1ISHA

Crystal structure analysis of bst-1/cd157 complexed with ethenonadp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
total genus 84
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1ishA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ishA02
1E92A 4HP8A 5H81A 1BXZA 2H63A 5FI5A 4DGSA 3VPGA 1TT7A 4DC0A 4XDZA 5BQFA 2HSDA 3SC4A 3DFZA 1BTOA 1V6AA 3ASVA 3RFXA 2NU7A 4YJHB 5F3RA 1K6XA 1C1DB 4B3IA 1VJ0A 4JK3A 3BTOA 3KEOA 4L8VA 3JQEA 5BNFA 2QZZA 5I7VA 2QZ9A 3A1NA 3KYDB 1TEHA 4BOYA 2DAPA 2O7SA 1U5CA 3IP3A 2J5KA 2DTDA 4DMLA 1ONOA 2Y0DA 3C24A 2NVWA 4D0SA 3ZW9A 1E7RA 4CMAA 4K6CA 1QP8A 4P4LA 1GEEA 2RIRA 4CMIA 4CL8A 4CLRA 3AI2A 3IC5A 4FDAA 4YB8A 1NVGA 2O3RA 1JTVA 1RM0A 5CDSA 3K73O 4MVJP 3ZNPA 3TF5A 4W6ZA 5JAMA 4BMSA 2I66A 2X9VA 2P68A 1ID1A 3B1FA 3VZPA 1QKIA 3GGOA 1OBFO 2HK8A 3AFNA 5F21A 3IS3A 1HZZA 1PJ2A 4NHEA 5G4KA 2D5CA 3VKVA 1I01A 4I5DA 5L95A 1LDYA 2JAPA 4DLLA 5A9SA 1JKIA 1ZH8A 3P7MA 1T2DA 3P2OA 5ITVA 1MB4A 3MEQA 2AE1A 5TT0A 2PY6A 3ANNA 1ZFNA 4LMRA 3WMWA 3DBHA 3KM0A 4CMCA 1A72A 4U0KA 5EL0A 3BHIA 3S2GA 1U1IA 2DPGA 3SC6A 3F1KA 2VT3A 3AM3A 3QWAA 4TKLA 2CDCA 4RV9A 1R16A 5HS4A 4O0LA 3RI3A 1Q7BA 3JQ6A 5F1KA 4OXNA 5FF9A 4JNKA 1GUFA 4BO4A 4DQVA 4CUJA 1LDBA 2J8ZA 3V2GA 5IZ4A 3ICPA 3MOGA 2Q4EA 4DPKA 3KZVA 4M87A 1HLDA 4FFMA 4KUEA 4Y6SA 2RAFA 1YBMA 1YL6A 5A1TA 5DBIA 5T8KC 5A9TA 4B8WA 1KVUA 1MV8A 2HAEA 1LU9A 1MG5A 4XR4A 1LDEA 1AUPA 5L40A 1X13A 2ZB7A 3JTMA 1SO8A 2VRBA 3TZ6A 1K6JA 3S1LA 4NBUA 1U3VA 1N7GA 3BZUA 1EVJA 4J3FA 4MP3A 1VC2A 3TRIA 4BKQA 4NBTA 3L6EA 1H93A 1Y81A 4L76A 1PJCA 2IDZA 2J3IA 1PQWA 3UXYA 1TT5A 1YONA 2DFVA 3KSDO 1ISHA 5BSHA 2R00C 4W7IA 3LLSA 4DIOA 1EMDA 1OAAA 4MVJG 2I9PA 2Q1UA 2D2IA 4JJGA 1C14A 3OJOA 5AOVA 2J3HA 3FSRA 4IDEA 1ZK0A 4PCVA 1DEHA 1UP7A 5CP8A 3TN7A 3PVZA 1KETA 4PG7A 4BKPA 2B37A 4IJKA 1JW9B 4LCJA 3MWEB 4MKZA 2XXBA 3ENKA 3W4KA 4Y6RA 2I6TA 2AQIA 3C8MA 3DAFA 4E6PA 2EP7A 4FOOA 4OQYA 5K0ZA 1QLJA 2HRZA 2GN4A 5EMHA 1F17A 2AQKA 3CMMA 2HCTA 1UDCA 3NUGA 1YJ8A 3MJSA 3RC9A 4J4TA 3PDJA 4L75A 4TVOA 3KB6A 3A06A 3JQAD 1TT5B 4K28A 3UFXA 1EQ2A 2F1KA 2JAHA 1N9GA 4ZJUA 1E1KA 4RZHA 3IIEA 3AM4A 1YDWA 3VPHA 2FY8A 3LYLA 