1IS4A

Lactose-liganded congerin ii
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
134
structure length
134
Chain Sequence
b'DRAEVRNIPFKLGMYLTVGGVVNSNATRFSINVGESTDSIAMHMDHRFSYGADQNVLVLNSLVHNVGWQQEERSKKFPFTKGDHFQTTITFDTHTFYIQLSNGETVEFPNRNKDAAFNLIYLAGDARLTFVRLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONGERIN II
publication title Crystal Structure of a Conger Eel Galectin (Congerin II) at 1.45 A Resolution: Implication for the Accelerated Evolution of a New Ligand-Binding Site Following Gene Duplication
pubmed doi rcsb
source organism Conger myriaster
molecule tags Sugar binding protein
total genus 27
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1is4A00
3I4IA 4Y1YA 4LBQA 1YIFA 1BYHA 4YW2A 2A6ZA 2WJSA 2AR6A 4JCKA 5T55A 5T5PA 4YM3A 5CB7A 1S0GA 2WSUA 3WG3A 1DFQA 2VW1A 3WUDA 1QGLA 3BIWE 2D6LX 3LSDA 5E89A 3ZSLA 1W0PA 2WQZC 3FLRA 4XJ9A 3WVJA 1V6OA 2P34A 1V6NA 1CPMA 3AJZA 1W6PA 5T52A 3FBYA 4FPHA 4ZKTB 3ZXFA 4BM8A 3HN1A 4P9XA 2PHTA 4FP2A 5EWSA 3UK9A 2DYCA 4Q1RA 4C1WA 1WW6A 2XG3A 1AXYA 2BQPA 2GN7A 3R4UA 1CVNA 4BLJA 3OJBA 5CAZA 5KXEA 3M3OA 4YZ1A 2WNEA 1DIWA 1MS5A 2EXIA 3M3EA 2ZGQA 1W6QB 1ULFA 2DVDA 2GALA 4W65A 1DQ5A 5H9QA 3VKNA 1V6IA 1YYNA 4R9BA 1W6OA 4YGEA 2ZABA 1Q8QA 3AZVA 1DHKB 3BOPA 4FOVA 2PHFA 2JKBA 5IK8A 1FATA 1MACA 3D4KA 4ATFA 4CRQA 2EXHA 2NMOA 1W6QA 3AX4A 4XE9A 1BJQA 3NV2A 1G9AA 3BODA 3AP4A 3AYDA 1J1TA 1C1FA 1I3HA 4L8QA 3T2TA 5GLUA 1LTEA 4Q1PA 1W6MA 4XHBA 1WCSA 4Z8BA 3A4UA 4DRVA 2VY0A 5JOYA 3VUOA 1LU2A 3AYCA 3QCWA 4FPFA 2DTWA 4Q26A 1CJPA 4YGDA 4CZSA 5DG2A 1CESA 1QOTA 3RS6A 4F83A 1S0CA 2VW0A 1OFSA 2PELA 1DLLA 1LESA 4UW4A 1GSLA 3N7KA 2R0HA 4LBLA 3MW3A 4GALA 3H0OA 1UN1A 5GZEA 1HQWA 2ZACA 1DQ0A 3L2YA 1MR5A 1TEIA 2FMDA 3RMYA 1N1SA 2YROA 4XJAA 1MZ5A 2R1DA 1KITA 2D3SA 5DUXA 2CL2A 3WZ1A 5HCAA 1AJKA 3V0AA 4JRAA 3RRDA 1Q8SA 1DGLA 1SLAA 1WD4A 3ZSKA 2E6VA 1ONAA 4BLIA 5KXCA 1KDKA 1N1TA 1JXNA 3LSEA 1UZZA 2B7YA 3ATGA 3GALA 4XIOA 2P37A 1LU1A 4BMEA 1HLCA 1VALA 2CWMA 2R0FA 3ZXKA 3TAYA 3AXEA 2PHWA 4YZ4A 4XBLA 1XQNA 3M3CA 2YZ4A 1YXWA 1BXHA 3D6EA 3U4XA 2VXRA 1UKGA 5GLTA 2V73A 3APBA 1GKBA 4DFSA 2DUQA 4Q8KA 1ENRA 3OYWB 4YW4A 3ZXEA 1G8WA 1OKQA 4YFZA 3FLPA 4YGCA 1PZ9A 2AH2A 5SV8A 4YM2A 1IS3A 5T50A 3M1HA 3INAA 1FX5A 2DUOA 2EF6A 1UMZA 1V00A 1Z78A 4XHXA 3VKFC 1KJLA 4YG3A 2D3RA 1LOFA 2E51A 4OZXA 3N36A 1AVBA 3WV6A 4I30A 1HDKA 1ULDA 1KRIA 1R1ZA 3POYA 3WCRA 3AP7A 3B00A 3OPZA 3B69A 3UJQA 2GMPA 1IKPA 3N7MA 4GWMA 3WNXA 2ZGLA 2NM1A 3JU9A 1SLIA 1G9DA 2ZKNA 3ZPYA 3WG1A 2FHRA 1B09A 4ISQA 2ENRA 3WUCA 2ZAAA 4UW3A 3OGGA 3M2MA 5JVVA 3A0NA 2Z42A 4WVVA 2LALA 2W52A 1W0OA 4LBKA 1YO8A 2Q5TA 3WDWA 2NP0A 2NYYA 4Q8LA 5KXBA 5IUQA 3WDTA 1DQ1A 3ZXLA 3WLUA 4M3CB 1UPSA 1DQ6A 1MS1A 3VKLA 3IN9A 1JN2P 4XDQA 4GXLA 3SISA 4FPOB 5JMCA 2PHXA 2GN3A 3FLTA 1CPNA 2XB6C 3OBTA 3VKMA 4Y24A 3AJYA 3C2UA 5IT6A 4XJ8A 1LOFC 1N3PA 1WBFA 3M3QA 3RQ0A 2DUPA 3HR9A 2RHPA 4M01A 3POSA 4M3CA 5JOWA 2ZGUA 3A0KA 4GWNA 5DZFA 4LBNA 1V6JA 3ILFA 4YZ5A 1U0AA 2OVUA 4YZ3A 3MW2A 1S0BA 1WW7A 3ZXJA 4Q27A 4FOQA 4BQ1A 1DQ4A 2P3JA 1SLBA 1MS9A 1O4ZA 3ZVXA 2A5ZA 2I2SA 1AZDA 1A78A 2GMEA 2CNAA 1LECA 2A7AA 1FV2A 1NXD1 4H55A 5KXDA 2A6XA 1Y7BA 2VW2A 1LOAA 3UJOA 5CBLA 1WW5A 1KQRA 2JDZA 4ISRA 4FPYA 1WLDA 1ZM1A 1IKQA 5T5OA 5JOZA 1UZYA 2UWAA 4YGBA 3CNAA 4HL0A 1C1LA 4AYUA 1SBFA 1URXA 1IS6A 1DQ2A 4IQPA 1IS5A 2D3PA 2AREA 3RG0A 1N3QA 3WG2A 5GLZA 5H9RA 4FPLA 3NV4A 4U2AA 1QOSA 1GANA 2D6KA 2ZGOA 5F5QA 5T54A 1G9BA 2W08A 2DWRA 3OY8B 2H0BA 3SH5A 1IS4A 2GNTA 1UL9A 5HCBA 1RITA 4XYXA 1WBLA 3USUB 1JYIA 2EAKA 3N7JA 2DU1A 2DVFA 4TZDA 2D6OX 2AGSA 2A75A 1FYUA 1G9CA 1IOAA 3Q9OA 1F31A 2ZHLA 2DVAA 3LCPA 4Y1VA 3FUQA 4XJWA 1D0HA 3OY8A 4R9AA 3UL2A 3WDYA 4AGRA 2WT2A 2ZGRA 3V0BB 2DURA 2DV9A 4XTPA 3USUA 3ZSMA 1QKQA 3AP5A 3D5OA 5EYYA 1ENQA 5H9SA 5E88A 2NN8A 1LGBA 3N35A 5DG1A 3JUUA 1ULGA 1WD3A 1APNA 5DZGA 5AVAA 1WLWA 3B3QE 2A6VA 2ZMNA 2ZA9A 4M00A 3VKOA 5GZFA 2ZGMA 4FPEA 5EYXA 1FNZA 3AFKA 1LHNA 1YRZA 3O0WA 4KBBA 5DUVA 2DVBA 4DRRA 1WW4A 4Y22B 3NWKA 4Y20B 1SCSA 1GYKA 5GZDA 1X50A 2A6WA 1AJOA 1QOOA 3FUOA 1LGNA 2AENA 1DBNA 1S0JA 4R9CA 4ITCA 1RINA 4Y1UA 2ZHNA 2YMZA 4UW5A 4UW6A 2LTNA 1QDCA 3R4SA 1S0EA 3AXDA 1Z0HA 4YW5A 4LBOA 3SLIA 3B01A 2AYHA 1ULCA 4XTMA 2ERFA 1LEDA 3AK0A 2UWBA 3NV3A 5CA6A 3OYWA 4WV8A 1F9KA 1GNHA 1DYKA 4LBQD 4YFWA 2D6NA 1MZ6A 1S1AA 3IPVB 1N1YA 3MPPG 2E53A 1MS3A 2UWCA 5JLVA 4XBQA 5GLWA 1BZWA 5IK4A 4LBMA 2VU9A 3OBRA 3PJQA 4P9WA 4DPNA 1CIWA 2ZGNA 1NLSA 1VIWB 2A3YA 3AP9A 1LOBA 5IK5A 2WLQA 2YXSA 1S0IA 1FAYA 4TYSA 5JDBA 4XMAA 3AYAA 2C5DA 1AF9A 1LENA 5GJ6A 4K21A 4R9DA 4PBOA 1H9WA 1N1VA 2A3XA 3N3HA 3AZWA 2CY6A 2JE9A 3T1LA 2OW4A 2EIGA 5E8AA 3SITA 1W6PB 1JHNA 4YM0A 4XXPA 1LOCA 4AVSA 1FNYA 1JYCA 3IMNA 1Q8OA 1G9FA 1LGCA 2P2KA 1CONA 1LHWA 2C9AA 4AGVA 1AX2A 2P3IA 5JOXA 1S0DA 4P9YA 2WKKA 4XJZA 4YW1A 4Y1ZA 2D6MA 1UAIA 1N47A 2UU8A 1VLNA 1V6KA 3MEPA 5HCFA 1SBEA 3AZZA 2OUHA 3R05A 1UX6A 2EXJA 4BMBA 1QDOA 4XXAA 1W6OB 2ZZJA 1GLHA 1MVQA 2E7TA 4PCRA 4XMIA 2WT0A 1SBDA 1GZWB 3AP6A 3QLQA 3SH4A 3WDUA 1CQ9A 4YW3A 2EXKA 4ZXKA 5EXOA 4GKXA 3PVEA 1RIRA 2UURA 1H30A 3DGTA 5T5LA 1Q8PA 1GNZA 2ZBJA 