1ISFA

Crystal structure analysis of bst-1/cd157
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
total genus 86
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1isfA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1isfA02
4D44A 1S7CA 2ZTLA 1NHGA 1M76A 2A35A 3H3JA 1BGVA 1YL5A 2ZYAA 5ES3A 1HYGA 4CMIB 1LBEA 2Y0DA 3DZGA 4AJHA 4YWJA 4L75A 3ETGA 3DXFA 1BXZA 4PRLA 1Q7GA 3D64A 4MJLA 3IIEA 1I24A 4J1TA 1PGJA 3Q6IA 3HNPA 3HQ4O 1NFQA 3TPCA 5JY1A 3OA0A 3IJPA 2Q49A 3RU7A 1WMBA 2YHIA 2EP7A 2NU6A 4J7CA 2V65A 3C7DB 3BYZA 4GVXA 3AU9A 3C1TA 3G79A 1RM0A 4BUCA 3HDJA 2JJYA 3F5QA 5TS3A 1X7HA 3KVOA 4MKZA 3E03A 4GQAA 5DCYA 4PG5A 3NRCA 3QLJA 2Q4EA 3NDJA 3B1JA 3EVNA 3CUKA 5KIAA 4XQEA 4IS3A 1KOLA 2PFGA 4KP7A 4Q3BA 4YVFA 1DPGA 3NGXA 2C59A 4IQ8A 1LDBA 4E2WA 2AEJA 3PLNA 4P22A 3RROA 3QE3A 1ADFA 3VH3A 3VPGA 4XRGA 5F1KA 1QRRA 2GDZA 4CM9D 3ZH2A 1TT5A 3E48A 4L4XA 2CNBA 4XRRA 5JO9A 3WYBA 3ADOA 2X0JA 2Y1EA 3JQFA 3QSGA 4ZQGA 4DA9A 1SEVA 3PDUA 4DC0A 1BDBA 3JYNA 1WLYA 2X7HA 1X13A 2HKIA 4ALIA 1YJ8A 4RF3A 1H2HA 4PIVA 1BVRA 1LRJA 1GEGA 4D0SA 1SCUA 2Q1TA 3U4IA 1E6EA 2ZJ0A 4DXHA 1SBYA 1B15A 2WYVA 3DHNA 5JS6A 4WNCA 4QUKA 1Y8RA 3FWZA 1NP3A 4XQ9A 3PP8A 4GSKA 1FDWA 1KY5A 1NQAO 3ABIA 3HWRA 4BNTA 2A4KA 3ZHXA 4FFNA 4U8GA 5F1OA 4ID9A 5T8KA 2NTVA 4K6FA 3ZWNA 5A5FA 2NVUB 3ZWBA 2W2LA 1VC2A 2PZKA 4GGOA 3VKVA 3GDGA 5KJEA 3P7MA 5C3MA 1PQWA 2FPPA 3ANNA 1ID1A 3CXRA 3OF2A 4FGSA 1EEHA 4YB8A 1KVTA 1ZK3A 3GUYA 5TJHA 3H7AA 4EUEA 3PIIA 1VE9A 2D1YA 3P19A 5FFFA 4MVJE 5K6AA 1Y7TA 3DAFA 3GK3A 3PHHA 4AJJA 3UICA 2YW9A 5A9SA 3MZ0A 5KJ6A 2CDCA 1XU9A 2D4AA 4U7WA 2BRUA 2F1KA 3PWZA 3SC6A 4WLFA 4J43A 4MP3A 2PGLA 1W8DA 3FNEA 4PLYA 5L95A 2VHZA 1PJQA 1BVUA 1VL6A 3GDOA 1EK5A 3HHPA 4U5QA 2V7PA 4EZBA 4R16A 1I5RA 4YT4A 1SC6A 3H9EO 4UVHA 3DZIA 5COQA 5EQDA 3WIDA 2IYPA 5JYEA 2DKNA 5KWEA 3PYXA 4JGBA 4XA8A 1FDTA 1YB5A 4UULA 1L1FA 2Y99A 1E7MA 1HLPA 4WOJA 2AE2A 1MFZA 2RH8A 4PCVA 4NIMA 4RF5A 3VPXA 3NT4A 1DLJA 4N5NA 3NTQA 2DLDA 3R6DA 4PLTA 1P45A 1XSEA 5I8WA 4FOOA 5L53A 2J6IA 3LC1O 4CLEA 2O7QA 3ZWWA 3WNVA 4E12A 1X15A 2ZTMA 2A94A 5A9TA 2GNAA 4YJFB 2HK8A 1E3JA 1ZBQA 4CMAA 4BO9A 1XEAA 3S8MA 2IZ0A 2GN8A 2ET6A 4UUMA 1R0LA 1E3WA 3O4RA 3EUWA 3W6UA 1NVMB 2Q4BA 4NBTA 2I3GA 3KUXA 1GTMA 3U62A 4EJMA 1VJTA 2YV2A 1ZK4A 5G0VA 1Y81A 1I01A 3DOCA 1CQJA 5G0WA 4E31A 4CV2A 3JQGB 3UCEA 3V1TC 1VJ0A 5I7VA 4NMHA 4FFMA 1LLUA 1WW8A 4PG6A 4MVJI 3RI3A 1YGYA 1JVBA 5DNAA 1HRDA 4X54A 1EFLA 3TOZA 1JVSA 2CZCA 3GFGA 4L9RA 3WGYA 4D3FA 2IXBA 1JKJA 2YFHA 2RHCA 4LISA 4JLWA 1SNYA 4EDFA 5JE8A 1ML3A 1XA0A 3W8EA 1ONPA 1PGOA 4B79A 1JWAB 2P91A 2GF2A 5HA5A 1LTHR 2C20A 3DTTA 2BFOA 3BMCA 3ZU2A 2AEFA 1DHRA 4CMKA 5DBFA 1DFHA 1V6AA 2E48A 3KTDA 1ZK2A 3HJAA 1I3LA 4NK4A 4M49A 2CF6A 4OAQA 3VH1A 5L4NA 2GR9A 2O3QA 3IJRA 4NH4A 4DBVO 2OP1A 5ICSA 1F17A 1H9AA 2FMUA 5I7FA 5DT9A 3GVXA 1O95A 3DBRB 4PFJA 4BIIA 2O3JA 2RIRA 3E6AA 3RSHA 1LI4A 1V35A 1DHTA 2BF7A 3ULKA 3ZCXA 4WOKA 4CR7A 4BO2A 1NYTA 2X58A 3GN2A 2EGGA 2WMDA 1BDMA 4XGKA 4E2YA 4GLLA 5EMHA 1I3NA 1XYGA 1ZCJA 4KQWA 5AXBA 3UHAA 1R4MA 5F3RA 1C0IA 3BMNA 4YRDA 3ZNOA 3DR3A 2CDBA 2Z1MA 3DOJA 1JA9A 1PWXA 3WG9A 2GD1O 1XU7A 2PZLA 2DTEA 1N2SA 3FD8A 3KV3O 3FTPA 3MOIA 2VYVD 2HAEA 4WECA 1BXGA 4EUHA 1PEDA 3QWFA 3DMTA 5LC1A 5T64A 1TI7A 3L4SO 5CPFA 1KETA 3FPLA 4DIBA 1YOVA 2PD3A 3O8QB 3OJLA 4RQUA 4BB5A 4GPD1 3RC7A 2OO5A 2D59A 2J8ZA 2VZ9A 3HFSA 2E4AA 3JQBA 4I5FA 3GVHA 5I8ZA 5KOIA 2XOXA 1W6UA 4XDYA 3G0OA 3TF5A 4CMBA 2GN6A 5MGBA 2WE7A 1U5AA 3NT5A 5TF4A 1UDAA 3JYLA 1SO8A 3CTMA 1KYQA 2AMFA 4BNWA 1E7SA 1ONOA 3U49A 3FNFA 4YJGB 4WUVA 3H8VA 4D45A 2JHFA 1PJBA 2OP0A 2FPIA 4RPJA 4A5OA 2PTGA 4F3YA 3BTOA 4K6CA 4MIYA 2C82A 2YHIB 3JYPA 3I83A 1B3BA 4A2CA 4CUJA 3TL2A 3B1FA 3OMLA 3FSRA 5T67A 3D5QA 4EYEA 3WFIA 2DBVO 4MVJH 2QIOA 2I76A 3CIFA 5IDQA 1GQQA 3AY3A 3DBHA 4KOAA 4E0BA 1ZEJA 3PQFA 4EUFA 4E5NA 5K6AC 2R2GA 1UDBA 4YDRA 2EEZA 4BGUA 3BTVA 3D0OA 5HTOA 3OHSX 3WBBA 1X0XA 3LSYA 4RJTA 2H6EA 2XF8A 4R41A 4QTZA 4WE3A 3I9KA 6ADHA 2VT3A 4AJ4A 4HADA 4IDCA 4IINA 4WNIA 1XIVA 3VH2A 4A7PA 4P4NA 4KQXA 4XQCA 1PJLA 2FOIA 4UEJA 5G0UA 4CUZA 3KEOA 1KIFA 2NVWA 2P9EA 4P4GA 4EITA 2EXXA 5L45A 4R54A 4BNZA 3C3XA 3JQAB 1QXSA 3KOUA 3WNQA 5L7YA 5AVOA 2EGHA 1I3KA 2HSDA 2NADA 1C0LA 4MP6A 3WIEA 1EK6A 4CM8A 2JCXA 2BELA 3DZFA 2AW5A 2IDZA 3TZ6A 3ZZNA 1AGNA 3WWYA 2ZTVA 3NJ4A 3SJUA 1P0FA 1C1XA 3K96A 3GHYA 3L4BA 4LCJA 1EBUA 5TNXA 4ND3A 3OEYA 3VDQA 3LT0A 4OIMA 1U1IA 3DOOA 2SCUA 3UGKA 3FF4A 1GCUA 3AUAA 1P9LA 1XQ1A 2BFAA 2O7SA 2Y0EA 3A06A 3BTUA 1KVRA 3IOYA 1N5DA 4NPCA 1K0UA 3BXXA 3NDIA 4OXKA 4XR9A 3I9JA 4K1LA 4HBGA 4RO0A 3WJAA 4M1QA 2YDXA 3PGXA 1ULUA 3GRPA 5BT9A 4YT2A 4DREA 3IUPA 5G4LA 2OXIA 1IUKA 3PEFA 4I9HA 4ZGWA 1FMCA 1V3VA 4C7KA 5IG2A 1KEWA 1L7EA 5EERA 1AUPA 1DRVA 5AXDA 1LDYA 2Q1UA 1WMAA 2JCVA 4DPKA 1FDVA 3DZKA 4HP8A 1AE1A 4M89A 5A06A 4YQZA 4BNGA 4R9RA 5IDXA 3QQPA 4E5KA 4OH1A 4OOEA 1OI7A 4QSMA 3PZRA 3VDRA 1NQTA 3GF4A 3PLRA 1J4AA 3F47A 1Q7BA 2NSDA 3CMCO 5AYVA 4CM5A 4ZQFA 2IZZA 4AVYA 1D7OA 4IZIA 1ZK0A 3AUTA 3HDYA 3JQ7B 3ASUA 4JXKA 3RQSA 4DBZA 3GH3A 