1IS4A

Lactose-liganded congerin ii
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
134
structure length
134
Chain Sequence
DRAEVRNIPFKLGMYLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Conger Eel Galectin (Congerin II) at 1.45 A Resolution: Implication for the Accelerated Evolution of a New Ligand-Binding Site Following Gene Duplication
pubmed doi rcsb
source organism Conger myriaster
molecule tags Sugar binding protein
molecule keywords CONGERIN II
total genus 27
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1is4A00
1AJKA 3W58A 5E89A 3AJZA 5AVAA 3M3CA 1CQ9A 1IS4A 2XB6C 3LSDA 3MW2A 4ZKTB 2ZA9A 2D3SA 1UL9A 1UPSA 1YIFA 4XJZA 5FREA 3ZXEA 5FRAA 4KBBA 1W0OA 4NO4A 3LSEA 3DUIA 1ENSA 2G4IA 1S0FA 2LALA 1FV3A 2DV9A 5GZDA 1V6NA 2ZGKA 1WBFA 2P2KA 1IOAA 3WNXA 4LBNA 3V0AA 1ONAA 1IKPA 1G9CA 2CYFA 4TYSA 2DVDA 1GSLA 4CRQA 1C1FA 1LU2A 5GM0A 5T54A 4XDQA 1LODA 2AENA 2ZAAA 4Y22A 4YLZA 4FP2A 1DQ0A 3D4KA 2WKKA 5CAZA 1QOOA 1UAIA 4FQZA 2A3YA 2DURA 2GNTA 4FOQA 4PBPA 3O0VA 3VV1A 2NMOA 1G9AA 3OYWA 3FLRA 4M3CE 1MZ5A 4Q27A 3GALA 2PHXA 4XIKA 1LHWA 4XXAA 5H9QA 1GZWB 3D6EA 1KJRA 2NN8A 5EYXA 5T50A 2R0FA 4AVVA 3SITA 1S0EA 1LGCA 2VW0A 4UW5A 3I8TA 1BZWA 4FPLA 4HL0A 3PJQA 3VKLA 4JCKA 2VUAA 2YY1A 1W6PA 1LU1A 1MS9A 2BQPA 4M3CB 4FPHA 1YXWA 2W68A 2UURA 3OJBA 4SLIA 3RQ0A 3WDTA 1AX1A 1DFQA 1KDMA 1LULA 4YW4A 5DG2A 4AGGA 4FQ4A 1D0HA 1DGLA 3R4UA 1TEIA 4M00A 1SCSA 2VU9A 1N1YA 1FV2A 4ZXKA 5LK5A 5IUQA 3OY8A 1MR5A 3PVOA 1C1LA 4L8QA 3N7KA 3JUUA 2PHFA 4FPGA 3AZYA 3M3EA 4LBOA 1Q8QA 3MPPG 3FUQA 3A0KA 1GLHA 3MW3A 3Q9OA 2P34A 4DQAA 2VY0A 4HANA 3WHUA 4FPFA 1SBDA 4Y20B 5CA6A 4GKXA 4YM3A 3R05A 4Y1VA 3N3HA 1ENQA 5IK5A 3VKMA 3AFKA 3ZVXA 2B7YA 3I4IA 1QF3A 1EPWA 3V64A 3HN1A 4XJAA 1NLSA 3ZXFA 1CPMA 2EXJA 2I2SA 2EXKA 3MW4A 2DYCA 4FPEA 1O4YA 2ERFA 3V0AB 3AX4A 1KITA 3AXDA 2R49A 3ILFA 5KXDA 2E6VA 1QU0A 5JVVA 1FYUA 3NV2A 4YW2A 2D3PA 1C4RA 4AGRA 1DQ1A 1LJ7A 4XHXA 5T5LA 2D6LX 2W39A 2ZBJA 4R9BA 1LGBA 1W6OA 3AYDA 4YG0A 4TZDA 4YZ1A 2A6VA 1NXD1 1ULGA 4UW3A 1F9KA 4YZ4A 2DVFA 5E8AA 5DUWA 3ENRA 1Q8SA 1WD3A 3OGGA 4CTEA 4XTPA 5GLVA 3L2YA 4BQ1A 3N7JA 3POWA 5DUUA 4LBMA 5GLZA 1VAMA 3AXEA 3C2UA 4OZXA 4XILA 1IS3A 1LOFC 4ATFA 2CNAA 1YRZA 1G86A 4XIOA 2DU0A 1QNYA 2EAKA 1FATA 2W08A 2WT2A 4ASMB 1GICA 1JHNA 1LHVA 1ENRA 4M3CA 4YGEA 5T5JA 1DQ2A 1Z0HA 3ASIA 1MVQA 2JKBA 1W6QA 4M3CF 4LBQB 4XBQA 4ITCA 3FLPA 4XJ8A 4CZSA 4YGBA 3WLUA 1ZA4A 3NV3A 2YZ4A 2ZGUA 4R9DA 1AVBA 1DQ4A 4FPOB 3WG4A 1H9WA 1Q8VA 2JJ6A 4GXLA 1CN1A 3VKNA 1MACA 4JRAA 1DYKA 2VXRA 1IS6A 2NYYA 1JOJA 2ZGSA 1QMJA 2ZGRA 3SISA 2EXIA 1I1EA 2SLIA 4Y22B 1HKDA 1LECA 1CONA 3NV1A 3ZYPA 4DS0A 1S0BA 1UZYA 1C57A 1KJLA 4YG6A 3VKFC 2DWRA 4FOVA 4YM1A 2OVUA 2NZ9A 2ARXA 3SH3A 4WV8A 1HQLA 3UK9A 1H30A 3BTAA 1XQNA 4PBOA 4BM8A 2D6PA 4U36A 1UX6A 2DVAA 3AP7A 1YI7A 1B09A 2UWBA 2ZMLA 4K1YA 1LOEA 5JLVA 1WW4A 2WT0A 1Z78A 1KQRA 1VIWB 2C9AA 4H55A 1BYHA 1VAVA 1N3PA 2WLQA 4YFZA 4YGDA 1QOSA 1A8DA 1WLDA 3OYWB 2TEPA 4MYEA 3B9CA 3FFZA 2WJSA 1GZWA 2DTWA 2UU8A 4Z8BA 5H9RA 1SBFA 4Q26A 3KQRA 2R1BA 1SACA 5CB7A 5T5PA 4FPKA 4XJWA 4IQPA 1PZ9A 1QDOA 5KXBA 2OUHA 2ZABA 3AZZA 4Y20A 4XZPA 3WV6A 3ZSKA 1Q8OA 5GZCA 2CTVA 3DGTA 5E88A 3HR9A 4K1ZA 3NV4A 2A6WA 2WQZC 5DZGA 1SFYA 3AK0A 4GWNA 5GLUA 3N7MA 1LTEA 1DQ5A 3AZXA 2GNDA 1G9DA 2JECA 2D43A 1G9BA 3IPVA 5JMCA 3D5OA 5T5OA 1LEMA 2GDFA 2LTNA 2WNEA 2ZHLA 1W6PB 5DUVA 1N1SA 1WW6A 1RIRA 1DIWA 2YROA 4YW5A 1JW6A 1G8WA 1OKQA 2Q5TA 5HCFA 3WDUA 1SLIA 2P3JA 2A6XA 3AP9A 1CJPA 2R16A 2D7FA 2ZGTA 5KXEA 1VALA 1S0IA 2AYHA 5GZEA 1MS3A 2E51A 3N36A 1WLWA 3OPZA 5CBLA 5IT6A 3OY8B 3IM0A 2WT1A 2VW1A 2YXSA 1LGNA 1GV9A 1SLTA 2ENRA 1SBEA 3AP6A 2NM1A 1GYKA 3USUB 1HDKA 1N1VA 2JE9A 3O12A 4WVWA 1URXA 2PHTA 3OBRA 1JYIA 1UKGA 1LHUA 2E7TA 3AZVA 3KM5A 2PHRA 5F5QA 1SLCA 5SV8A 3WDVA 4Q2FA 4BMEA 1W6MA 2A7AA 1LEDA 1ULFA 4BPZA 1JN2P 3QCWA 1F31A 3R4SA 1RINA 2V73A 1Q56A 3RSJA 1LOAA 4RL7A 4XJ9A 4I30A 2GN3A 5JOZA 3A4UA 3IKWA 3O0WA 3LCPA 3M3OA 4XMIA 3U4XA 2CL2A 5T55A 5JDBA 1A78A 3ATGA 4XHBA 3BOPA 5BYNA 1AZDA 1W6NA 2JE7A 4Q1RA 3W59A 1V6LA 5JOYA 2D3RA 1WLCA 2ZGPA 2ZGLA 1FX5A 3B00A 2AR6A 2EF6A 4XOGA 4Y1ZA 5EXOA 4K21A 4C1WA 1N47A 1W6MB 2OW4A 1MS5A 1DYPA 2NP0A 5H9PA 1BQPA 1MVEA 4YM2A 5KXCA 3APBA 4WVVA 1MZ6A 5HCBA 4PCRA 4YFWA 4XTMA 1AXKA 2ZZJA 2DUQA 2GALA 1JUIA 2AGSA 1QDCA 1S0CA 5JOWA 3ILNA 4XBNA 2AH2A 1RITA 3WCRA 1HQWA 1N3OA 2AUYA 1Y7BA 3SNMA 5T52A 3IPVB 1PZ8A 5F9TA 3T1MA 3VUOA 2VW2A 4XMAA 1GNHA 1WW7A 4GA9A 2DU1A 4RA0A 3WVJA 1LCLA 3FUOA 2ZGMA 1V6OA 3ZPYA 4ISRA 1WCSA 3AZWA 1DHKB 1V6KA 4XYXA 1H9PA 5GZGA 1AJOA 2ZHKA 5L73A 4GALA 4F83A 1ULCA 1V6JA 5DZEA 2YMZA 1KRIA 3M1HA 2YV8A 4C1XA 2GMEA 4LBJA 4YG3A 4Q8KA 1A3KA 3PVNA 1W6QB 4M01A 4FPJA 3FBYA 1UMZA 4DRVA 2GNBA 3WDXA 2D6OX 2XG3A 1LESA 1W6OB 3UJOA 3T1LA 2D6KA 1S0JA 2WSUA 5IK7A 3GNEA 3OBTA 1IKQA 3ZSJA 4Y24A 4ATEA 1AXZA 3USUA 1CIWA 3WOGA 2A75A 2D6NA 1BKZA 3WDYA 1WUVA 4BOWA 3AYAA 1DQ6A 1ZM1A 1FNYA 3MEPA 4YGCA 1S1AA 4PQ9A 1LHOA 1AX2A 2DUPA 3ZXLA 2NMNA 2EIGA 1GBGA 4DRRA 4YW1A 2ES3A 2ZGQA 2H0BA 5DZFA 3FLTA 5GZFA 1CESA 2CWSA 4PF5A 1ULEA 4Y1YA 3IMNA 1LOCA 3M2MA 2D44A 2ZHNA 