4CQLB 3EYWA 4YRBA 4R1UA 2LDXA 3O38A 3L6OO 5JC1A 3OICA 3RC7A 5JCJA 4BNTA 4HNGA 4XR9A 4MPDA 3JQDA 2P5YA 3WQQA 4CM5A 4Q3DA 4AFNA 2OORA 4JX8A 5DCWA 2NU8A 1PSDA 2OHXA 3K96A 3HSKA 2WMDA 5IZCC 3D1LA 1ML3A 2B83A 5KNLA 2YJZA 5ER9A 2WM3A 4A2CA 3I9OA 1XELA 2Y67A 2GPTA 3LU1A 2ZYGA 3ZHYA 1T2AA 3RUEA 1ZSVA 4QECA 4P4GA 1RPNA 1J49A 3P2YA 3E1KA 1LBEA 3FBGA 4XQGA 1DIAA 5DF1A 4YVFA 3NTOA 2HUNA 2BI7A 1QV6A 4G81A 2UYYA 1QORA 1WNTA 2VYNA 1Y9EA 2GN8A 4HNHA 4N5LA 2B5VA 1FMCA 4O59O 4CMBA 3C7DB 4E13A 1MFPA 4D3DA 1FXSA 1UDBA 2P4QA 4UUNA 3NDIA 3CIFA 1PWXA 4GWKA 4LSMA 3L4BA 4KZPA 4BNWA 1XDWA 3FTPA 4LSWA 5AXAA 1BVUA 4YJGB 1K2WA 3BMOB 1P74A 3UVEA 4TSKA 1WXDA 2Q1WA 3R6DA 1DJQA 1E6EA 1GQQA 2OFPA 3Q2KA 5JLAA 2RBEA 3WQRA 5JY1A 4C7KA 5DCUA 4RPJA 1XWFA 1HF3A 1Y8QB 3DBRA 3AFMA 3AU8A 4RO0A 3WMXA 5TT1A 3ZWPA 1XGKA 3DONA 2VOEA 4IGEA 3RKUA 2ZKLA 4UAGA 3FHLA 1T24A 4XD2A 4UEKA 1ZNQO 5A3VA 4FJ2A 2Z95A 2G17A 4PG4A 1R4MA 1W4ZA 2EKLA 2PD3A 2VT2A 4HX5A 1BSVA 3HJAA 4TQGA 1IB6A 3AWDA 3GZNA 4UULA 5K6AA 3FN4A 5J23A 5IDWA 4OL9A 5IAAA 1IZ0A 3DOOA 3T7EA 2VNSA 1YGYA 4WUVA 1DPGA 1UH5A 1AN9A 4I08A 3TZCA 1PS9A 4XJTA 3BMOA 2C59A 4B3JA 2V6BA 3U4IA 1N5DA 5KTKA 4HADA 2POQX 5IN4A 1OZAA 1R4NA 3D4NA 4OH1A 2JD2A 2YV1A 1OC2A 1RM5A 3H65A 3I6IA 3RFTA 5L4NA 5L4SA 1BW9A 3PHIA 3IJPA 2VCYA 3EC7A 3O9ZA 3T4XA 2Y93A 3VZSA 5T64A 2B36A 4BO6A 3JD1A 5A03A 1U5AA 4B4WA 1Z7BA 3PEFA 4EBFA 4HXYA 4IDCA 3MJ4A 2VZ8A 2YZ7A 2ZYAA 4Q3AA 3UF0A 1KVTA 5FFFA 3FPLA 1PL6A 4U8GA 3C1OA 1R0SA 1EDOA 2A92A 3L0DA 5L7YA 3GN1A 4XA8A 1HE4A 1WMBA 1GCOA 3WFIA 3UICA 2PZJA 1E3WA 4IZIA 1KVRA 3UAGA 3MJVA 3PFFA 2GERA 1DHRA 4BNIA 2VWPA 3TWOA 4GL4A 3CTMA 4Y9DA 3LC1O 1WDLA 3PLNA 4CLEA 4RQTA 4WEOA 3CINA 3DOCA 1YRLA 2DQ4A 3IUSA 2G76A 4CV0A 4DLAA 3C3XA 1DJNA 3NT4A 2GN9A 3K30A 2CD9A 3PIIA 4OOFA 3A14A 4PGFA 3CKYA 5EIOA 2P9CA 1I2CA 5JDIA 1MA0A 1EUCA 5KOIA 2VHYA 2QHXA 1IZ9A 4O5OA 1QLHA 2DFDA 1DC6A 3IKVA 4M54A 3VVBA 3ANMA 4D45A 1PGNA 3GDOA 1U28A 1ZEJA 4GSLA 3G1TA 4MVJI 5A06A 3C7CB 1PJ3A 5JAQA 1DFIA 1XLTA 3G49A 4C7JA 3WSWA 3HFSA 4X54A 1TVEA 4OSPA 2O3SA 3T7CA 5CDTA 2EHDA 2BGKA 2HMTA 2HMVA 3GDGA 4E5PA 1EE2A 4XIYA 4YACA 3KHUA 4YDRA 3Q0EA 1NQAO 