1M2WA 1QP8A 2GZ1A 1ISJA 2B35A 3JQ7A 5H83A 1G6KA 3VKUA 4XJTA 1GD1O 1V3TA 3WMWA 5U9CA 1I8TA 4BMNA 2B5WA 5A3JA 2XXBA 1SPXA 3L6OO 4DMMA 4OQZA 4N5LA 4MDHA 3OIFA 5G2OA 2C54A 3CKYA 3G1UA 2QRJA 1PSDA 3RIHA 5TX7A 4ZRNA 1H6DA 1Y8RB 1NPYA 4FOSA 1Y5RA 1R15A 4TVOA 1NR7A 5DN9A 5HS6A 3OEWA 4OXYA 3MJEA 4YAKA 3OIGA 4B7XA 3M1LA 3VZSA 4CMEA 3MJSA 3WX0A 3UKOA 4CV3A 4QECA 4J4HA 1X7DA 4I5DA 1N9GA 4W82A 1I32A 1WXDA 2VRCD 2JFGA 5HS4A 4XKJA 3OJEA 5JCJD 4OXNA 1E7WA 1EVJA 2H63A 3JQ9C 4G2NA 4JN6B 2P4QA 1QYVA 2YJZA 3DMTC 2H9IA 3K8ZA 4IMRA 4YEDA 3UCFA 3SBOA 1K6XA 3PXXA 4DLBA 1Y9AA 3V2HA 3VZPA 3SX2A 3JTMA 1DJNA 4RGBA 5JYDA 3B1KA 3TFQA 2VTDA 1CQIA 2XXJA 1B2LA 2HCTA 1YONA 3D7LA 3ZI0A 3H2SA 1K6IA 3DEYX 1QMGA 4NHEA 2AG8A 1IPEA 5TLSA 1SMKA 3D3WB 3EDMA 9LDTA 1LC3A 4CQMB 2GSDA 1VPDA 3LZ6A 4BNIA 2B69A 1UZMA 5JMPA 3ZWMA 1ZMOA 1U3WA 1XELA 3GT0A 4R01A 4NNJA 1FF9A 3LT1A 3ITDA 3SVTA 1B14A 4WLUA 4DMLA 4J1SA 2VUUA 1ZSNA 1JKFA 1H0KA 2DC1A 1GYRA 4J7UA 3PHJA 3OJOA 5L4LA 5GZ6A 4B7UA 3KYCA 4M8SA 3LU1A 4D0RA 1ZIDA 5T6BA 2GN9A 4CMCA 5EPOA 2QQ5A 2QRLA 4OMUA 3H4VA 5G4KA 4MKXA 4CLDA 4BNUA 5L3ZA 3NKLA 5KJCA 3BMNB 3H5AA 4BMSA 4BHTA 3I6QA 4D43A 5JAQA 2HUNA 4RZIA 4Q3DA 4ZHSA 2DM6A 3ZWOA 2JD1A 1GR0A 1HDXA 2JCYA 5IF3A 2G5CA 3VHRA 1ZJYA 1BXGB 1XGKA 2B4QA 2VHVA 3FR8A 3ZWXA 1I2CA 3V5NA 3UW3A 1LDEA 4ZICA 5JCXA 2NNLD 3FHLA 4QT0A 3DO5A 4ILKA 3WTCA 1J5PA 1A71A 2JFFA 3P2OA 1IB6A 5DCWA 1EE9A 5BSHA 1EDOA 4Q3CA 2NU8A 4JJFA 3AJRA 5BQFA 1VKOA 3EZLA 5JC1A 1N1GA 4WCFB 4CM1A 4W6ZA 4UAGA 4RORA 4CQMA 1DC6A 3TWOA 1ISGA 1PX0A 4U0KA 3KHUA 3AI1A 4XB1A 3H5NA 4CLOB 2VQ3A 1NNUA 3UF0A 3D5TA 5EN4A 2XAAA 3PYLA 1GUYA 3K2EA 4I9NA 3ST7A 5IJZA 2B37A 3PFWO 4WLEA 1DB3A 4Z3DA 4CL3A 1ZSVA 2JFHA 4YJGA 1ZZEA 4OKNA 1PU2A 3NAQA 2X0RA 4UVEA 3I5MA 5T5QA 4IJUA 1YBVA 3GC6A 4ALJA 1DIHA 2HMSA 1DC3A 3GN1A 3EMKA 3EY4A 1C1DB 1JLLA 4CM4B 3A14A 2OZPA 4GI2A 4MO2A 4R5HA 4IGFA 5EL0A 3MOGA 4FB5A 3WGZA 2UUOA 2PZJA 3KSDO 4IY1A 1M75A 2Y67A 2CVZA 4NJMA 3RJ5A 4ALKA 3AI3A 1HL3A 4NJMB 4O0LA 2I6TA 3KM0A 3C8MA 1U28A 1LLQA 4WGGA 2HK7A 3FRJA 3RUDA 4BO0A 1QV7A 4JP2A 1LSJA 1HETA 1AHIA 4LK3A 4Q9NA 1GUFA 1HZJA 1HKUA 2Y1GA 1MV8A 3IP1A 2CDAA 4DTIA 5AQ1A 3OICA 2LDBA 4CLRB 4K26A 1C0KA 1C1XB 3RAJA 3FCOA 3NGLA 1JWBB 2EW8A 5T8KC 3U5TA 3ROPA 1EUZA 1TVEA 2HRBA 3KYDB 4FC7A 4MVJM 2EJWA 4INAA 5DCUA 5T57A 2DPHA 2I99A 1YDWA 1B7GO 5CG1A 1YDEA 2VRCA 2ZYDA 3AWDA 4BO5A 3ZWPA 1WZEA 1PTJA 1E92A 4AICA 1BMDA 2EKLA 1LRKA 5DBGA 2G0TA 4RL6A 3I3OA 3OBBA 4RVHA 4WEOA 1Z82A 2Q50A 4J7XA 3K31A 4IDBA 4Q3NA 1OFGA 1SB9A 1ZH8A 4B4WA 2H5LA 3H2ZA 1HEUA 4FSHA 4OM8A 4C7JA 2J3KA 4W9NC 5KJFA 3IP3A 2Q3EA 3K6JA 4ONEA 2PGJA 4BKQA 3QWAA 1OC4A 5A9RA 3GGPA 4PLZA 2Q2VA 4XJSA 2I9PA 3WBFA 2FR1A 1P74A 2AEMA 3WMXA 2WJPA 1JTVA 2DTDA 1E1LA 1WDLA 3KEQA 3OSUA 2UUPA 3BA1A 5TIIA 3GNQA 4BNLA 4N54A 2Y1OA 3JQ8A 4BB6A 3GUCA 4J90A 3U09A 5EESA 2NUAA 4Z9XA 1P1JA 4BKPA 3GDFA 3OH8A 1YB4A 1WWKA 3WWZA 2HMUA 4OKIA 3DFZA 3QWHA 3WICA 1A72A 3GQVA 3HUDA 3ZV3A 4EGFA 3AY7A 1Y6JA 3MJ4A 3DDNA 4P4LA 1N7GA 1MB4A 3W8FA 4EJ0A 1ZKMA 5CAEA 5F1PA 4DVJA 1DIBA 2TMDA 3TOXA 3QY9A 4PG7A 4WKGA 2D2IA 1B8UA 5TRTA 1O8CA 3HSKA 4YRBA 4UUNA 1N1EA 2VYND 2OHXA 4L4RA 2O3SA 3F1LA 4ZJUA 5JAZA 3I9LA 3AY6A 4KWIA 4CUKA 1FXSA 5IZ4A 2XPCA 3B20A 3FNGA 1DIRA 4A26A 3GNTA 2C2YA 3RFXA 1HDOA 3S2EA 1EQUA 4PLVA 2NTJA 3COSA 3GPDG 5A5EA 5L4SA 3PVZA 4FFRA 3WTBA 3C85A 1N92A 1U4SA 4BO7A 1XLTA 4TVBA 1NWHA 2VWPA 1Y8QA 2PD4A 4YAJA 5HRUA 3WYCA 3AM5A 4RPKA 3S2GA 1DEHA 3K5PA 3A9WA 4R1SA 5J23A 3DMYA 4EEZA 2J5QA 5DP1A 5HM8A 2IEBA 3X2EA 4IBOA 3F9IA 3V1UA 3GRKA 4FDAA 4E33A 1E7QA 1E3EA 1WPQA 2DFVA 2CSUA 3G49A 2ZJ1A 3JYQA 5JLAA 3G17A 4AJ2A 2FP4A 1KS9A 1K6JA 1BWSA 1NTOA 2V6MA 4ZN6A 5ENVA 4LSWA 4WASA 2Y66A 3ANMA 3Q9UA 4ZU3A 2J3IA 1BXKA 2ZB4A 2Q99A 5ER9A 3I4CA 3NT2A 4OHUA 2QW8A 1IYZA 1HSZA 3L07A 2JAHA 3OM9A 1Q7CA 1LSSA 4JJGA 5ER6A 4AG3A 4R4JA 4LW8A 4KUEA 3M1AA 4U0JA 4XX0A 3RBZA 5CDGA 1YE3A 5B4TA 1D8AA 4IJVA 4YJHA 4RPLA 3E9QA 2FR8A 1ZVMA 1DSSG 1ULSA 5KVCA 4R1UA 4BNYA 1NASA 4KWHA 2JD2A 2VT2A 4IM7A 1K3TA 2GUGA 4HUJA 4XGIA 3RKUA 1T2FA 2O4UX 3O03A 4E30A 1RPNA 2H1SA 4RPGA 3Q3CA 1TLTA 2WYWA 4FGWA 4PZDA 4AJOA 2BH9A 3C1OA 2X9VA 3AFNA 5JO0A 5U4QA 3PHIA 4ZVVA 1MX3A 4FBGA 3TZCA 5DULA 1V9LA 1JAYA 4O63O 1G0NA 2GPTA 2PNFA 2YY7A 3IDSA 3DQPA 3QHAA 3S55A 2C0CA 2GGSA 3W4IA 3CZMA 1DAOA 4B3HA 5ILOA 2FSSA 4M55A 1GUZA 3BHJA 4JK3A 1P1HA 3JQAD 4MVJP 1MP0A 4CMGA 5A04A 2OMEA 5JFOA 2PK3A 4CMIA 3RASA 4CJXA 3EYWA 4GKVA 5CPBA 2DQ4A 4XD2A 1R37A 2B83A 4HFJA 3CH6A 3L9XA 1VKNA 3ON5A 3RFVA 3TZKA 2GZ2A 3GNSA 5DF1A 3WDSA 2YV1A 1M6WA 3TN7A 3K92A 3MTGA 5A02A 3JCZA 4L73A 3WLEA 1K89A 2C5EA 2I66A 2WDZA 5BNFA 3AFMA 3D1LA 1A27A 3EGOA 1GPJA 4A27A 2B0JA 1TB4A 4P8RA 1NWCA 2NM0A 5IZCC 3C7AA 4IDGA 3FR7A 4M87A 5JCJA 1TT7A 4HV4A 4I08A 3M2TA 4XYGA 4R5MA 2QG4A 4F45A 5A1TA 5JC8A 2VZ0A 4TKMA 8ADHA 3V8BA 4I8XA 1MA0A 2BI8A 1ZNQO 2FZWA 3I23A 3GR6A 4OSPA 4PG4A 4BGVA 1ZK1A 1ISHA 5IXSA 1GV1A 4BNKA 1M66A 3IMFA 2VZ8A 3OQ1A 4RVFA 1C3VA 4XB2A 3EHEA 1QYXA 2VRBA 5KVSA 2DBRA 2X5KO 1HZZA 1ZEMA 3O26A 5FF9A 4Z3KA 4Z6KA 