRDA 3RSJA 3H3LA 2WRAA 2VBPA 5FPBA 1H30A 4GMP3 4LLFA 5IUQA 2YXSA 3KVBA 5C8WA 3OOXA 3HNBM 3O1SA 4KNCA 5FPLA 3PNAA 4YGDA 4H7LA 4XPVA 1GNYA 4CPBA 1O7FA 2Q8DA 1W8WA 1MEC2 3OGGA 3I49A 4JKMA 2GALA 2W91A 3AMQA 1C8M1 1WMDA 4YFWA 4XFFA 3GDBA 3RI8A 3QACA 1RUD1 1RYYA 2XONA 1W9WA 4BB3A 2B9VA 5LK7B 2VZUA 2RM21 1RJ7A 3FZ3A 1F2NA 1BYHA 4TWTA 4NN0A 4AOCA 2F4LA 2PMWB 3DKQA 1R091 5CKMA 1LOCA 4TN7A 2OUJA 1RUH1 3AMMA 1FV2A 3AP9A 1NT0A 1YIFA 4CUAA 1US2A 4SBVA 5KR7A 1AR91 5C9AB 3B93A 4A7KA 2YFUA 1ZBE3 1TME3 1NY72 3PL0A 3C7GA 2QZ2A 1EV13 3X29B
chains in the Genus database with same CATH topology
1UZZA 1ASJ1 1MS0A 1N3OA 1RTVA 1G9DA 2A6WA 1SLCA 1YI7A 3AKRA 3FBYA 4HANA 1OQEA 4HPKA 1W6MB 5AC93 3WDWA 5ACA2 4N9HA 4KWLA 4RHV1 1YUDA 5F9TA 4IEUA 5A33B 4AI2A 1DQ5A 2HWC2 4CP0A 1AXYA 2RR11 3AMPA 2IXJA 1S0GA 2FMYA 4XF0A 4LO5B 2AZ5A 1YFXA 4Q0QA 4R4ZA 2DVGA 3WUDA 1UF2C 4JTNA 2WNVB 4QPGA 4D7SA 1SEFA 5T5OA 4HK8A 4FCAA 1RUE3 2ILMA 4FXKB 5JI7A 4XF4A 4RQPB 1NLSA 4OUMA 1QGLA 5IK8A 4HL0A 3LA2A 2FQPA 1ENXA 2ZGQA 1R1A1 3Q9OA 2R063 1IS6A 1WW6A 4IEXA 3JUUA 2GU9A 2JEMA 4TLFA 2CNAA 5J09A 2XLGA 3ZFGA 5KWRA 2DVDA 2IZWA 1YLLA 4XJWA 4PDWB 4FAGA 1QOOA 5E89A 1NA1A 1CJDA 1QJY2 1KRIA 4Z07A 2NM1A 2PHLA 3FFZA 4D3WA 1K5MB 2GAUA 4Y22A 1V9U3 4R8HA 2ET7A 5FCCA 1W6QA 1AL23 1ZNPA 1V70A 3W58A 1NLRA 5LK5A 3OGJA 4B3NA 3M70A 4MGKE 3B02A 4YG6A 2AENA 3M8LA 1DGLA 3ENRA 2GN7A 4N9IA 3WDUA 4Y5Z0 1S1AA 1W6NA 2OIIA 1SFYA 2PLV1 2CGPA 2X29A 4XJ8A 4L9BA 1WMFA 3NV1A 5T52A 3VBSC 3J26N 3JZVA 4G9SB 4UBGA 2HJIA 5T54A 3KGZA 3FUOA 1KDMA 4QXKA 2CL2A 2D3PA 3SISA 1C8M3 5J36A 5J7MA 3HT1A 1CIWA 4PIYA 1PVC2 1D0GA 1Q8PA 2HWB2 1XYPA 2VGDA 1GNHA 3FWEA 