2PKQP 4QX6A 2I3GA 5I7SA 5CG1A 3BMQB 4XYGA 2B4QA 3G17A 3WYCA 2DT5A 2NADA 2Q2WA 3ROKA 4I8XA 1I36A 3HHPA 3AY7A 4BGUA 4FBGA 3ULKA 3FR8A 1FK8A 4XDYA 5EERA 2AEMA 1KVSA 5ENVA 4CJXA 5KJEA 1QYDA 4U6SA 2ET6A 3E03A 3K2BA 1PQPA 5FYDA 2VHXA 2CF6A 3FR7A 3FBTA 4J2OA 3IUPA 3UW3A 3CXRA 3KO8A 1LEHA 4PRKA 3KLMX 5T57A 1C0PA 3ZV3A 2QRLA 3FRJA 4TRNA 4BKRA 5FWNA 4CM7A 5TX7A 1UP4A 3JYPA 2J3KA 3HADA 2PTGA 1DO8A 2ZJ1A 3PFWO 1O0SA 3MWDB 3SJUA 5EPOA 3AI1A 4J43A 1X1TA 3LDHA 4LRTB 5JSFA 1UDAA 1E77A 3JQAB 2ZTVA 5H82A 4D41A 1R0LA 1ZSYA 2B0JA 2ZB8A 3ZDFA 1V35A 1NYTA 4EUEA 4IPTA 4RORA 1ORRA 1U7TA 4RF2A 1HDRA 2XXJA 2HDHA 1DAPA 1ZMTA 4EDFA 2PKRA 1ZKMA 2FHSA 5G4LA 1PS0A 2A35A 4RDHA 3DHYA 4U6QA 3AI3A 1BMDA 1P1HA 4QTZA 4R1SA 4RVFA 5BSGA 2DM6A 3AW9A 3CSDA 4XB1A 4YPOA 1M2WA 1Q7CA 4CM8B 4G65A 2E6UX 4H7PA 1I8TA 1TB4A 2FPPA 2EEZA 1M6WA 3R3JA 3W4IA 1C1DA 2TMDA 4LRSB 4OXKA 3EMKA 3PYLA 1EVYA 2VUUA 4R51A 2PWZA 3STHA 1P33A 2H1SA 3OEWA 3C7AA 2Q1TA 2E49A 4R41A 3NTQA 4ZQHA 1P1IA 2X4GA 1DFGA 3ROQA 2VTDA 1EUZA 2CVOA 2X5OA 4IJUA 3P5SA 3PYXA 2JD1A 1I0ZA 1VLLA 3VHRA 1PGOA 2C07A 5LCXA 3DZFA 3KRTA 2ZB4A 2Z1MA 4D46A 3ETGA 4KOAA 4F6LA 1ARZA 4FFNA 2J5QA 2CVZA 1ZXLA 1KVQA 4TRRA 1JQBA 3JQGA 3UOGA 5B4UA 1E1NA 4MO2A 5KJ1A 4J1SA 4XJSA 4IDFA 1J0XO 2RH4A 2A94A 3FNGA 3ONFA 3W8EA 3HUDA 5DT9A 1N2SA 2HO5A 4FOSA 4CLHA 3ZHZA 4ND5A 3OP4A 4YCAA 1HSOA 4HFJA 1E5QA 1H9AA 1FDVA 1NTOA 1WAMA 1IULA 3AM5A 3PI7A 2D3TA 2HQ1A 1DRWA 1CERA 2XPCA 5JBIA 4BKOA 4IQ8A 4FGSA 3RQSA 1BXGA 4D43A 5LDHA 1PJTA 1XKQA 4MIOA 4NU6A 2F00A 2GASA 3ZU5A 3LVFO 4BNXA 4O1MA 1WZEA 4UUOA 2IZZA 3WOHA 1WDKA 4XGKA 1JU9A 4A27A 4KUHA 1HDOA 4HFMA 2JJYA 3TPCA 4A03A 1JAYA 4E30A 2W8ZA 1GL3A 1D8AA 3QWBA 3OQ1A 2Y1FA 4ONEA 1CRWG 2BD0A 1JWAB 2P2SA 4BUCA 3NJ4A 1EFKA 2BFAA 2CF5A 3BMCA 3IJRA 1X1EA 4DA9A 3HDJA 4BNGA 1H2BA 1X14A 4OYRA 5ES3A 3WWZA 5KVQA 4YAEA 1HSZA 1NWCA 3E5MA 1WLYA 2JCVA 5A9RA 4KQWA 3H2SA 3JD3A 4S3MA 3QJ5A 1LRKA 4TRJA 5B37A 4QQRA 1M75A 3K92A 5KKCA 1EVZA 2JHGA 1D3AA 2B69A 2FN7A 4BQRA 3NT5A 2VYVD 1EUDA 1UP6A 2NTNA 3HDHA 4TVBA 4WCFA 5BSEA 1NQOA 4YBZA 4NJMB 3N74A 3TNLA 2Q3EA 5KVSA 1H6BA 2G82A 4KP7A 4AL4A 4FIZA 4YRDA 3PWKA 1NAIA 1HE5A 