1I1EA 1GZWA 3WDXA 1G7YA 1W6MB 1GBGA 1MS8A 4FOYA 5DUWA 2V5YA 3RSJA 4U36A 1A3KA 5T5JA 1A8DA 2ARXA 4C1XA 2D7FA 3ILNA 3IKWA 4RL7A 3MW4A 1EPWA 2DVGA 2PHRA 1V6LA 4CTEA 1PZ8A 2R49A 2VH9A 2VUAA 3ILRA 2JECA 5L73A 3T1MA 3WHTA 2SBAA 3AZYA 4ASMB 1SLCA 1SCRA 1ULEA 4AWDA 1QF3A 1DZQA 4XOGA 5DXDA 4YLZA 1GZ9A 1LULA 1SLLA 1JOJA 1CR7A 1ZA4A 2ZGPA 4FQ4A 4PQ9A 5GM0A 3VV1A 3ENRA 4AVTA 3AZXA 2W39A 2ZGKA 4XJUA 1AX1A 2A71A 1JW6A 4Y26A 3HMYA 1BKZA 2CYFA 5IK7A 1FV3A 3ZYRA 2JD4A 5GLVA 2AUYA 2D44A 1LHVA 2TEPA 3B9CA 3KQRA 4LBJA 4XIKA 5FREA 4SLIA 2YY1A 3POWA 4AVVA 1AXZA 1LOEA 1H9PA 3WOGA 3DUIA 4ATEA 5F9TA 2WT1A 5CNAA 3FFZA 3RMXA 1ENSA 3V0AB 1WUVA 1C57A 2KM2A 4RA0A 3V0BA 1LJ7A 4AGGA 2JE7A 3I8TA 4P14A 4FVVA 1BQPA 1W6NB 2EALA 3PVNA 4FOWA 2A6YA 2ZHMA 5GZGA 2NMNA 1LHUA 2D6PA 2R16A 3WCSA 3WG4A 1VAMA 2CTVA 2GNMA 2GDFA 3V64A 3N7LA 5DUUA 2G4IA 4GKYA 1GICA 4Y1XA 3KM5A 3TB0A 1F5FA 3O0VA 4JC1A 1WLCA 3ZYPA 1SFYA 1KJRA 1OQ1A 1PZ7A 1W6NA 2DTYA 5BYNA 5GZCA 2A70A 1KDMA 2ZGSA 4FQZA 3O0XA 2ZHKA 4PBPA 4XZPA 1MS4A 1QNYA 4BOWA 1O4YA 3O12A 2OUJA 2ZMKA 1HQLA 4K20A 4M3CE 1AX0A 3SNMA 3W59A 1LOGA 1SLTA 4Y22A 4Y20A 2GMMA 2SLIA 1HKDA 4K1ZA 2CWSA 4FP3A 4NO4A 4NOTA 1JUIA 3O5SA 1Q56A 3IM0A 1QNWA 2A3WA 1V6MA 3GNEA 2GNDA 4HANA 5DZEA 3W58A 4WZFA 3WDVA 1YI7A 3ASIA 1LHOA 1GZCA 4K1YA 1VAVA 5LK5A 4GA9A 4WVWA 1N3OA 2NZ9A 2ARBA 4XILA 3PMEA 1Q8VA 4FPJA 4PF5A 2PHUA 1C4RA 1JBCA 2GNBA 2W68A 1LODA 4M3CF 4YM1A 5GALA 2E7QA 1MS0A 3IPVA 3WHUA 2ZMLA 2P3KA 2HYKA 4FPGA 4LBQB 4YG6A 2WSVA 2D43A 3BTAA 4Q2FA 5H9PA 2R1BA 4MYEA 1G86A 4FPCA 1LEMA 3AYEA 5FRAA 4YG0A 1D2SA 1AXKA 1S0FA 4FPKA 1GV9A 3SH3A 2ES3A 1CN1A 2YV8A 4YZ2A 4DQAA 1LCLA 2JJ6A 3V65A 3PVOA 4D69A 3NV1A 1QMJA 4DS0A 4BPZA 1DYPA 2DU0A 1SACA 2ZGTA 4XBNA 1QU0A 1MVEA 3ZSJA
chains in the Genus database with same CATH superfamily
5JI7A 1BYHA 4DMIA 3OGRA 4CEWA 1QHDA 4QPGC 3TEXA 2VZ1A 5FPBA 3E97A 4UF0B 1QGLA 2R042 1DG6A 4O7XA 1W0PA 1OC1A 4GULA 1JZ5A 4EN8B 1UW8A 2VNVA 3FLRA 3I2DA 4XJ9A 3WVJA 5T52A 5F1RA 4NAMA 3ZXFA 1R1A2 4KH9A 1J84A 4P9XA 2PHTA 4KBZA 1YJKA 3OBAA 4UFJA 4DZGA 4C1WA 4MZUA 3ZFGA 1XNAA 2ID4A 2BQPA 4BLJA 1CVNA 5FK7A 5KXEA 3DKQA 3M3OA 2WNOA 4FO9A 2WNEA 3O1TA 4DY3A 1GOGA 2GC3A 5C3QA 5EIYB 5JZGB 4QWNA 3LEMA 5IJRA 3WSOA 4CUBA 4GH4C 1TVGA 1YYNA 4QU1A 4MGTA 1PNFA 4HMZA 2ZABA 3SKJE 4AI0A 2XLAA 1BVP1 3O7OA 4PT6A 1V9U2 1OUXA 2VVEA 3KV6A 4FOVA 4G4FA 5A32B 1TE1B 2JKBA 1QJY1 4PQQA 5B4NA 1FATA 1MACA 3D4KA 2J1AA 4CRQA 4AI9A 1MEC1 4CEWC 3AX4A 5LZ6A 1H2LA 1BJQA 4HVOA 4B1MA 1HB4A 1OOPB 1UQXA 4IEZA 4V1PA 5A32A 3EMRA 4IGPA 1W06A 5CIRA 2ZEXA 2PHDA 2WNUB 4XHBA 2WDBA 5JR2A 3DKWA 2QDNA 2C9KA 2CGPA 3RYPA 2Q8EA 3ZFGC 1OOPA 2JDPA 3CDZB 2ARAA 1QQP2 4LKSA 4F83A 2WNUA 3O1UA 1UKRA 1BCXA 1X36A 2XVGA 4Q4V1 4CUCA 3K51A 5KBFA 3J7HA 4RQPA 4NHKA 5FZ8A 1NY72 1PHMA 2R043 3WW4A 5F5IA 3O14A 4AVBA 2WWUA 3PL0A 1KEXA 3U07A 5CKNA 1HQWA 1AR72 1YIPA 3SC7X 1JZ2A 4AEJA 2HWF1 1R1A3 2F4LA 4YW7A 1DZRA 1W9FA 5FYBA 3ZM8A 1RVF1 3C7EA 4CP2A 4OHYA 2R1DA 1RUNA 2O0OA 5FZ6A 3VBHB 1W2TA 3P1IA 5DUXA 3WZ1A 3IZOA 1AJKA 2VCCA 3O1MA 3ZSKA 1WD4A 3ELNA 3PU3A 1O59A 4Y3OA 1IGOA 4P9LA 5FY4A 1N1TA 2BW8A 1JXNA 2K2SA 3LSEA 1UZZA 3ATGA 3GALA 3LGRA 4BQ5A 3CEWA 1V9U3 1OOPC 1ND2B 2E26A 5JXJA 5L9VA 2R0FA 3S0MA 3TAYA 1ACCA 1XPWA 5K8SA 4XUOA 4YZ4A 2WNUC 4G9SB 4RQPC 3IDBB 1YXWA 2OZ6A 3D6EA 1TMF1 3R0RA 3U4XA 4BK5A 1HX6A 3FBMA 3VGIA 2BERA 2XL9A 3SHRA 3VN4A 1K42A 3KD4A 1PZ9A 5SV8A 5A1LA 3PMSA 2VQTA 3M1HA 4MGIE 4OQ9A 3CBNA 4K6BA 4JQTA 2HWE2 1UMZA 1H1MA 1KJLA 1QQP3 1ZZBA 4DXZA 1JZ3A 2J7MA 2P4EA 1H4HA 3N36A 4QB1A 1PNGA 4J1XA 3WCRA 1AYM2 2IZWA 2QQVA 2VR4A 1V70A 5JIUA 4UT5A 2G1MA 5FMOL 4GWMA 3DPRB 3VBHC 4HKOA 1AR73 4IEPA 5DN2A 2CDOA 2JEMA 5ACA1 1UPIA 3MIHA 3MLJA 3OPTA 5KHKA 2FBEA 2FHRA 2YFZA 5L19A 3WUCA 3LOBA 3OGGA 5JWPA 3M2MA 4YARA 2WL1A 5CU1A 4MX3A 2Z42A 4AHXA 3I2HA 3BUCA 5LA1A 1W0OA 1YO8A 2CGOA 3DPRA 3OUIA 4FTSA 1UYPA 3W9AA 2D93A 2ZAHA 3CHXA 4KWLA 4LE4A 3BI3A 4L9BA 3I2KA 2QQLA 3LIHA 1B35A 1Y9GA 2YC4A 4GXLA 3SISA 1K45A 1UY4A 4FI9A 3MF6A 1HIXA 4XCBA 2XVKA 3OBTA 1H2MA 5FLJA 3VKMA 1WLTA 5F3EA 2JWPA 3ON7A 4M01A 2RHPA 5IW0A 3RI9A 1DZTA 2Y6KA 4GWNA 4EWAA 1PVC1 4COWA 1V6JA 2N7GA 1YQ5A 3IAPA 4ET7A 4YZ5A 1F4HA 3OSDA 3MW2A 2YBPA 1S0BA 1WW7A 2BNNA 1W03A 4P08A 4Q27A 4XABA 4PHZA 1DQ4A 5LBBA 1O4ZA 3H1WA 2A5ZA 1AZDA 1ULOA 1GP6A 3MLKA 2J1TA 3LFIA 1NXD1 4H55A 4NHLA 4NHYA 2HWE3 4XZUG 1HRV2 3LIGA 1W8UA 3DPRC 4HG6B 5CBLA 2JDZA 1PGW2 5F6LB 2B9UA 2WO7A 5JOZA 3I2OA 3HOBA 3CNAA 4IXLA 4MHRA 1HRI1 1AYM3 2W1SA 1F15A 1IS5A 4QD2A 5EFUA 3C3VA 3RG0A 3POFA 1B35C 2KA3A 3OGSA 3HNBM 4U2AA 1QOSA 1WCUA 4TXWA 5D8AB 2Y8KA 1G9BA 1JH5A 3OY8B 2BFUL 3SH5A 4HLTA 3RVHA 1F5JA 1POV0 3NJXA 5I0UA 4HN1A 2ILMA 3H9AA 1UZVA 3KT7A 2DU1A 4UFMA 2GP3A 4HK9A 3C7OA 1G9CA 5FYSA 3LQCA 5D8AA 4AI8A 4BQXA 2DVAA 3ZMOA 1QJU1 3FUQA 3OY8A 3WDYA 4R9AA 3UL2A 4E4HA 1W9YA 2WT2A 3DYOA 2C4XA 4BQWA 2DV9A 1NE6A 4XTPA 5FY5A 3VHNA 2JDYA 2YC0A 1QJX2 5JXHA 1QKQA 1XYPA 4AQTA 1CD3G 5EYYA 5FZ7A 2W9XA 5B4XA 4ZZ5A 1CAUA 1WZXA 5H9SA 5FO8B 3LPGA 5IVBA 1RTVA 3UNPA 3JUUA 1WD3A 1APNA 3B3QE 2R041 2Y6GA 2ZMNA 3LA3A 3NSTA 1IPKA 1YQ6A 4HN0A 3HBKA 3WNOA 2ZGMA 