1G1AA 3PI7A 2G82A 4NJOA 3CZRA 1DIGA 4E3ZA 3ZNPA 4AJPA 1JW9B 5GMOA 1HYHA 4YACA 1XDWA 1H94A 3PHLA 2P5UA 3DTYA 3VOSA 4OL9A 1R0KA 4E2XA 3JQ9A 4J0FA 3IUSA 1UXIA 4G81A 4MOWA 5F5LA 1YXMA 2PA3A 2C5AA 2DFDA 2FHSA 3IC5A 3LT4A 2YZ7A 3LT2A 2I65A 2P68A 3A4VA 2YYYA 4RF2A 4DRYA 2VWGA 1HE4A 4HNGA 3IQDB 4BL5A 6LDHA 4JIGA 1E1NA 3MJVA 1HF3A 3H9QA 1N7HA 2YQ5A 4YTEA 3ORFA 1D4FA 4I5EA 1X1EA 2O3TA 1UZNA 1HDCA 2NTNA 4GBJA 3I9OA 3ZDFA 3TDKA 1NPTO 3JD0A 1C14A 4BNJA 4PGFA 1Y1PA 3RU9A 3LC7O 1E5QA 4RPHA 1E3SA 1HWYA 2FSVA 1UP4A 1YB1A 3L77A 1ENZA 4FN4A 2RBEA 1FK8A 4KDEA 3H3FA 2HJSA 3T7EA 1LDMA 2DAPA 2VHWA 3MCVA 1B16A 3GZNA 1A4IA 1HLDA 2WYUA 5TC4A 1PJ4A 3PRJA 5C7IO 5JSFA 4OGWA 1NAIA 3GMSA 1QLHA 1DC4A 4QO7A 1BTOA 4GX2A 2VOJA 2CVOA 3VH4A 1E5LA 1I3MA 4CM6A 1NM5A 4K28A 3RUHA 1ZSYA 3L6EA 3OIDA 4O59O 1KY4A 1J6UA 2D0IA 2B4TO 4YR9A 2VOEA 1U3TA 2O50A 3PFFA 5THKA 4D79A 1HDRA 4TRNA 2FR0A 1PIWA 2AE1A 3MJTA 2EV9A 2X8LA 3U4DA 4OJNA 1A9ZA 1CDOA 1O0SA 3PDJA 1N8KA 5JY6A 3K2BA 2EF1A 3U4CA 3BMOA 3RD5A 4MKRA 1R0SA 5ILGA 3ZNQA 1BHSA 1I33A 3QWBA 4CM7A 4M86A 3UVEA 1ZJZA 1RKXA 3UXYA 2VWHA 2Q2WA 2NQ8A 4LVUA 4NFSA 3LLVA 1VSVA 2IODA 4Z9YA 1JDJA 1NPDA 3HN7A 1YL6A 2FWMX 2UAGA 4AFNA 1IPFA 1ADCA 7MDHA 3AOGA 1LDNA 1H2BA 4EI2A 3INTA 3DAPA 5A9SB 3CEAA 5JDCA 5C7OO 3K9QO 1E77A 1UP7A 2J3HA 2QRKA 3LC2O 5I9MA 3PJEA 3EAGA 1UJMA 1V3UA 3A1NA 4UEKA 3H9UA 1NFRA 1UXHA 1Q1NA 3FBTA 4NG5A 4E5YA 2AHRA 2IRWA 4J1QA 3C1AA 3AM4A 1GZ3A 3E5RA 2VNSA 5B1YA 2EG9A 1A9YA 4E6PA 1KVSA 4ZQHA 2GO1A 3INRA 2VHXA 2ZATA 3OQBA 2VYNA 4JQCA 2DBQA 4J91A 1LC0A 4W99A 5ADHA 1JQBA 4BO1A 4JBIA 4BO4A 3FN4A 4PN3A 1OAAA 1O9BA 4D46A 1YVEI 3NTRA 4XDZA 1Q0LA 3F5SA 2Y1CA 4TROA 4Y67A 1F8FA 1AXGA 2O4CA 4QFCA 4RF4A 5HBRA 4YJDA 2CD9A 1KEPA 5EIOA 1EBFA 1NAHA 2O2SA 1IZ9A 4UUPA 4HFMA 5C37A 2PLAA 1T4BA 5JNLA 4UVIA 1XR3A 2ZTUA 3QRWA 5FYDA 3GEMA 3RUIA 4D3DA 2P2SA 4FQ8A 3O8QA 2Z5LA 5BSFA 3Q9NA 4TSKA 2QYTA 3WR5A 4NR0A 2F00A 5DOVA 1JU9A 1DOHA 5G0SA 3W8DA 2EKQA 1WP4A 4Z0TA 3CINA 2J5RA 4A10A 3ZN2A 2WD7A 3AUUA 4J9UE 2VN8A 3NX4A 1HE5A 1WDKA 2EHDA 3E9NA 1KVUA 1UH5A 1H6CA 4H7PA 1VI2A 2OBNA 3OECA 3GA0A 2D8AA 4O5OA 5A3VA 1QV6A 4W7HA 2JKVA 1ZO8A 3H6KA 4L0QA 3LLSA 5KVQA 1YOVB 3H9GA 3UCXA 5DZSA 1D3AA 1ZXLA 3ZWVA 4LRSB 2AQKA 3W1VA 1XCBA 2HMWA 2OOSA 1PWZA 1MFPA 4WCFA 4IIUA 2EP5A 1PZGA 4XQGA 1OZAA 3D3WA 3DL2A 3ZU4A 2W2KA 1EQ2A 1P77A 1P1FA 3FTNA 2W2KB 1I10A 3QWIA 5L40A 3EZYA 1HYEA 4IQ0A 4A73A 1IZ0A 2DTXA 4N5MA 2GZ3A 3KO8A 4KZPA 1ZFNA 3JD4A 4JROA 4PVCA 4JX8A 5K9ZA 5ICMA 4TRRA 3PHGA 1JAXA 3NEPX 3ETEA 4B4VA 1DFIA 4D42A 5FEUA 3GPIA 3W4JA 4WLNA 3H9JA 1X14A 1OBFO 1U3UA 1R4NB 1EDZA 3BMQB 4CMJA 5G4KB 4J4BA 2NV6A 5TT0A 1ENOA 4W7IA 3S2FA 2B36A 1F8GA 1E1KA 2VWQA 4JNKA 4LMRA 3GMDA 3RC2A 4KUGA 4L8VA 3N7UA 2I3AA 1HTBA 1QSGA 3JQBC 2FN7A 4WPGA 3T4XA 1R4MB 3F4LA 1KEUA 2UYYA 1GV0A 3GG2A 4FW8A 3OFSA 4YA6A 4R3NA 4Z0PA 3JQAA 2EERA 4NQZA 1PJ3A 3LVFO 3RFTA 1HE3A 2RAFA 5GY7A 2VUSA 3WGTA 4S1VA 5C5IA 3N58A 4FFLA 3G1TA 4ZA2A 1LJ8A 3HB4X 3DONA 4MIEA 1UAYA 5LDGA 4E4YA 4BNNA 2P9GA 2YQ4A 3F46A 2C29D 2IXAA 4IGEA 1LDGA 1YH3A 1MUUA 3IAHA 3OP4A 3E9MA 3FI9A 4GMFA 4DYVA 3VVBA 4DQUA 1B8PA 4IQGA 2ZCUA 3SEFA 4O6VA 1GPDG 2EW2A 5JBIA 3E5MA 4GAEA 3RWBA 1WZIA 2W90A 1DLIA 1M6HA 2X0NA 3DBHB 5DBIA 5GZ1A 1V0JA 4AJLA 2JHGA 4FR5A 5AOVA 2PD6A 4RQTA 5TGDA 3JQ8B 3LQFA 3ZWAA 3DFUA 4RDIA 3M2PA 5JW6A 1NQ5A 3GGOA 3P2YA 1E6UA 3HE3A 1FDSA 1QKIA 3RJ9A 4DLLA 1EVIA 1A7KA 1GZ6A 1MC5A 5LDHA 3TRIA 4AJKA 3PTZA 1X1TA 2DT5A 2BFPA 1LEHA 1PQUA 3JQ6A 2R00A 2YHUA 4BOYA 1GQ2A 2EIHA 3KSZO 5AXAA 3SC4A 4B4OA 1H6BA 3OJFA 4GWKA 1DDOA 5BSEA 2Q1WA 4XCVA 2CY0A 4BVAA 4XGNA 4DPLA 1UAGA 3D4PA 1F14A 1P0CA 3L9WA 4YJFA 5CFZA 5I7EA 4RDHA 2BGMA 4NBWA 1RM4A 3G3EA 1P33A 3RUEA 8LDHA 1T2EA 2POQX 4NI5A 3GG9A 4IZHA 4NU6A 1E7YA 2PH3A 2BGLA 4MVJA 4DWVA 1P44A 2YUTA 2P4HX 1JN0A 4CODB 5TJ9A 3E1KA 3K73O 3TJRA 3RUFA 2AA3A 5B4VA 1X0VA 3QVSA 3ZHZA 3R1IA 1U7TA 2PWZA 4YT8A 1DO8A 4YT5A 1U9JA 4BQRA 4HX5A 1UZLA 2VHYA 4LRTB 2WEKA 5AXCA 1EZ4A 3EK2A 4NBUA 1KVQA 4LGVA 4DYDA 3K30A 1I2BA 2O3UA 4R1TA 3ZGYA 4CR6A 1AXEA 4I1IA 3VVCA 1I36A 4DL9A 3ICPA 4M54A 1SEPA 2PGDA 4DPMA 3TZQA 1B0AA 2P9CA 3JD3A 4ZRMA 3VPFA 1Z74A 1WNTA 4F46A 1P1KA 3Q2KA 1QYDA 5CDTA 1HDYA 2D3TA 4EW6A 1TA4A 1VJ1A 2Y1FA 4II3A 2FRDA 5IDYA 2BKAA 1MGOA 3FPCA 2ZB7A 4CQLA 2C2XA 4DQXA 3RCBA 5JDIA 1ZW1A 4PRKA 1PS8A 1HDGO 4EBFA 5I9LA 3NJ8A 4XYBA 4ND5A 4RCVA 4D3SA 3KLPX 4Y6SA 5IAAA 2VTEA 5KKCA 5KJ1A 9LDBA 3I6IA 4GX1A 3DBVO 1YQDA 1PR3A 2X4GA 4TZTA 4DQVA 4ROSA 1O89A 2RCYA 1U8FO 2PV7A 5I7SA 1YL7A 2X6TA 5BR7A 5IZCA 5CDYA 4NFHA 3UAGA 3V1YA 1MC4A 3PQDA 4GH5A 4RV9A 3RC9A 1KERA 3B6ZA 3ADPA 1PZFA 1HT0A 2Y68A 2E6UX 4J3FA 2GLXA 4RVGA 4GX0A 1QORA 4E21A 4IDFA 3STHA 4ALMA 3T7CA 3ZW9A 1N9GB 1PZEA 2E82A 2E37A 4QEDA 1DAPA 2WWRA 3PJDA 3IL2A 2GYYA 5KVVA 2IE0A 3MEQA 1IE3A 1QR6A 1Z45A 3RBVA 4I9UA 2RH4A 1GCOA 4NBVA 3Q11A 1OOEA 2NVBA 2B5VA 2A9FA 1LUAA 4BNVA 1AHHA 1Y8QB 4OQYA 4HNHA 5L7WA 1QYCA 4D41A 4IXWA 3EC7A 3HN2A 4PLCA 4YPOA 2GCGA 4BQPA 3ZHBA 3NV9A 2DBZA 4OOFA 2LDXA 3CMMA 5A4DA 4QXMA 1RJWA 5FI5A 4FJ1A 2WSBA 