3QWHA 4PLFA 5HTOA 3KUXA 5L3ZA 3M2PA 3QSGA 1XU7A 2I3AA 1Y6JA 1T2EA 1UJMA 1WVGA 4PG5A 4D7AA 4F45A 3DMTC 1LLUA 2HMSA 5A04A 4BO8A 4IMRA 3OQ6A 1N8KA 4J4HA 3WXBA 3QVWA 1VSUA 4FJ0A 3KVOA 2BKAA 5KJCA 3WYEA 3ROMA 1B0AA 2PZLA 1HYGA 3HDYA 4YTEA 2NACA 4ZQEA 4U0JA 4BNZA 5T5QA 4ID9A 4MVJF 4Z3KA 4E31A 3PZRA 5JCXA 4XWYA 1T26A 3JQ9A 2Q50A 4BKUA 2HJSA 4R5MA 1E7SA 2O3QA 3SX2A 2Q2VA 4FC7A 4PN3A 1BGVA 4II3A 2IE0A 3O8QB 1XYGA 5IJZA 3BIOA 4PIVA 3PGXA 2CDAA 3VC7A 3I9NA 5KKAA 1G1AA 2HRBA 5TC4A 3IOYA 3WIDA 3PDUA 3GHHA 5ER6A 1VJ1A 3ZH2A 3NGLA 3U0BA 3UCFA 5EINA 1QYXA 1EEHA 1U4OA 1Y5MA 1A5ZA 2I76A 2OP0A 3DBLA 3A28A 3H2ZA 1MXHA 4LN1A 3WNVA 2DBRA 3WBBA 2IXBA 2ZTUA 4MDHA 3RJ5A 1H6CA 5DP1A 2ZQZA 4W9NC 4CM1A 1Y7TA 4FFRA 5G0VA 3VVCA 4CMEC 3DAGA 3T4EA 1LDMA 2O2YA 2HJRA 2WSBA 4WECA 3WYBA 5A5FA 4YT8A 5DNAA 2BFMA 1AE1A 1GYRA 4E2WA 5IN5A 4MOWA 4RVHA 4OOEA 1NFFA 3WTCA 3ZNOA 4J7CA 4QXMA 2IEDA 1XU9A 4MP8A 3B1KA 2OBNA 3RUFA 1NXQA 3ETDA 2VNAA 1UZMA 4AJKA 3INRA 4DMMA 4EITA 1RKXA 5MGBA 3JQAA 4FSHA 3JQBC 5CDUA 4JXKA 1UUFA 2C5AA 3ETEA 2UV8A 5TSDA 4CL3A 1Y1PA 1R12A 3K5PA 1A4UA 3KEQA 4OO3A 2PA3A 1LSSA 1GZ6A 1YQGA 5BSFA 3RBVA 1PL7A 4IQGA 2W98A 2VTEA 4YT2A 3M6IA 4GAEA 3OQBA 2DLDA 3LZ6A 4NBVA 3I9KA 1T2CA 3GEMA 4DIBA 3L07A 1HTBA 4GI2A 1E3SA 2GDZA 3ENNA 1U7HA 2AEJA 2DPHA 4ILKA 3LT4A 4BMVA 1XQ6A 5KWEA 3GR6A 1GY8A 3AUAA 3DAPA 4Y8VA 5DCYA 4E3ZA 2YHUA 1DAOA 4G2NA 1VL6A 4BNNA 2OGUA 2VZ9A 4CQMD 2Y99A 2BFPA 3WGGA 4D44A 2RCYA 3BMCB 1XG5A 3DTTA 1MXFA 3DWFA 1GZ4A 1L7DA 1PS8A 3NDRA 3C85A 1BG6A 2EIHA 3GT0A 1HE3A 1UZLA 4UVHA 3OJ0A 1LLCA 2FOIA 2NUAA 4JLWA 5A02A 2EW8A 1I3MA 4C4OA 2H5LA 1LSUA 1YL5A 3PRJA 4W7HA 1M76A 3TFQA 1UAYA 1PWZA 2O3TA 3PHGA 4A73A 3B1JA 4PLZA 3KSUA 4NH4A 2PGLA 1MC4A 1NHGA 4W9NA 1SAYA 4IS3A 3ZI0A 4YJDA 3A4VA 3I9MA 3RJ9A 3ST7A 1ADCA 2QIOA 5CDGA 4WASA 4WNCA 1N1GA 3F5SA 5CAEA 2FSVA 2SCUA 4EEXA 2D59A 4TZTA 1U8XX 1NNUA 4R54A 3WGOA 2GGSA 2TMGA 3RU7A 2E4AA 4BO5A 3QVOA 3N58A 2AQHA 2DBQA 2NU6A 1PU2A 4I5FA 4AJEA 5IZCA 5U1PA 4I5GA 5I9MA 3JD0A 3SLKA 5BNIA 2PH3A 4YWJA 3NV9A 4HY3A 3QQPA 1BW9B 2C7VA 3L9WA 1HRDA 2NVUA 4UEOA 4CM6A 3BAZA 4YJFB 4BNHA 4YJGA 5I7EA 4NK4A 5B12A 2YV2A 