2RM23 1QJU1 4YZ2A 1YHFA 3VUOA 5E16A 3IBMA 2VQAA 2VVEA 5L19A 5C9AA 1W6OB 4DZGA 3UL2A 3D6EA 1R093 3A4UA 3BOPA 1LENA 3VBHB 3NAPC 1DHKB 3VBOC 3SH4A 2XJPA 1NCRC 4CDWC 1RUH3 3MZHA 3FFQA 3AFKA 4Y1VA 3G6JB 1AR93 3V65A 1F5FA 3VL8A 5JZGC 4M0HA 1W6MA 3VHPA 2EA7A 1YO8A 1NXD1 2WKKA 2VY0A 1GFF2 1ASJ3 1H4GA 4FOVA 4XQDA 3DPRB 1NOVA 2WFF1 5A33A 1M06G 4YW3A 2HWE1 3GBFA 3QCWA 1CN1A 1XRUA 1PO12 3FE5A 1HV1A 2CGNA 2DVAA 3ASIA 4RHV3 4EN7B 3MIHA 5T5LA 4RSUA 3VZNA 1DFQA 3VBUB 2H0BA 2DFCA 2D6OX 3USUB 5F6KA 5FO9B 2LM3A 2LTNA 3WV6A 1UPSA 2RR13 1AUYA 2ZGKA 2ZMLA 4QPIC 4COYA 2XLFA 5EWSA 1KITA 4CYDA 1G7YA 4RQPA 1XNKA 1JUHA 2HWF1 2GNMA 2D44A 1AXZA 2CWMA 1V00A 2TEPA 2XLAA 1G9FA 4QT6A 2EXJA 1NCQC 4QX5A 4GQ7A 4ZXKA 2E53A 4S2FA 3FMGA 1HX6A 4XMIA 1ZM1A 4E9KA 4LBOA 3NL1A 2XVGA 1WLTA 4DMIA 3BCWA 1QF3A 3SMHA 1AZDA 2R1BA 1HKDA 5J3UA 1SACA 2OPKA 4Q4V3 4YZ4A 4K21A 4PDWA 1H8VA 4PLOA 3GZAA 3WOGA 1PGL2 2RS12 3H1MA 3MW2A 1UW8A 5CA6A 1RC6A 5DUXA 5T5JA 4F7ZA 1PGSA 3AJZA 1K5MA 3OTFA 3M4FA 1V6NA 4LBQA 3CF6E 2OA2A 1B35B 4LBQD 1U5XA 4QM9A 2LUWA 1PNFA 1HQNA 2UY9A 3VGIA 4PLMA 3H1YA 1ZA4A 3KS7A 4XOGA 5J98B 1Q3EA 1ZRFA 1VJ2A 4I3PA 1CONA 2QDNA 1QHDA 5CBLA 2XKOA 3AB0A 2ZHNA 5EXOA 5DDJ2 2XJQA 4AVAA 1JXNA 2I2SA 2CAUA 3WDVA 1EV13 3AZYA 4EROA 1ENRA 4AXOA 3PJQA 5C8CB 3LAGA 1DDLA 1REFA 2PLV3 1H8TC 4JQRA 4YM2A 1RUC2 4JAAA 4Q0PA 1HXS1 5C33A 2EIGA 4P9IA 3MIEA 3VBFC 3R05A 1RUNA 4LO6B 1REDA 4BE3A 5KXBA 3R4UA 2UURA 4DXZA 3M3QA 1SDWA 3RJ2X 1AR81 4CEWA 4LO4B 1W6OA 1VBC1 2ARBA 3CO2A 1QH6A 2FBEA 2R32A 3OY8B 4XF3A 3TRSB 3VBHA 4XW3A 2JE7A 3J9SA 1ZRRA 4KU7A 3MIFA 3H1WA 4K8FA 4F3JA 4OI2A 5JWPA 3UKNA 1OA3A 2WS91 4ATEA 1CPMA 3ST7A 