2O23A 1GYQA 1BG6A 3KZVA 1GQYA 4FJ0A 1ISFA 1RYEA 4IXTA 2GN4A 5DP2A 2WD7B 2EJVA 3PGJA 3WYEA 4KTVE 5TSDA 5EJ2A 4L76A 2WD8A 3KYBA 3KSUA 4WCDA 3QVTA 4JBGA 4FIZA 4B8WA 4DC1A 3TZHA 1U2GA 3WB9A 2RHRA 1SZJG 3VPSA 5THQA 3ROKA 1LQTA 1PL6A 4OYRA 4HFRA 4XYLA 3GLQA 1E1MA 1S6YA 2UV8A 2ZQYA 2BFMA 3PPIA 3RKRA 1LA2A 1LQUA 4AJNA 3PYMA 4LMPA 1MLDA 1ADGA 1ENYA 3BIOA 4GGPA 4KDFA 4TWRA 4F6CA 4WLOA 3MWDB 3IS3A 4Y8VA 5TT1A 4PLWA 4B7CA 4QO8A 4E2ZA 1QLJA 4UUOA 3ZV4A 3QIVA 2JAPA 3E8XA 1NQOA 2NACA 2AXQA 4EEXA 4HKTA 3SLKA 3AOEA 3E18A 2DU8A 1O5IA 5COAA 4C4OA 1L7DA 3H65A 4ALLA 1VSUA 1ISMA 2PY6A 4LSMA 5I9NA 4TQGA 5GZ3A 4H15A 3WGOA 3GEGA 4Z0HO 5CG2A 4Y6RA 3BHMA 3A28A 3DZBA 4XR4A 1LXCA 3KYCB 4FFPA 4J6FA 3TSCA 5BSGA 3I52A 1KBZA 1W4ZA 3WQSB 4K9DA 4TRMA 4P38A 5H82A 1B3RA 4A0SA 5BNIA 1VL0A 3INGA 4YAGA 4PG8A 2O48X 2ZK7A 2JD0A 1NXQA 4H3VA 1FJHA 3QA9A 4Y6PA 1CEQA 4LCEA 4CLOA 4OO3A 3AUSA 4BO3A 4NZ9A 2ZCVA 5JDIC 3O38A 4URFA 1K2WA 3GVIA 3DWFA 3U0BA 1E3WB 4Z9FA 2V6FA 2W8ZA 4ALNA 4GL4A 1XKQA 4UEOA 3TQHA 1SOWA 1CIVA 1XHLA 4ZQEA 1W73A 2GRAA 3U9LA 1RWBA 1T2AA 1X7GA 3GAFA 3HG7A 4H16A 5IN5A 5ENDA 4WEQA 4E5PA 5IN4A 4CM4A 2CMDA 4QX6A 2EKPA 3PWSA 3UOGA 1PGPA 3KRTA 1F0YA 7ADHA 1T24A 4N7RA 5IDWA 2J3JA 1E3LA 3SXPA 1ISIA 4CM9A 3I9NA 1RYDA 4PLGA 2V6GA 3OA2A 1GYPA 1XG5A 3M6IA 4GSLA 4J2HA 4TKLA 4JCOA 5B4UA 1A5ZA 2NVUA 4Q39A 3OETA 4XZ3A 4UREA 1BW9B 3R3SA 5CEFA 4J0EA 3TL3A 2D5AA 3MJCA 5KKAA 4ZQBA 5CHEA 2Z95A 4IPTA 3HDHA 5F21A 4N18A 4UVGA 1F12A 3QP9A 5ITWA 3HADA 1LU9A 1Y9EA 3OQ6A 4KTTE 3QVOA 3S2IA 5ITVA 4L4SA 4NK5A 1Q0QA 3BMCB 3WOHA 4BGEA 4RZHA 4DIOA 5HWSA 3LF2A 5L9AA 3ANLA 2BGKA 4BKRA 1MG5A 1UP6A 2O2YA 3BMQA 2X5JO 3DBLB 4IS2A 4GLOA 2IEDA 2Z1NA 3ZU5A 4D7AA 1KC1A 5JAMA 2O3RA 1CETA 1NFFA 3HFGA 3WFJA 4BS9A 5TQVA 1PQPA 1IHXA 1R12A 2C7GA 3EVTA 1PS9A 1SOVA 1BRMA 1H93A 1H5QA 1PGQA 2OBYA 2HU2A 1PJ2A 3R0IA 4BO8A 3PIDA 4LVCA 3DHYA 1OC2A 4MVJG 3WJ7A 3UH1A 5A05A 1PGNA 2ZIZA 1K5HA 3Q1LA 4BV9A 4KMSA 2HQ1A 5CP8A 1VL8A 3B70A 3WGHA 3WQRA 4WK6A 1YJQA 3ONFA 1YWGO 3MWEB 3HB5X 4XIYA 3NTOA 1DC5A 3HDQA 4O1MA 3DB2A 4BKUA 2QYSA 4IMPA 5L7TA 4ZD6A 3WGGA 1ZXBA 3VTFA 4CQLB 4MINA 1QG6A 1W0CA 1Z7BA 4Q3AA 1YBMA 5FWNA 1XWFA 3ZW8A 4CMEC 1GY8A 1U4OA 2Q1SA 2BD0A 1B8VA 1EUCA 1LSOA 3U3XA 4XWYA 2X0IA 2HK9A 3NDRA 4U6QA 3ZWYA 4ND1A 2OORA 4J9VA 5H81A 1ENPA 2PKQO 4Y9DA 1BSVA 1F06A 2BI7A 3ROQA 4ITUA 2IZ1A 2TMGA 4LN1A 4MPDA 2Q45A 3O9ZA 3GVCA 2CUKA 4BNFA 4DGSA 3AOEC 1EMDA 2WE8A 3ONEA 4CPDA 3PZBA 3DAGA 2HO5A 4FCCA 4J1NA 4RVSA 3FBGA 1PZHA 4FS3A 5DOZA 2I5PO 4IDDA 4RLSA 1PJSA 2OUIA 5DDIP 1V8BA 2HRZA 2ZB8A 1CRWG 1HE2A 1NVTA 1DRUA 3I1JA 1DRWA 1SAYA 3VZQA 3RUAA 4R69A 3IKTA 1GEEA 3NUGA 4L74A 1GAEO 4E5MA 2YV3A 5U1PA 2X23A 1IY8A 1GDHA 3VAZA 3VTZA 3ZV5A 1GU7A 3PJFA 4S3MA 4PZCA 2Q46A 4II2A 1J49A 4HY3A 4G5HA 4BKOA 4FD3A 1UXJA 2VYVA 3ZU3A 2X9NA 3AU8A 3UFXA 3ETDA 4BNMA 2YFQA 3LK7A 3RUCA 1T1SA 3QVWA 4YJHB 3H5RA 1NX6A 1YS4A 3BAZA 1UXGA 4NFYA 5BNTA 3GOHA 4HFNA 3W6ZA 2AQ8A 5CEJA 1NBOA 2C7VA 3JQEA 4CV0A 3FNHA 1SB8A 4RLHA 1CJCA 3PK0A 4CR8A 2HDHA 2WM3A 5CDUA 1WAMA 1VM6A 1CWUA 2HMVA 3JV7A 3DHEA 3ZWCA 1H9BA 3DC2A 3AK4A 3UUWA 3FWNA 4NBRA 5COBA 3F4BA 1MG0A 5IFLA 3ENNA 3JD2A 1MXHA 4PLFA 3PJGA 3Q0EA 4CLRA 1T4DA 1LRLA 3N74A 2YDYA 1R4NA 1FDUA 4AL4A 4R9SA 1LLCA 4AJIA 1XQ6A 4J2OA 3VC7A 2QX7A 1LSUA 2X1HA 4F6LA 4CMHA 3RBXA 2R00C 4BV8A 3ONDA 5C7LO 1U3VA 4EJ6A 3WSVA 4R3WA 5EINA 1ORRA 1OMOA 3T4EA 2ILTA 3HZZA 3KXDA 1J0XO 4YRAA 1DFGA 1P1IA 1HXHA 1GFSA 1Z6ZA 1T25A 5EQFA 3V2UA 3WSWA 4CL8A 1UXKA 4B8ZA 4BO6A 2C07A 2X22A 1AN9A 4BGIA 1GZ4A 4W9NA 3WGIA 1DJQA 2BMAA 4XYMA 1WDMA 2WTBA 4ND2A 3WXBA 5KCZA 3TFOA 1JKIA 3RC1A 3GHHA 4DUPA 4G65A 2JL1A 4CQMD 3KB6A 5L51A 1YO6A 2R6JA 1R6DA 1YQXA 1TT5B 2FPGA 1M67A 1R66A 3C24A 4ESOA 2CF5A 3LDHA 2IYOA 1T2CA 1O6ZA 4WJZA 2ZYGA 3ZHYA 5F5NA 1P31A 1UR5A 1PR9A 1RM3A 1U5CA 2FY8A 4RVDA 1T26A 2OFPA 2X86A 3U4HA 2CFCA 2Y05A 1E0DA 1PS0A 3D4OA 4CM8B 3ROMA 4J49A 1IULA 4MVJD 3DZJA 1R16A 2B4RO 3UN1A 1RM5A 3Q2IA 1UDCA 3JQGA 4JP3A 4DIFA 1PL7A 3JYOA 4KUHA 1NR1A 4FFOA 1GL3A 4FPXA 4PLHA 3ASVA 2Q2QA 1EVZA 4CM3A 4NDNE 1NVGA 2QHXA 4FJ2A 2AQIA 2NU7A 3JQDA 3JQCA 5G0TA 1DXYA 1ARZA 1EFKA 1I2ZA 3BMOB 4XEHA 3QVXA 2W4QA 4U6SA 3F6YA 2W2LD 3GFBA 1ZMTA 1EVYA 4OSOA 4CLXA 2W98A 2J5KA 1LNQA 2A92A 4BNHA 2DVMA 1TEHA 3WQQA 4YXFA 3E82A 3IKVA 2X5OA 3JQFC 3JD1A 1IOLA 1YBAA 2BLLA 2HMTA 1VRWA 5LCXA 1YQGA 1KC3A 4TRJA 3EW7A 4MP8A 4B4UA 1P1RA 3QW2A 3VZRA 4BMVA 4E13A 3WLFA 5CEEA 2NWQA 1YKFA 2DPGA 3DBLA 1E7RA 3CSDA 4FC6A 4XYEA 4R51A 2QZ9A 4PZEA 2BHLA 3S1LA 2V6BA 1Z7EA 4WCFC 4R1NA 1U7HA 4YAEA 5JAIA 1A7AA 4IUYA 4TZKA 4PLPA 3TNLA 3ZNNA 1Z75A 4HWKA 3GAZA 1UUFA 2ZQZA 4MVJF 5FI3A 2QZZA 1P3DA 1LLDA 3GEDA 4IIVA 5JDCC 3SLGA 3GVPA 3ENKA 5A03A 1ZUD1 2OGUA 2Y1DA 1U2DA 1HDZA 4CV1A 2PKQP 1CERA 2HJRA 2HLPA 4YAIA 4J4TA 3P5SA 3BTSA 3WGQA 1D1TA 2Y93A 4A03A 1LX6A 1T2DA 1TXGA 2PKRA 3ICCA 4J16A 4IJWA 2PH5A 2I67A 3KYDA 4RVUA 3KLMX 4IDAA 4R68A 4GMGA 1U8XX 3X2FA 4GWGA 1DBVO 2VNAA 1ONNA 4ND4A 3AW9A 3R3JA 1T1RA 1CYDA 1MXFA 4GX5A 1QYWA 2AQHA 2AG5A 1A4UA 5B12A 2DUWA 3WS7A 1KEVA 4TMFA 