4WLNA 3CE6A 1PJ4A 4PLTA 1GCUA 4EYEA 4LCEA 2IZ1A 5AVOA 3LT2A 3C1TA 4R16A 3TZQA 5HM8A 5JFOA 4AG3A 4W99A 1P0CA 3PQEA 2GYYA 1QV7A 1YQXA 4NK5A 3W8FA 3H7AA 1BXKA 3ZWYA 3RUHA 4J0FA 3ZNQA 1FJHA 4ZRNA 1ZXBA 3ZNNA 3AU9A 4EW6A 3LC2O 1I3LA 2XAAA 4XZ3A 1NASA 1PJLA 1TLTA 3DFUA 3GY0A 4E21A 4XQCA 3CPSA 2VYND 1R6DA 2GZ3A 1ULSA 4HFRA 4Z9XA 1OMOA 1R0KA 1WMAA 4PLPA 1QR6A 2JFGA 4B7UA 1EZ4A 2GF2A 4AJ4A 4GKVA 2C20A 1XEAA 2CUKA 3GVPA 1KBZA 4CUKA 5IXYA 5JPIA 1R4NB 2IODA 1YL7A 1ZCJA 3U4CA 1UXIA 1KYQA 3H3JA 3UHAA 1MGOA 4HV4A 5COBA 2OMEA 1B26A 1E3LA 3BMNB 4EJMA 4CMKA 3DZGA 4D0RA 3GGPA 2Z5LA 4FD3A 2FMUA 3HQ4O 3PZBA 4Z0TA 1K6IA 2DTEA 4I9NA 3VAZA 1I2BA 4A7PA 3DR3A 1DLJA 2ZQYA 4I9HA 3GDFA 1BVRA 3CZMA 1ISJA 1YOVB 4PLWA 1HDYA 3QLJA 4FFOA 5AQ1A 3L4BC 3QY9A 4TRMA 5I8WA 3Q9UA 4Z0HO 1J5PA 1ZK4A 1V3TA 1ZEMA 1C0LA 1NP3A 1Z7EA 4BO1A 3NAQA 3OFSA 4MINA 4GX0A 3WTBA 4JROA 3VH3A 5KIAA 2G5CA 2WEKA 3AK4A 3G1UA 4GX1A 1NFQA 1HZJA 2JKVA 3H9QA 2WDZA 3IP1A 3GG2A 3ONDA 4CM8A 1LSJA 2Y0CA 3MCVA 2WD7A 5GZ3A 1G0OA 4B4VA 3LK7A 5HWSA 4OAQA 3GFBA 3GRKA 3D0OA 1PEDA 4RDIA 3KYCA 4JBHA 2EG9A 4L9RA 4RF3A 4RPHA 1YOVA 3KYBA 3WSVA 2Y68A 4J2HA 4MKRA 3IMFA 4D3SA 1Z82A 3HWRA 1HETA 4WLVA 1GD1O 4GMGA 2CDBA 4ND4A 4AJPA 4CV1A 4L0QA 3F5QA 4BNVA 3G79A 5EESA 1LXCA 4PFJA 2W2LD 1IY8A 1GYQA 1PIWA 2PFGA 2Q4BA 3R3SA 5JDIC 5KVCA 3GPDG 5KVVA 4GMFA 2DUUA 4OJNA 2EGGA 2X22A 1QSGA 5L4LA 4FJ1A 1DLIA 1W6UA 4E33A 1KIFA 1X15A 1E3WB 1LRLA 3RWBA 1N1EA 4BGEA 5JXWA 1GPJA 4IUYA 1ZW1A 4BV9A 1RYDA 3O03A 5F1PA 3DZHA 2NV6A 1RM3A 2WWRA 1VKNA 3ZWAA 5L7TA 1ZBQA 1H9BA 3OH8A 4NFSA 3PWZA 1BDBA 3IQDB 4RCVA 5DZSA 5A5EA 3WLFA 2EKPA 1Y5RA 4YR9A 1IHXA 1XSEA 4KMSA 1L1FA 4BNYA 4KWHA 2UDPA 4RZIA 3ZV5A 5F1OA 3GC6A 1A7AA 1H2HA 5JW6A 2BMAA 4N54A 1ENOA 1VE9A 2X58A 4NI5A 3WBFA 4DXHA 3PHLA 4IIUA 4MVJE 8ADHA 3BTUA 5IDXA 2R6JA 1Z6ZA 4XYEA 5G4KB 4CM3A 2FZEA 2IZ0A 3L77A 1NAHA 1E7QA 1E0DA 4WEQA 1Y8RA 1SB9A 3UUWA 1AHHA 1QG6A 2O2SA 1I2ZA 5JS6A 4L4XA 4OSOA 1X7HA 4TZKA 1F8FA 2CVQA 2VQ3A 1ADFA 3NGXA 1HEUA 3QP9A 4IINA 3KYDA 5L51A 4YAIA 1BXGB 1P1FA 3FNFA 2Y1OA 3E82A 4Z3DA 3WGHA 3JYLA 2DU8A 2Q99A 3DXFA 1D1TA 2VOJA 3W6UA 4CMEA 4BO9A 2C29D 4AICA 3PQDA 