1SCRA 3H0OA 4FVVA 4XE9A 5DXDA 2UWAA 4FPYA 1WW5A 3B01A 1PZ7A 3AP5A 3WCSA 2A3WA 5GLTA 2OUJA 3PVEA 1WD4A 3A0NA 3POYA 2UWCA 4P9WA 3SLIA 2DVBA 4LBQA 2C5DA 1GZCA 1QNWA 4LBQD 5DUXA 3WG2A 2FHRA 4Q8LA 3N7LA 4FOWA 3WDWA 3ZSMA 4YM0A 2AREA 4P14A 3UJQA 4P9XA 4AYUA 1MS1A 1V6IA 2JDZA 2E53A 2DVGA 3O5SA 3B69A 4W65A 4BLIA 1DLLA 4D69A 1HLCA 5CNAA 3IN9A 1AX0A 1JBCA 1LHNA 1D2SA 1F5FA 1GKBA 2V5YA 5DG1A 2ZMNA 3SH5A 1G7YA 3CNAA 2DTYA 4YZ5A 4XBLA 5HCAA 2DUOA 1DBNA 3B3QE 5GALA 2KM2A 3WG1A 3V65A 5IK4A 1QOTA 1O4ZA 2GN7A 1V6MA 1J1TA 2ZACA 3ZSLA 1IS5A 5GLWA 4Q1PA 3WUDA 1AF9A 1SLBA 2P37A 4UW4A 4JC1A 3O0XA 4K20A 2P3KA 4LBKA 1MS0A 3T2TA 4GKYA 1QKQA 2A3XA 1BJQA 1KDKA 1UZZA 3INAA 3POSA 2E7QA 5GJ6A 1ULDA 5H9SA 1W6NB 1CR7A 1S0DA 2PHUA 2PHWA 2ZKNA 4FPCA 1Q8PA 1FNZA 2A70A 2ARBA 3RG0A 3ZXKA 3RS6A 3V0BB 1SLLA 2D6MA 1R1ZA 3UL2A 4UW6A 2GMMA 3ZXJA 1GNZA 2ZGOA 4BLJA 4Y1UA 1JYCA 1WBLA 4P9YA 3V0BA 4GWMA 1OQ1A 2GMPA 2ZMKA 3AYEA 3BIWE 1AXYA 4NOTA 2A5ZA 2R1DA 1W0PA 1N3QA 2WSVA 2JD4A 5EWSA 3ZYRA 2CY6A 1QGLA 1YO8A 3RMXA 4ISQA 1X50A 5IK8A 3RMYA 4AGVA 4XXPA 2VH9A 1LOBA 1UN1A 4AVTA 1MS4A 3PMEA 4XJUA 1DZQA 1JXNA 2A71A 3TAYA 4R9AA 1CVNA 1S0GA 3ILRA 1GANA 2P3IA 3JU9A 2RHPA 4DPNA 2A6YA 1U0AA 4R9CA 2W52A 2Z42A 2EXHA 2R0HA 3WG3A 3AJYA 3VKOA 4AWDA 4DFSA 1CPNA 4YW3A 1LOGA 3RRDA 2CWMA 4YZ2A 3M3QA 3TB0A 2SBAA 1GZ9A 1LOFA 4FOYA 4AVSA 4Y1XA 1VLNA 5EYYA 3HMYA 4WZFA 4BMBA 1FAYA 2FMDA 4FP3A 1LENA 1V00A 3SH4A 1APNA 3AP4A 3WHTA 3NWKA 3WZ1A 3N35A 2EALA 2ZHMA 1N1TA 4U2AA 4YZ3A 5JOXA 2PELA 2GNMA 2HYKA 1YYNA 3QLQA 2A6ZA 1I3HA 1MS8A 4Y26A 3WUCA 4LBLA 3BODA 1OFSA 1BXHA 1SLAA 3AYCA 1G9FA 2ZGNA
chains in the Genus database with same CATH superfamily
3UGGA 3SCFA 4OUSA 1RUC3 1K42A 5FY9A 1YCIA 2ZA9A 2WAAA 3JBG3 2Y6JA 1NY72 4HFSA 3ZXEA 2G19A 5FRAA 3SXWA 2XBO1 3W20A 2J1AA 3HT1A 2JIGA 2DV9A 2P3YA 3GHMA 1AYN3 2WZR2 1CAUA 3WNXA 2P2KA 2PLV3 1YLLA 4LBNA 1NA1A 4NROA 4ZS3A 1ONAA 5K0UB 2DVDA 4IE4A 2QFEA 3ES1A 3J8F1 4MGSA 1DQ0A 4YSFA 5A33A 3C8XA 5CAZA 3SC7X 5B4NA 3ZYGA 4JKLA 4O61A 2BERA 2PMWB 1XRUA 2A3YA 2GNTA 2QZ2A 4DXTA 4QM9A 4HKLA 4M0HA 4NIHA 3A7QA 2ATFA 3ZMOA 3FLRA 5K7PA 3KV4A 4AEMA 3ZFGC 4PIZA 1PVC2 4XIKA 3WY6A 2HBUA 2RDQA 3UT0A 4Q4V3 5T50A 3RZZA 4AVVA 3ACHA 2VW0A 1TE1B 3I8TA 4Q29A 4HL0A 3PJQA 3G6JB 5D21A 2UYAA 5CG9A 4ZY9A 1LU1A 2IXKA 3MV11 4YVWB 2YHJA 2OYZA 1KFXL 2UURA 1SDWA 1TZOA 1AX1A 3ZMNA 2VO5A 2BWCA 3PTRB 1KDMA 2IXHA 5BNNA 2DCYA 2K46A 4FQ4A 4J1XA 1ZVFA 5CFCB 3R4UA 4NRMA 5C8CA 1TEIA 2FZ1A 4FTEA 4JDNA 4CCCA 2VU9A 1VMFA 3RI8A 1F8VA 3EB7A 2D98A 4CVUA 5KHKA 5IUQA 3OY8A 1O4TA 2FZ2A 1MR5A 1GQHA 2HWF2 1BHGA 3MFCA 4L8QA 3DF0A 3JUUA 2PHFA 5C3OA 1JYNA 3I2HA 1ZRIA 1PK6C 4UFHA 5JXGA 4OYUA 3A0KA 1GLHA 4CDWA 4HSLA 1JU3A 3RZGA 3Q9OA 2LUWA 2WNVB 4O65A 4CCEA 5C3QA 3WHUA 2WZPP 4RQPC 4Y20B 4A6SA 2XJPA 4C90A 4EN7B 3WP6A 3P3PA 2RJ2A 1ASJ1 3PHMA 2Z4FA 3DECA 1GWLA 1NA1C 5FAXA 1ENQA 4DNYA 5IK5A 3VKMA 3NW4A 3ZVXA 3FHIB 2YBKA 5FP8A 3WR0A 4A7KA 1PNGA 4XJAA 3ZXFA 2QKDA 2EXKA 5B2GB 1H1IA 1PX3A 1O4YA 3CKHA 4CCJA 3C7GA 1KITA 4A6OA 3ZLIA 2E6VA 3J7MA 1FYUA 4LK6A 2Q8CA 2V09A 1K5MA 1NCRC 1NT0A 1BLZA 2QDNA 4Y3OA 5FJHA 1LJ7A 2DBNA 4L0PA 4FXGB 4XEZA 4XQDA 5DPNA 3AL5A 1LR5A 2BNNA 2W39A 4MV2A 5BXXA 4R9BA 5FYHA 4RHV1 4TZDA 2ZEZA 4YZ1A 2P1BA 3IMMA 3S30A 2EA7A 5FFOC 4QXKA 4XUNA 5GLVA 4WVMA 5I0DA 1UD1A 1X9PA 4B7EA 2BUKA 2ZX1A 3N7JA 3VBSC 5BNOB 5GLZA 4LMFA 3VBRA 5F37A 3C2UA 2RV9A 4QGMA 4EWDA 3IAQA 4NVPA 1LOFC 5CG8A 4S2HA 5LK7B 1W8WA 4FI9A 4MX3A 5A6ZA 3W5NA 4CP1A 2FDJA 3LIHA 3ZYBA 1O3SA 4UFMA 3DPRC 1CAXA 1VBD1 1ZBE3 4ASMB 4M3CA 4YGEA 2IXCA 1Z0HA 3ASIA 3AMNA 2X8KA 3ETQA 1VBB2 2VPVA 2XOMA 4JHZA 4NHKA 3NV3A 3HIFA 2P6HA 2ZGUA 4GMP0 5LY2A 5FY1A 2WZ8A 2XKOA 2R063 4FPOB 4AEKA 5KC5A 2Q30A 3UV9A 2HEYF 3ZYJB 3VZOA 3VKNA 5L7OA 5L9BA 1DYKA 1JS9A 1WMEA 1IS6A 4RS5C 3DPRB 2ZGSA 1QMJA 2ZX2A 3GXUA 2EXIA 1EY2A 1I1EA 4P9IA 4Y22B 4CU8A 4DY5A 4DS0A 3S7EA 1NLQA 4DZGA 1S0BA 1C57A 1KJLA 3ACIA 5IVFA 2CDPA 1OA4A 4IEOA 4YM1A 2NZ9A 2VOWA 3KVAA 4UFIA 2GZWA 3NNLA 4H3WA 4COYA 1H30A 2VQUA 1XQNA 3E5XA 4PBOA 5FUIA 1RUE3 4BM8A 4U36A 1AR92 2PHLA 1RUC2 1BCXA 2ZMLA 5A7SA 4OI1A 1K5MC 1YFUA 4K1YA 1HJFA 5FO8B 1E5RA 2WT0A 1KQRA 2C9AA 1BYHA 1CJDA 2XJTA 1IPJA 5ACA2 2JKXA 1MQTC 3D8CA 1UYZA 1QOSA 3BALA 1WLDA 4LK7A 1JUHA 4OQ9A 3E6CC 3OYWB 3J7NA 4CXXA 4MYEA 3B9CA 3T0BA 4IETA 1R1A3 2FQPA 1SMVA 3VBOB 2QQJA 5FLJA 2J1TA 1SBFA 5FZ6A 3PUAA 2WR9A 1ASJ3 1SACA 1HB4A 2WO1A 1H8VA 2VCMA 4FPKA 4K8RB 5KXBA 4MGQA 1STMA 2YBSA 4LTAA 4AEJA 4NIAA 2JDPA 3I3MA 1LRHA 4JGZB 1Q8OA 5G04L 1UXZA 2C6SA 3ZSKA 4A7ZA 4BQ4A 1H6YA 4QHZA 1PK6A 4OHWA 1RUG3 5E1RA 1IGOA 4P5HA 2W9XA 2A6WA 2JX9A 3GZAA 1M06G 2B4KA 5DMYA 4CCOA 5JSPA 5DZGA 5GLUA 2ET7A 4WZCA 3VBSA 4DOUA 4HVOA 1AUYA 3AZXA 3PUIA 1XBFA 3HQXA 4BQWA 5FO9B 1W6PB 3F2ZA 1N1SA 4AR2A 1QJZA 1RIRA 5JXHA 1DIWA 2W1UA 3WDUA 3BGAA 2FCVA 3U1XA 4HPKB 1VBC2 2A6XA 3AP9A 1CJPA 1H1MA 2D7FA 2R16A 2XDVA 1VALA 2E51A 3N36A 5CFCA 4ET7A 2L9LA 1W99A 3DL3A 4LITA 5F3IA 4E4ZA 1WGPA 3LDKA 2VQTA 2VW1A 2YXSA 5A70A 2ZJCA 2NM1A 3VZJA 1ZZCA 1HB1A 4COWA 3O12A 4QHOA 3PUSA 4WVWA 5FMOL 3ZFGA 3N9NA 2WNOA 5A7WA 1QJX1 2RJKA 3OBRA 