4HXCA 4XF3A 2YYOA 4JHTA 1LHNA 1PX3A 1YRZA 3GZTB 3O0WA 2EAAA 4L97A 4ZPIA 5DUVA 4BK4A 4LITA 4DRRA 4LXLA 3EYPA 4Y20B 1SCSA 1O3RA 1GYKA 2IXJA 1X50A 3ZN4A 5HCHA 1HRV3 4KWKA 4RHV2 4AI2A 3VL8A 5A3MA 3H7JA 3TYJA 4EZ4A 3POGA 5D8AC 3VBRA 4PF1A 5FIXA 1PO21 4QX3A 3VD7A 4DIQA 3AXDA 1Y4WA 3ABZA 2YPJA 3DECA 4XFGA 3VBFA 2EIEA 2QFEA 3SLIA 5FOBB 2AYHA 5J7MA 1JYNA 4IGOA 2UWBA 5CA6A 3OYWA 4WV8A 5FY9A 3ACLA 1DYKA 2VD7A 2Y60A 3HQXA 4CCMA 2RS12 1O5UA 3B5LB 2DCJA 1RL3A 4KG8A 1HB1A 1NKGA 1C28A 2CGNA 1HW5A 3OCPA 4PIXA 5F5CA 5GLWA 4EQVA 4LBMA 2VU9A 2PTMA 3IB3A 2XUMA 4MV2A 1VIWB 3B02A 3AP9A 5L36A 4DOUA 2B39A 2WLQA 2EVXA 4HZFA 2LRPA 3M7AA 1NLRA 4CA9A 3MIBA 3ZXGA 1WMEA 2GC1A 1YWKA 1N1VA 4D6SA 2YG0A 3E6DA 1R082 2WO2A 2JDUA 3KVAA 3AZWA 1QJX3 3RZGA 5E8AA 2XDVA 3VZLA 4H7LA 3SITA 4GQ7A 2BBAA 3ORJA 1VB4A 2GU9A 3VBRC 1TQ5A 4XXPA 1LOCA 3JCIA 1RXFA 4AVSA 1LGCA 3VBFC 1S2EA 4N90A 4QQ2A 1LHWA 1UU4A 2PYTA 2QZ2A 1NY71 3HT2A 1W9TA 4AGVA 3LDBA 5FYUA 2DF7A 2O8OA 4M0NA 2BUKA 4NR1A 1VBB1 4XJZA 1YHFA 1VLNA 2Y6JA 1V6KA 3MEPA 5HCFA 4OQ8A 5FWEA 3AZZA 3M3IA 4QAWA 1D4VB 1ZRRA 4BMBA 3HNMA 3AKSA 4RHV3 1T6GC 4RSUA 4BA6A 3OBZA 5FZBA 4XMIA 3AP6A 4CCKA 1X7NA 3WDUA 4R52A 3H3ZA 4OMCA 5T3NA 3BU7A 4PIYA 5IWFA 5LATA 1H0BA 1XC6A 1BHGA 1HB3A 4ZXKA 4BQ4A 3WP4A 5K9YA 5C3RA 3A23A 5FPXA 4IV1A 2Q30A 1YQ2A 2IFWA 2G9GA 1F4AA 2UURA 3LB9A 2VGDA 3ALQA 2Z4FA 4KNCA 3WD5A 2CSGA 2JDKA 1Q8PA 2R061 1VPHA 3U1XA 2ZEZA 1PMIA 2IWGB 2RS13 3NNGA 1SQ4A 4Z1VA 1IG0A 3KGZA 1GBGA 4NPRA 4AFDA 4TWTA 3UKNA 2V5YA 3KHBA 4U36A 4C1XA 1E5IA 4XUQA 5C71A 3ILNA 4LORA 5J37A 2MHFA 1EPWA 1XYOA 3H8UA 3HT1A 2DVGA 1O5LA 1FXZA 1V6LA 2JG9B 1BEV2 4BIOA 5FP3A 2VUAA 4E4DX 3T1MA 1QXRA 1GUIA 2JECA 5A7NA 2SBAA 3AZYA 4MVTA 1ULEA 1UOJA 4XOGA 5JPNB 2WRAA 1CR7A 4PQ9A 3VV1A 4FQ4A 5GM0A 4BYYA 5KC6A 1R083 2RJKA 3CMGA 4HOOA 4PJYA 1ZRDA 4J25A 1JW6A 3Q8AA 4YWAA 4E4ZA 3MFAA 3WINE 2VMHA 4GJYA 4XQWA 3ZYRA 5GLVA 2JG8A 2TEPA 4LBJA 5A3PA 4Z2WA 1S2KA 5LY2A 4CP0A 2DFCA 5LA0A 2WNVB 5C5UA 3T4VA 2XWBB 3POWA 4LO8A 4IV1C 3WQ1A 1H8VA 1LOEA 2CHHA 2WC2A 1AYM1 5F9TA 3O1OA 5LEJA 1NZCA 5FYYA 2W87A 2WS92 1ENSA 2WN2A 1UOBA 3LEKA 2IXIA 1E5SA 4CU9A 2JE7A 1QJY2 3I8TA 4HK8A 2WNVA 1W6NB 1EUUA 4FAGA 5IATA 4J1WA 1J3QA 2OIIA 3MIDA 5I8TA 1UU6A 1XE8A 2VMFA 3N7LA 5DUUA 4CCNA 3Q8CA 4PLOA 3UKVA 1FPN2 1D2QA 3KM5A 2K9ZA 1F5FA 4MGSA 1SFYA 1KJRA 2ZKLA 1W6NA 2A70A 4D7YA 4FQZA 5FAXA 3JXSA 2W92A 3IIAA 2ZMKA 1HQLA 4K20A 4M3CE 4EROA 3SNMA 2JG8C 5LRSA 2CWSA 3I3MA 3IM0A 2X5IA 1QNWA 4YVSA 4CCLA 3MBWA 2Y33A 4WVZA 1QJEA 3SCFA 2VZOA 4ORFA 4K3UA 2YBKA 2VMGA 4PLNA 4EN7B 1JZ6A 2NZ9A 3LOIA 4TLGA 3PMEA 2HWF2 5FP7A 3BPSA 1O8PA 4IE6A 1OH4A 2PHUA 2WNVC 2GNBA 1K5JA 2W68A 1LODA 4M3CF 2CU5A 2E7QA 5FZKA 1X82A 3IPVA 3WHUA 2JXAA 2ZMLA 4YG6A 2HYKA 2BDRA 3ES1A 3GJAA 4B1LA 1JMUB 3K75B 4MYEA 4QX5A 3NNMA 4FPCA 1JYXA 2IFRA 1HRV1 2Y6HA 4P9JA 4ES9A 2BTVC 2VXJA 1D2SA 1PGW1 1S0FA 4FPKA 1WMFA 3SH3A 4CUAA 4G3YC 2BRTA 4DQAA 1LCLA 4D69A 1ND3A 3WNMA 1QMJA 2ZOEB 4KU7A 4BPZA 2PAEA 1OLMA 5E6HA 1MVEA 3I4IA 4YW2A 5T55A 2OPKA 2WJSA 2AR6A 2WS93 4AAPA 4ZZ8A 4OI2A 1CGPA 1RUI1 1QJY3 1S0GA 2BOIA 4V2WA 1CAWB 3WUDA 3OD4A 3LSDA 5E89A 4ARYA 1BK1A 4XCAA 3KWVA 3ZSLA 2G19A 4LKDA 2X5IC 3NW4A 4YVSC 3ETPA 1CPMA 4FPHA 1TMF2 4BM8A 4QKFA 2BZDA 1VB2A 1FPN3 2GH8A 3ZDSA 2IUWA 4WZCA 4QKBA 2DYCA 2E9QA 1RUH1 4XAEA 4AHZA 3BTXA 2XG3A 4A45A 1M4WA 5IVVA 2XKOA 1MS5A 5BNPB 1XXNA 2DVDA 2GZWA 1JYVA 2GALA 2IVIB 3VKNA 1RUG2 3OD0A 2YDEA 1KS4A 1V6IA 3AKQA 3O1VA 1W6OA 4YGEA 2J1RA 4BXSV 1Q8QA 3ACFA 1ND3C 2VZ3A 3BOPA 3DYPA 5A1AA 3H3LA 1OA2A 2V09A 2PHFA 5FUNA 5CG9A 4CCOA 5BNPA 2EXHA 1YI9A 4XE9A 3TNQA 4YPJA 4NIHA 5ACA2 1LR5A 2DFBA 2HWF3 3BODA 4LLFA 2OQ6A 4XF9A 3KV5A 5KHHA 1C1FA 2Q1ZB 3NL1A 3T2TA 5JSPA 1LTEA 4Q1PA 5FLHA 4D7SA 1GWKA 1WCSA 4LE3A 5CISA 4CDUB 3A4UA 4QHOA 2FMYA 1NAEA 4QXKA 1ZVFA 3BTYA 2QZ3A 1HJFA 3AYCA 4E8CA 4FPFA 1L7LA 1NA1B 1REDA 2JDNA 3POEA 3ZFFB 5DG2A 1YFWA 2XXZA 2VOWA 3NJVA 3RS6A 3GBWA 1S0CA 4OLLA 2PELA 3W21A 4CDUA 4K8FA 4PLMA 1E5HA 2XJVA 4IV3B 1RUD2 2P6CA 2JB8A 2WR9A 3MW3A 3H0OA 5GZEA 5G05L 4YVWB 1VMFA 1OT5A 1TMF3 1PVC2 2ZACA 5A3WA 1MR5A 1RB8G 1TEIA 2ZX4A 4DXTA 5BNPC 4CUGA 4OCTA 3RMYA 1N1SA 2YROA 1X33A 1POV1 1WA4A 2Y6LA 5FLIA 5J1XA 4XJAA 4IV3A 5C8CB 1K5MB 3H42B 1CZSA 4LA2A 2JDMA 1ENXA 3I59B 2D3SA 1NE4A 2C24A 3HVDA 2B4KA 5I93A 2VULA 2CL2A 4YVWA 2VMEA 1VAKA 1CAVB 4JRAA 4H7MA 2XQRA 3RRDA 1KFUL 1SLAA 1ZX5A 4DY5A 2AACA 1JU3A 3UGHA 1ONAA 2DBNA 3EJKA 2B7YA 2RR12 4XIOA 3X29B 1HRI2 3T09A 1HLCA 1PK6A 1VALA 2CWMA 3ZXKA 2FD8A 2MPFA 5I91A 2IXHA 2WWJA 2PHWA 4MXVA 1ODNA 3ZLIA 4HFSA 5ACA3 4HETA 4CDUC 4FXGB 3B9IA 5C3PA 1YC61 1BXHA 4MUVA 4QX1A 4YNIA 2HKXA 4ZONA 2TUNA 4DFSA 2HYXA 5F6KA 4YW4A 1RC6A 1G8WA 2BOJA 4BE3A 3O1PA 2UYBA 4JHZA 1S55A 4CCDA 2XJTA 4YGCA 3GZUC 4YM2A 1IS3A 4IV3C 3ZPOA 3INAA 2HJIA 1FX5A 2XUEA 1I5ZA 1OA3A 1J83A 2PHLA 3BALA 3BIEA 4JTNA 3BCWA 2EIBA 3VBOB 4OI0A 4YG3A 4YVWC 3AVRA 4ASKA 1LOFA 4OZXA 3CJIB 4AAXA 1R091 1AVBA 4QPYA 4EV0A 2E33A 1HDKA 1ULDA 4OFGA 4V2VA 1KRIA 3POYA 1VMHA 1RUD3 2XONA 3B00A 3OPZA 3VZOA 3RZLA 2GMPA 3E5UA 4QT6A 2X05A 1SZBA 3ECQA 1OSGA 4A7KA 1UXXX 1PK6C 2NM1A 3Q8EA 1PVC3 