4IDEA 1PJTA 1IL0A 3LF1A 2OL4A 1O94A 2X9GA 3CPSA 3BHIA 4GKBA 3VPHA 4B3IA 3KBOA 2NLOA 3I9MA 5JMWA 4MIOA 2NQTA 3GZ4A 4QFDA 3AI2A 2PZMA 1G0OA 2E49A 4Y98A 1ADBA 1H6AA 3GGGA 3ZV6A 3QV1A 3ITKA 4HXYA 2D5CA 4JJIA 1EUDA 1NHWA 2CVQA 3BZUA 5CDSA 2P5YA 3GZNB 3OJ0A 2UVDA 1B26A 4WLVA 3W4KA 4YCAA 2GERA 5IXYA 5MDHA 1BW9A 3PQEA 2NU9A 3D3EA 1VLLA 5B37A 3L0DA 4E32A 1PL8A 4GVLA 4AJ1A 1EE2A 1WVGA 4DLAA 5JPIA 3AM3A 3SJ7A 5K0ZA 2DUUA 5KTKA 4B3JA 2PR2A 3L4BC 3NYWA 1YRLA 1Y5MA 3QJ5A 4Q3EA 1GADO 2VCYA 4CLHA 1CF2O 4W4TA 4I5GA 1C0PA 1E3IA 3JSAA 2G17A 4QQRA 3C7CB 1HSOA 3I4FA 5KNLA 1Q0HA 4YBZA 3L6DA 1IHYA 3F3SA 1D1SA 5JXWA 2GASA 3DBRA 2ZB3A 3D4NA 3DZHA 1Z73A 3KETA 2ZKLA 1Q2XA 3V2GA 4IJKA 1C1DA 4NU5A 3LYLA 3MTJA 3CE6A 3RVDA 3GY0A 4YYZA 4UVDA 2G1UA 2UDPA 4BNXA 4PVDA 1E6WA 2Y0CA 2FZEA 3F1KA 1I30A 2EWMA 3PWKA 2G76A 1PJCA 1DIAA 1I0ZA 4XIJA 4YQYA 2VUTA 4AJEA 4JBHA
chains in the Genus database with same CATH superfamily
3LTEA 1RQPA 1L4NA 2B92A 2REQA 2DECA 2V96A 1YHZA 2C8JA 3CS3A 4MGIR 4DLNA 3I6MA 1M76A 3CT6A 3UEOA 5IAOA 3H3JA 3BXFA 3AFGA 2EJBA 2ZYAA 1HYGA 1WHSB 4ARIA 3SK0A 1IAVA 3WKDA 3CH5A 4PIMA 1KZ9A 4MV7A 4AJHA 4L75A 4RZ2A 1OV4A 1RT9A 4MR7B 3M6MD 1PSWA 3UPDA 4UFPA 5C9ZA 1KTIA 1C9MA 1I24A 1H1DA 4TQ9A 2MR6A 1WSWA 3Q6IA 4LY0A 4QQ8A 5EZQA 5TV2A 3IJPA 4ER3A 4LGMA 2CHFA 1P7ZA 2CLLB 3DR5A 1ZCBA 4R8VA 3HVJA 2QAIA 4KQGA 1EWTA 2V65A 5A7GA 3WRYA 3FDXA 2NU7B 5AI6A 2RH9B 4IVNA 4NG5A 3K15A 3EVFA 3IKJA 3HDJA 1EB8A 4YCBA 4PG5A 3SSMA 1DX4A 1KDRA 4ROTA 2Q4EA 3V46A 4P0QB 4MKHA 2UZIR 4EVRA 4C1BA 2HHHB 2H5JA 2J32A 5B3JA 2OPBA 2PFGA 2JIBA 1YK0A 4Q3BA 5G1NA 3CRRA 4KV9A 3NXKA 4RJIA 4D0NA 5BN4B 3ENQA 1TJ5A 3OZIA 1TMOA 1H8HD 2FSHA 3AJ9A 4UMEA 1WABA 1S1MA 2AFHA 4IQ8A 3VX4A 3IIJA 1PUXA 5DBHX 2GVNA 3ME5A 3T3MB 1V11B 4URUR 4XRGA 3UC5A 2HA6A 3K3PA 3UV7A 4EK9A 1GA6A 1QRRA 3O4HA 4CM9D 2MYTA 3DOEA 2PVCA 5TGTA 2XMGA 1TT5A 2G88A 2XZOA 1O03A 4XVUA 1FXWF 4XRRA 1JE1A 3RRXA 3AVWA 4DA9A 3O8NA 1NE7A 1PR0A 3T1HB 4JSRA 2OPHA 3AWIA 1GPAA 1TZCA 4OLAA 4E5UA 2X7HA 1KPGA 3U4GA 2HKIA 1XZAA 3KQMA 3L7OA 2HA3A 1TYZA 4D3ZA 5ALSA 2WB2A 1BVRA 2VPZA 2Q7XA 3OEED 3PGA1 2HWXA 1OV6A 4HGPA 4WZ6A 5M04A 4FU0A 5JR3A 3U4IA 5TS2A 3U37A 3ZZ0A 4QYIB 5ALTA 1B15A 4KGZA 1XTUA 5JS6A 4UBLA 4URVR 3OX2A 2A78A 1E79A 3HB7A 4EA6A 5ITZA 4XQ9A 3PP8A 3FYHA 1KY5A 3MGBA 3IQGX 4Q4HA 3BIFA 2HGSA 3F67A 5F1OA 1IOVA 2IGBA 2WHXA 5T8KA 3EIWA 4OHYA 2OG2A 4ZT2A 2JH3A 1EK0A 2IIVA 1J1ZA 5A5FA 3R9XB 2WHPB 4G3XA 4O2AB 3TMAA 2OCGA 1XAIA 3G5MA 1NV9A 1U7PA 4O2AA 2ADFA 4GGOA 4G1BA 4KDRA 3SHVA 1M1YA 3LXMA 4F8YA 4D56A 5C3MA 1ZLYA 5I51A 5GV8A 5MN6A 5FKJA 2HU5A 1ULZA 3Q7EA 2G0AA 2JGDB 1UJ6A 3FIJA 1ZK3A 1W88A 2XUIA 3H7AA 4NBLA 2YMLA 3TLBA 1WBDA 2NP7A 3P19A 4KPYA 1JHOA 2FH5B 3HWSA 3COVA 1CB0A 1EH5A 5FFFA 4G1UC 4GOKA 3CXUA 1Y7TA 2VJBA 4NU0A 1RLOA 2CLEB 3ZC3A 1OROA 4BASA 1G64A 2EBWA 4MGKR 3MZ0A 5KJ6A 1DG3A 4Q82A 3DYBA 3L8DA 3IHKA 1PTKA 3SF8B 2OGZA 4HDOB 1N5JA 2D1QA 3G23A 2C9OA 1UKVY 4WZAB 1BN7A 2AR7A 1EUQA 1NVFA 2PGLA 3OT1A 4PLYA 1FFWA 4U5QA 4BNDA 4ZI7B 3HHPA 4IOMA 4JUAA 4NEQA 4O2BF 4Q9LA 3HSSA 2MINA 4EZBA 5KHOC 2XMBA 2AN5A 2JGKA 4Q4AB 2XZLA 5COQA 2HZBA 3H9EO 3DZIA 1JPJA 1I7LA 4UVHA 1W76A 4AWXA 3DE6X 1O08A 2G7MC 1HO3A 4QICA 4BPRA 4Y7DA 4BUZA 2RGBA 4JGBA 1QG0A 3U13A 2QJFA 5A4JA 3DE3X 1F0PA 1KBOA 4QGFA 4WNAA 4RLFA 2Y99A 1L1FA 3RHTA 1E7MA 1RXVA 1MJNA 2OZEA 4WOJA 3KTAA 3LP8A 4FK8A 5JNUA 4NIMA 2X13A 1DLJA 1C3OA 4JOCA 2DLDA 3I64A 4X8LA 3N59A 1BO6A 1P45A 3K4PA 4LK2A 2JAUA 2J6IA 4V0SA 2IEZA 1JZTA 2DX7A 4E12A 5B7NA 1AXRA 2XE6A 2A94A 3M82A 5GPBA 4UDNA 1PSZA 1IBLB 1GQOA 1RDFA 1ZBQA 2QY6A 3FPAA 4CMAA 4W9MC 3COJA 2GBPA 2IUEA 3GEPA 4B2YA 2IZ0A 1H8EA 2ET6A 2QI9F 3BC1A 2RKBA 3MYRA 3QYPA 4FT2A 3KSMA 5DK6A 2AOUA 5HF9A 3O4RA 3U80A 2IS6A 1K68A 2OC9A 3RQIA 3W6UA 3K70C 3K72B 2IXEA 5GV7A 1WDTA 3KDSE 3K2QA 2YVAA 2JZOA 4NBTA 3LBNA 1WUIS 2OB2A 3OPMA 4L8GA 1NV8A 1GTMA 3W0LB 3C5HA 1VJTA 4TYQA 4QGBA 5G0VA 3UWKA 4DRZA 1PYOA 5ADWA 1EM8B 1A9XB 1MU0A 2XECA 1XRPA 3H9BA 3LX5A 1Q17A 2GM4A 1LLUA 2P27A 2ZGVA 1RRKA 2FFAA 1NXSA 1RI5A 1JU4A 4E5DA 4K9MA 4HD8A 1AQUA 4YP7A 5K3DA 3ZGVA 3J80A 1JGTA 1AKMA 1A7JA 1CUAA 1L5RA 1NP6A 4D3FA 1NJ1A 2YFHA 2RHCA 1JJVA 2R62A 2XRZA 2RHBA 4MWSA 1SNYA 3T9BA 5KTRA 2X14A 3GT4A 5JE8A 4H6PA 1ML3A 2ZIUB 4ICIA 3QPAA 3W8EA 1XJWA 4GG1A 4DZRA 3QIAA 5JZ9A 3OY2A 1FTYA 1JWAB 3SMQA 1DX6A 2CCJA 4XPZA 2XUDA 3PNLA 1C3XA 3S2UA 4DBVO 3MK31 1X8XA 2N3ZA 4WMLA 1DFHA 3AFOA 3G1WA 3HZRA 4JOBA 4C1NA 4BLRA 3K9FC 1WMEA 4ZCIA 2E48A 3THWB 3WB2A 1KTVA 1U99A 2P3LA 1VZ3A 4IGIA 1Z29A 2C1ZA 4WKOA 3A31A 4M49A 5TE9A 4OHWA 2CF6A 2I2WA 3GJQA 2Q5IA 1IMOA 4OAQA 4URYR 4X8OA 2OYCA 2GR9A 1LTKA 2JBAA 4NH4A 3SM3A 1GTG1 3RIEA 2IYSA 2PKCA 4YRCA 3PNOA 1F17A 3RS3A 1H9AA 3TEMA 4EI7A 1FNCA 1QZUA 5LQSA 2RIRA 2ZP1A 1LI4A 1V35A 1N5MA 3ULKA 3KXIA 3MGAA 4CR7A 5K0EA 2DCUA 3IQFA 3ROZA 3RTAA 4DR4B 2VDJA 1Z2PX 3ESYA 3I92A 3GN2A 3UHFA 1YMUA 4XGKA 2PIDA 4GLLA 1E4VA 5TMPA 1I3NA 3KL4A 4RTLA 3KE8A 4RXUA 2JS7A 3IBTA 4HZGA 4WOCA 5EJIA 1YKSA 1Z62A 4ETNA 5FCDA 3UAXA 1C0IA 1U8TA 4LVOA 2FPRA 2Q7OE 4RK7A 