2GRAA 1LTHR 2G1UA 2I99A 1DIGA 5IXSA 1KY5A 3U4DA 2YYYA 2FR8A 2PGJA 3E48A 3FF4A 4MIEA 1LUAA 1GQYA 2VWQA 5GMOA 4Q39A 1UXJA 3I6QA 2QYSA 1SEVA 1SMKA 2PLAA 4UUMA 5C7LO 3JYOA 3AOEC 3UN1A 5L53A 4CM4B 5COAA 3FNEA 2PR2A 1CIVA 1O9BA 2H6EA 1N9GB 3LF2A 3DZBA 4N5MA 4AVYA 3WGZA 2YY7A 5LC1A 3MJTA 5CHEA 1NR7A 2WYUA 2JFHA 1FDUA 3RASA 2Q45A 3DBHB 5T8KA 4DUPA 4E5YA 5JDCA 5B4VA 3ADOA 4NR0A 4BNUA 4LGVA 1ZO8A 1CJCA 2VHZA 4I5EA 3ANLA 3O4RA 1CF2O 3FI9A 3DDNA 3I3OA 4J7UA 5A4DA 2QYTA 1BHSA 1Z45A 3ITKA 3E6AA 4GVLA 4ALJA 3PWSA 1J6UA 4MKXA 4MJLA 4RJTA 4XKJA 3E18A 2BLLA 1VJTA 4E0BA 3MOIA 4LVUA 4Y6PA 3WJ7A 4BMNA 3EW7A 3WIEA 1C1XA 4N5NA 5JNLA 4KDFA 3IL2A 1JA9A 4CLRB 2QQ5A 1IUKA 3SEFA 1LQTA 4BNMA 4ZRMA 1IPFA 2GZ1A 4NU5A 4CR7A 4BHTA 3ZWVA 2X8LA 5I9NA 4JBGA 4J9UE 3HN2A 1NPYA 5JE8A 1ENZA 4AJ2A 4NNJA 4RF5A 2PH5A 3EVTA 1K5HA 1YB1A 3AUSA 1IPEA 5AXDA 1R66A 3R0IA 4IJVA 5TJHA 1FDWA 1LDNA 2PV7A 4OIMA 4CMIB 3G3EA 1XR3A 1P44A 3LQFA 4LW8A 4FN4A 1NM5A 3RBZA 1JVSA 3H8VA 1KEUA 4INAA 2V7PA 3GMSA 3ASUA 4R01A 5ILOA 1CETA 1VPDA 4UVIA 1YJQA 3QHAA 2X6TA 4JN6B 3ADPA 4O6VA 5A9SB 1T4BA 1O94A 4HWKA 2E82A 4CR6A 1NPDA 3WS7A 5ITWA 1ONPA 3FWZA 1C1XB 4J6FA 5IFLA 2VZ0A 1FF9A 2PGDA 4WCFB 4GSKA 1W0CA 2FP4A 2NTVA 4F46A 5A05A 2YQ5A 3F4LA 1F0YA 4IDGA 4IY1A 2Y66A 2OXIA 1ZK1A 3B70A 3AJRA 3GLQA 4EJ0A 2D4AA 4NG5A 2J5RA 3PJEA 1AGNA 3H9UA 1OC4A 1PZGA 4M49A 3SLGA 4CLDA 2C0CA 3DZKA 2FWMX 4HKTA 3RC1A 1DIHA 1XCBA 3JCZA 2FPIA 4GVXA 5EJ2A 1LC0A 1MLDA 1NR1A 2W2LA 1T25A 2Y1GA 3QWFA 5C7IO 4Y98A 4QO8A 4MVJM 4RL6A 1YQDA 1PGPA 1SEPA 2ZTMA 2CSUA 2YW9A 3BXXA 5DBFA 3RCBA 2GUGA 1VL8A 3TOXA 3Q6IA 1EE9A 2WD7B 4YA6A 4ALMA 3GNTA 4ZGWA 6LDHA 3L4SO 3OSUA 1ENYA 2O4UX 2ZIZA 4FCCA 4KUGA 1Y8RB 4WJZA 2P9GA 5CPFA 1H0KA 5GY7A 4BO3A 3VPXA 7MDHA 4ZVVA 2JL1A 2ZB3A 5DOZA 5CFZA 4BO0A 4YT4A 1EK6A 4YAGA 2NSDA 2HK7A 3U09A 2NQTA 3QE3A 4M89A 3DTYA 2Y0EA 4QSMA 2O4CA 3L6DA 3Q11A 3FTNA 3WFJA 3RUCA 2HLPA 4DIFA 4O63O 2OO5A 3QRWA 1JDJA 3D5TA 4H15A 3K6JA 3RU9A 4DL9A 9LDBA 3OBBA 4Q3NA 1SBYA 4WCDA 3EK2A 4YJHA 4RLSA 1T1RA 5TGDA 5ICMA 3PXXA 3EZLA 1LJ8A 1W8DA 1LI4A 3NRCA 3DB2A 3ZWOA 3VH2A 1B8PA 1IE3A 2EF1A 4YAKA 1MG0A 3TJRA 1ZUD1 3EVNA 4BVAA 