4ZU7A 3VZMA 1B09A 4P00B 3QOPA 1HN0A 3SXWA 1JS9A 1RJ7A 1WA6X 1BEV1 5HXVA 3BU0A 5JVVA 3A0NA 4X8NA 2W95A 2LALA 4NIIA 2ZX2A 3POIA 5IHRA 1H6XA 5DAXA 3O1RA 4C0BA 3NJZA 3RFRA 4Q8LA 1H4GA 5LBEA 4UF0A 1DQ1A 3RYKA 3ZXLA 2VPVA 1MS1A 3LZZA 3IN9A 2RR13 1JN2P 4Q4W1 5CFDB 1PO22 5F7UA 1HRI3 2NQYA 3LA2A 5FP8A 1C3HA 2GN3A 2LS6A 2VOTA 5DQ0A 2FDHA 1GP4A 4MGZE 3C2UA 1LOFC 5K4LA 1WBFA 3IWZA 1F8VA 3A21A 3N4MA 2PFWA 2WS91 5FY8A 2ZGUA 3A0KA 1BVVA 5DZFA 3TOJA 1FI2A 4LBNA 3ILFA 1RJ8A 2YGMA 4AQSA 1MQTB 4F8AA 5JZGA 1ZZ7A 3ZYHA 2VO5A 4X6QB 3AB0A 5CKQA 2WABA 5FZMA 3VHRA 4FOQA 3I2JA 2XHKA 4CCCA 3MV11 3S6PA 1SLBA 3WNLA 3ZVXA 1BMV2 2I2SA 4JDNA 4AFAA 5AVPA 2GMEA 3H8RA 1FPN1 1LECA 1FV2A 1QJU3 1VBD1 2K0GA 4IEQA 4LQRA 4I09A 4IL7A 2VW2A 3BPZA 3FJSA 3ZYBA 1VJ2A 4LHNA 4PIZA 4HL0A 3BB6A 1VMJA 2D98A 5LB6A 4KGQA 4QPWA 4YYOA 4AYUA 1URXA 1IS6A 4R4XA 2E63A 2D3PA 1W2OA 2AREA 1J3RA 1N3QA 2A1XA 3GCXA 3WG2A 5GLZA 5FZ0A 4N53B 4HPKB 4L2NA 1GANA 2BVBA 2C26A 5F5AA 5T54A 1AL21 4UFHA 4WVMB 2HWD1 2W08A 5C9AB 1W8WA 2GNTA 1OVSA 1UL9A 3DL3A 5LA2A 1VBB2 4QQPA 4XFBA 1RITA 4NIGA 5CG8A 3OB8A 3S30A 3V56A 1D4M2 4JGYB 4AEMA 3LWCA 4B7EA 1R64A 3F95A 2GSYA 4TZDA 4N53A 2D6OX 2AGSA 2A75A 2Y34A 3A7QA 3NVCA 4HPKA 5JZGC 3Q9OA 1F31A 2ZHLA 4E8DA 3AVSA 3KT4A 5EHDA 2BU9A 3V0BB 1NX9A 4JX0A 3PIJA 4KWUA 4WM8B 4AFBA 1CZTA 1PO23 1Y43B 1YNAA 4JGYA 1W3XA 1EPZA 3USSA 4CPBD 2VBDA 5A6ZA 5AFEA 3ST7A 4HBNA 3WF2A 4OHVA 3MZHA 4YRDA 3MHZA 3P6BA 5BUVA 3BGAA 2NN8A 2R062 1UXZA 2QDRA 4N9IA 4QM9A 4XVHA 3VBHA 4CDXB 4QKDA 5DG1A 1ULGA 4WM8A 3AKRA 5AVAA 5FY0A 2A6VA 2WBKA 4M00A 3NAPB 2RVAA 5FZHA 4IDZA 4B4QA 4FPEA 3I97A 1FNZA 3HQRA 3OOXA 2X8KA 4OMDA 4KBBA 4M4RA 4D8MA 2DVBA 4KU8A 2C6SA 1ND2A 2PLV1 3NWKA 4Y22B 3MLLA 4CXXA 3FUOA 4NE9A 1LGNA 5C70A 4N53C 2VOVA 1WMDA 3PTYA 1QEXA 1ZA7A 1RINA 2Y6FA 3BYWA 4Y1UA 4E2QA 2W1QA 2ZHNA 5FZAA 3H7YA 3IDEA 1QDCA 4P02B 2EICA 1Z0HA 4AZZA 4LBOA 4FBFA 3HN3A 1O4TA 3B01A 1RUG1 4XTMA 2VG9A 1AUYA 2RMU1 4JGYC 3G7DA 1F9KA 3LKJA 4LBQD 2D6NA 3I2GA 3ZR5A 4N7IA 2X09A 3MPPG 2E53A 2ZX1A 4LUMA 5JLVA 1T2XA 1FOD2 1VBB3 3KS7A 1BZWA 4DXSA 5JUVA 4DPNA 1VRBA 3NKTA 2ZGNA 4WM8C 4AOCA 2VZVA 4JDOA 4OUMA 1OLRA 3JB4C 1UOFA 2YXSA 5I8SA 1FAYA 5A6QA 2VTXA 4XMAA 2F4PA 1LENA 3NKGA 4LK6A 4OHXA 2JX9A 4PBOA 4E27A 4FSJA 1ND2C 2Q0AA 5LBFA 1YFXA 4NPLA 4XF1A 4IESA 4NVPA 3TNPB 2JE9A 4BISA 2EIGA 5LW9A 2FDGA 4QQOA 1W6PB 1YEWA 2VBBA 3W5MA 1OF4A 2R063 3LDKA 4XFIA 2EIDA 5F2SA 5J36A 1UY3A 1G9FA 3D82A 4COUA 1CONA 4RR3B 4HONA 1QIQA 1DGRA 5HI0A 1AX2A 1NQJA 1RUD1 1S0DA 3U14A 1GOFA 4P9YA 2LW8A 3H1MA 4YW1A 4LHLA 5FZLA 1UAIA 1SEFA 2BVVA 2UU8A 4AI3A 1LAJA 3VD4A 1I5PA 1W90A 2CAVA 4IEUA 2I45A 2VVFA 4RN5A 4C90A 5A70A 4DO0A 4QHZA 4S2GA 2ZZQA 1IPSA 1QDOA 4B7KA 2KD7A 1MVQA 2RS32 3J4UH 4BB3A 4PCRA 2WT0A 1SBDA 1TME1 3SH4A 1UIKA 1ZRFA 4HVRA 1CQ9A 3GYDA 4AG4A 4N7UA 4YW3A 2EXKA 4UBGA 1YQ8A 2IXCA 2XJUA 4N9HA 3PVEA 3W20A 3RDIA 2RR11 2XL7A 1A6CA 4XFHA 2YPDA 1GNZA 2ZBJA 3ZOIA 4JAAA 1UIJA 1G7YA 1W6MB 4KWJA 1UMIA 1FOD3 5DUWA 1A8DA 1J3PA 3PHMA 2D7FA 1PM4A 1RUI2 4RL7A 3WEZA 1F2NA 3ZXDA 2PHRA 1J59A 2QQUA 4COYA 4CTEA 1VBE1 2R49A 2VH9A 2RDRA 3O1SA 3GF6A 3GHNA 3KV4A 5I8YA 3PNAA 1PGL1 2LROA 4AHYA 1ALYA 1OD5A 3VDAA 3ENRA 2HWB1 2X10A 3D3AA 2W39A 4XJUA 1RUH2 4AI1A 2A71A 2XQXA 1EP0A 3RZHA 1OLQA 4BIFA 1LB2A 3HJRA 2VM9A 1AR62 4NJ4A 1XSRA 3FZ3A 3MIEA 4LK7A 5FMBA 3J8F1 5FREA 1V0AA 2Y0OA 2XVLA 5A7SA 5K7PA 1OHFA 2YY1A 1XE0A 4K9SA 4ATEA 3DUIA 2G9ZA 4XFCA 3K4ZA 3V0AB 2P1BA 1K3IA 3RJ2X 1LJ7A 3AMNA 4GWJA 3GBFA 1DF0A 2ZXQA 4FVVA 2EALA 2JDAA 3WF0A 2HEYF 3VDDB 5GZGA 2RS33 2GC0A 4UWDA 1VAMA 5A6XA 5C6CA 2WAAA 1POQA 1YCIA 4KMQA 5FZFA 4AVCA 2O8QA 4LULA 3NRUA 3TB0A 2VMIA 4RGKA 5A7PA 5FY7A 4A2UA 4AE2A 1ASJ1 1CAXB 2DCYA 3M4FA 3S7IA 1OQ1A 5FO9B 5FWJA 2XGXA 1NLQA 5D1IA 5DABA 5GZCA 1KDMA 4OI4A 2MNGA 5LASA 3RZMA 3H8XA 2VZQA 3LDRA 4GMP0 5FBJA 5DMYA 4TSVA 1A34A 3O12A 3VBUB 5FXXA 4BWOA 1AX0A 5HXMA 1LOGA 1SLTA 2Z2SB 4QX0A 4Y20A 4E2SA 1HKDA 1CAXA 3O5SA 4LO4B 1RUI3 5DZEA 3S5AA 3HPNA 2AEYA 4L0PA 1DYOA 1XNTA 3EO6A 4NAOA 2E7AA 3WDVA 3WW1A 1YI7A 4LT5A 1GZCA 5FZIA 1UO9A 1VAVA 3VBUA 1OPMA 1H2NA 4XILA 2WYFA 5IVYA 1D0GA 4PF5A 2TBVA 4CCJA 1BMV1 5A33B 4LOTA 2WZEA 1RUH3 4I02A 1OF3A 2JE8A 2ZX0A 2BWCA 4BZ4A 2WO1A 3BTAA 4IEXA 1AR63 1LEMA 3AKTA 3MFCA 4QGMA 5FRAA 1PO12 1GV9A 3AMQA 2ES3A 1CN1A 2YV8A 4MXWB 5LA9A 3V65A 4XF4A 3WP6A 4CVUA 4XPVA 1W0NA 5A33A 5CFCB 3VDDC 3C7HA 2ZGTA 1QXJA 4Y1YA 5FPUA 1TNRA 3FMGA 2A6ZA 4JCKA 2WINB 4YM3A 5CB7A 1L7QA 2YUEA 5HV0A 2WSUA 1DFQA 1RUF1 1UU5A 2VE1A 1KXGA 2D6LX 2VUDA 2VW1A 3BIWE 4MADA 4MXWA 5A3LA 4EZHA 1TZOA 3E5QA 3PURA 3OF1A 3GM8A 5CFCA 1JI6A 3AJZA 4W6XA 1V6NA 1CIYA 1H1IA 1ULPA 4IE5A 3MIGA 1D4M1 5IVFA 5FPLA 3JQWA 3HN1A 3IAQA 3KCCA 4FP2A 1X8MA 3HQUA 5EWSA 3VBUC 3J7NA 2PMWB 3E5XA 1XU2A 3PDQA 2F17A 5C4WB 1IPJA 1WW6A 1AXYA 2ZEWA 2VZUA 1VBA2 4M0HA 4ZHNA 3GCWA 4Q0SA 4YZ1A 4P5HA 2QQPA 1DIWA 1RYYA 2EXIA 3K4DA 4OUEA 3M3EA 2ZGQA 4AR2A 4UFIA 1PM7A 1W6QB 4IERA 1ULFA 5FZEA 2Z79A 4DXRA 3FHQA 4KGGA 3ZIXA 1OUSA 5ABJB 3PUSA 4R9BA 2CDPA 1R092 1COV2 4FFIA 3AZVA 1YUDA 5CZKA 4XDOA 3WP3A 4AW7A 4URTA 1XNBA 5IK8A 1VR3A 4QX2A 4ATFA 1SPPB 1W6QA 2AEZA 