4NPLA 5FYMA 1ZRFA 3B5LB 2R071 5F5QA 3WDVA 4BMEA 1YUDA 1W6MA 3CZJA 4IDZA 1F31A 1LOAA 2HWC3 4JDMA 4RL7A 4XJ9A 2GN3A 3O1VA 1W9FA 3U4XA 4QAWA 2CL2A 2RVAA 1QQP3 2XJRA 3N9PA 2BBAA 2O14A 3KF3A 3D0JA 2PA7A 3ON7A 5FPVA 1DGWA 1OA3A 3GF6A 3IB3A 1V6LA 2X10A 3RPQA 5JOYA 1CAWA 2UY8A 4N90A 3JD72 4FAGA 2ZGLA 5FLHA 1ND2C 1EYBA 3B00A 4Y1ZA 4K21A 1W6MB 2OW4A 1DYPA 4OUMA 5FUNA 2OKXA 2RS12 2XJSA 4LOSA 4YM2A 3APBA 1O59A 2WZEA 1OF4A 5FTTC 3CJIB 4BE3A 2OQ7A 2RMU2 5ABJA 2RM21 1EP0A 3AL6A 4YFWA 5FQ0A 4XTMA 5FY8A 1VBC3 1XOYA 1JYXA 3MIEA 1JUIA 2AGSA 1QDCA 1VBA3 1S0CA 1AL23 3PIJA 3RVHA 3THCA 2WL1A 3WNOA 4CP9B 5FZDA 5A32B 5I8YA 3VD4A 2HYXA 5J3UA 1UY3A 1Y7BA 4XFGA 2VD7A 5I0SA 4CSWA 2QUOA 4AHZA 3VUOA 1GNHA 1UYPA 3MLKA 2DU1A 3OCPA 4INDA 2TBVA 4MXVA 3T2OA 5HPOA 1V6OA 4HG6B 4OHVA 1NE6A 5JIUA 1GOGA 1B35A 1XE8A 1UOGA 3TEXA 5GZGA 1IG3A 3ORJA 2ZHKA 3FJSA 5L73A 1PX4A 3HD8B 2WYSA 3IIAA 5DZEA 2XGXA 3ZFEC 3O1SA 1EV11 2YV8A 4P9JA 2GMEA 1W8FA 4IXLA 4LBJA 1H2NA 4X6QB 1A3KA 3IDEA 1O91A 3C3VA 2EIBA 4IV1C 2G9ZA 4QQOA 4QQLA 4B4PA 4DRVA 3WDXA 5A6XA 3I49A 4NPMA 1IG0A 1LESA 3FBMA 4K40A 5JZGB 3ZSEA 3CEWA 2JEMA 3MI8A 2D6KA 3W9AA 1HJGA 4Q4Y1 1R64A 3KGZA 3OBAA 4KL1A 1IKQA 4XDOA 2R062 3VBOA 3ZSJA 4BU2A 4KWLA 4P9GA 1SDDB 3N4MA 4E4HA 1WUVA 3T0AA 4BOWA 1RJ7A 4N43A 3RI9A 4I01A 1OXCA 1TG7A 5EJ3A 3MEPA 1S1AA 1LHOA 5FV3A 1NG0A 3WEZA 3ZR5A 1Z7S1 5I0TA 2DUPA 1GBGA 2B39A 2RS53 1RUI2 4B3NA 4YW1A 4W8JA 2ES3A 4EE2A 5DZFA 2VVEA 1COV2 3LEIA 4HBNA 4V2WA 3FMGA 1JZ6A 5GZFA 1X8EA 1Y9MA 5FOJB 2X53S 3NO8A 3J7LA 4QPIB 3ZXGA 4Y1YA 3S7IA 1RUF3 3RZLA 3PURA 5A1AA 2W46A 4EZ4A 2D44A 2WAOA 1SCRA 2WFF3 4GH4A 1JTZX 5DXDA 1AR62 3WCSA 5LBBA 3LA3A 2WFF1 5L7OB 1K45A 4OHYA 2Y60A 4A7YA 4PT6A 2Y26A 3RYKA 5EHDA 3VDDA 3P5BA 1QNWA 5BPXA 3WG2A 3I2GA 5JMOA 3N7LA 1POV1 2LM3A 2WDBA 2AREA 3UJQA 3G7DA 4LT5A 4CEYC 1ASJ2 2ET1A 2JDZA 2DVGA 2ZPXA 3B69A 3UESA 3ZM8A 4KWJA 1GMMA 4AI2A 4IEZA 1X36A 1F5FA 1XB9A 2ZMNA 3LA7A 2ORXA 4N7IA 2XHKA 3SH5A 3WP3A 4R4ZA 3AMHA 4CPBA 1DBNA 2BVVA 5GALA 3JD73 3SQOA 3UGFA 4Q0VA 2VMEA 1RXGA 5FZBA 1DU3D 1IS5A 2PXJA 4QT6A 2E63A 3WUDA 3TEWA 1AF9A 1SLBA 2P37A 3T3YA 1HXS3 2YC4A 4XDPA 5FPLA 1OQDA 1I5PA 4G4FA 4K20A 2P3KA 3I2FA 4LBKA 4NN0A 3T2TA 5I0RA 1ZZ8A 1QKQA 1AYM2 3QH6A 1PVXA 3INAA 4B29A 5KHJA 1RVF2 1ULDA 1RUI3 4WM7C 1NCQB 2PHWA 4XURA 5J37A 3UKTA 4AVAA 1JOBA 1UU5A 4LHNA 5C33A 2D6MA 2HWF3 1REDA 2N7GA 2IFRA 2X5IB 2OIIA 3H1YA 2ZGOA 4AK3A 4BLJA 4F8AA 2XLGA 3QH7A 3PVBB 3V0BA 4GWMA 1LB2A 1CX1A 3ST7A 4AFBA 5CVRA 5C3SA 5A33B 4CDXB 3BI3A 5FKCA 2A5ZA 1CX4A 3ZYRA 2Q8DA 1QGLA 3C7OA 5FPBA 4G9SB 3W5MA 2YU2A 1NLRA 1XXNA 5A6YA 1LOBA 1UN1A 2WNVC 4YWAA 1BBT3 1EAH2 2PYTA 1W2AX 3LE0A 1JXNA 4TWTA 5DAWA 4MHRA 3VL9A 1ZZBA 2WFPA 4RQPA 5LRRA 4R9AA 1S0GA 3ILRA 4HSJA 4XUPA 5FZFA 3TAYA 2VXJA 4BXSV 3LDRA 3JU9A 3WF1A 3LEKA 1VRH3 5FZOA 2R0HA 3WG3A 1QJU2 4AWDA 5LATA 4CE8A 5J48A 1NOVA 2KXLA 3TB0A 3ZKYA 1O8PA 1AYM1 4Y5Z0 2HWE1 2XONA 2RR12 3HMYA 5A7OA 2FMDA 2UYBA 4PDWC 1LENA 1J83A 4XZUG 1UY1A 4Z2WA 3WHTA 4BA6A 2ZX0A 5KWRA 4XF4A 2TUNA 1AR73 4K3UA 1VB2A 4AEDA 3O7OA 1YYNA 4Q4Y3 2OPWA 3OB8A 2GH2A 4E8CA 4LBLA 2J1VA 2HEWF 2I74A 1W04A 1FT9A 2OPKA 2CGNA 4JGYB 3WNLA 3U37A 4BJ0A 4BQ1A 3W58A 3ZKUA 1CAVB 5FYSA 2WWSA 3H8XA 1WCUA 4N43B 4OZOA 1XSQA 2XB6C 4XFHA 3MW2A 3HVDA 4XF3A 4YRDA 4L9BA 2F17A 4RSUA 4BK5A 2QCSB 4E4DX 5AC91 5ACA3 5FPAA 2RS31 5FREA 3BTXA 2AEZA 3ZPOA 4MGKE 2LS6A 3U75A 4RD7A 3THDA 3H8UA 2MEV3 3QACA 2LALA 1S0FA 4PQQA 3GJBA 1FV3A 3M70A 1AR61 2ZGKA 3TRSB 2R072 1ZX5A 5LBCA 4K7JA 1GSLA 3ME2A 2FD8A 5T54A 2JWPA 4XDQA 5D8AB 2EICA 5IFPA 1J1LA 3MF9A 4Y22A 5JZGC 4FP2A 3POGA 2ADEA 3ZN6B 3EMRA 2PQQA 1QOOA 3WP5A 1UAIA 1AL21 4PIYA 3IDBB 3VV1A 1OA2A 3LFIA 4ZPIA 5JPNB 1WMDA 3VDDB 2VZRA 3T0DA 1QJFA 1SG3A 2FCTA 1MZ5A 2BOJA 3OF1A 4M3CE 4Q27A 5CFDA 4BIFA 5LRSA 1RUH2 1OOPC 2YPDA 1EUTA 2VZOA 5H9QA 1ND3C 3D6EA 1KJRA 2NN8A 2IVJA 1RMU1 4WM8A 4ZZ8A 2ZKLA 2R0FA 4IW3A 5J96B 4LUKA 1RTVA 4XCBA 5HXMA 4FPLA 1W8NA 3TEZA 3BKZA 2VUAA 1ZBA3 1W8UA 1PO11 1NXMA 1MS9A 3JB8A 3AMQA 4M3CB 4ZU4A 2GC0A 1YXWA 1COV3 3OJBA 3GYDA 2DCZA 1GQGA 5EFUA 2VNOA 2AACA 3NNFA 2O8QA 3VBSB 5BNOC 2RS33 4AGGA 4RHV2 1D0HA 1DGLA 4QDRA 1R1A1 2VMDA 1JI6A 1UZ0A 1W2OA 4AG4A 4DB5A 1SCSA 1ND3A 1RUJ2 5JUVA 1FV2A 3QOPA 2R073 5CFDC 3BTZA 1W2TA 4MLOA 4HONA 3GBWA 1D4M1 1TNFA 3SKVA 1Q8QA 3KB5A 3MPPG 2VVFA 4I0WB 3MW3A 1C5IA 2P34A 2VY0A 4FBFA 5C5TA 5FYYA 2I45A 5CYYA 3ZYHA 3R0RA 4MZUA 3MIGA 2BPA2 3N3HA 4DXRA 3HNBM 1X8MA 2HWE3 2VCAA 3AFKA 5FZKA 1ND3B 2B7YA 3I4IA 1QF3A 4B1MA 4C0BA 3V64A 3EO6A 2WNUC 1NY71 3HN1A 4BXFA 1CPMA 2ADDA 2ERFA 1VRH1 2BGCA 3AX4A 3AXDA 5FCCA 1M4WA 4NHXA 2I07B 4N53C 5JVVA 3GBFA 4CYDA 3NV2A 2W47A 2WO7A 4YW2A 2HH9A 1C4RA 3FL7A 4JTOA 5DABA 4IL7A 2VBPA 3WF2A 1JOPA 5T5LA 2D6LX 1GP5A 2ZBJA 3H1MA 2P5BA 2W5FA 1LGBA 4QX3A 1W6OA 3KV6A 5C4WC 4YNIA 1RUI1 3WW1A 2C26A 1F4HA 2R043 4UW3A 2VNRA 1GR3A 1XNAA 3LEGA 2DCKA 4XQ4A 4YZ4A 5E8AA 5BNPC 3OGGA 2IXIA 4LEJA 4QXBA 1RUNA 4XTPA 1ODNA 3VBUC 4QPGC 1HN1A 3CZUA 4LBMA 1VAMA 5JXIA 5FQ0B 4MOAA 3OGSA 1IS3A 3AKQA 4LA3A 3BUCA 1G86A 3E97A 4XIOA 5FWJA 3AC0A 4IV3C 1L3JA 2EAKA 1FATA 1S2BA 3LD8A 