1I10A 1ISMA 2VYVA 4PZCA 1U3TA 1PR3A 2VHVA 2V6MA 1M6HA 2NQ8A 2GN6A 2X23A 2YFQA 3ZW8A 1QMGA 1YB5A 3PHHA 3BTSA 4MP6A 1A27A 3ZZNA 4E5MA 1VRWA 3MTJA 3GVXA 2QRJA 2IXAA 4BNFA 1VSVA 3WLEA 3I4FA 5EQDA 2X5KO 2Y05A 4CMJA 4PRLA 3NYWA 1LA2A 4J1QA 5I9LA 1YBAA 1ISFA 4CR8A 1O95A 3U9LA 3OA2A 5ENDA 1CWUA 4GX2A 4FQ8A 2YUTA 3NJ8A 4BS9A 3OHSX 1K0UA 3UH1A 1ZK2A 4ND3A 2R00A 4I9UA 1KY4A 1BDMA 4GKBA 1O8CA 1X0XA 2YV3A 2VN8A 4CODB 2I5PO 5K9ZA 4DTIA 4XEHA 2C2XA 4TMFA 3SJ7A 1AXGA 3GAZA 4BO7A 4IM7A 4EGFA 2FZWA 2ZATA 3K9QO 4B79A 2D0IA 1F12A 1YBVA 4NJMA 3WDSA 3ITDA 5BNTA 1I33A 4NPCA 5ILGA 4JJIA 2W2KB 3F4BA 1GAEO 1PTJA 3I5MA 4W82A 3U62A 2NVUB 1JAXA 4UUPA 4UREA 7ADHA 4IDDA 4IDAA 1MC5A 2XF8A 1D4FA 1B16A 4NBWA 3RFVA 4CQLA 4GLOA 2EP5A 4IIVA 1WDMA 3LF1A 2AG5A 2HK9A 1TXGA 3OIFA 3LSYA 2W4QA 3IKTA 4JGBA 5MDHA 2OL4A 1EBUA 4JJFA 4WPGA 2YHIB 2YHIA 1GEGA 4A5OA 1DRVA 2IRWA 2OUIA 3OECA 1XHLA 1HYHA 3SBOA 4QFDA 1RWBA 4PZEA 4PLGA 3R1IA 1MFZA 1P77A 3WQSB 3I9JA 1ZK3A 4DYDA 3JQ7A 2JCYA 1GUYA 4S1VA 3K31A 1ADBA 4CMHA 2CZCA 2GR9A 3HE3A 1F14A 3PJDA 3TL3A 1HDZA 3EGOA 3PPIA 3MTGA 4FC6A 1F06A 2GCGA 1LLDA 2R2GA 4DBVO 2ILTA 2PZKA 5JC8A 5JO0A 4NJOA 3V8BA 3C1AA 4E5KA 5C3MA 2PKQO 4XYBA 5U4QA 3JQBA 1JN0A 3JD2A 1Z74A 4CPDA 3COSA 4DLBA 4OGWA 3GUYA 4OKNA 5DULA 3H9EO 5TIIA 2BELA 2AXQA 1GTMA 2EGHA 1QXSA 3DC2A 2GLXA 4BL5A 3B20A 3RAJA 4GWGA 1I30A 4OXYA 4ZICA 4DPMA 5G0SA 1LLQA 4J49A 1Z75A 4L74A 4DPLA 1U2GA 4YRAA 1N7HA 1WP4A 1DB3A 1WW8A 3AOGA 4QFCA 1GR0A 1PGJA 3OEYA 1J4AA 1DFHA 4I1IA 3KV3O 1NFRA 2CNBA 1QYWA 3W6ZA 3HG7A 4RPKA 5F5LA 1E3JA 4WLFA 3FCOA 1PJQA 3UKOA 1M66A 4AJHA 3GHYA 1HDGO 3MZ0A 3VZQA 1SCUA 1LQUA 3GVIA 3ONEA 4ITUA 2NWQA 3GVHA 4JQCA 3GEGA 1QRRA 3GH3A 3ZWXA 1A4IA 3ZV6A 2GZ2A 1PX0A 1VI2A 3HNPA 4UVDA 4YQYA 3GUCA 3KSZO 3OMLA 1NX6A 1B7GO 3S8MA 3VZRA 5B1YA 3H9JA 3VTFA 3WWYA 3K8ZA 1E5LA 3E5RA 4H16A 3GZNB 4NMHA 1E7YA 3JQ8B 4EI2A 4WE3A 1O89A 2G0TA 3JQFC 3TDKA 4L4RA 2AA3A 3AY6A 5THQA 1SB8A 4Q3BA 2C2YA 1UXHA 2P5UA 4AJLA 2O3UA 2DBVO 3V2HA 3RKRA 5KJ6A 1GZ3A 1GU7A 3H3FA 3I52A 4YAJA 4JBIA 4IZHA 1Y8QA 3DBRB 4J90A 4MVJD 4ZA2A 2P9EA 4XB2A 1YE3A 5GZ1A 4J91A 3TOZA 3O26A 3LC7O 3GN2A 5JMWA 2NLOA 