1ZRIA 3NMBA 2JIGA 4ZS2A 5AFBA 1QY4A 1DU3D 2ZJCA 3AP4A 3AYDA 3KV9A 4XC9A 1POV3 1J1TA 4I0AA 3WF3A 2XPJA 1O7FA 4Q4Y1 5C8WA 5L7OB 5CFCC 1I3HA 1HXS1 4INDA 5ERLA 4CDWB 1E57A 1BK0A 1SPPA 4Z8BA 4TTGA 1QH7A 2DCTA 3TWIA 2FZ2A 1PO13 5LK7B 1SG3A 2VY0A 5JOYA 1VBC1 3VUOA 3NQHA 3C7GA 2JG9A 3LPFA 4Q26A 4YGDA 5L7OA 2OXBA 1GQHA 4Q4W2 5F2WA 3SQOA 5AC92 3TN91 2VW0A 1OFSA 1QH6A 1W05A 2R32A 3NO8A 3THTA 1RGSA 3JZVA 3R4DB 4Q0PA 4QKNA 4D6QA 2JENA 2R0HA 4LBLA 2QQWA 4NWVA 5JXIA 3D0SA 5JXGA 4NPMA 2B9VA 4GALA 1FOD1 4NIAA 1U5ZA 2RJ2A 1OXCA 1XNCA 2H0VA 1VRH1 2ADEA 2YU1A 1DQ0A 5J09A 4MGKE 3THPA 4C0HA 2FMDA 4HKLA 4WM7B 5J48A 1ZBE2 4CU8A 3ETQA 1H8TB 3KSCA 2Y64A 3MDPA 3ROUA 2RDQA 1VBA3 4RFT0 2XR4A 3ACHA 3WP5A 1WKYA 3VZNA 5HCAA 4DUWA 1VBD2 4IE7A 1SFPA 1Q8SA 5FYHA 2E6VA 5C3OA 4WM7A 4BLIA 1W8ZA 3PUHA 4B3NA 1H8TA 1COV3 1R093 4DINB 4AQ2A 4IE0A 4QMAA 2P37A 4BMEA 2JG9C 3N9LA 5L7OC 1AR91 1W8HA 2B42B 3AXEA 4I0WB 5DDJ2 2VQUA 4RGGA 1D7PM 1XQNA 1PGSA 2VZRA 3I54A 3PUQA 4FAHA 5IFTA 2YZ4A 1AL22 1GZTA 4Q0VA 1W3VA 2HWD2 5GLTA 1BEV3 2V73A 1GKBA 1NYWA 4F7ZA 1P8JA 2DUQA 5A3TA 3U37A 1ZZ9A 3CKHA 4MOAA 1OKQA 2RS31 2XJPA 3G6JB 3MICA 4HT1T 5FYZA 5BNNB 1JZ4A 3FLPA 4H14A 2AH2A 1WMXA 5T50A 3T08A 5FPAA 2Q8DA 5I0DA 1W28A 2EF6A 4LKEA 1V00A 1Z78A 3OTFA 4XHXA 3VKFC 4AEDB 1Q3EA 4AXOA 2P6HA 1HJGA 2D3RA 4Q4W3 4W6YA 4XETA 3WW3A 2PAMA 3DF0A 3ZYJB 4I30A 4P9GA 4QDRA 1UY1A 1ZREA 4Z07A 5IVEA 1R1ZA 4WM7C 4A7YA 3AP7A 5DAVA 3PIGA 3K4AA 3T30A 3ME2A 1H8TC 4L99A 2XMLA 1IKPA 1I9RA 4Y5Z0 4RD7A 3WNXA 1ZZCA 2I74A 4AEDA 3JU9A 5BNOB 2R6QA 4A3ZA 4HVQA 1G9DA 4XEZA 3WG1A 1M06G 1U5YA 4ISQA 1ZRCA 4Q0QA 2ZAAA 4UW3A 1KD7A 3ACGA 1ZBE3 5IAXA 3MIFA 4WVVA 2W52A 5JSRA 1RUE1 3GZEA 4QPIB 4QGLA 3FE5A 4GZ9A 4LBKA 2PAKA 1C8M2 4RS5B 3WDWA 1VBD3 2PLV2 2RM21 5FR3A 1REEA 3MUZ1 3KHCA 5FXVA 4FTBA 5IUQA 1CAWA 5HV4A 3UV9A 1JUHA 3RWNA 4A44A 2RJLA 2FDJA 1XJAA 1AR61 1F35A 3NNLA 4XDQA 2WZR1 5JMCA 1W99A 2PHXA 5FP9A 4Q4X2 2XB6C 4RS5A 4Y24A 1UWWA 4D6RA 2XBO2 2RMU2 4H3WA 4BCUA 3AL5A 1OQEA 4CYDA 3RQ0A 2DUPA 4EN6B 4LUKA 1CX1A 1AL23 4OUSA 3ACIA 2HWD3 2IVJA 2C1FA 1RMU1 5FMDA 3S7EA 1NCQB 2D5HA 1U0AA 1YJLA 4YZ3A 3EHKA 5JPMB 3QH6A 2MEV2 3FHIB 3IDAA 4AEDC 3IDCB 1Z7S1 1BLZA 2Y0IA 5C3SA 2P3JA 1GMMA 2Z5WA 4JKKA 4RFRB 2CNAA 2A7AA 4A6SA 5KXDA 5J96B 1H2KA 1ZZ8A 3ZDVA 1Y7BA 4AVAA 2DCZA 3IIIA 3RWKX 1WW5A 1KQRA 3DN7A 4FPYA 3T2QA 3TEZA 1IKQA 1UZYA 3GZAA 4UYBA 5FBZA 2UWAA 4YGBA 2FDFA 1C1LA 4EJRA 1SBFA 1L3JA 3SEEA 1FMD2 2UY9A 4IQPA 3SCGA 2XOMA 4YSFA 4HKWA 2VJXA 5H9RA 3OG2A 2VNRA 2D6KA 2ZGOA 3NNFA 4QB2A 5F5QA 4E9KA 4RS5C 3D0JA 1ZZ6A 2DDUA 1XOYA 2DWRA 2H0BA 2VOKA 3EXUA 5HCBA 3VHPA 4NMIA 4XYXA 2P3YA 1WBLA 3ZFFA 1NA1A 1JYIA 2QQMA 4FFHA 3SKVA 2DVFA 1C8M3 1FYUA 1LRHA 1W8OA 2PLV3 4W8JA 5LY1A 1IOAA 5KHGA 5CVRA 4XURA 3VDCA 3LCPA 4Y1VA 4XJWA 5FJKA 1IZ3A 1D0HA 4AGRA 1ODMA 2R7EB 2J1EA 2VUCA 1ZYBA 1TME2 2VQ0A 5A7QA 3K2OA 1REFA 1OLME 3EB7A 3WNNA 4E2GA 1PO11 4Q4X3 5J3UA 3T3YA 3ZSMA 1G6NA 3N9NA 4GB32 5FKBA 3ZN6B 1RUG3 2UY8A 4HSLA 2XBO3 2RMU3 3AP5A 3D8CA 4FFGA 1MZEA 4QXCA 5BPXA 2XH6A 5C8CA 1K5MA 5A3UA 5E88A 3I59A 4QB6A 4LMFA 1C8NA 4C91A 4K7JA 5DZGA 2QQOA 5JI9A 1CAVA 3I3DA 4DUVA 5FMCA 2ZA9A 3VKOA 4URAA 2MEV3 3ZN6A 4Y33A 3AFKA 5FCCA 5FXZA 1PIV2 4JZRA 3ZR6A 3EBRA 1VBE2 5FXWA 1AL0G 3JD71 1WW4A 4QDSA 1PVXA 3ZFFC 1NA1C 2WA3A 5GZDA 2A6WA 1PGL2 1HQNA 1QOOA 2VCAA 2BJSA 2WN3A 1HV1A 2AENA 1DBNA 1S0JA 4R9CA 2HWB2 5EPAA 1VBA1 4DEQA 4ITCA 5FYVA 3H1YA 2J22A 4UW5A 4UW6A 3E6CC 3BOWA 3R4SA 1FMD3 4EN0A 3WT3A 5BNQA 2ERFA 3AK0A 3ZIWA 3J8F2 2W3JA 4YFWA 5KC5A 1COV1 5FY1A 1S1AA 2K46A 4Z82A 2VZPA 3ZKYA 4Y4RA 5C8CC 1K5MC 1TG7A 4IEYA 4UFKA 3C8XA 4GH4B 5IK4A 3K46A 4FTEA 2GAUA 3OBRA 3VBOA 4A6OA 1CZVA 2ZS6B 1NLSA 3H3UA 5KWRA 3CJIA 2Q8OA 4LKFA 5IK5A 4ZU4A 1UY0A 5IYYA 4TYSA 5FZOB 5JDBA 1OQDA 3LE0A 3PJYA 4CEWB 2XJSA 2IXKA 5GJ6A 5APAA 1TME3 4K21A 1H9WA 2I07B 4XDPA 4OI1A 2A3XA 4AFMA 5D21A 1ASJ2 1NG0A 2CY6A 5FYMA 4GB33 5FYCA 2OW4A 4B8EA 3OEBA 4NWWA 4QHBA 5FZOA 3HAGA 4XAAA 5I0TA 5AC91 4H2AA 1FNYA 2J42A 1JYCA 3IMNA 3KGLA 3ZFGB 2C9AA 5JOXA 2JD9A 1OURA 2OPWA 2WKKA 4IW3A 1Y9QA 5CYYA 4Y1ZA 2D6MA 1PIV3 4HSJA 4D3WA 4KI5M 1VBE3 2VQAA 1UNBA 5CFDA 4O9EA 3R05A 1UX6A 2BP6A 3WY6A 2EXJA 4UXAA 1ZBE1 2AC1A 3K3NA 2QQIA 3AMMA 2ZZJA 3F2ZA 2E7TA 3L9JT 4KQ7A 4XXAA 3T2PA 3VBOC 2HWB3 3CJIC 4JV4A 3QLQA 3QBQA 3LFMA 4LO6B 4ZXEA 3U11A 2OA2A 1JU4A 2LM3A 2JB4A 4QDQA 4XUNA 3UYJA 5BY5A 2VECA 3T4HB 3U10A 4OHZA 4X8PA 4MG2A 4GKXA 3J9SA 1MQTA 2W46A 3J8F3 3P3PA 5T5LA 4Q0UA 4MHUA 1A8MA 1I1EA 4W6WA 1AR81 5CFDC 3RSJA 5DDJ1 5FOJB 2FCVA 1JOBA 3UT0A 2ZEYA 1GR3A 1RUF2 1AYN2 5BV6A 3RYRA 1VE0A 4IGQA 1JYWA 5L73A 5C33A 1SCRA 3I3BA 4MH0E 2XJRA 1DZQA 5FZCA 4YLZA 1GZ9A 1LULA 1KFXL 1JOJA 1SLLA 1ZA4A 2J1SA 1I6XA 3DXTA 3ES4A 4RQPB 5A80A 4CU7A 3GJBA 2C0ZA 2CV6A 2RS51 3AZXA 3U0ZA 1AX1A 4CEYB 1ASJ3 3FC0A 4Y26A 3KT1A 4WVMA 4PI0A 4IEWA 3URFA 2GP5A 5C9AA 2CYFA 1DDLA 4NRPA 3WQ0A 4CSWA 2HEWF 1UOGA 2RG4A 5FKCA 2JD4A 3WG3A 2AUYA 2D44A 1LHVA 5KHJA 5LBCA 4LA3A 4CXWA 3KMHA 4BXFA 5DAWA 4AVVA 5FZ3A 1MQTC 1AXZA 4CEYA 3WOGA 5L9RA 3PLQA 4LHSA 1SDWA 5CNAA 3KZ4C 3FN9A 3LD8A 3RMXA 3TBDA 3OUJA 1WUVA 3T0BA 1C57A 2KM2A 