5A7QA 4AVBA 1BK0A 1GICA 1LHVA 1NQJA 1JYWA 2VTXJ 4NMIA 4RQPB 1HV0A 4JKKA 1MVQA 1W6QA 1UZVA 2A73B 2RMU1 4LBQB 4M3CF 1YC61 4Q4X3 4SBVA 4XBQA 4YGBA 4Z2AA 2WO3A 5AVPA 4UYBA 2Q1ZB 3DCQA 4CEWC 1JZ5A 3WW2A 1AVBA 4LQRA 3R4DB 1XYOA 4ASKA 3WG4A 4BIOA 1IQDC 3NAPA 3UNPA 3S5QA 4GXLA 1AR82 5A3OA 2NPIA 1K12A 1MACA 4CDXA 2VXRA 5FPZA 1JOJA 4QPGA 2ZCWA 3SISA 2JG9C 1AYM3 2IWGB 1RUD1 3JCIA 2SLIA 5F5IA 1W90A 2HEVF 4CCMA 2DDUA 5BNPA 2Y6LA 5FP7A 2RDRA 2VL4A 1UIJA 1OOPB 2VZPA 3I54A 4YG6A 3OTFA 2DFCA 3VKFC 2DWRA 4FOVA 4EV0A 1PGW1 5FK7A 2ARXA 3SH3A 3BTAA 4LPLA 2D6PA 1UMHA 2DVAA 2CAUA 1SPPB 1YI7A 2Y0OA 1B09A 1BBT1 1H8TB 4LXLA 3SKJE 4MHUA 1OURA 5JLVA 2WBKA 1Z78A 4H55A 1AL0G 1KXGA 4LKEA 4WVZA 1H4GA 1A8DA 5FYVA 4JQTA 2ARCA 1NCRB 3MF6A 4FSJA 1PO23 3FFZA 3H3UA 3KVBA 3RDIA 3LEMA 2R30A 1OKOA 2DTWA 4N9IA 4CEWA 1ACCA 4Q26A 4HK8A 4TTGA 3KQRA 3I97A 2R1BA 4FO9A 4GULA 3I2OA 1PZ9A 1QDOA 1WCDJ 4BQYA 2ZABA 1NYWA 1UU6A 3WV6A 1C3HA 1GUIA 4XCAA 1O3RA 2FDGA 1OSGA 2CTVA 3DGTA 4IV3A 2W92A 2F6BA 1PGW2 5T3NA 1R082 1XE7A 1XU1A 1UF2C 1XC6A 4CPBD 2YGMA 3NV4A 2WQZC 1FPN3 2JENA 4YW6A 1JYVA 2JDUA 1JYTA 4FFHA 2C9KA 4HN0A 5SV5A 5IAXA 2O0OA 4A3XA 2GNDA 2VZQA 3AKPA 5CU1A 3ZFEB 5HI0A 4HETA 4LHKA 5HV0A 1JZ4A 5JMCA 4L99A 3D5OA 4BZ4A 2HWB1 1LEMA 2LW8A 2WNEA 2ZHLA 3CLPA 3VBRB 3S5AA 1RHI2 1W9YA 4BQ5A 3D82A 2YROA 4BISA 5BNNB 1JW6A 4UI9L 5HCFA 1JZ8A 3BIEA 3I2KA 2RE9A 5KBFA 2ZGTA 1QWRA 4GQ7A 4COVA 3VDBA 2QTWB 1MS3A 3E5UA 1POQA 3FHAA 2FDIA 2VMHA 4GB31 1UIKA 2BFUS 2Z69A 3I2IA 5IT6A 3LDBA 2XUMA 5DDJ1 1DF0A 3K51A 4OMDA 3S0MA 1LGNA 1GV9A 4C91A 1SLTA 5FOBB 3TN91 2ENRA 1SBEA 3LOIA 3AP6A 5BNQA 1GYKA 1W06A 4XAEA 1HDKA 1NCQA 2QQVA 4Y5SA 2PHTA 3KM5A 1LHUA 2E7TA 4Z07A 5F32A 3VBOC 3VD3A 1VBA1 1OH3A 4CU9A 1HRV1 1C28A 4W6YA 1PGL2 1LEDA 1ULFA 2BFUL 3QCWA 3R4SA 1RINA 2PFWA 4IGPA 4XFIA 1HB3A 4KU7A 3A4UA 3IKWA 2GP5A 2NLRA 3M4FA 5JDBA 5T55A 3WD5A 4XHBA 1U12A 3BOPA 4RR3B 3VDAA 2IZWA 2QQKA 4ZU7A 4JHTA 1J59A 1AZDA 2JE7A 3U07A 1PVC1 4G3YC 3KCCA 5G05L 1QJX3 3KHCA 3K46A 1FMD1 4D3WA 1XE0A 4MGTA 1WLCA 4BQXA 2ZGPA 3PJYA 5HXVA 1BK1A 3H8OA 4AFCA 4XOGA 2EF6A 4AQSA 1W2UA 4C1WA 3H8RA 2DBIA 2HWD3 4HK9A 2WC2A 1MS5A 2H0VA 5KHGA 4OQ8A 4RFT0 1NZCA 5H9PA 4CEYB 2JDAA 1BQPA 3O1OA 2GC2A 4JV4A 4NJ4A 1MZ6A 5HCBA 2CU5A 3JQWA 5F2WA 4JGZC 4CCNA 1PIV1 4AF9A 3ZR6A 4DIQA 1DZTA 1UQXA 4FAHA 1UYYA 4XBNA 3RWNA 2R042 2XH6A 5FPXA 3J8F3 4FFIA 3WCRA 2W91A 1W8HA 5T52A 4PJYA 2VCCA 5ISLA 5DAVA 3VBUB 2RS32 5BY5A 2QQMA 3RGBA 5F9TA 2VW2A 4XMAA 1WW7A 1OOPA 5FY4A 2LROA 5I0UA 5AFEA 1LCLA 3BPZA 4AEDB 1XNTA 3N9LA 4QHBA 1R093 3AZWA 2ZTNA 1V6KA 5D2AA 3NMBA 1AJOA 5EJ1B 4XACA 2ZEYA 2XVKA 1GU3A 4LO6B 4YG3A 5I8TA 5JZGA 1UNBA 1W6QB 5HBAA 4M01A 4AZZA 1UMZA 2B45X 1RUC1 2K2SA 3OUHA 4JDOA 5A3WA 3C7EA 4OMCA 2BGPA 4CCLA 4K9SA 1MEC1 1U5ZA 2RM23 3CQOA 4ASLA 2VQAA 3T1LA 4EQVA 3ROUA 3GNEA 4QQ2A 3AVSA 5IK7A 1C5HA 3OBTA 4JX0A 4Q0UA 5FKBA 3WX5A 2VVDA 4Y24A 4FCAA 3USUA 1WLTA 2ILMA 3BB6A 4JGYA 2VTXA 4S2FA 1BKZA 1RVF3 4DUXA 5FZLA 3WF0A 1QJU1 1DQ6A 1UOFA 5AC92 4HMZA 1Z7S2 1ZM1A 1PGSA 1OPMA 4FXKB 3SHRA 3DYMA 1FNYA 4GMP1 4LKDA 4QX2A 5FYUA 5CFCC 4JTNA 3ZXLA 2NMNA 2EIGA 4Q4X1 3VBFB 2BWAA 2JB4A 3POBA 4MG2A 4CEWB 2VOKA 2H0BA 2ZGQA 5DAQA 2QZ3A 1H8TC 2CWSA 2OS2A 3OD0A 2YC0A 2ZZQA 5E6HA 5KR7A 4FVVA 3POEA 2YGLA 1YJLA 4Q0SA 4QPYA 1PZ7A 5FZ0A 2FBEA 4CCDA 5FP9A 3PVEA 1FPN1 2UWCA 3K2OA 3DV8A 4QKNA 1GZCA 4LBQD 1W0NA 1WCQA 2D97A 3NJVA 4Q8LA 3WDWA 4CXWA 3ABZA 3I59A 4P14A 1NAEA 3VZNA 3HAGA 3NRUA 3OGVA 4KWKA 1RHI1 4NRPA 4W65A 1LAJA 1ALYA 1HLCA 3CL1A 3H9AA 3IN9A 4JKMA 1XYPA 1PGL1 3RZKA 2V5YA 1G7YA 4AW7A 1O7FA 4QQPA 1DZRA 2DUOA 3RFRA 3ZIXA 3VDDC 4OHZA 3H3ZA 2XR4A 4MADA 3B3QE 3GHNA 4PDWB 3J7HA 4QXCA 3WNNA 3ZN5A 5BV6A 1RYYA 1PO21 3BU7A 1QOTA 1O4ZA 5A3MA 1RC6A 1J1TA 1OUXA 1NKGA 2WIIB 3MDPA 3ZSLA 4DUWA 2VBDA 1DP0A 1L7RA 1MQTA 4UW4A 3VBUA 2QNKA 4JC1A 2OQ6A 3VLBB 2RR11 2VMFA 3NL1A 4XFBA 4KG0A 1RHI3 1BJQA 2C0ZA 1HV1A 3BN6A 1RUD2 3POSA 3UKVA 3K4AA 2VNVA 4FFFA 2J1SA 5C4WA 4Z1VA 3ZXKA 1VBD3 2CV6A 1ZBE1 1Q8PA 1EV12 1FNZA 2ARBA 5IHRA 1KFUL 1SLLA 4META 5FUPA 2GH8A 2JD9A 1YIPA 3VZKA 4UW6A 4XF1A 2EIDA 4EN9B 4D94A 1WKYA 1GNZA 3DKQA 3ZXJA 3VHPA 4COZA 1POV0 1WBLA 3AKRA 3LA2A 4P9YA 1RUD3 1SFNA 1RUF2 4I02A 4RR3A 2ZMKA 3M7AA 3AYEA 3ZN6A 1W0PA 1E5SA 5EWSA 5CFDB 5JPMB 2VZTA 5FXXA 2R32A 2CHHA 2W95A 3RMXA 2WNUA 4ISQA 1X50A 5IK8A 2WA3A 3NNMA 2VMGA 1QJY3 3TN92 1XSRA 2B9VA 3VHNA 5JI7A 4QX7A 1F35A 2FDKA 4HZFA 2XPJA 5EP9A 3UETA 3OGJA 1DZQA 4XJUA 5IATA 3FWEA 3N9QA 5EPAA 4DUVA 1GANA 4UF0B 4AFAA 2WZR1 3ZFFB 2RHPA 5FMBA 2W52A 2P4EA 5FO7B 3AJYA 5LCWL 2QQIA 4YZ2A 3M3QA 4GJZA 4AVSA 3FFQA 1LOFA 1QH7A 2RR13 3L9JT 3QD6A 2O8OA 2GAUA 5A3NA 3VBRC 2CGPA 3EBRA 4Q4V2 4ZONA 4FP3A 1VBE3 4CU6A 5JSOA 5EIYB 3I3BA 1F4AA 3LGRA 3N35A 5CEHA 4U2AA 2PELA 4KI5M 4NRQA 3URFA 2PTMA 2B8MA 2B9UA 1IPKA 2BTVC 3JQXA 3USSA 1OI6A 3BODA 3J4UH 4KG8A 3MIFA 3RZMA 1AJKA 3NNGA 4BHPA 4EN0A 3AJZA 5AVAA 3M3CA 3OBZA 1CQ9A 5C9AA 1CGPA 3LSDA 2VM9A 4ZKTB 4WM8C 2D3SA 2HWC2 1UL9A 2D5FA 1YIFA 4Q4X2 1B35B 2YDEA 3JBG2 1W0OA 2WABA 3S57A 5JCTA 3DUIA 1ENSA 4QPIC 2G4IA 2VQ0A 2BBVA 4KBZA 2PAEA 1V6NA 2ZX4A 