4RR3B 2D6MA 3JD71 4MXVA 4A7ZA 2O1QA 1G86A 3DPRA 1S0JA 2XB6C 2C9AA 2XJRA 2OW4A 4R9AA 1RUI1 4M3CB 3W59A 1HRI1 1AYN2 1IGOA 3WP4A 4RS5C 2WFF3 1FPN2 4K20A 3VBUA 4AF9A 2HWE3 1FOD2 4YVWA 4LEJA 2EAKA 1AR71 4WM7B 3TOJA 4CDUC 2IXKA 3M3IA 1H2LA 3FHIB 3LB9A 1DQ2A 4Q4Y2 4YYOA 3RMYA 3TAYA 1LODA 4HT1T 2UWCA 1JN2P 2VOXA 5DZEA 1VBE3 1S0FA 5TSWA 1FV3A 2BW8A 2NYYA 2AGSA 1JOJA 2ZX1A 4ES9A 4UW5A 4W6WA 5CFDC 5FTTC 3JBG2 4KG0A 1S0BA 1ENSA 3DF0A 3T1LA 2GH8A 4I0AA 1GBGA 5T3NA 1OQ1A 4I2OA 1BBT1 1GZWB 5L7OB 4D7YA 3PVNA 3JB8A 2HKXA 2QKDA 2WQZC 4DNYA 1A78A 4MXWB 3VZLA 4KGQA 5E1RA 3LA7A 1M4WA 4AE2A 4Z2WA 2HEVF 2DVBA 2WSVA 1VAVA 2C1FA 2PYTA 2DF7A 2UWBA 5A32B 4AK3A 1WLCA 1PO21 1R1ZA 2X53S 4GIQA 2XVLA 2BYVE 2VOVA 4RL7A 1LOAA 5GLWA 4HSJA 4KWJA 1ALYA 3VKFC 2C5DA 3KCXA 2E63A 1AHSA 4RGGA 4I09A 1RHI1 5FREA 5C8CA 5BY5A 1EP0A 3CJXA 3S6PA 1QY4A 3WVJA 4FTBA 2D6LX 2R041 5BNPA 3BOWA 4MV2A 5I0UA 3EXUA 4MGYE 1PIV1 2B46X 5FAXA 3N7JA 3VKOA 4LTAA 1MZ5A 1RUF2 2DFBA 4XHBA 2YROA 1PK6C 3OY8A 4JGZB 3USSA 3N35A 1J59A 1I9RA 4WZFA 4FOYA 3TN92 4AEDB 2PHXA 3HIFA 4RR3A 4BWOA 2ZHMA 5FOBB 4CP2A 4XJ9A 1AX2A 2H0VA 2WNUC 2AUYA 5F6LB 1APNA 2HWD1 1SFNA 2WS93 4JVAA 3LWCA 4IEQA 1JW6A 1SBDA 4GULA 4JDNA 3WINE 3JD73 5JOYA 4M3CA 1AR62 1R082 1UL9A 4Q0UA 2IFWA 3MPPG 4N7IA 4OHYA 1IKPA 1W39A 1RUI3 2XJTA 4XZPA 5JIAA 3U0ZA 3N7KA 4MX3A 1HRI3 1ZRDA 4YW2A 4CDQA 4L92A 3GZUC 4WM7A 1H1IA 4YG3A 3WP5A 4Q4W2 1LHWA 3J8F2 2FZ2A 2ZA9A 5KHJA 2CGOA 1ZREA 3WDTA 1AR73 2JXAA 2RMU2 3AMHA 3NVCA 1QKQA 1VBB1 3ROUA 2F4PA 3VKLA 3ZXKA 2Z2SB 4LBMA 1PHMA 1S2BA 1WCDJ 4GWNA 4CEYB 3WP3A 1NG0A 1ZX5A 3SCFA 4HN1A 4JGYB 3ATGA 4JRLA 4AHWA 1QWRA 2H6CA 3B00A 3WX5A 