2Q4SA 3V0BA 3W5NA 1VP6A 2RDSA 3U4SA 2Y38A 2VUJA 2XWJB 1Y9MA 3PVNA 2XLGA 5A7OA 2WO3A 3VB9A 4A3XA 5IVCA 2CTVA 1ST8A 2GNMA 3MYXA 1UX7A 2JKXA 2WWSA 3AMHA 5DAPA 3OPWA 5E1RA 2G4IA 3KLSA 4GKYA 4Q4Y2 4CDXA 1GICA 4Y1XA 1C8M1 1IQDC 3AFGA 3O0VA 1HXS2 3A22A 1WLCA 2F6BA 1KGYA 4JC1A 1OA4A 1PZ7A 1XNKA 3DYMA 3KF3A 3N9QA 5LEKA 1EAH1 3KB5A 2ZGSA 3NAPA 4OYUA 4BQ3A 4CPBA 3POBA 4Y4YA 1VBC2 4PBPA 2VCBA 4XZPA 3OEAA 1OBNA 1MS4A 3N9OA 5C9AC 2OUJA 1AHSA 4Q4X1 5F3CA 4I3PA 3W59A 4Y22A 4META 4ONUA 2HH9A 2SLIA 4NO4A 2VAUA 2XBO1 4FP3A 4WBBA 3TN92 4N43B 1Q56A 3CQOA 5JAXA 3GNEA 4HANA 1RUF3 3W58A 1AYN3 3MPBA 1WGPA 1T6BX 1CJDA 4CEYC 3THCA 2QCSB 3WNPA 1LHOA 4D7TA 3ITQA 3L2HA 4W4ZA 3KCXA 4GA9A 5FMOS 2MEV1 1D4M3 1VRH2 2VNGA 5BXXA 1Q8VA 1EV11 3K3OA 4J6GA 2VCMA 4N43A 5GALA 1MS0A 3BTZA 4I01A 2P3KA 4LBQB 2WSVA 2D43A 4Q2FA 5H9PA 3PU8A 2R1BA 2G9FA 1G86A 3AYEA 2V5DA 5FZDA 3CLPA 4YG0A 4CDXC 1AXKA 1NQDA 3JBG1 5F32A 2D40A 1J1LA 2J1UA 3Q8BA 2DU0A 1SACA 3KCYA 3NAPC 1QU0A 1FMD1 3ZSJA 4AHWA 4LBQA 1YIFA 1ZBA2 3RGBA 5T5PA 4NN0A 2VOXA 4A42A 3MV01 4KG0A 3J7LA 2XHNA 2WZ8A 4A4AA 1AR92 1OPOA 2ADDA 1JOPA 4D94A 2CAUA 2D5FA 5LCWL 1US3A 2WQZC 3PVBB 1V6OA 2P34A 1B35B 5F39A 4LO5B 1W6PA 3SMHA 3FBYA 3TEWA 4ZKTB 2BV4A 2FCTA 4Q4Y3 4LR4A 2OX0A 3HWJA 4NUBA 5ANNA 3UK9A 1HXS3 4QXBA 3BVCA 4Q1RA 2BGCA 4RR3A 3S5QA 2OT7A 3UGGA 4Y5TA 1JODA 5CAZA 2GN7A 3R4UA 4N43C 3B94A 3OJBA 1HN1A 2NLRA 1VBC3 3Q8FA 4K8RB 4COZA 4JKMA 2VZSA 4NRMA 2PA7A 4A41A 4QQHA 4W65A 4LHKA 1DQ5A 4Y5SA 5H9QA 4GB31 3TN93 1XNDA 2BNMA 4JDMA 4COVA 3GGLA 5A7WB 2ZX3A 1DHKB 4MGYE 3J26N 2HLEA 1GOHA 1XSQA 3B93A 5LRRA 3QD6A 2NMOA 2QJVA 3AC0A 4TN7A 4QQLA 3NV2A 1VRH3 4O65A 4UBHA 1RHI2 1G9AA 1TNFA 1PIV1 5A7WA 3IBMA 2BFUS 3E1F1 1DGRN 2QUOA 4L8QA 2KXLA 1US2A 1RUE2 1W6MA 4CP9B 3CZUA 5EP9A 2BGPA 2RM22 3VD5A 4DRVA 2QQJA 5FP4A 5E16A 4RR3C 1W04A 5DPNA 2OZJA 2IXLA 2B5HA 1LU2A 4NROA 3PUIA 3WF1A 3QCWA 5KHIA 2DTWA 1CJPA 1PMJX 2JICA 2ZPXA 1ZBA3 4CZSA 2V4AA 4LPLA 4LNVA 1CESA 1QOTA 2FCUA 2WZR2 3WF4A 4CP9A 1DLLA 3HEIA 1LESA 4QM8A 1GSLA 4UW4A 3R6SA 1AR93 1SDDB 3N7KA 5FUPA 4DUXA 2ATFA 3OUHA 1PX4A 3I3QA 3UETA 2P17A 3UKTA 1UN1A 2H6CA 3HD8B 3WQBA 2QNKA 3L2YA 5A3NA 1RMU2 4JVAA 4O9GA 1CX4A 4JRLA 4IEOA 5CEHA 1MZ5A 1CAUB 2QBXA 5EJZB 1Z7S2 5FYTA 2ZCWA 3GDBA 1KITA 2X53S 3TRSB 5FTTC 5B2GB 3FHAA 1FT9A 3V0AA 3NNJA 2Y26A 4P9IA 1RUOA 3LA7A 1DGLA 4F3JA 2PQSA 1X9PA 1ZNPA 2ARCA 2HBUA 2Q1MA 2LUWA 3VDDA 2ORZA 1C5HA 1KDKA 5J98B 5KXCA 1NXMA 3THDA 4OULA 1LU1A 1GFF2 1QXPA 3EQEA 3VBSB 4B29A 5FO7B 4LIUA 2VNOA 3ZYGA 2H6BA 3ZFEB 2WFPA 4CDQB 3IMMA 3GHMA 4XBLA 3M3CA 2PN5A 3VD9A 5FZ4A 3LAGA 4GIQA 1RHI3 1XB9A 2D97A 3VBRB 4BJ0A 5FK8A 2QTWB 2VXRA 1UKGA 3APBA 1R1A1 3VBFB 4QXHA 3VBSA 1XRUA 4MLOA 5FZ1A 4XUPA 1ENRA 1RUE3 3OYWB 3ZXEA 4Q8KA 1JZ8A 4OHWA 3ZFEA 2B45X 5A3OA 4CDQA 1Y3TA 1GQGA 3GBGA 1JTZX 2FZ1A 2RM23 4YFZA 4PDWB 1U12A 2W0XA 2HWC2 2VVDA 3M8LA 4QGNA 3BKZA 2J1VA 5LWBA 2DUOA 2V72A 1RUC2 2ZTNA 3RPQA 4S2DA 1XYNA 1OVPA 2YBSA 1DLCA 2WZR3 5GKAC 2E51A 3LEGA 3WV6A 2FDKA 1V9U1 2UYAA 4PI2A 4PDWA 4CU6A 1RXGA 1NCRB 3B69A 1OH3A 3UJQA 3AM2A 3IT8A 2W5FA 2VC9A 3N7MA 5IFPA 2ZGLA 2R30A 2VMDA 1SLIA 2ZKNA 1RMU3 4RGAA 3ZPYA 1AYN1 2ENRA 1W2AX 1PMHX 2NPIA 3ZSEA 4JKLA 1RUJ2 3SEPA 3POJA 1Z7S3 1NCRA 2RE9A 2AZ5A 4FCAA 4RYDA 3RZKA 2O14A 3N9MA 4XF0A 3UGFA 2XJQA 2Q5TA 3AKPA 3JD72 3VBSC 2NP0A 4EWDA 1SMVA 2NYYA 5KXBA 2JIJA 1GWMA 3GXUA 2QE3A 3WDTA 3ZFEC 4P5YA 4CDQC 2V4VA 4R8HA 4X6RB 3WLUA 4M3CB 1UPSA 1DQ6A 4O61A 2OKXA 4OZOA 3K77A 3VKLA 1QQP1 4FPOB 3KQ4B 5F8PA 4AFCA 1EUTA 2FQPA 1CPNA 3FLTA 4IEVA 1GP5A 3RZJA 2ETEA 3AJYA 5IT6A 4XJ8A 5FZGA 5C4WA 2YB7A 1N3PA 2E31A 3CL1A 3M3QA 4EYUA 1JYTA 3HR9A 1W39A 1O6UA 3MI8A 2VZTA 3POSA 4M3CA 5JOWA 4TLFA 4PDWC 1AR71 5HBAA 2TNFA 4IE4A 4S2HA 1YFYA 1STMA 2BNOA 2OVUA 5ISLA 4IV1B 1H1AA 2Q1FA 5I0SA 3AL6A 3ZXJA 1UMHA 4MGQA 4BQ1A 1NZIA 5ABJA 3DEMA 1MS9A 5D2AA 4BQ2A 2RDNA 2OYZA 2HWC3 1UF2C 2WFF2 1A78A 3ZMNA 2W47A 5FQ0B 3ZO0B 4Z2AA 1NCRC 3VHOA 3I49A 2A6XA 1SFNA 1RUC3 1LOAA 3UJOA 4ISRA 3ZXAC 1WLDA 1ZM1A 3KF5A 2YFUA 5T5OA 2R072 4W50A 5A6YA 1BBT2 5F37A 1DQ2A 3QH7A 5FQ0A 5HPOA 1DCSA 1DGWX 4XUTA 4CDWA 4KL1A 4FPLA 3NV4A 1QJZA 1U5XA 2WUHA 1UCXA 3CJXA 5C4WC 4GAZA 4UAPA 1S4CA 4BH9A 2BYVE 2W91A 1IS4A 1RUJ3 2JG8B 3HIFA 3H50A 2GH2A 3KVBA 3USUB 2OS2A 3N7JA 4FT8A 2W1UA 5L9BA 2ET1A 3JD73 1J58A 4LOSA 3VZKA 4E4SA 4ZU5A 3WX5A 2EA7A 2ET7A 5ABJC 3S57A 2HWE1 1OFNA 1IG3A 2ZGRA 4JGZB 4LTAA 2DURA 4DB5A 3USUA 3VL9A 1O3SA 5FZ9A 3FL7A 3D5OA 1QJFA 1ENQA 3WXPA 4GMP3 4CCEA 3CIHA 3K48A 4SBVA 1ZBA1 3CZJA 4FFFA 1LGBA 4JGZA 2YGLA 1LKNA 2W2IA 3N35A 4Q29A 4I0BA 4BU2A 1AR82 1WLWA 1MEC2 4CDWC 5GZFA 2W1WA 5EYXA 5K0UB 2VMCA 3HBZA 4I3GA 2RV9A 2W94A 1O91A 2WFF3 4AQ6A 3ZN5A 2WQ8A 2VTFA 1GQPA 4DEVA 3I2IA 2O1QA 3CF6E 3MF9A 5CKMA 1AJOA 2X5IB 5EJ1B 1JHJA 4UFLA 4YVSB 5EJ3A 2JDHA 2RS52 1UYXA 2R073 5K0UA 1L7RA 3RZZA 2YHJA 2YMZA 4ASLA 5F3IA 1BBT3 4CE8A 3DXUA 1OMIA 1UYZA 2LTNA 2QQNA 1S0EA 2Z69A 3FWEA 4C8DA 4YW5A 3CU7A 2WAOA 1ULCA 1WCKA 1LEDA 3NV3A 4L11A 4NHXA 4Q4V2 5AC93 1GNHA 2WZPP 4ARXA 2WA4A 5BNNA 1MZ6A 1W8FA 3IPVB 1N1YA 3U78A 5CADA 3U75A 2E32A 3UESA 2YU2A 5I0RA 1MS3A 2UWCA 4NHMA 