1WBFA 3V0AA 2BRTA 1MQTB 3OEBA 4I3GA 1IKPA 2VMCA 4TYSA 4CRQA 1C1FA 1LU2A 3CBNA 3IAPA 1UMIA 4UBHA 4F7ZA 4IV1A 1LODA 1ULPA 3D4KA 5L36A 1UZWA 2J1UA 5FXVA 1YQ2A 3OSDA 2E31A 4PBPA 4GIQA 5LA1A 3WINE 4A2UA 1JZ3A 4NHYA 1OBNA 1V9U3 1GNYA 5FY7A 1C8NA 2JE8A 4CUBA 2PHXA 1LHWA 3CHXA 1J3QA 2IXJA 5IAVA 1S0EA 5FZ9A 2VZ3A 1BZWA 2DF7A 1CAWB 4IE7A 3ACLA 1X9TA 4M4RA 3MUY1 4YYOA 2XWJB 1CAVA 2O1QA 3HWJA 5ANNA 3VKLA 1F5JA 4MSVA 4Q0QA 4NWVA 4BQ2A 4DO0A 1UY4A 2BQPA 2WN2A 3BPSA 2W68A 2EVXA 5C8CB 4R4XA 4SLIA 3RQ0A 3WDTA 4BCUA 1DFQA 4TN7A 3THPA 1LULA 2YYOA 3VD5A 3MUZ1 2WQ4A 1OVPA 4D7SA 3FN9A 3GJAA 4EWEA 2BP6A 1CAUB 1R091 1YI9A 5DDJ3 1N1YA 5JAXA 5J7MA 1AR63 1A8MA 1YEWA 4GB33 1VB4A 1VBA2 1NQDA 3PVOA 4P5YA 2BJSA 1C1LA 2W87A 2VZVA 2W1SA 4H14A 3N7KA 2Q8OA 1DYOA 1VAKA 4FPGA 1D4VB 3AZYA 3VBFC 2PN5A 4LBOA 5FMCA 3VBHA 4AQ6A 2WYFA 4MGYE 1Y4WA 1OFNA 4DQAA 4LHLA 4FPFA 3N9OA 1SBDA 1X33A 2W1QA 4LO7A 5FIXA 5F7UA 5CA6A 4GKXA 3ZN4A 4YM3A 3R05A 2J42A 3MLJA 2WNVA 4Y1VA 3LIGA 4K8FA 3WQ7A 5E16A 4QPIA 2QQPA 1OD3A 3V56A 3HOBA 2AZ5A 1I5ZA 1KS5A 1QJX2 1QQP2 2WLPA 3I2DA 3MW4A 4FPEA 4B4RA 1W03A 3V0AB 4D6RA 3BU0A 4GWJA 5KXDA 4KMQA 3A21A 5FP3A 5JR7B 3NJYA 2D3PA 4PLOA 3Q8CA 1DQ1A 4XHXA 4H7LA 3I3QA 4CDUC 1UOBA 3HBZA 3VL8A 2WRAA 2Y64A 4P00B 1O3TA 2R7EB 4JRLA 1ULGA 1FOD1 1F9KA 2DVFA 3AMPA 3KGLA 3ENRA 1Q8SA 1WD3A 3KT1A 1GP4A 1XNCA 3DYOA 5FYCA 1ZYBA 3L2YA 1UY0A 3MV01 1ZRCA 2XBO3 4GAZA 5FZGA 3NKGA 2R6QA 1D4M2 3L2HA 5F3GA 5L7OC 1E5IA 3AXEA 5KHHA 1TNRA 1OPOA 2B42B 1YRZA 2BVBA 2X09A 3KD4A 3TN93 1QNYA 1V0AA 4DXZA 5J1XA 5J36A 1ENRA 3OOXA 2GC3A 2J7MA 4A44A 1MEC3 2JKBA 4XJ8A 1HRV3 3ZFFC 4CEYA 3D3AA 3IIIA 4BWOA 2YZ4A 2RS13 3KSCA 2YB7A 1H9WA 3KF5A 1Q8VA 2JJ6A 4LR4A 1C8M2 4Q5OA 2JXAA 3DN7A 4AFDA 2JDKA 3B93A 4RYDA 1AR81 4W50A 5K4LA 1X7NA 1SHWB 2RMU3 1LECA 1XYNA 3KV5A 1FOD3 1UZYA 2BGOA 2WINB 3T2QA 3KT7A 4QX0A 4DEVA 4E8DA 1ODMA 4WV8A 1HQLA 4RGAA 1O8SA 1EV13 2Y0IA 1UX6A 4AI3A 3AP7A 5IVVA 1PIV3 4AHWA 1PMHX 4LORA 1LOEA 4WBBA 4HLTA 1O6UA 2PQSA 4X6RB 2MNGA 5K0UC 5F3EA 2BOIA 3MYXA 4MVTA 4PI2A 4B4QA 5FBJA 1KGYA 1W3VA 2TEPA 4LE3A 1QJY2 2RDSA 1K5MB 2Q1MA 2QJVA 2UU8A 4Z8BA 5H9RA 3KT4A 3E5QA 4XF0A 3ZFFA 4QKDA 1Y43B 1T2XA 2PAKA 1J84A 4HVQA 2OUHA 3AZZA 4JQRA 4UBGA 5LY1A 1W28A 2ORZA 4IEQA 3VZMA 4CDWC 1POV3 2QQWA 4MO3M 4WVMB 3VBFA 2D5HA 5E88A 2ZEXA 1I6XA 3HR9A 1B35C 4K1ZA 4E27A 2BNMA 1GZTA 1R081 4NIGA 1SFYA 3AK0A 3POIA 4GWNA 4DINB 3N7MA 1LTEA 1S4CA 3VHOA 4D6SA 1G9DA 3KS7A 3U14A 4MUVA 2E26A 2XHNA 2IXLA 3LF7A 5T5OA 1Y3TA 1QQP1 5DUVA 5JSRA 4I0BA 5EJZB 1H8TA 2OA2A 3HPNA 1VMJA 1G8WA 4IERA 2Q5TA 3WXPA 3AVRA 3VB9A 4OHXA 1GFF2 4Z82A 4GJYA 4QD2A 4CDUA 5KXEA 4IEVA 1S0IA 2AYHA 3MBWA 1PIV2 1WLWA 1AR93 3OPZA 5ABJB 1NCRA 3OY8B 4ZZ5A 1OLQA 1HW5A 3KWVA 5IVEA 3C7HA 2XUEA 1LNSA 4YVWC 1UPIA 2HWB3 2JG9B 1RL3A 3EJKA 3LPFA 4KWUA 3USUB 1FXZA 2JE9A 2WWUA 1PO22 1ZZ7A 1JYIA 1UKGA 3AZVA 1W9TA 3IDCB 2PHRA 2WN3A 2VZUA 1VJ2A 2VOVA 1COV1 5SV8A 5EQUA 4Q2FA 2A7AA 2OZJA 4FFGA 4TXWA 3T30A 4AQ2A 4BPZA 1JN2P 4IE0A 3POFA 4E2SA 2V73A 3KQ4B 1Q56A 3RSJA 1R1A2 3BYWA 3GZTB 4I30A 5JOZA 3ZXDA 5F2SA 3GGLA 2ETEA 3M3OA 5FK8A 1BMV1 5K8SA 4QB6A 3ATGA 2MEV2 4YW7A 3HJRA 4PIXA 1V9U2 1W6NA 3PU3A 4Q4W2 4RGKA 4KU8A 1MPXA 2X29A 4Q1RA 4UXAA 1OUSA 3TNQA 4HN1A 3W59A 5FR3A 4ZXEA 2D3RA 1VBB1 5FP4A 1LKNA 1WMFA 1W8OA 1YHFA 4IUGA 4E4SA 3MFAA 2AR6A 4YVWA 2V72A 1DGWX 3OUIA 4IESA 5F8PA 4KNCA 4UAPA 4PLMA 2NP0A 4FT8A 5A3LA 2VE1A 5KXCA 2VZ1A 4QX1A 4EN6B 4WVVA 5BNNC 3M8LA 4TLFA 1AXKA 4URTA 2J22A 4O9GA 2NQYA 2DUQA 4RGGA 4AI1A 2BNOA 3KV9A 4NIIA 5JOWA 3ILNA 3ZX7A 3LAGA 5A7PA 1RITA 2C24A 3EYPA 5A7WB 4CDQA 2AUYA 2QE3A 3RWKX 2HWC1 1D7PM 4XFFA 3VD9A 5DN2A 2YUEA 4QXHA 3U4SA 1D4M3 3F95A 3E1F1 4RA0A 2XBO2 4NHMA 4A42A 2IVIB 3DXTA 4AI8A 4ISRA 1C8M1 3K3NA 1V9U1 3LQCA 5D8AC 1KD7A 1DHKB 1Q3EA 1H9PA 3K77A 2ZEWA 1KEXA 2DCTA 4GALA 4ZS2A 1V6JA 4GH4B 5FJKA 4CDUB 4DEQA 4F83A 1RUE1 1HN0A 2ZOEB 3M1HA 1JODA 2JDHA 4BK4A 4F3JA 2ZXQA 3KCYA 4FPJA 3FBYA 5FY5A 3QBQA 2GNBA 2D6OX 2Y33A 1VBE2 1WCKA 4NAMA 1W6OB 4V1PA 2VMIA 1PO13 4RN5A 5LEKA 1H2LA 4R52A 1IPSA 3AB0A 3MLLA 1S0JA 2YFUA 1OLME 2FDFA 3KMHA 3Q8BA 2BW8A 4D0QA 5A7NA 4ATEA 4IGOA 1RMU3 3H3LA 3WOGA 2A75A 2Y6HA 3KHBA 2RJLA 2D6NA 5I8SA 4LO8A 1HXS2 5LB6A 1HRI3 3PDQA 3ECQA 2YPJA 5CKQA 2JG8B 1OMIA 2H6BA 2D93A 5CISA 5JR2A 4ARXA 4QKBA 4YGCA 3HBKA 2OXBA 4PQ9A 3WNPA 3NSTA 1AX2A 4XC9A 3W21A 4P08A 3K4ZA 1WWYA 4KH9A 5JIAA 4HKWA 4TLGA 3VDCA 1UYXA 1UWWA 4D6QA 4CA9A 1F2NA 3H7JA 1CESA 1J3PA 5LBFA 2HKXA 1ULEA 4LIVA 3FE5A 1JH5A 3IMNA 2W3JA 4LLFA 3KCXA 4H2AA 3H0OA 4XE9A 1VBE1 1EPZA 1YNAA 2A1XA 2BDRA 1WW5A 2VECA 4FPYA 2VULA 2W2IA 5LA9A 3ZYFA 4M4PA 2K9ZA 2A3WA 2OUJA 3GCWA 1A6CA 3SLIA 3TBDA 5I93A 1RUG1 2CAVA 4NHLA 1CZSA 5DUXA 1IQAA 1W39A 1VRBA 3O1PA 4FOWA 1TME1 4YM0A 5DQ0A 3ZSMA 4AI9A 5C3PA 2V4AA 2WZR3 4HXCA 3LFMA 4P9XA 4AYUA 1K3IA 3O5SA 2E53A 4S2GA 4BLIA 1GWMA 1DLLA 4D69A 4CDWB 1JBCA 2QDRA 1GKBA 3O14A 5A80A 4CU7A 3DPRA 2DTYA 4YZ5A 5HCAA 4FTBA 5JI9A 1HRI1 2KM2A 1US2A 4MXWA 4QU2A 2XKPA 5FZCA 3V65A 4HT1T 3GZUC 5GLWA 1HQNA 4QPWA 1IZ3A 3H42B 3U78A 3T09A 1JZ7A 2C4XA 5C4WB 3O0XA 1T6GC 3LZZA 2KA3A 2GP3A 1OQEA 