4RNDB 3DOJA 3KZ1E 2XH8A 3D54D 4PPNA 3WHLA 2DTEA 4AO8A 2FFQA 2IF2A 5C1DA 5M5BA 4WECA 2WTEA 1Z8FA 3ZD9A 4EUHA 2GPNA 3DMTA 1I9GA 1TI7A 1CK4A 3L4SO 1KETA 3VDXA 3ZJ5A 3TEJA 4C2AA 2IY9A 2PD3A 2H4FA 2QNBA 3KKOA 4GP7A 3GZTB 4BB5A 4R0NA 4GPD1 4YLYA 5JI2E 2QMYA 2OO5A 1EFDN 1KP2A 4AWAA 1UBKS 5LQRA 3PEVA 2DHQA 1Q1AA 5FO1A 2PS1A 5I8ZA 4J3NA 4BFTA 5L3VA 2CNKA 2XGMA 4EJSA 1QX3A 1OZFA 3MLAA 5FWYB 3G2KA 4OB6A 2MTBA 3FFWA 4AN1A 2G06A 3YASA 3HO6A 1FSZA 2GN6A 3CE9A 5D3KA 5MGBA 2IT1A 4BEWA 2IP2A 4ARUA 1KFEB 1N6IA 1UDAA 4IDQA 3ZDYB 5C8XA 3ZI7A 5KYGA 3KB2A 1GNVA 4Y6LA 4YV2A 1E7SA 3HXMA 3KWJA 3NG1A 4Q3KA 4F4JA 2D7CA 3HABA 3CKKA 2I4IA 4EHIA 2Y71A 1CY4A 5B30A 4JXXA 4NZPA 3AR4A 5IULC 4Q7MB 4QGSA 2VQ6A 2FPIA 2NZWA 4FKMA 4DUZB 1DUSA 2PTGA 4A5OA 5IW8A 4RK6A 3ZHSA 1U1EA 2C82A 3TEFA 2R6FA 4HWOA 4TKZA 4CIDA 4F06A 1Q50A 3SIPA 2ZI5A 3UJ8A 4ZOLA 1XRQA 2XIJA 4EYEA 1YACA 3CV3A 4F1KA 2VRWA 2ASVA 4M1SA 3VUEA 4B33A 4CGYA 5BR1A 1H3FA 2H1WA 5I45A 1GQQA 3R7BA 4KOAA 2C98A 3LBIA 1XL0A 2Q6LA 1GGHA 1PE0A 3K94A 1E9VA 1Y6FA 3E8SA 1ZEJA 3JARB 3C43A 4EUFA 4E5NA 5K6AC 1GHTA 3GLTA 1AF7A 1UDBA 2EEZA 1AOXA 1CZRA 3T4PA 4MGHA 2OCYC 3B9QA 4F5EA 5DKFA 1C8KA 1X0XA 3LSYA 4D4MA 4QFMA 5EE9A 4QTZA 1QIMA 1ZMRA 3N6RA 4QOGA 4YFVA 4RMIA 1XA3A 5IH3A 5ALEA 3EXHB 1MR3F 2PUWA 4FQ5A 4IDCA 2P6UA 2FTKE 4WNIA 3VH2A 5CTAA 4XW2A 3ROEA 4Y1RA 1VP9A 1Z68A 3L06A 4XQCA 4FWTA 3O3OB 3SSOA 2RHLA 3JASB 4CUZA 1VLVA 3CNBA 2Z2KA 3KEOA 1JT9A 4YPVA 3NW9A 2P9EA 3IVMA 3OESA 1SC4A 2X4IA 4X91A 5L45A 5JASA 3GV0A 5F3WB 2WYHA 4RKQA 3I04A 3DYVA 4MP6A 2NADA 1C0LA 1RWMA 2A6PA 1QHIA 2FUG1 2R48A 2ZJFA 2PJZA 2QTVA 4WINA 1FC0A 2JCXA 5FL7D 4PX5A 4DHWA 3DZFA 3HKBB 3PUXA 2IDZA 2OAP1 4F5YA 3KPWA 3WWYA 4UTPA 2C31A 1R3UA 4KXXA 1GZSA 2XB6A 1ZVVA 4C6TB 1LZKA 3OTIA 2FETA 3MIIA 3MLBA 4X93A 4RANA 1KAQA 3K96A 4WN9B 4LCJA 4HPXB 4NTZA 1EBUA 4OHXA 3EASA 3NPAA 1FYFA 4MH0R 2BGIA 1TMYA 3NORA 1H66A 3LT0A 3AVTA 2JAWA 3ZGNA 1T2UA 1H2RS 3ED5A 5J5CA 1E63A 1GCUA 4CKWB 1UMCA 3RS0A 3QF7A 4GBMA 4PHCA 1N5DA 1YC2A 1WA5A 1K0UA 3GUZA 4M76B 4XR9A 4TT3D 2Z5GA 3AUXA 5FOTA 2I8CA 1CFZA 4P1ZA 4GLFA 5AKGA 1Q91A 3PGXA 3FYDA 1W4RA 3GRPA 4QYTA 3W6PA 3TTSA 4FFVA 3ZLTA 3DE2X 4X7RA 3JAWA 4CKCA 1IY9A 2YHSA 5IG2A 1NW3A 1FNNA 1L7EA 2ZITA 1LDYA 2Q1UA 2XSZD 1ZM2A 4G5YA 4FUTA 3OFVA 3T34A 3DZKA 5E95A 3TOSA 3IHWA 1U0JA 2FMHA 4OQQA 2FPLA 4ER5A 1YJ5A 1YR9A 3C5EA 2PGIA 4P2BA 4R9RA 3KKPA 4K9QA 5C5CA 1HORA 1NJ8A 4X41A 4HJXA 4E5KA 2F8SA 5JVDA 3SZGA 1USWA 4OH1A 3PZRA 2RGRA 1EP1B 1WR8A 3PLRA 5J2TA 1Q7BA 1U1CA 2R2AA 5KSWB 2GTHA 2QJWA 4ZQFA 1ECGA 5CXSA 4IZIA 4REQB 4IIHA 3E0QA 1TD9A 4MR9A 4EG5A 1UWCA 2YXDA 1QP8A 3Q85A 2A5JA 4EHNA 1K06A 5H83A 2QXYA 1TEXA 3KOWA 4YAOA 3DMNA 5CNKA 4XUGB 2A59A 1GD1O 2AF4C 4LPSA 1E1DA 3ZWDA 1V5FA 4C4XA 2X6RA 3HGMA 2B5WA 1E2DA 3WDLA 5P8WA 4PBRA 2WINI 1NXXA 3ZWQA 3H5OA 4DMMA 3SHTA 4PAOA 3N8KA 2XT6A 4LQ4A 4YO7A 4KR2A 4BJ1A 1K8QA 5G2OA 4CIBA 2LZ0A 1XDSA 1QKKA 1Y9JA 2PMKA 4KPUB 4EHKA 2AGVA 3CKYA 3SYRA 1DZIA 1P5JA 1QOPB 4AN0A 1ULHA 4ZRNA 1H6DA 4NARA 5EE1A 1V8OA 3L0YA 1NPYA 4FOSA 1JDVA 1T5LA 2G5GX 1NR7A 3H1PA 3Q3GE 5HF5A 4BYMA 1GPKA 2V7QA 4DT1A 4J2TA 10MHA 3I6ZA 4NZZA 2D74A 1EXVA 1MO2A 2XBMA 3KJIA 4OXYA 4YAKA 3RT1A 1PEYA 1EFCA 3KT8A 1CZHA 2XODA 3ZE2B 4ZHQA 2R6HA 3H1BA 4QECA 4XIFA 3SOPA 1X7DA 1IJFA 3QE2A 4W82A 6PFKA 3M5DA 4D4JA 5HK9A 1CF9A 1ICIA 3WDMA 1LVGA 5FOVA 1XTSA 4JT4A 2LIPA 2BMJA 2HREA 1E7WA 2ZRAA 1EVJA 1JIXA 3LPNA 4G2NA 4JN6B 1YIOA 1V37A 3RSFA 2H9IA 1BKYA 3AERA 1K6XA 2GCOB 1M2VA 4MV0A 3KVYA 3V4ZA 1W5EA 2NZ8A 4OY3A 3HTXA 4LA4A 3JTMA 1ZHFA 1W0JA 5JYDA 2W2TA 3WK6A 3TFQA 2ECFA 1CVIA 2PBRA 1CQIA 1TM4E 1AY0A 2YN0A 4G97A 1OA1A 3H5LA 5D6NA 4YREA 2O8FB 3WLMA 3HCCA 2HCTA 3LLMA 2MMGA 5DYIA 2AG6A 3VGJA 3WFZA 3DEYX 2XZPA 2XUKA 4NHEA 4S2EA 5TLSA 4R1LA 1CIJA 1D04A 1I7DA 3SBDA 3R3XA 5EUQB 4ZTBA 2ESRA 3CF4G 1N2XA 2CFIA 2GSDA 1VPDA 3EBLA 3H0EA 2B69A 1UZMA 1UWKA 1SVNA 5FJJA 5JMPA 3ABOB 1U3WA 4LBYA 1F4VA 4XM0A 3X43A 3OKCA 1TF5A 1GPUA 1XELA 3MAJA 3GT0A 1JB1A 4ILEA 3N0WA 2YXNA 4JVMA 4A0GA 1FF9A 2ZI3A 3LT1A 4LHEA 4LYAA 5FTLA 5JH7F 1ECLA 1JR3D 2YWEA 2EYQA 2GVDC 5KYUA 2VUUA 3HJCA 4HH4A 4PGGA 4J7UA 4N8SA 2H3EA 4PZPA 5DX1A 2CFSA 2A5FA 5E4TA 5EVJA 5A4MS 4Y7CA 1NMZA 4QOHA 5IF9A 1JSXA 1X8KA 4X63A 5CJPA 3GARA 2BISA 2VIIA 3LK6A 2IPLA 3LHIA 4OQLA 2PZGA 5EPOA 4BECA 3H4VA 5C2JB 1VHDA 4WCVA 4MKXA 4XWAA 4ETMA 5E3IA 3OPYB 3MERA 4FWBA 5CBPA 1BKDR 1HQCA 5C1OA 2Y77A 4JGGA 1G4HA 4X3OA 2GK6A 3JZIA 2YICA 3H5AA 3LHDA 3I6QA 1I0LA 1YR3A 5JAQA 4EFMA 1BE0A 4Q3DA 4OUDB 4L5IA 4CKBB 2DM6A 3ZWOA 2ACKA 2QAJA 2A88A 1Z08A 1HDXA 4LY6A 4UD2A 3L84A 3SQNA 5IF3A 1U90A 5IMSA 3VHRA 1BXGB 1FQWA 2EIXA 5K6TA 3DL7A 3ZWXA 4LJKA 2A0UA 2RMKA 2JHPA 5E7QA 3A4TA 3OUTA 4QT0A 3IE1A 1J5PA 1SCUB 3T9CA 1LH0A 2X5XA 2C97A 2PRKA 5BYAA 4KITB 3AJRA 1G2OA 1VKOA 4XDHA 5JC1A 2NO1A 4PSDA 1NLUA 2IU0A 4CM1A 5KYXB 5DJ5A 3W2EA 1MC1A 4RIHA 5LBIA 1DC6A 3RE1A 1TQ6A 4GOND 1IXRC 4GMDA 4GEGA 4L15A 3ZCPA 2WVHA 2QA5A 4O4LA 3D5TA 3OOWA 3UB3A 4K8OA 4B74A 2OHVA 3PYLA 3RSLA 1ZUIA 3R3UA 4GIBA 4WLEA 4BLTA 4YY3B 1DB3A 3V4OA 3AIOA 