2WLPA 4XBQA 2A73B 5JSOA 2VL4A 4JGZC 4P9WA 1YFUA 1NT0A 3PJQA 1CIWA 1RHI1 1ND3B 5JMOA 2A3YA 3MUY1 1LOBA 1S0IA 1W9SA 2B46X 1RVF2 1K12A 1WCDJ 3AYAA 2C5DA 1AF9A 4QX7A 5EZWA 3VDBA 4R9DA 5G04L 4Q5OA 3T0AA 5JR7B 5BNOA 3N3HA 4D0QA 1W8NA 4BQYA 3TEYA 5F3GA 3T1LA 3P3NA 3N9PA 4AF9A 1WCQA 1S2BA 3RJRA 4ES8A 1EAH2 4BDVB 1JHNA 1O8SA 5K0UC 1UD1A 4DNYA 4IETA 4YM0A 4QPIA 1UZWA 4QX8A 1Q8OA 2P2KA 1AR83 3JB8A 1OI6A 5DDJ3 1MEC3 2P3IA 1OD3A 5EV7A 2XLFA 2BWAA 2BEOA 3PUAA 4AEKA 4AK3A 4BHPA 1IQAA 1XU1A 5BNNC 5KR7A 4EWEA 1N47A 1NOVA 1SBEA 4IUGA 4UOJA 3WQ7A 1WWYA 2OUHA 5IVJA 5FPVA 5FJHA 2WIIB 3ZYIB 1W6OB 2HBTA 3RNSA 1CWPA 1E5RA 1GLHA 5M0TA 1EV12 2L9LA 5TSWA 3I3EA 2WQ4A 2RS53 2KR2A 1GZWB 3E6BA 4CXYA 3HNYM 4XQDA 4B4RA 4EN9B 1UZ0A 2BGOA 2P5BA 4GD4A 1NCQA 1QJX1 5EXOA 4MSVA 3ZX7A 1EY2A 4S2FA 4XW3A 1DP0A 1U5IA 1RIRA 3JBG2 5BNOC 4Q4V3 2OQ7A 4YW6A 1H30A 1UY2A 2X29A 2XKPA 3DGTA 1O3QA 1GZWA 3WDXA 3T0DA 1MS8A 5JIAA 4FOYA 1XBFA 1GNYA 3NJYA 1A3KA 1C5IA 3P5BA 2ARXA 4M4PA 4QPIC 4ZS3A 5T5JA 1JZ7A 3IKWA 3M70A 3MW4A 4NRQA 1MZFA 1PZ8A 3WHTA 3VD3A 1RVF3 3ILRA 4I2OA 4ASMB 1HB2A 2VTXJ 1SLCA 4AWDA 1GU3A 5ANQA 1QF3A 4UI9L 5DXDA 2DCKA 4RHV1 4AVTA 2ZGPA 3AMPA 2BPA2 3PTRB 2ZGKA 5C5TA 2HWC1 5FPZA 1W9WA 5FFOC 4CP1A 3HMYA 1BKZA 3SCHA 1GWLA 3VLBB 1EAH3 1RUC1 4B4PA 5IK7A 1FV3A 3B9CA 3KQRA 1W8TA 4XIKA 3I2FA 3OGJA 3DCQA 4SLIA 1NCQC 3LF7A 4NIDA 2HEVF 3MGUA 2RS11 4MO3M 2IC1A 1H9PA 3BN6A 4GJZA 1XE7A 2WT1A 3FFZA 1O3TA 2GC2A 1X8EA 2DBIA 3C7FA 4RA0A 1HV0A 2ORXA 4L92A 4AGGA 3T2OA 4P14A 1H6YA 5JCTA 5FV3A 4OVEA 3DV8A 1BQPA 2QQKA 5A1FA 4FOWA 2A6YA 2Q8CA 2ZHMA 5SV5A 1RUJ1 1LHUA 1YLLA 2D6PA 2NMNA 1EV13 2R16A 3I7DA 4XACA 3WCSA 3V64A 4GWIA 2GDFA 3WG4A 4A7ZA 4QPGB 1UYYA 1PK6B 1SHWB 3CO2A 2B8MA 4N8MA 5EQUA 1MPXA 4EE2A 4JTOA 1R081 3H8OA 1NUKA 3ZYPA 1OKOA 1DGWA 4XFFA 4ZY9A 2DTYA 5BYNA 2VBPA 3JBG3 1Q5OA 3VZJA 5FUIA 3WR0A 3O0XA 2ZHKA 4LIVA 1QNYA 4QPGA 1O4YA 4BOWA 3FX3A 4FXKB 2WYSA 1IHMA 2PXJA 1W2NA 4Z92B 2GMMA 4NOTA 4K1ZA 3B7MA 1KS5A 3RI8A 1JUIA 3WNKA 4GMP1 5FDBA 1X9TA 2A3WA 1V6MA 2GNDA 3LEIA 2QKDA 4K40A 2FDIA 3QACA 4XQ4A 5IAVA 3J7MA 5FYIA 4LJHA 4WZFA 3ASIA 4K1YA 4QU2A 2PQQA 5LK5A 4LEJA 4WVWA 1N3OA 5DAQA 1YQCA 2ARBA 4FPJA 1QWRA 3WW2A 2YC2A 3ZKUA 1C4RA 1JBCA 5C7GA 4YM1A 4LO7A 2WFF1 1W2UA 1LNSA 1QJU2 4FPGA 4JQRA 2BBVA 2QVSB 4LLOA 4AL9A 4GH4A 4XFAA 3ZYFA 4YZ2A 2R071 2JJ6A 1EYBA 3PVOA 3NV1A 4R4ZA 3FFQA 3OGVA 1BBT1 1DYPA 1Q43A 3JQXA 3MO4A 4DS0A 4XBNA 2EAKA 5GLUA
chains in the Genus database with same CATH topology
5JI7A 1BYHA 4DMIA 4CEWA 1QHDA 4QPGC 3E97A 1QGLA 2R042 1DG6A 1W0PA 4GULA 4EN8B 1UW8A 3FLRA 4XJ9A 3I2DA 3WVJA 5T52A 5F1RA 3ZXFA 1R1A2 4KH9A 4P9XA 2PHTA 1YJKA 4DZGA 4C1WA 4MZUA 3ZFGA 4BLJA 2BQPA 1CVNA 5KXEA 3M3OA 4FO9A 2WNEA 4DY3A 2GC3A 5JZGB 4GH4C 1YYNA 1PNFA 4HMZA 2ZABA 4AI0A 2XLAA 1BVP1 3O7OA 1V9U2 2VVEA 4FOVA 4G4FA 5A32B 1TE1B 2JKBA 1QJY1 1FATA 1MACA 3D4KA 4CRQA 1MEC1 4CEWC 3AX4A 1H2LA 1BJQA 4HVOA 1OOPB 4IEZA 4V1PA 5A32A 5CIRA 2PHDA 2WNUB 4XHBA 3DKWA 2QDNA 2CGPA 3RYPA 3ZFGC 1OOPA 1QQP2 4F83A 2WNUA 1UKRA 1BCXA 1X36A 2XVGA 4Q4V1 3K51A 5KBFA 4RQPA 4NHKA 1NY72 1PHMA 2R043 3WW4A 3O14A 4AVBA 3U07A 1HQWA 1AR72 1YIPA 4AEJA 2HWF1 1R1A3 1DZRA 1RVF1 4CP2A 4OHYA 2R1DA 1RUNA 2O0OA 3VBHB 5DUXA 3WZ1A 1AJKA 3ZSKA 1WD4A 3ELNA 1IGOA 4P9LA 1N1TA 2BW8A 1JXNA 2K2SA 3LSEA 1UZZA 3ATGA 3GALA 3LGRA 3CEWA 1V9U3 1OOPC 1ND2B 2R0FA 3S0MA 3TAYA 5K8SA 4YZ4A 2WNUC 4G9SB 4RQPC 3IDBB 1YXWA 2OZ6A 3D6EA 1TMF1 3R0RA 3U4XA 1HX6A 3FBMA 3VGIA 2XL9A 3SHRA 3VN4A 3KD4A 1PZ9A 5SV8A 3PMSA 3M1HA 4MGIE 4K6BA 2HWE2 1UMZA 1H1MA 1KJLA 1QQP3 1ZZBA 4DXZA 1H4HA 3N36A 1PNGA 4J1XA 3WCRA 1AYM2 2IZWA 1V70A 5JIUA 5FMOL 4GWMA 3DPRB 3VBHC 4HKOA 1AR73 4IEPA 2JEMA 5ACA1 1UPIA 3MIHA 3MLJA 5KHKA 5L19A 2FBEA 2FHRA 3WUCA 3LOBA 3OGGA 5JWPA 3M2MA 4YARA 2WL1A 5CU1A 4MX3A 2Z42A 4AHXA 1W0OA 1YO8A 2CGOA 3DPRA 4FTSA 3W9AA 2D93A 2ZAHA 4KWLA 4LE4A 4L9BA 1B35A 4GXLA 3SISA 3MF6A 1HIXA 2XVKA 3OBTA 1H2MA 5FLJA 3VKMA 1WLTA 4M01A 2RHPA 3RI9A 1DZTA 4GWNA 4EWAA 1PVC1 1V6JA 2N7GA 4YZ5A 3MW2A 1S0BA 1WW7A 2BNNA 4Q27A 1DQ4A 1O4ZA 3H1WA 2A5ZA 1AZDA 3MLKA 1NXD1 4H55A 4NHLA 2HWE3 1HRV2 3DPRC 5CBLA 2JDZA 1PGW2 5F6LB 2B9UA 5JOZA 3CNAA 4IXLA 1HRI1 1AYM3 1IS5A 4QD2A 5EFUA 3C3VA 3RG0A 1B35C 2KA3A 4U2AA 1QOSA 5D8AB 1G9BA 1JH5A 3OY8B 2BFUL 3SH5A 4HLTA 1F5JA 1POV0 5I0UA 4HN1A 2ILMA 3H9AA 3KT7A 2DU1A 4HK9A 1G9CA 4AI8A 5D8AA 2DVAA 3ZMOA 1QJU1 3FUQA 3OY8A 3WDYA 4R9AA 3UL2A 2WT2A 2DV9A 1NE6A 4XTPA 3VHNA 2YC0A 1QJX2 1QKQA 1XYPA 4AQTA 1CD3G 5EYYA 1CAUA 5H9SA 5FO8B 1RTVA 3JUUA 1WD3A 1APNA 3B3QE 2R041 4HN0A 2ZMNA 3LA3A 3NSTA 1IPKA 2ZGMA 4XF3A 2YYOA 1LHNA 1YRZA 3GZTB 3O0WA 2EAAA 4L97A 5DUVA 4DRRA 4Y20B 1SCSA 1O3RA 1GYKA 2IXJA 1X50A 3ZN4A 1HRV3 4KWKA 4RHV2 4AI2A 3VL8A 5A3MA 3H7JA 3TYJA 5D8AC 3VBRA 1PO21 3AXDA 2YPJA 3VBFA 4XFGA 5FOBB 2QFEA 3SLIA 5J7MA 2AYHA 2UWBA 5CA6A 3OYWA 4WV8A 3ACLA 1DYKA 3HQXA 2RS12 1O5UA 3B5LB 2DCJA 1RL3A 4KG8A 1C28A 2CGNA 1HW5A 3OCPA 4PIXA 5GLWA 4LBMA 2VU9A 2PTMA 2XUMA 4MV2A 1VIWB 3B02A 3AP9A 5L36A 4DOUA 2B39A 2WLQA 2EVXA 4HZFA 3M7AA 1NLRA 3MIBA 3ZXGA 1WMEA 2GC1A 1YWKA 1N1VA 3E6DA 1R082 3AZWA 1QJX3 5E8AA 3VZLA 4H7LA 