4GKYA 2A3XA 1YQ5A 1KDKA 3ALQA 4CXYA 5GJ6A 2G1MA 1W6NB 1CR7A 2PHUA 2ZKNA 4J25A 4Q4W1 4QPGB 2A70A 3RG0A 3RS6A 5HV4A 3V0BB 3R6SA 3FZ3A 1RUH1 1YQ6A 2WWJA 1DG6A 2C1FA 3B7MA 1JYCA 4LE4A 1U5YA 4WM7B 3Q8EA 3VD7A 1OQ1A 5FZMA 2GMPA 2JG9A 2HWB2 4M0NA 3ZYIB 1AXYA 2UY9A 5FMDA 1VP6A 2JD4A 2VAUA 3OD4A 3EHKA 1YWKA 1K5JA 1YO8A 2VTFA 1SFPA 1J58A 2JIJA 3RMYA 4AGVA 2D40A 4LNVA 4XXPA 2VH9A 1VBB3 1CD3G 1NE4A 1R092 2PLV2 4H7MA 1QXJA 3IZOA 3K75B 4XFCA 5JXJA 4DMIA 2VNGA 2A71A 1JHJA 1OC1A 4EYUA 2BV4A 2JDYA 4KGGA 4QB1A 3LOBA 1U0AA 5EV7A 2HLEA 2Z42A 3VBHC 4DFSA 3VKOA 3P6BA 1CPNA 2CWMA 4D7YA 4Q4V1 4J6GA 5DAXA 2SBAA 1GZ9A 5APAA 3WNMA 5C71A 1H2KA 5FMOS 1VLNA 5J09A 1I9RA 1ZA7A 1RUOA 4WZFA 4BMBA 4HPKA 4GD4A 1KRIA 1APNA 3AP4A 3I7DA 5A3PA 3NWKA 5C8CC 5LW9A 5ACA1 5AC93 2HWF1 5JOXA 1N1TA 4YZ3A 2GNMA 1GP6A 3MZHA 4QX8A 4RHV3 1AR91 1MS8A 2W0XA 4Y26A 3WUCA 5C9AB 3VBHB 4JGZA 3WQ1A 1SLAA 3Q8FA 1ZZ9A 2PLV1 2ZGNA 2J1RA 3GALA 3MGUA 5DDJ2 1W9SA 4UFKA 5E89A 5FZ4A 5GKAC 2VUDA 5FZEA 1IS4A 2X5IA 3HQRA 3IBMA 3LB9A 1VE0A 3RZHA 2CGOA 4N9HA 1ST8A 5A3TA 1NZIA 5F5CA 4ZU5A 1UPSA 4XJZA 5LWBA 4AFMA 4LKSA 5IVBA 3KZ4C 3UGHA 4KBBA 4NO4A 5L19A 3LSEA 5FZ1A 5GZDA 1SQ4A 1YFWA 1IOAA 1PNFA 2XJVA 2EAAA 1G9CA 3U10A 2CYFA 4P9LA 2VBBA 1REFA 5FYTA 3CDZB 5FYIA 2VJXA 5GM0A 5LZ6A 5FZIA 2AENA 2ZAAA 4JAAA 3T08A 1D0GA 1OF3A 4YLZA 1XPWA 4RS5B 2WKKA 5IVJA 1W3XA 1WMXA 2VOTA 4FQZA 2DURA 4FOQA 2MPFA 3VZLA 3NKTA 3O0VA 5A3UA 2NMOA 5F1RA 5F6LB 1XNKA 1G9AA 1OLMA 3OYWA 4OCTA 4OULA 4QU1A 4GWIA 3OGRA 3SEPA 3VN4A 2VUCA 2XLAA 1RUF1 4XXAA 1GZWB 2JDNA 2V4VA 3I3EA 4PLNA 5EYXA 4CUGA 4IEUA 4R8HA 3SITA 4UW5A 1LGCA 3CO2A 3WNKA 4IE6A 4IEYA 5C9AC 2K0GA 2FDHA 4JCKA 2YY1A 1ENXA 1W6PA 1IHMA 2BEOA 4FPHA 3K3OA 1Z7S3 3HN3A 3MO4A 1FI2A 4CDQB 3MIBA 4W6XA 3A23A 2WO2A 1YFYA 2CDOA 1UKRA 5DG2A 4YW4A 5C7GA 3U0ZA 3WF3A 4M00A 1BVP1 1CZVA 3WP4A 4ZXKA 2E33A 5LK5A 5FZ8A 3IWZA 1FMD3 2YBPA 5D1IA 2B5HA 4ES9A 3E6BA 5K9YA 3M3EA 4A45A 3X29B 2QQUA 2ID4A 3FUQA 2YU1A 2YG0A 5KC6A 4HANA 4OUEA 4E2QA 1UX7A 4LJHA 5C6CA 2ARAA 1JZ2A 4D8MA 4GB32 4XF9A 5IVCA 1AYN2 3B94A 4ES8A 2LRPA 1VBC1 1CAXB 2EIEA 1TME2 2E32A 1CZTA 5IW0A 5FYZA 4A4AA 1FPN2 4ARYA 2VGDA 1EPWA 3K48A 1NLSA 4E9KA 2EXJA 2I2SA 4QMAA 5F3CA 4Q4Y2 2DYCA 2BZDA 2JG8A 5IYYA 2Z79A 3J26N 3MHZA 4PF1A 2R49A 1QEXA 3ILFA 4RR3C 4XETA 1QU0A 2Y6KA 2KD7A 2X5IC 2RM22 3EQEA 5FPUA 3PLQA 4AGRA 1RUH3 1UO9A 2P17A 4OFGA 1OH4A 5C5UA 5IVYA 5J98B 5JWPA 4QKFA 4A3ZA 1P8JA 2DFBA 5ANQA 4Y4YA 4EJRA 4QB2A 3RYPA 4P02B 3VGIA 2XJUA 3AYDA 4YG0A 4AEDC 4D7TA 5C3RA 2A6VA 1QHDA 1NXD1 2WS93 4XAAA 1H1AA 5DUWA 3DEMA 4LHSA 3BOWA 2RS51 5A1FA 4CTEA 1GOFA 4IV3B 1SEFA 4CP9A 3PTYA 1ZREA 4PDWA 3GBGA 3POWA 1MZEA 5DUUA 2XQXA 4I0AA 1BBT2 1EAH3 4OZXA 4N7UA 2XL7A 4XILA 3DXUA 3FX3A 4ATFA 3JZVA 2CNAA 4B1LA 2G9FA 2DU0A 1QJEA 4UFJA 5DAPA 3IDAA 4Q4W3 2WT2A 2W08A 1JHNA 1MEC2 2Q8EA 1VRH2 5T5JA 1DQ2A 3ETPA 5FWEA 3K4DA 3D0SA 3RJ2X 4ITCA 3FLPA 4IEXA 4CZSA 4ONUA 4ORFA 1ND2B 1ZA4A 3T4VA 3UYJA 3WLUA 1PHMA 1TME3 4AE2A 1QXPA 1EUUA 2QQOA 4R9DA 3NJZA 1PO12 1DLCA 1DQ4A 3OPTA 3PU8A 5C70A 2WQ8A 5TSWA 2W94A 2DCJA 1CN1A 1AR72 4JRAA 4E2GA 3O1MA 4LOTA 4AVCA 2NYYA 4Q0PA 2ZGRA 3U11A 1OD5A 2IFWA 1HKDA 3NV1A 1CONA 1U5XA 3ZYPA 4EROA 4C8DA 4LULA 1W8TA 4XFAA 5A6QA 2R041 4V2VA 3GZEA 2OT7A 2OVUA 1F15A 1WZXA 2ZAHA 2GC1A 4HVRA 3UK9A 2XWBB 3ZXAC 5L9RA 3TNPB 3H50A 2YC2A 2UWBA 4KGQA 3SCGA 1X82A 1WW4A 4L92A 1CIYA 1VIWB 1WA4A 4OI2A 1VAVA 2WLQA 1N3PA 2PAMA 4N53A 5IJRA 4YFZA 4OVEA 4YGDA 1PM4A 3MIHA 1J3RA 4CDXC 1VR3A 4JGYC 4CCKA 3NVCA 2Y6FA 1UU4A 2FMYA 2WJSA 1GZWA 1VMHA 3PNAA 3RNSA 2WUHA 4XABA 3I3DA 2QVSB 5FZOB 4L2NA 3ZDSA 4XPVA 5CB7A 3OG2A 1RUJ3 5T5PA 4XJWA 4IQPA 1ULOA 2XXZA 4Y20A 4K6BA 3NNJA 4XZPA 1HRV2 2XMLA 4NUBA 5GZCA 4LIUA 2G9GA 2XL9A 3T4HB 5FDBA 1HX6A 1C8M3 3WW4A 3AKTA 3POJA 3PUQA 5FZHA 4AQTA 4IE5A 3FHQA 4XUQA 3CMGA 1DQ5A 1W9WA 3JXSA 4CUCA 4GH4C 4FTSA 2JECA 1VBD2 2D43A 1G9BA 3IPVA 4MGIE 3B02A 3ELNA 3WF4A 2GSYA 4NR1A 1YQ8A 2GDFA 2LTNA 3H1WA 3M3IA 4AHYA 1WW6A 4YVSC 3CJIC 4YW5A 1OKQA 1RMU2 1SLIA 2P3JA 4XW3A 1BEV3 3ZIWA 1OT5A 3TWIA 1AHSA 1DCSA 3AMMA 3BVCA 4NAOA 5GZEA 3H7YA 4I09A 4UFLA 3PIGA 5CBLA 1Y9QA 4LO4B 3IM0A 3NAPB 2WT1A 4KQ7A 4Z92B 3RYRA 4JZRA 2MHFA 1T6BX 3HNYM 2J1EA 1H4HA 4X8NA 2JG8C 2RDNA 2YFZA 2R061 3HT2A 1N1VA 2QQLA 1URXA 2H6CA 1TVGA 2V5DA 4IGQA 1BVVA 4AOCA 3ES4A 1OVSA 1H0BA 1SLCA 2ZX3A 3ITQA 1Q5OA 2E9QA 4AHXA 1TQ5A 4RFRB 1UOJA 2WNUB 1ZNPA 3WQBA 1MZFA 3HNMA 3TOJA 5HCHA 3O0WA 1RXFA 3LCPA 4XMIA 4Y5TA 3ZOIA 4B7KA 4BDVB 1W2NA 4CP2A 1A78A 3SEEA 3A22A 1V70A 1D2QA 2HJIA 2X05A 5BYNA 1ZBE2 1YJKA 2MEV1 4B8EA 3CU7A 5D8AA 3C7FA 3WT3A 1H2MA 1QJY1 3RZJA 1NCQC 4AAXA 4L97A 2PHDA 4HOOA 1FX5A 2Q4SA 3FC0A 4QGNA 4BYYA 1DGRA 5EXOA 4DXSA 4YARA 1N47A 3GCXA 1O3QA 4QDSA 1E5HA 3KLSA 4XUOA 4EN8B 1MVEA 1UCXA 1TMF2 4TSVA 5BNPB 5FZ7A 4PCRA 5FZAA 4WM8B 2ZZJA 2GALA 1A34A 1YFXA 5LASA 3PUHA 4GMP3 3CJIA 2Q0AA 1ZBA1 1AR71 4YVSA 2AH2A 5ABJC 1PM7A 1CWPA 5LA2A 1HQWA 1N3OA 3JBG1 4LA2A 2BU9A 3SNMA 5AFBA 4AL9A 2WA4A 3J9SA 3IPVB 1PZ8A 3T1MA 3O1RA 4PI0A 1ND2A 4GA9A 3WVJA 4OI4A 2GU9A 3FUOA 2ZGMA 3ZPYA 2Q1FA 2QQNA 1VPHA 1WCSA 3SCHA 4XYXA 