2W68A 4LHKA 5JVVA 1GZWA 4NHKA 3CJIA 4IEOA 3FC0A 2GNBA 3GYDA 4M01A 4A2UA 4MXWA 4AVSA 2PN5A 2ZGMA 2ZACA 5FBZA 3UK9A 1RVF1 4ISQA 4FTSA 1BBT3 3TYJA 2UWAA 1HDKA 3I4IA 4XTPA 3MICA 3BIWE 2BVBA 3WT3A 3ZXGA 2SLIA 3ZMNA 5A32A 1QXRA 5K8SA 4O9EA 2DCZA 3CL1A 4QPYA 1MQTA 4P9WA 4COWA 1RUG2 2AR6A 4QGNA 1ZZ9A 2A73B 3GBGA 1PO23 4IETA 2JG8C 4RFT0 1HRV1 5ABJB 4X6RB 1H2MA 2EXHA 4MVTA 2CV6A 1TNFA 2ZHKA 3SCGA 3ZMOA 5BV6A 5FLIA 1SLBA 3M3EA 4FPYA 2RS52 3NW4A 4KU8A 4AI1A 2ZX2A 5CFCA 3U11A 2JDZA 3ZSLA 1U5IA 4RA0A 3OJBA 1EAH1 2JE9A 2XBO1 4TYSA 2JICA 4ES8A 1BMV2 1AL0G 5JOZA 3AZVA 4XYXA 3VZMA 4IV3C 1LEDA 2R043 1V6JA 3PHMA 5JOXA 4YW4A 1PIV3 1RUJ1 2KA3A 2JX9A 1VAKA 4AEJA 4JGZA 5I8SA 1MEC1 1YFYA 3D82A 2ZOEB 3L2YA 1F5JA 2ZAHA 4AEDA 2YYOA 1VIWB 2GH2A 4OI1A 3ALQA 4LE3A 1GZCA 2YC0A 1ZYBA 1O3QA 3WDYA 1WD4A 4XETA 1WW4A 2D93A 2D43A 4Y20B 4HZFA 5HCBA 4E4ZA 1LHVA 2GDFA 3HAGA 3B7MA 3OF1A 4YGEA 5KHGA 1YI9A 1QQP3 1MS4A 2HWD3 4R9BA 2EF6A 1NY71 1REEA 2QE3A 4ZU5A 3VKMA 4Z1VA 2P17A 4XFHA 3ZFGC 4AGGA 4BH9A 1VB4A 4N43B 1TMF2 4FPCA 2PHDA 3E97A 2E6VA 3MGUA 5GJ6A 2UU8A 2A3WA 3EQEA 2QCSB 5GZGA 5C6CA 4K3UA 5J37A 5ACA1 1GV9A 3WXPA 2G9GA 2VU9A 1WLDA 4J6GA 2NMOA 2HWC1 5LRSA 4AVCA 4HMZA 4OHZA 5CIRA 5FFOC 3GHNA 1TME2 4LNVA 4OVEA 1EV12 2WLPA 1VBB3 3AK0A 4FPHA 5DXDA 3MF6A 3T1MA 4JGYA 3LZZA 2DCYA 2ZZQA 2TNFA 4HKWA 3ZFEB 1I5ZA 2R30A 3RQ0A 5AC92 3A0NA 4IEZA 4NR1A 4Y4YA 1VRH1 1FT9A 5F5QA 2W0XA 1KFUL 1OFSA 3MEPA 3ZFFB 2HEYF 3V0BB 4FPEA 4XFIA 2XGXA 4XFAA 1O3SA 5CAZA 1H4HA 1YJKA 5LEJA 1A6CA 1BEV3 3DN7A 4FPKA 1OPMA 2MPFA 2JENA 2N7GA 3VLBB 2A6XA 4GKYA 1Q8QA 1Z0HA 4E27A 4QQ2A 4LULA 3ZXLA 3MFAA 5T55A 3MLLA 4AFDA 4MGIE 1U5YA 2PELA 