3SITA 4GQ7A 1VB4A 2GU9A 3VBRC 1TQ5A 4XXPA 1LOCA 3JCIA 4AVSA 1LGCA 3VBFC 4N90A 4QQ2A 1LHWA 2QZ2A 1UU4A 2PYTA 1NY71 3HT2A 4AGVA 2DF7A 2O8OA 4M0NA 2BUKA 4NR1A 1VBB1 4XJZA 1YHFA 1VLNA 1V6KA 3MEPA 5HCFA 3AZZA 3M3IA 1D4VB 1ZRRA 4BMBA 3AKSA 4RHV3 1T6GC 4RSUA 4BA6A 4XMIA 3AP6A 1X7NA 3WDUA 4R52A 3H3ZA 5T3NA 3BU7A 4PIYA 1H0BA 4ZXKA 3WP4A 5K9YA 5FPXA 4IV1A 2Q30A 2IFWA 2G9GA 2UURA 3LB9A 2VGDA 3ALQA 4KNCA 3WD5A 2R061 1Q8PA 1PMIA 2IWGB 2RS13 4Z1VA 1SQ4A 3KGZA 1GBGA 4NPRA 4AFDA 4TWTA 3UKNA 2V5YA 4U36A 4C1XA 3ILNA 5J37A 2MHFA 1EPWA 1XYOA 3H8UA 3HT1A 2DVGA 1O5LA 1FXZA 1V6LA 2JG9B 1BEV2 4BIOA 4E4DX 2VUAA 3T1MA 1QXRA 2JECA 2SBAA 3AZYA 4MVTA 1ULEA 4XOGA 5JPNB 4PQ9A 1CR7A 3VV1A 4FQ4A 5GM0A 4BYYA 5KC6A 1R083 2RJKA 1ZRDA 4PJYA 1JW6A 4E4ZA 3MFAA 3WINE 2VMHA 4XQWA 3ZYRA 5GLVA 2JG8A 2TEPA 4LBJA 4Z2WA 1S2KA 4CP0A 2DFCA 2WNVB 2XWBB 3POWA 4LO8A 4IV1C 3WQ1A 1H8VA 1LOEA 2WC2A 1AYM1 5F9TA 5LEJA 1NZCA 2WS92 1ENSA 2IXIA 2JE7A 1QJY2 3I8TA 4HK8A 2WNVA 1W6NB 4FAGA 4J1WA 1J3QA 2OIIA 3MIDA 5I8TA 1UU6A 1XE8A 3N7LA 5DUUA 4PLOA 3UKVA 1FPN2 1D2QA 3KM5A 2K9ZA 1F5FA 1SFYA 1KJRA 2ZKLA 1W6NA 2A70A 4D7YA 4FQZA 5FAXA 3IIAA 2ZMKA 1HQLA 4K20A 4M3CE 4EROA 3SNMA 2JG8C 5LRSA 2CWSA 3IM0A 2X5IA 1QNWA 4YVSA 4WVZA 3SCFA 4ORFA 4K3UA 2VMGA 4PLNA 4EN7B 2NZ9A 3LOIA 3PMEA 2HWF2 2PHUA 2WNVC 2GNBA 2W68A 1LODA 4M3CF 2E7QA 1X82A 3IPVA 3WHUA 2JXAA 2ZMLA 4YG6A 2HYKA 3ES1A 4MYEA 4QX5A 4FPCA 2IFRA 1HRV1 4ES9A 4P9JA 2BTVC 1D2SA 1PGW1 1S0FA 4FPKA 1WMFA 3SH3A 4G3YC 4DQAA 1LCLA 4D69A 1ND3A 1QMJA 2ZOEB 4KU7A 4BPZA 2PAEA 1MVEA 3I4IA 4YW2A 5T55A 2OPKA 2WJSA 2AR6A 2WS93 4OI2A 1CGPA 1RUI1 1QJY3 1S0GA 1CAWB 3WUDA 3OD4A 3LSDA 5E89A 1BK1A 3ZSLA 2X5IC 3NW4A 4YVSC 1CPMA 4FPHA 1TMF2 4BM8A 1VB2A 1FPN3 2GH8A 3ZDSA 4WZCA 2DYCA 2E9QA 1RUH1 4AHZA 2XG3A 1M4WA 2XKOA 1MS5A 5BNPB 1XXNA 2DVDA 2GZWA 2GALA 3VKNA 1RUG2 3OD0A 2YDEA 1KS4A 1V6IA 3AKQA 1W6OA 4YGEA 1Q8QA 1ND3C 3BOPA 1OA2A 2V09A 2PHFA 5CG9A 5BNPA 2EXHA 1YI9A 4XE9A 3TNQA 5ACA2 1LR5A 2DFBA 2HWF3 3BODA 4LLFA 4XF9A 5KHHA 1C1FA 2Q1ZB 3NL1A 3T2TA 5JSPA 1LTEA 4Q1PA 5FLHA 4D7SA 1WCSA 4LE3A 4CDUB 3A4UA 2FMYA 4QXKA 1ZVFA 2QZ3A 3AYCA 4FPFA 3ZFFB 1NA1B 1REDA 5DG2A 1YFWA 2VOWA 3RS6A 3GBWA 1S0CA 4OLLA 2PELA 4CDUA 4K8FA 4PLMA 4IV3B 2XJVA 1RUD2 3MW3A 3H0OA 5GZEA 4YVWB 1TMF3 1PVC2 2ZACA 1RB8G 1MR5A 1TEIA 2ZX4A 5BNPC 3RMYA 1N1SA 2YROA 1X33A 1POV1 1WA4A 5FLIA 4XJAA 4IV3A 5C8CB 1K5MB 4LA2A 3I59B 1ENXA 2D3SA 1NE4A 5I93A 2VULA 2CL2A 4YVWA 1VAKA 1CAVB 4JRAA 4H7MA 3RRDA 1KFUL 1SLAA 1ZX5A 4DY5A 1ONAA 3EJKA 2B7YA 2RR12 4XIOA 3X29B 1HRI2 1HLCA 1PK6A 1VALA 2CWMA 3ZXKA 2MPFA 5I91A 2IXHA 2PHWA 4MXVA 4HFSA 5ACA3 4HETA 4CDUC 4FXGB 3B9IA 1BXHA 4MUVA 4YNIA 2HKXA 2TUNA 4DFSA 5F6KA 4YW4A 1RC6A 1G8WA 4BE3A 2UYBA 1S55A 2XJTA 4YGCA 3GZUC 4YM2A 1IS3A 4IV3C 3INAA 2HJIA 1FX5A 1I5ZA 1OA3A 3BALA 2PHLA 4JTNA 3BCWA 3VBOB 4OI0A 4YG3A 4YVWC 1LOFA 4OZXA 3CJIB 4EV0A 1R091 1AVBA 4QPYA 4OFGA 1HDKA 1ULDA 1KRIA 3POYA 3B00A 1RUD3 3OPZA 3VZOA 2GMPA 3E5UA 4QT6A 3ECQA 1OSGA 4A7KA 1PK6C 2NM1A 4ZU7A 1PVC3 3VZMA 1B09A 3QOPA 3SXWA 1RJ7A 1BEV1 5HXVA 5JVVA 3A0NA 4X8NA 2LALA 2ZX2A 4C0BA 3NJZA 4Q8LA 1H4GA 1DQ1A 3RYKA 3ZXLA 2VPVA 1MS1A 3LZZA 3IN9A 2RR13 1JN2P 4Q4W1 5CFDB 1PO22 1HRI3 2NQYA 3LA2A 1C3HA 2GN3A 4MGZE 3C2UA 1LOFC 1WBFA 3IWZA 1F8VA 3N4MA 2PFWA 2WS91 2ZGUA 3A0KA 1BVVA 5DZFA 3TOJA 1FI2A 4LBNA 3ILFA 1RJ8A 2YGMA 4AQSA 1MQTB 4F8AA 5JZGA 1ZZ7A 4X6QB 3AB0A 3VHRA 4FOQA 2XHKA 3S6PA 1SLBA 3ZVXA 1BMV2 2I2SA 4JDNA 4AFAA 5AVPA 2GMEA 1FPN1 1LECA 1FV2A 1QJU3 1VBD1 2K0GA 4IEQA 4I09A 4IL7A 2VW2A 3BPZA 3FJSA 1VJ2A 4LHNA 4PIZA 4HL0A 3BB6A 4AYUA 2D98A 4KGQA 4YYOA 1URXA 1IS6A 4R4XA 2E63A 2D3PA 2AREA 1J3RA 1N3QA 3WG2A 5GLZA 4N53B 4HPKB 4L2NA 1GANA 2BVBA 5T54A 1AL21 4WVMB 2HWD1 2W08A 5C9AB 2GNTA 1UL9A 3DL3A 1VBB2 4QQPA 4XFBA 1RITA 5CG8A 3S30A 3V56A 1D4M2 4JGYB 4AEMA 3LWCA 4B7EA 2GSYA 4TZDA 4N53A 2D6OX 2AGSA 2A75A 4HPKA 3NVCA 5JZGC 3Q9OA 1F31A 2ZHLA 3KT4A 3V0BB 4WM8B 4AFBA 1PO23 1Y43B 1YNAA 4JGYA 3USSA 1EPZA 5AFEA 3ST7A 4HBNA 4OHVA 3MZHA 4YRDA 5BUVA 2NN8A 2R062 2QDRA 4N9IA 4QM9A 3VBHA 4CDXB 5DG1A 1ULGA 4WM8A 3AKRA 5AVAA 2A6VA 4M00A 3NAPB 4B4QA 4FPEA 1FNZA 2X8KA 4KBBA 2DVBA 4KU8A 1ND2A 2PLV1 3NWKA 4Y22B 3MLLA 3FUOA 1LGNA 4N53C 2VOVA 1WMDA 3PTYA 4E2QA 1RINA 4Y1UA 2ZHNA 3H7YA 3IDEA 1QDCA 1Z0HA 4LBOA 4FBFA 1O4TA 3B01A 1RUG1 4XTMA 2VG9A 1AUYA 2RMU1 4JGYC 3G7DA 1F9KA 3LKJA 4LBQD 2D6NA 4N7IA 3MPPG 2E53A 2ZX1A 4LUMA 5JLVA 1FOD2 1VBB3 3KS7A 1BZWA 4DPNA 3NKTA 2ZGNA 4WM8C 4JDOA 4OUMA 1OLRA 3JB4C 2YXSA 5I8SA 1FAYA 4XMAA 2F4PA 1LENA 3NKGA 4OHXA 2JX9A 4PBOA 4E27A 4FSJA 1ND2C 2Q0AA 1YFXA 4XF1A 4IESA 4NVPA 3TNPB 2JE9A 2EIGA 4QQOA 1W6PB 2R063 4XFIA 5J36A 4COUA 1G9FA 3D82A 1CONA 4RR3B 1DGRA 5HI0A 1AX2A 1NQJA 1RUD1 1S0DA 4P9YA 3H1MA 4YW1A 4LHLA 1UAIA 1SEFA 2BVVA 2UU8A 4AI3A 2CAVA 4IEUA 2I45A 2VVFA 4C90A 4S2GA 2ZZQA 1QDOA 4B7KA 1MVQA 2RS32 3J4UH 4PCRA 2WT0A 1SBDA 1TME1 3SH4A 1UIKA 1ZRFA 4HVRA 1CQ9A 3GYDA 4AG4A 4N7UA 4YW3A 2EXKA 4UBGA 2IXCA 2XJUA 4N9HA 3PVEA 3RDIA 2RR11 2XL7A 1A6CA 4XFHA 1GNZA 2ZBJA 4JAAA 1UIJA 1G7YA 1W6MB 4KWJA 5DUWA 1FOD3 1A8DA 1J3PA 3PHMA 2D7FA 1RUI2 4RL7A 1F2NA 3ZXDA <