3I59B 2WFF2 2BYVE 5CIRA 1ULCA 2YMZA 4C1XA 1RUG2 4Q8KA 5A1LA 5BUVA 5LEJA 3DKWA 5LA0A 3TEYA 4Y33A 3N9MA 3E6DA 3PVNA 3TYJA 4LLOA 4EZHA 2VC9A 3MICA 4UF0A 4AI0A 3UKNA 3O1TA 3OPWA 3B9IA 4XUTA 1UW8A 2XG3A 2CSGA 4QDQA 5F39A 2Z5WA 3WW3A 3BTYA 3UJOA 1S55A 1RB8G 1BEV1 2WSUA 5KHIA 3I2JA 4Y4RA 2OX0A 1XNDA 1PMJX 1HIXA 1AXZA 3BCWA 1CIWA 1RJ8A 2RG4A 1HRI2 1NA1B 1KS4A 1QY4A 3AM2A 5F6KA 3WDYA 3NJXA 3OEAA 2VCBA 1SZBA 3AYAA 3GDBA 3WSOA 1QIQA 3ACGA 1REEA 4N53B 1NUKA 1Y9GA 4JVAA 1TMF3 4LO5B 4A41A 1ZRDA 1ZBA2 3P1IA 1ZRRA 4W4ZA 5M0TA 1JMUB 1SPPA 1PK6B 2HWD2 4DRRA 3JB4C 4EWAA 4URAA 3O1UA 4S2DA 3VHRA 4WM7A 5CADA 3FLTA 4AAPA 4PF5A 5F5AA 3EXUA 4QQHA 5CKNA 1UY2A 1RUJ1 1LOCA 1UXXX 2VR4A 3M2MA 1AL22 2ZHNA 4XQWA 4N8MA 2UWAA 4AXOA 2XVLA 1QXRA 2XJQA 3AP5A 3B01A 4L11A 1S2EA 2W1WA 5GLTA 4OI0A 2F4PA 5FY0A 3POYA 1WD4A 3A0NA 4P9WA 1XU2A 3NAPC 3ZDVA 2DVBA 3JD71 4CP0A 4LBQA 2C5DA 3RJRA 4LKFA 4XVHA 3GM8A 2FHRA 3Q8AA 2WS91 1RGSA 4NIDA 3ZO0B 2IUWA 4W6WA 1MS1A 1V6IA 3LKJA 4COUA 4X8PA 4J1WA 4UOJA 3T2PA 1W05A 4MXWB 5CNAA 4BQ3A 1AX0A 1LHNA 1D2SA 4UT5A 5DG1A 3CIHA 3ZFGB 4NPRA 4DY3A 2VZSA 3CNAA 4ZHNA 1XNBA 4XBLA 1YQCA 3HQUA 3AKSA 5FBZA 1QJU3 3WG1A 1O5LA 5IK4A 5L9VA 4O7XA 2GN7A 4NWWA 1V6MA 2ZACA 2JDMA 4OLLA 4Q1PA 4O9EA 4BB3A 5K0UA 1Q43A 1R083 3DYPA 3PL0A 3J8F2 1GWKA 1MS0A 1UZZA 2AC1A 2E7QA 3S6PA 5H9SA 1GQPA 1GOHA 1S0DA 3LPGA 4FPCA 4QX5A 5ERLA 1RUE2 2Y38A 5FZ3A 5I91A 4PHZA 2AEYA 1E57A 1R1ZA 1FMD2 1G6NA 1XJAA 2F4LA 3UL2A 3AFGA 1OHFA 4IV1B 4MGZE 5FXWA 2GMMA 5A32A 1ZZ6A 2JICA 4Y1UA 5IFTA 4IEWA 2HBTA 2P6CA 2TNFA 4YPJA 4N43C 1WA6X 5IWFA 4C0HA 2Y8KA 1HXS1 3BIWE 2E7AA 3CF6E 4NOTA 4RS5A 2WS92 2R1DA 4UWDA 5FXZA 1N3QA 2VG9A 2WSVA 2CY6A 3ACFA 2VOXA 5EZWA 1L7QA 2ZS6B 4IEPA 4GZ9A 1EAH1 1US3A 4MH0E 4AVTA 3P3NA 1JU4A 1MS4A 2VUJA 3PMEA 5FYBA 1DDLA 3THTA 1TMF1 1NX9A 5FLIA 1PMIA 3PMSA 1CVNA 2Y6GA 2B46X 4NE9A 2XVGA 4I2OA 3OUJA 2P3IA 4DPNA 2A6YA 4R9CA 3ZFEA 2EXHA 4LUMA 2HWD1 1O5UA 1LOGA 4YW3A 1U5IA 5LBEA 3RRDA 5B4XA 2HWE2 4FOYA 2KR2A 1QH6A 1AYN1 2RS52 1AR83 2FCUA 4Y1XA 2XLFA 2XQRA 1DGRN 4QGLA 4HKOA 4QM8A 1FOD2 5EYYA 3WQ0A 4YVSB 4CUAA 1FAYA 1PVC3 4BH9A 1W8ZA 3HEIA 1V00A 3SH4A 4I3PA 1S2KA 3MIDA 3WZ1A 1RVF1 3MPBA 1BMV2 2EALA 2ZHMA 4CDQC 5C8WA 1OLRA 4QWNA 5CZKA 2JB8A 1H6XA 2Y34A 5BNOA 2HYKA 1L7LA 2RS11 1BEV2 2OZ6A 1HB2A 2QBXA 3NQHA 5CKMA 3QLQA 2A6ZA 1I3HA 2Z2SB 3IT8A 3SMHA 1OFSA 1BXHA 2IC1A 3LWCA 3AYCA 1G9FA 3CJXA
chains in the Genus database with same CATH topology
3SCFA 4OUSA 1RUC3 1YCIA 2ZA9A 3JBG3 1NY72 4HFSA 3ZXEA 5FRAA 2XBO1 3HT1A 2DV9A 3GHMA 1AYN3 2WZR2 1CAUA 3WNXA 2P2KA 2PLV3 1YLLA 4LBNA 1NA1A 5K0UB 1ONAA 2DVDA 2QFEA 3ES1A 3J8F1 1DQ0A 4YSFA 5A33A 5CAZA 3ZYGA 1XRUA 2A3YA 2GNTA 2QZ2A 4QM9A 4HKLA 4M0HA 2ATFA 3ZMOA 3FLRA 5K7PA 4AEMA 3ZFGC 4PIZA 1PVC2 4XIKA 3WY6A 4Q4V3 5T50A 3RZZA 4AVVA 2VW0A 1TE1B 3I8TA 4Q29A 4HL0A 3PJQA 3G6JB 5CG9A 2UYAA 1LU1A 2IXKA 4YVWB 2YHJA 2OYZA 1KFXL 2UURA 1SDWA 1AX1A 3ZMNA 2BWCA 1KDMA 2IXHA 5BNNA 2DCYA 4FQ4A 4J1XA 1ZVFA 5CFCB 3R4UA 5C8CA 1TEIA 2FZ1A 4FTEA 4JDNA 2VU9A 3RI8A 1F8VA 2D98A 5KHKA 5IUQA 3OY8A 1O4TA 2FZ2A 1MR5A 1GQHA 2HWF2 3MFCA 4L8QA 3DF0A 3JUUA 2PHFA 1PK6C 3A0KA 1GLHA 4CDWA 4HSLA 3Q9OA 2LUWA 2WNVB 3WHUA 2WZPP 4RQPC 4Y20B 4EN7B 2XJPA 4C90A 3WP6A 3P3PA 3PHMA 1ASJ1 1NA1C 5FAXA 1ENQA 4DNYA 5IK5A 3VKMA 3NW4A 3ZVXA 3FHIB 3WR0A 4A7KA 1PNGA 4XJAA 3ZXFA 2QKDA 2EXKA 5B2GB 1H1IA 1O4YA 1KITA 2E6VA 1FYUA 2V09A 1K5MA 1NCRC 2QDNA 1LJ7A 4XQDA 4FXGB 4XEZA 1LR5A 2BNNA 2W39A 4MV2A 5BXXA 4R9BA 4RHV1 4TZDA 4YZ1A 3S30A 2EA7A 5FFOC 4QXKA 5GLVA 4WVMA 1UD1A 4B7EA 2BUKA 2ZX1A 3N7JA 3VBSC 5BNOB 5GLZA 3VBRA 3C2UA 4QGMA 4EWDA 4NVPA 5CG8A 1LOFC 4S2HA 5LK7B 4MX3A 4CP1A 1O3SA 3DPRC 1CAXA 1VBD1 1ZBE3 4ASMB 4M3CA 4YGEA 2IXCA 1Z0HA 3ASIA 3AMNA 2X8KA 3ETQA 1VBB2 2VPVA 4NHKA 3NV3A 3HIFA 2ZGUA 4GMP0 2XKOA 2R063 4FPOB 4AEKA 5KC5A 2Q30A 3UV9A 2HEYF 3ZYJB 3VZOA 3VKNA 5L7OA 1DYKA 1WMEA 1IS6A 4RS5C 3DPRB 2ZGSA 1QMJA 2ZX2A 2EXIA 1EY2A 1I1EA 4P9IA 4Y22B 4DY5A 4DS0A 3S7EA 4DZGA 1S0BA 1C57A 1KJLA 4YM1A 1OA4A 4IEOA 2NZ9A 2VOWA 2GZWA 4H3WA 4COYA 1H30A 1XQNA 3E5XA 4PBOA 4BM8A 1RUE3 4U36A 1AR92 2PHLA 1RUC2 1BCXA 2ZMLA 4OI1A 1K5MC 1YFUA 4K1YA 5FO8B 2WT0A 1KQRA 2C9AA 1BYHA 1CJDA 2XJTA 1IPJA 5ACA2 1MQTC 3D8CA 1QOSA 3BALA 1WLDA 3E6CC 1JUHA 3OYWB 4MYEA 3B9CA 4IETA 1R1A3 2FQPA 1SMVA 3VBOB 5FLJA 1SBFA 1ASJ3 1SACA 1H8VA 4FPKA 5KXBA 4LTAA 4AEJA 1LRHA 4JGZB 1Q8OA 3ZSKA 4A7ZA 1PK6A 4OHWA 1RUG3 5E1RA 1IGOA 4P5HA 1M06G 2A6WA 2JX9A 3GZAA 5JSPA 5DZGA 5GLUA 2ET7A 4WZCA 3VBSA 4DOUA 4HVOA 1AUYA 3AZXA 3HQXA 5FO9B 1W6PB 1N1SA 1QJZA 1RIRA 1DIWA 3WDUA 4HPKB 1VBC2 2A6XA 3AP9A 1CJPA 1H1MA 2D7FA 2R16A 1VALA 2E51A 3N36A 5CFCA 3DL3A 4E4ZA 1WGPA 2YXSA 2VW1A 2ZJCA 2NM1A 3VZJA 1ZZCA 5FOJB 4COWA 3O12A 3ZFGA 4WVWA 5FMOL 1QJX1 2RJKA 3OBRA 1ZRFA 3B5LB 2R071 5F5QA 3WDVA 4BMEA 1YUDA 1W6MA 1F31A 1LOAA 2HWC3 4JDMA 4RL7A 4XJ9A 2GN3A 3U4XA 2CL2A 1QQP3 2XJRA 3D0JA 2PA7A 1DGWA 1OA3A 3GF6A 1V6LA 3RPQA 5JOYA 1CAWA 2UY8A 4N90A 3JD72 4FAGA 2ZGLA 5FLHA 1ND2C 1EYBA 3B00A 4Y1ZA 4K21A 1W6MB 2OW4A 1DYPA 4OUMA 2RS12 2XJSA 4YM2A 3APBA 4BE3A 5FTTC 3CJIB 5ABJA 2RMU2 2RM21 