1KPIA 2JFHA 4YJGA 2PYZA 4BEJA 4E2FA 2Z2XA 1O94C 2PU7A 2V3WA 4EG3A 1GCAA 1I3CA 4GI1A 3I5MA 2BGWA 1YBVA 3LDFA 4A6XA 1DIHA 2HMSA 4DIMA 4JBXA 5JI3E 1PF7E 2G4LA 1VBNA 4R6WA 1KQOA 2HIMA 3G88A 4LHSA 3K8QA 5TDHA 5KO2A 1JLLA 1WS6A 4CM4B 3IIKA 4EBBA 4MO2A 5EL0A 3V9PA 5EJEA 3LAWA 4Q9JA 2OA0A 2GKGA 2UUOA 3SXUB 5BSRA 4TVSA 4MUEA 4L7VA 5K2MA 4DDMA 1UK7A 1PFVA 2GJSA 3H4TA 3RJ5A 5B7QA 2HV8A 2ZJ3A 2AFIB 1CR0A 3WLAA 4D8WA 4NKRA 1COZA 3PLAE 1LPOA 3KM0A 4X71A 3ROFA 1ZG3A 5ALOA 1LLQA 1U5BA 1KGDA 2HK7A 1RQGA 3FRJA 4RA9A 1VG9B 2XHEA 4GMKA 4RLQA 1GO2A 1F1JA 2VHUA 2WHQA 1E69A 3E4CA 5TPWB 4Q9NA 4LK3A 1CF4A 1HZJA 2BSXA 1SVUA 1QPZA 3BQNB 1R8SA 2XQJA 4C2BA 4DTIA 5K09A 3VR2A 5ERYA 4H27A 3Q5DA 5AESA 1Y6GA 2DWPA 3QEMB 1C0KA 2IU6A 3FCOA 3TLGA 1YKGA 3NGLA 2EW8A 1L7VC 4JVSB 4QTYA 5CXUA 1EUZA 1FYXA 1TVEA 1D6MA 3QX3A 3KYDB 4JP5A 1WD7A 2QQGA 4F2DA 4P2GA 1GZ5A 3JQQA 2H1OA 2GXQA 2I99A 4PRZA 3MT7A 4FEEA 4QDZA 4B31A 3MC1A 3PR1A 2H52A 5JD6A 4YUYA 1B7GO 5LNK1 2YQZA 4QTXA 1XZ8A 1NUPA 1U0OC 2BEKA 1K7CA 1W9MA 1ANKA 4MVCA 1V71A 3FTEA 3LI2A 4KRGA 4FTWA 3PCXA 2P11A 4OQEA 4JSTA 3DHVA 5B36A 5BUZA 2EKLA 2VR1A 3NC0C 2OC4A 4JSYA 1F4PA 1Z82A 2EWVA 2Q50A 1DV1A 3RYFA 4MUYA 3MGCA 3ZVLA 1M1YB 1OFGA 1QK4A 3A3KA 5AKLA 4K40A 3OLVA 3FZGA 1KI2A 1W19A 2CHUA 2H29A 4FSHA 4I1VA 2H4JA 2B25A 3EHDA 4DLKA 1V7QA 3IP3A 4RY8A 3DDUA 4ONEA 2EFGA 3KZOA 4BKQA 1Q3KA 3A6GA 5A9RA 1JE0A 1UFQA 3F49S 3HU2A 5CB8A 4NU8X 1Z8NA 1QO7A 1V16A 3LY5A 3M83A 4FYJA 4JLNA 4DSOA 1TYCA 4UCQA 4B44A 1TD1A 3CQ9A 4MYRA 2QTHA 5C5DA 3ZLBA 1E0AA 3I4LA 4ZMBA 2WQ6A 4LF7B 1FFXA 4PYJA 4EKIA 5HW0A 3VU3A 2WKSA 3B2EA 3OSUA 4M9ZA 4QPJC 2UUPA 5TIIA 3OZAA 3V32A 3LMKA 1Y1SA 3EQ9A 4AMZA 3HHEA 4J90A 1IU9A 2HTFA 3FGNA 3IAS6 4Z9XA 2JAOA 5CUQA 5EESA 4H7FA 2R8BA 2A1TR 4TS4A 1PR5A 1YB4A 2W4MA 4L95C 5JZOA 3WWZA 1ESDA 3B9RA 2IYVA 1UANA 5DH9A 2ABWA 3KIPA 3AYZB 3L18A 2RK6A 4BLSA 3GQVA 1DAKA 1P62B 3PTLA 3ZV3A 3AY7A 3MJ4A 3DDNA 4P4LA 1MB4A 2C4MA 4B4KA 3M33A 4KLZA 1THTA 2N1BA 1X9GA 2FMKA 2OBMA 2JGMA 2XYHA 5HGJA 2VK1A 2IYLD 3OZFA 3TW0A 3COPA 4DV6B 1AM4D 3D8SA 1WCYA 2H16A 4C7OA 3TOXA 4PG7A 1ZINA 3TLYA 3MCTA 2A0WA 4LXHA 3VOAA 621PA 2F8TA 3OHPA 1G2QA 2EFYA 4HTFB 1PDOA 1ZOPA 1VOTA 5IYZB 1ZGCA 3F1LA 2X42A 3AY6A 2VQDA 3IP8A 4QRHA 1FXSA 3O2QB 4WH0A 1EX6A 2IKSA 3QPDA 5AH0A 5H4HA 4DQKA 1S8OA 3SR4A 2E4YA 3KJEA 4A26A 3S2EA 3TVTA 3ZQJA 2RB5A 4I3FA 1VPWA 3COSA 4P7JA 5A5EA 3I42A 3KDAA 1DBWA 2OCPA 3UFBA 5JNVA 2Z3VA 3GT3A 1GITA 1DPFA 3H4MA 2VWPA 2WKRA 2AVDA 2J48A 1S3SA 3DLTA 2P3OA 3GAMA 3H3XA 3NHZA 4R81A 1EINA 2QRGA 5DM60 5AVVA 3FB1A 1YBHA 3FOEC 2II6A 3S2GA 3PXBA 1DEHA 2XD9A 3A9WA 3IT1A 5B57C 3C3PA 4EEZA 1GCGA 2J5QA 1W49A 4C87A 1YAHA 5DP1A 4HDCA 3X2EA 1AA9A 3T0FA 3GRKA 2QI9C 4QU9A 5LBUA 1J2RA 4X8MA 4C07A 1YU6A 1YS1X 5F2OA 2XT9A 5EJFA 4AJ2A 3A2LA 5LQJA 2FP4A 4WXMA 2IIPA 4TLLB 1NTOA 2V6MA 3EXIA 3HXLA 4H31A 5KHLB 2FX5A 1QHGA 4ZN6A 3D3NA 4LSWA 4WASA 5ENVA 2IWRA 3LUPA 3LNCA 2Z58A 4P7GA 2WF9A 1GNSA 3RIYA 4XLLA 5ER9A 3NT2A 4OHUA 1IYZA 4GO1A 4M37A 4AD8A 2JAHA 4AUEA 1Q7CA 1LSSA 4HB2A 5ER6A 4ZKEA 4AG3A 2QRNA 3CNOA 2AUTA 1V2GA 4LW8A 4RAOA 4KUEA 3VISA 3TAUA 4OV6B 1P7CA 1RABA 2QTTA 1OYOA 1TVMA 3AR2A 4OQNA 1T6XA 3WLRA 2Q0HA 5GIOE 1AMOA 4B4DA 2VH2A 1W1IA 3RVKA 4DUGA 1DAEA 3PT9A 4PQRA 1RBMA 1HOTA 2XA1A 4R83A 1BRTA 1P9NA 1ZAKA 1P4GA 3CC8A 1FVOA 4R1UA 4R7GA 4MYCA 3W5DA 3UPUA 1JYEA 4P7BA 1K3TA 2IV3A 2QZSA 4HUJA 3IDQA 5IAKA 2QQFA 2YVQA 1T2FA 5T6MA 4OK5A 4B3SB 2IS2A 3BCHA 4FXOA 2O4UX 3O03A 4PHGA 3GLIA 4UU0A 4RPGA 2P77A 2WIGA 3RVJA 5YASA 1TLTA 2A0XA 1JECA 1SD2A 2WR8A 4PZYA 5JD4A 1X87A 2V5UA 3O6VA 4OHBA 2C4WA 1MX3A 1UEJA 4I36A 3N2KA 3O21A 3TLCA 3OTWA 3QEOA 3KKNA 4M1TA 5DULA 1JAYA 1P5HA 2DQKA 3A1CA 1Z0JA 3TB6A 1UT8A 3EODA 1S7GA 3S55A 4ZYYA 2GGSA 4DV5B 1LW7A 1DAOA 1JFVA 1I4WA 4R1PA 1WXGA 1H4VB 1NJFA 2D0OB 3W3AH 1E8MA 5K0SA 1XCJA 4M55A 3R77A 1H0RA 2IPXA 3BHJA 3DFMA 3J7TA 3H8JA 4QREA 1CUVA 2XX3A 1PV2A 3JQAD 4JC8A 4ON9A 5IT4A 1MP0A 1IATA 5FBWB 1EGMB 1NM5C 3TQQA 2M1ZA 5K8LA 3KFLA 2PK3A 4FDUA 5THXA 4TQUS 4LYHA 2DQ4A 3N53A 3P5BA 1EBBA 1G7CA 4XD2A 3W2HA 2FPIB 2RSLA 4JL6A 2H4ZA 1SM4A 2B83A 3CUWA 4ANFA 2Q3FA 3L9XA 1HT1E 3CGGA 3CR7A 4AF7A 1YI1A 3ON5A 2RAPA 4QNNA 4HQ6A 1F7VA 4KO3S 2NO4A 3RFVA 4ZYWA 4DADA 5DRTA 4EW2A 3WDSA 5TPZA 3PPYA 4AP9A 2J0UA 4UTVA 4RM3A 1M6WA 1MAAA 3TN7A 4ABTA 3ELUA 3JCZA 3WLEA 1T3GA 1SOAA 2YIDA 2C5EA 5F4ZA 2WDZA 3AFMA 5IBRA 3D1LA 1Q83A 3EGOA 4EGSA 1ZH2A 3MSCA 4JB0A 4U5XA 4GE0A 4A27A 2XCRB 1YCFA 4GQIA 1L9XA 5EMLA 2NM0A 3PNVA 1T9ZA 4WX2B 3SZUA 4DJJA 3KQUA 4JQOA 1VI5A 3BK7A 4XYGA 3IQIX 5E3HA 4F45A 1VLZA 1N4DA 8ADHA 4QUEA 1WMDA 1MA0A 2BI8A 3EBOA 3I23A 4LZWA 4OSPA 1KQFA 5J4LA 2XMRA 4RFVA 3BG5A 2V54A 1GTJ1 3PE6A 4N5DA 4JASB 1Y3CE 1GV1A 5AJHA 3AUJB 2F3SA 3EDYA 4HWSA 5E38A 1Q0UA 2NUTA 2DF8A 1EEXB 4KR6A 4XB2A 2C77A 1R6UA 5CX4A 3EHEA 3ZK9A 3LM8A 4EHAA 2VRBA 1WSBA 3R0ZA 4TSRA 4X1KB 4Y2XA 2W6JA 4Y1FA 2X5KO 1HZZA 1LBTA 4Z3KA 1E2NA 1YZUA 2NZ2A 2HF8A 3P9QA 3USCS 3PI7A 2CXTA 1DC7A 3M6AA 5GGXA 2BFNA 5KB3A 4K9PA 4LOKA 2C9MA 1XTPA 1Q6ZA 3CX3A 2XA9A 1UPTA 2G5PA 4AJPA 