2TUNA 3JQWA 3S0MA 5C9AC 2CYFA 4S2HA 1UU6A 2BNOA 1RMU2 4Y1UA 2XUMA 5ABJA 3D0JA 4NWVA 3UV9A 4AI8A 2R062 1KXGA 1LOBA 2P3IA 1HLCA 3HMYA 3MYXA 1HRV3 4XBNA 4KGGA 2E7QA 5C4WC 1T6GC 4IEYA 1PVXA 5FQ0B 1H2KA 5H9RA 3WNXA 1EAH3 1OPOA 3H7JA 2XBO3 3VV1A 4AEKA 4GH4B 4AW7A 2A5ZA 1NXMA 1KJRA 1F9KA 4YGBA 5CVRA 1AF9A 1RUJ3 4E2GA 2B5HA 1AL22 1MEC3 4RQPC 4BPZA 2VULA 4QM8A 2XL7A 4KBBA 1ND2C 1PVC1 4ATFA 2HWB1 4N7UA 4YM1A 5JDBA 2B8MA 1UKRA 4COUA 2VNGA 4YM3A 5GALA 1X36A 4Y20A 1ZZ6A 4Q4X2 4IERA 4LHNA 5JSRA 1MS9A 4N43A 2D6KA 3AYDA 4B8EA 4OULA 3JU9A 1MS3A 4Q27A 1UMZA 1GANA 4R52A 3VHOA 1ULDA 4Y1ZA 3V56A 4LBNA 1ND3C 1YFWA 2DYCA 4B4RA 1SLTA 3SH5A 1FX5A 3P3NA 4LBLA 3NWKA 3OBRA 4IV1A 5H9PA 5CB7A 4XFGA 1V6LA 1PO11 2FMDA 4XE9A 4DY5A 5ACA3 2BFUS 4YVSC 1XYNA 2GMEA 4O9GA 1S55A 2VECA 4IESA 2HWC3 1RUH2 4XF1A 3VKNA 1MS1A 5KC5A 5DUUA 2MEV3 5JPNB 1LGBA 2BBVA 3RYKA 2Q5TA 2CY6A 3ZFEA 1ULFA 2PQQA 2ZKNA 2ZGUA 1OI6A 4YM0A 2JJ6A 1LULA 4DB5A 4NPRA 3V0BA 5AFEA 1VRH3 2ZX3A 1ZZCA 3WD5A 1LHUA 1J1LA 1RUD3 1SBEA 3VDDB 4GB32 2DUQA 5JOWA 4HKLA 3RDIA 1YNAA 1COV1 3WW4A 1CAVB 4META 3ZSKA 1J3RA 4CEWC 1IKQA 4XXAA 3TB0A 4AQ6A 2MNGA 3VBSB 2E7TA 2VMGA 2D3RA 1YXWA 3T2TA 1D4M1 2I74A 1LU1A 3I54A 4K7JA 3THTA 1X8MA 3WR0A 2RJKA 1DIWA 5J96B 3CU7A 3WW1A 4C91A 3D0SA 3DPRC 2ZZJA 5D1IA 4Q4V2 3ZO0B 3H0OA 3AM2A 3MW4A 4HVRA 5BNOC 3N4MA 3POWA 1PNGA 4GH4A 3NAPB 4D69A 3VBOB 1ZZ8A 1KQRA 1NCRB 1H2NA 1A3KA 4CDWB 1JYCA 2XL9A 1HQWA 5DDJ1 3S7IA 4B4PA 2WNVA 1SLIA 5JZGB 1AX1A 3KGLA 3UKVA 4N53B 3NKTA 4YVWC 2JECA 1WW7A 3AKSA 1DYPA 1WW5A 3IDEA 3W9AA 1MZ6A 5I0TA 4BCUA 4YARA 4FP3A 5EJ3A 2XG3A 4PIXA 3I8TA 4LUMA 4IEPA 5BNNC 1XU2A 4LHLA 3WQ1A 1XXNA