1EP0A 4YFWA 5FQ0A 4XTMA 1VBC3 3MIEA 1JUIA 2AGSA 1QDCA 1VBA3 1S0CA 1AL23 2WL1A 5A32B 5I8YA 5J3UA 1Y7BA 4XFGA 5I0SA 2QUOA 4AHZA 3VUOA 1GNHA 3OCPA 3MLKA 2DU1A 4INDA 2TBVA 4MXVA 1V6OA 4OHVA 1NE6A 5JIUA 1B35A 1XE8A 5GZGA 5L73A 2ZHKA 3FJSA 3HD8B 3IIAA 5DZEA 3ZFEC 2XGXA 1KRIA 1EV11 2YV8A 4P9JA 2GMEA 4LBJA 4IXLA 1H2NA 4X6QB 1A3KA 3IDEA 1O91A 3C3VA 4IV1C 4QQOA 4QQLA 4B4PA 4DRVA 3WDXA 1LESA 3FBMA 4K40A 5JZGB 3ZSEA 3CEWA 2JEMA 3MI8A 2D6KA 3W9AA 4Q4Y1 3KGZA 4KL1A 1IKQA 3VBOA 2R062 3ZSJA 4KWLA 4P9GA 3N4MA 1WUVA 4BOWA 1RJ7A 4N43A 3RI9A 4I01A 5EJ3A 3MEPA 1S1AA 1LHOA 1NG0A 1Z7S1 5I0TA 2DUPA 1GBGA 2B39A 2RS53 1RUI2 4B3NA 4YW1A 2ES3A 5DZFA 2VVEA 1COV2 4HBNA 3FMGA 5GZFA 1X8EA 2X53S 3NO8A 4QPIB 3ZXGA 4Y1YA 3S7IA 1RUF3 2D44A 2WFF3 1SCRA 5DXDA 4GH4A 1JTZX 1AR62 3WCSA 3LA3A 2WFF1 5L7OB 4OHYA 4A7YA 2Y26A 3RYKA 3VDDA 1QNWA 5BPXA 3WG2A 3N7LA 1POV1 2LM3A 2AREA 3UJQA 3G7DA 4LT5A 4CEYC 1ASJ2 2ET1A 2JDZA 2DVGA 2ZPXA 3B69A 4KWJA 4AI2A 4IEZA 1X36A 1F5FA 3LA7A 2ZMNA 4N7IA 3SH5A 2XHKA 3WP3A 4R4ZA 3AMHA 1DBNA 2BVVA 5GALA 3JD73 4Q0VA 1DU3D 1IS5A 4QT6A 2E63A 3WUDA 1AF9A 1SLBA 2P37A 1HXS3 1OQDA 4G4FA 4K20A 2P3KA 4LBKA 4NN0A 3T2TA 5I0RA 1ZZ8A 1QKQA 1AYM2 3QH6A 1PVXA 3INAA 4B29A 5KHJA 1RVF2 1ULDA 1RUI3 4WM7C 1NCQB 2PHWA 5J37A 3UKTA 4AVAA 1UU5A 4LHNA 5C33A 2D6MA 2HWF3 1REDA 2N7GA 2IFRA 2X5IB 2OIIA 3H1YA 2ZGOA 4AK3A 4BLJA 4F8AA 2XLGA 3QH7A 3PVBB 3V0BA 4GWMA 1LB2A 3ST7A 4AFBA 5CVRA 5A33B 4CDXB 2A5ZA 1CX4A 3ZYRA 1QGLA 4G9SB 1NLRA 1XXNA 1LOBA 1UN1A 2WNVC 1BBT3 1EAH2 2PYTA 1JXNA 4TWTA 3VL9A 1ZZBA 2WFPA 4RQPA 5LRRA 4R9AA 1S0GA 3ILRA 4HSJA 3TAYA 3JU9A 1VRH3 2R0HA 3WG3A 1QJU2 4AWDA 5J48A 1NOVA 2KXLA 3TB0A 1AYM1 4Y5Z0 2HWE1 3HMYA 2RR12 2FMDA 2UYBA 4PDWC 1LENA 4Z2WA 3WHTA 4BA6A 2ZX0A 5KWRA 4XF4A 2TUNA 1AR73 4K3UA 1VB2A 4AEDA 3O7OA 1YYNA 4Q4Y3 2GH2A 4LBLA 2HEWF 2I74A 1FT9A 2OPKA 4JGYB 2CGNA 4BQ1A 3W58A 1CAVB 2WWSA 4N43B 4XFHA 2XB6C 3MW2A 4XF3A 4YRDA 4L9BA 4RSUA 5AC91 5ACA3 2QCSB 4E4DX 2RS31 5FREA 4MGKE 4RD7A 3H8UA 2MEV3 3QACA 2LALA 1S0FA 3M70A 1FV3A 1AR61 2ZGKA 3TRSB 2R072 1ZX5A 4K7JA 1GSLA 3ME2A 5T54A 4XDQA 5D8AB 1J1LA 3MF9A 4Y22A 5JZGC 4FP2A 3ZN6B 2PQQA 1QOOA 3WP5A 1UAIA 1AL21 4PIYA 3IDBB 3VV1A 1OA2A 5JPNB 1WMDA 3VDDB 4M3CE 1MZ5A 3OF1A 5CFDA 4Q27A 4BIFA 5LRSA 1RUH2 1OOPC 5H9QA 1ND3C 3D6EA 1KJRA 2NN8A 4WM8A 1RMU1 2ZKLA 2R0FA 5J96B 4LUKA 1RTVA 4FPLA 2VUAA 1ZBA3 1PO11 1NXMA 1MS9A 3JB8A 3AMQA 4M3CB 4ZU4A 2GC0A 1YXWA 1COV3 3OJBA 3GYDA 2DCZA 1GQGA 5EFUA 2VNOA 2O8QA 3VBSB 5BNOC 2RS33 4AGGA 4RHV2 1D0HA 1DGLA 1R1A1 4AG4A 4DB5A 1SCSA 1ND3A 1RUJ2 1FV2A 3QOPA 2R073 5CFDC 4MLOA 3GBWA 1D4M1 1TNFA 1Q8QA 3KB5A 3MPPG 2VVFA 4I0WB 3MW3A 1C5IA 2P34A 2VY0A 4FBFA 2I45A 3R0RA 4MZUA 3MIGA 2BPA2 3N3HA 1X8MA 2HWE3 4C0BA 3AFKA 1ND3B 2B7YA 3I4IA 1QF3A 3V64A 3EO6A 2WNUC 1NY71 3HN1A 1CPMA 2ERFA 1VRH1 2BGCA 3AX4A 3AXDA 5FCCA 1M4WA 2I07B 4N53C 5JVVA 3GBFA 4CYDA 3NV2A 4YW2A 1C4RA 4JTOA 4IL7A 5T5LA 2D6LX 2ZBJA 3H1MA 1LGBA 1W6OA 5C4WC 4YNIA 1RUI1 3WW1A 2R043 4UW3A 2VNRA 1GR3A 4XQ4A 4YZ4A 2DCKA 5E8AA 5BNPC 3OGGA 2IXIA 4LEJA 1RUNA 4XTPA 3VBUC 4QPGC 4LBMA 1VAMA 5FQ0B 1IS3A 3AKQA 4LA3A 1G86A 3E97A 4XIOA 4IV3C 1L3JA 2EAKA 1FATA 1S2BA 4AVBA 1GICA 1LHVA 1NQJA 4RQPB 1HV0A 1MVQA 1W6QA 2A73B 2RMU1 4LBQB 4M3CF 4Q4X3 4SBVA 4XBQA 4YGBA 5AVPA 2Q1ZB 4CEWC 3WW2A 1AVBA 3R4DB 1XYOA 3WG4A 4BIOA 3NAPA 4GXLA 1AR82 2NPIA 1MACA 4CDXA 2VXRA 5FPZA 1JOJA 4QPGA 2ZCWA 3SISA 2JG9C 1AYM3 2IWGB 1RUD1 3JCIA 2SLIA 2HEVF 5BNPA 1UIJA 1OOPB 3I54A 4YG6A 3VKFC 3OTFA 2DFCA 2DWRA 4FOVA 4EV0A 1PGW1 2ARXA 3SH3A 3BTAA 2D6PA 2DVAA 2CAUA 1YI7A 2Y0OA 1B09A 1BBT1 1H8TB 5JLVA 1Z78A 4H55A 1AL0G 1KXGA 4WVZA 1H4GA 1A8DA 1NCRB 3MF6A 4FSJA 1PO23 3FFZA 3H3UA 3RDIA 2R30A 2DTWA 4N9IA 4CEWA 4Q26A 4HK8A 3KQRA 2R1BA 4FO9A 4GULA 1PZ9A 1QDOA 1WCDJ 2ZABA 1NYWA 1UU6A 3WV6A 1C3HA 1O3RA 1OSGA 2CTVA 3DGTA 4IV3A 2F6BA 1PGW2 5T3NA 1R082 1XE7A 1XU1A 1UF2C 2YGMA 3NV4A 2WQZC 1FPN3 2JENA 5SV5A 4HN0A 2O0OA 4A3XA 2GNDA 3AKPA 5CU1A 3ZFEB 5HI0A 4HETA 4LHKA 5JMCA 4L99A 3D5OA 4BZ4A 2HWB1 1LEMA 2WNEA 2ZHLA 3CLPA 3VBRB 1RHI2 3D82A 2YROA 5BNNB 1JW6A 5HCFA 2RE9A 5KBFA 2ZGTA 1QWRA 4GQ7A 4COVA 1MS3A 3E5UA 2VMHA 4GB31 1UIKA 2BFUS 2Z69A 5IT6A 2XUMA 5DDJ1 1DF0A 3K51A 3S0MA 1LGNA 1GV9A 4C91A 1SLTA 5FOBB 3TN91 2ENRA 1SBEA 3LOIA 3AP6A 1GYKA 1HDKA 1NCQA 2PHTA 3KM5A 1LHUA 2E7TA 4Z07A 3VBOC 1VBA1 1HRV1 1C28A 4W6YA 1PGL2 1LEDA 1ULFA 2BFUL 3QCWA 3R4SA 1RINA 2PFWA 4XFIA 4KU7A 3A4UA 3IKWA 2NLRA 3M4FA 5JDBA 5T55A 3WD5A 4XHBA 1U12A 3BOPA 4RR3B 2IZWA 4ZU7A 1J59A 1AZDA 2JE7A 3U07A 1PVC1 4G3YC 3KCCA 1QJX3 1FMD1 4D3WA 1WLCA 2ZGPA 3PJYA 5HXVA 1BK1A 4AFCA 4XOGA 2EF6A 4AQSA 1W2UA 4C1WA 2HWD3 4HK9A 2WC2A 1MS5A 2H0VA 5KHGA 4RFT0 1NZCA 5H9PA 4CEYB 1BQPA 2GC2A 4JV4A 1MZ6A 5HCBA 3JQWA 4JGZC 1PIV1 4AF9A 1DZTA 4FAHA 4XBNA 3RWNA 2R042 2XH6A 5FPXA 3J8F3 3WCRA 5T52A 4PJYA 3VBUB 2RS32 5BY5A 5F9TA 2VW2A 4XMAA 1WW7A 1OOPA 5I0UA 5AFEA 1LCLA 3BPZA 4AEDB 4QHBA 1R093 3AZWA 2ZTNA 1V6KA 1AJOA 2XVKA 4LO6B 4YG3A 5I8TA 5JZGA 1W6QB 5HBAA 4M01A 1UMZA 2B45X 1RUC1 2K2SA 4JDOA 4K9SA 1MEC1 1U5ZA 2RM23 4ASLA 2VQAA 3T1LA 3ROUA 3GNEA 4QQ2A 5IK7A 1C5HA 3OBTA