3NBKA 3FFTA 2B20A 3PGMA 2WIAA 3BFVA 5IPFA 4YACA 1XDWA 1H94A 2O2GA 3HBAA 1ZJWA 2ZJ8A 1QH8B 3KLBA 1CUJA 1R0KA 1YNSA 2QKYA 2V7QD 3D6TB 5DHSA 3TB4A 4OSEA 2JF0A 4H0FA 1YS9A 3BWVA 1Z7YA 2CL7X 3LT4A 2SECE 4XOUA 3LT2A 1OYWA 1QGUA 4DRYA 4P3NA 3IQDB 4JIGA 2HJWA 3MJVA 3C6YA 2RKWA 3U31A 4V0NA 4DM7A 1HF3A 3GPCA 2O8EB 1A82A 3LRTA 3P4YA 4X1YB 3E3NA 3W8RA 4QLBA 1D4FA 5DGDA 4HNUA 1XN1A 1KSHA 4WFJA 1UZNA 3JPWA 4TGLA 1R2QA 2I29A 1XOIA 1HDCA 2NTNA 2D1FA 1U65A 4FBLA 5DHFA 4N3GA 1BHJA 5IMBA 1B0UA 3CF2A 1RBZA 4FHCA 1C14A 5EIXA 4G84A 2FN8A 3TR5A 4C4TA 4E6EA 4O4JF 1BWRA 3LC7O 1B8NA 2L17A 4CI0B 1HWYA 4KQ2A 4B2LA 2FSVA 3CSUA 4QM7A 1AU9A 4X1IA 3EVGA 4KGXA 4ABYA 1ENZA 4EHHA 3BJZA 2ZG6A 4ZCRA 3WNBA 4KPFC 4DV7B 3HP1A 1SCKA 2HJSA 3ICEA 3COWA 1LDMA 1QFXA 3MCVA 4G0XA 1B16A 2WD9A 1AQLA 2BC9A 3BEDA 1PFGA 3GZNA 5FRDA 4I4NA 5CA0F 5H9WA 2OV3A 2CVHA 1PJ4A 3PRJA 5LZ7A 3F7TA 3R7DA 4OGWA 1N32B 2ZBVA 3DL0A 1NSTA 1VBMA 1GR1A 4QOEA 1N2OA 1IBSA 1QLHA 1BTOA 1XL1A 2WZQA 4MCHA 4OHOA 2DGDA 1M2KA 3VH4A 1E5LA 1R5OA 2Z83A 1NM5A 3C3WA 4OHMA 3FVTA 4ZODA 3QKRB 1PNQA 3L6EA 4FKZA 1YR7A 4OXIA 1NI5A 1WIWA 3SX0A 4YR9A 2WFLB 1KIMA 2CK3D 4B80A 1GXSA 4KPUA 1HDRA 4YP5A 2HJVA 3K32A 4TRNA 1KZYC 2FR0A 2VP6A 1YZGA 3GP5A 1YJXA 3MJTA 4CL2A 4OJNA 5DTMA 2L0XA 4PICA 2O8BB 1IG3A 1A9ZA 3PDJA 4QXAA 3VU9A 4EYQA 2OXRA 2R6ZA 4O4JB 1O0CA 2ZAMA 4YMSA 3U7GA 3NVKI 2EF1A 2IVZA 1N7IA 1RAEA 3IT0A 3QU9A 4OJYA 4EJFA 3T1VA 3OTGA 4MKRA 2BRUC 2ETXA 2CJWA 2YFKA 4ZYLA 1D4OA 1L0BA 1I33A 4CM7A 3KBBA 3JQPA 4M86A 2WIKA 1JBEA 4YXWA 2NQ8A 3IULA 1A76A 1PJAA 4NULA 1T8RA 4YMLA 2EZ8A 1VSVA 1OQAA 1YRBA 1JDJA 4HYYA 3VKHA 3HN7A 3B7PA 1YZFA 4HQKA 2ZPAA 2H1IA 4YDSA 7MDHA 3ZDZB 3FJYA 4UJ5A 5BV1A 1RNLA 3INTA 5HZGA 5PNTA 3DAPA 3VMFA 5A9SB 5GONF 4KFUA 3K9QO 5BVHB 5BOSB 5C7OO 1UP7A 1QDLB 2QRKA 3B85A 4JFAA 4OAOA 2J3LA 2O8FA 2XQFA 2O1SA 4UEKA 3UT5A 2C04A 4U7PB 1AKYA 2CLDX 1PV1A 3A4LA 4FE4A 4FMDF 4IYRA 2IRWA 4G56A 4J1QA 1AK9A 3AM4A 1GZ3A 3C1AA 4LDJA 3FMVA 3N3AC 4UM7A 4XX0B 1A9YA 3PBKA 1M1XB 1Y42X 2JLYA 3WHIA 2GO1A 1V41E 3C6BA 4PAGA 3MILA 5C8DA 1JXMA 3E84A 4TLCA 2DBQA 4CETA 1T0HB 4FGKA 5ADHA 3U44A 1AIPA 1OJLA 1UEIA 3FN4A 5L6LB 3R8XA 4HLNA 4EG7A 3TDNA 1JXAA 3CISA 3R24A 5EZ6B 1NURA 4UATA 1Q0LA 2ZUUA 4UUQA 1N3BA 1YI8A 2H08A 4TROA 3B1XA 1EX7A 3CCBA 4DHEA 1UC8A 2WPDA 4RF4A 1FQKA 1KEPA 4COOA 1NAHA 1G41A 1UM8A 1IZ9A 1XMXA 1EGAA 4HDRA 4LC0A 4BWFB 4DV4B 1T4BA 4UVIA 2RG7A 1XR3A 1NVVR 2ZTUA 3ID6C 5FYDA 2WUWE 2GBLC 4GMHA 4FQ8A 3U40A 2V9PA 2QYOA 5I9IA 4F5ZA 1YR1A 2Q8PA 4WI1A 3Q9NA 4XVHA 4YP0A 3WGJA 2QYTA 3I01A 3X1ZA 2UXDB 3O47A 1K2VN 1DOHA 3F78A 5G0SA 2C1EA 1G20B 2D5LA 3Q7TA 4GYKA 1USIA 2HXSA 2V7XA 2J5RA 3BXPA 4A10A 1A95A 4ZC8A 5AD1A 3ZBTA 2OZLB 1TTTA 2VN8A 3I12A 3K5HA 4F91B 3IUQA 1JHRA 3U3JA 3VUFA 1DV2A 1UH5A 3R9IA 1H6CA 3I04M 4H7PA 4WTOA 3OECA 5A3VA 4O5OA 5FQNA 1RFGE 2HHJA 2HPZA 5IM4A 5EC8A 3BGOS 3LLSA 5KVQA 2ZJAA 3H9GA 1SD1A 5E1OA 5AOCA 3UCXA 4AMGA 3ZD6A 3S3TA 1AV7A 2XW6A 3WOVA 1Z2DA 3H8WA 4J29A 2HMWA 4F3NA 3NNDA 3PKZA 1OH8A 4P32A 1H3EA 4F21A 2Y4OA 1PZGA 1M9NA 1ZD3A 1NVWQ 1OZAA 4UM9B 3LXUX 1ZD4A 2VP2A 1XYYA 1KOJA 2HDWA 1EDDA 4L9WA 3G8CA 1PLJA 2W7TA 3NWEA 1T3LA 4BQQA 1X77A 4YS6A 1HMYA 1J9GA 1IZ0A 2GZ3A 3KO8A 3JD4A 1UBSB 3EZXA 1BA3A 4JROA 5CFMA 4PVCA 1JJ7A 2PKYX 6REQB 4HL6A 2R7KA 1N2BA 2REXB 3O93A 3PHGA 1MB2A 5EI5A 1DFIA 3B3JA 5FEUA 1G5IA 5JHGB 2IEYA 2QPTA 5DK4A 3CNHA 4RD3A 1VKZA 4IR7A 3LC0A 1NSFA 1Z5PA 3HB1A 3OMWA 1TU0A 5D6OA 4NOMA 3GL9A 3CUTA 4E1AA 2PA0A 5IVHA 1U3UA 1I2DA 3HFJA 1JV2B 1K97A 4C21A 5G4KB 1KOFA 1S1CA 1FMJA 3A9SA 1ENOA 4E11A 4EWLA 1OCEA 3ZDDA 5KSPA 1E1KA 1GIAA 2LKCA 1JIVA 5CCBA 2WC1A 5CFLA 1MQSA 1GN8A 1ZGJA 1MTZA 1KGSA 2I3AA 4Z49A 1HTBA 1N6NA 3AQIA 2RONA 4WPGA 4LHXA 3Q2OA 3PD0A 5T41A 2HEIA 1KOGA 1AUXA 1V1MA 1J8MF 2D3WA 2QRPA 4JOQA 1KEUA 2AJBA 4RA9B 4OJMX 4G5FA 1B1CA 2BFBB 1EVEA 1Q3TA 4P3XA 3JQAA 4RJKA 4C4RA 2CGEA 2HBRA 5JBNA 3RFTA 5IC6A 3E7WA 1JEDA 1R9JA 5GY7A 2BZ1A 3WGTA 1QYIA 1LJLA 2O0LA 2WSMA 4S1VA 1SXJE 5TEVA 2IOYA 2XE7A 4LAFA 2YZKA 4G07A 4ZA2A 3AEYA 3AY0A 4MIEA 3IXQA 2CCGA 4I55A 1FTGA 2WZCA 4E4YA 7GPBA 5J1SB 2IKQA 1GT91 1T0JB 4YRNA 5K3SA 3MNFA 4P4UA 3UXHA 1TAHA 4WT7A 3ZXIA 1LDGA 2X8WA 1YH3A 4C3UA 5DHPA 1RXIA 2UYGA 3OP4A 1RWXA 2MSWA 3E9MA 2Q7DA 4DYVA 4F6RB 4DDKA 3UV6A 3VVBA 4UM5A 1Q0TA 3EPJA 2JATA 3VSAA 4EW3A 4ZYZA 1GPDG 1RU3A 2EW2A 4M1ZA 3ZTTA 5JLJA 3CR8A 3QK7A 2WYOA 3RK4A 1M74A 2GD6A 5ALMA 3VO2A 3IPAA 3E22B 3LWNA 2XWBF 1V0JA 5KS2A 5ARBA 2FF7A 3E2MA 4JI0B 4RQTA 5TGDA 1VYTA 3JQ8B 4FSDA 4X60A 3VKWA 1COWA 4RDIA 4KSCA 4DDVA 2ICAA 1N1DA 4ZVSA 1GGFA 1U9ZA 1UJNA 3VSBA 1E6UA 4HGRA 1FDSA 1QKIA 1VKHA 3SMVA 1A7KA 1HEYA 3N8IA 1MC5A 5ALJA 4GYYA 5FAXA 1F5NA 2VDMB 1PFWA 4OEHA 1X1TA 3BZWA 4MI6A 2O20A 2IYFA 4R7TA 3JQ6A 4IHJB 4D6XA 4QOFA 2YHUA 4BOYA 3D31A 1DVRA 1RPZA 3L4JA 3M6XA 5KOJA 3FPBA 2G9NA 3LLUA 4B4OA 4MWGA 3OJFA 4GWKA 1DTWA 2FQYA 3KVNA 5KVAA 2CY0A 4NX2A 3D4PA 3KHTA 4LHYA 1P0CA 3L9WA 1SIOA 1RCFA 3ZUGA 1GTVA 5EY5B 1UK6A 3I28A 3OZEA 2PT9A 5AM5A 3NQ41 3S5JA 1RM4A 1SPBS 3TIVA 3G3EA 4L8LA 4OGFA 3K0EA 8LDHA 4HQFA