3TZKA 3UCXA 4DRYA 4CM9A 1JKJA 3ZCXA 1F8GA 2WJPA 1LDGA 4URFA 3GNSA 4U5QA 4CMGA 1XQ1A 4Z0PA 5DP2A 3ZGYA 3KXDA 3Q2IA 1QYVA 3VPFA 1ISIA 2Q1SA 4Z9YA 5IDQA 3JQ8A 3OA0A 1UAGA 2WYVA 2QRKA 4OKIA 4ZD6A 4DVJA 1JWBB 1GDHA 5JMPA 3D3WA 1DSSG 4NBRA 4OHUA 4WLOA 5T67A 5L7WA 3GGGA 3DMTA 1O6ZA 4J0EA 1Q0HA 3DHNA 4LISA 4PZDA 2BGMA 4Q9NA 4MVJH 4E2ZA 3JV7A 3PLRA 4K9DA 4QUKA 3W8DA 3GZ4A 4JIGA 1PZFA 4M55A 4BNLA 4J4BA 5T6BA 3Q3CA 1TI7A 4L73A 3DEYX 1DC3A 4NQZA 1C3VA 2FR1A 4P8RA 2YDYA 1IOLA 1RM4A 4D42A 4E2YA 3M1LA 3QVTA 4WOJA 4A10A 3EAGA 2D5AA 2FR0A 4EZBA 3IDSA 5JAZA 2X7HA 2NNLD 5TF4A 5CPBA 3KTDA 4YXFA 4YEDA 1K3TA 3AUTA 2JD0A 2X86A 3D5QA 1GQ2A 1B2LA 1P9LA 4CM4A 2VWHA 2J3JA 2JHFA 2BGLA 2OZPA 4EUHA 3TSCA 3VOSA 2P91A 4L4SA 3D3WB 3SXPA 1HYEA 4WLUA 1BRMA 1V9LA 3UGKA 5C37A 4WNIA 2NTJA 3P19A 4E2XA 3NTRA 4FFPA 3X2EA 4QO7A 1KERA 1AHIA 1R37A 5I8ZA 3BMQA 3CEAA 5FEUA 3V1UA 4P22A 1EK5A 2YDXA 3WGTA 2DBZA 3OF2A 4NDNE 1WPQA 3GVCA 3GF4A 4K1LA 1NHWA 2AG8A 4NFYA 3FD8A 4Z9FA 2HMUA 2XOXA 2V6GA 2DC1A 4B4OA 3PTZA 1V8BA 2AW5A 1I24A 2WD8A 1ZMOA 3MJEA 4R9SA 5L45A 4Q3CA 3RIHA 4E12A 2AQ8A 5BT9A 2IYPA 3S55A 4JCOA 4B3HA 5TLSA 1XA0A 3PHJA 1ZVMA 4B4UA 1YKFA 2ZJ0A 2V65A 3ZWMA 3D7LA 4DWVA 1RYEA 4CLOB 4FB5A 1C0KA 1DC5A 2Y1CA 3TZHA 1E1MA 1KC1A 3D4OA 4CV3A 3GPIA 2HKIA 3BYZA 4UEJA 1DHTA 3JQGB 1GV0A 1P1KA 3E9QA 8LDHA 5JYEA 2NU9A 3NT2A 3KLPX 2VRCA 5G0WA 2D1YA 3OJFA 4E5NA 5IF3A 4LK3A 4KWIA 1MUUA 1VL0A 1HT0A 4GBJA 3ZU3A 2C54A 1HWYA 2GO1A 1W73A 3JQCA 3GA0A 2OP1A 3PK0A 4M86A 3I9LA 4IS2A 1ZZEA 4DQXA 4CUZA 3CMCO 3ZHXA 3UCEA 3LT1A 3CZRA 3F9IA 2VUTA 1LSOA 1H94A 1Q7GA 5F5NA 4DC1A 1ENPA 4AJJA 1V3VA 3GG9A 1ZJYA 2UVDA 1DBVO 4N18A 1R15A 1CQIA 4Z6KA 1IHYA 2B4RO 4LVCA 4BB5A 2PD6A 2Q46A 1P31A 3N7UA 1LX6A 1E1LA 2DKNA 4IMPA 4EEZA 4FR5A 3GK3A 3INTA 1ISGA 2AHRA 2BRUA 2NM0A 1ADGA 1LRJA 1KC3A 3VPSA 4J1NA 2RH8A 3RBXA 2AE2A 2O23A 2WE8A 4F6CA 1M67A 4W4TA 3LT0A 4PG6A 3GMDA 1U8FO 2CMDA 1U2DA 5K6AC 9LDTA 5I7FA 1A9ZA 4AJNA 4ZHSA 1FDTA 4D79A 1HLPA 2NVBA 4DQUA 2ZCVA 1E7WA 3Q9NA 5GZ6A 3RUDA 3OM9A 4ZQBA 1U3UA 1VKOA 2AMFA 2RHCA 3H5RA 4FW8A 4HFNA 1YB4A 1WZIA 2O3JA 2FRDA 3TFOA 4PLHA 1PZEA 4R1NA 1NVMB 3BTVA 4YT5A 3FNHA 3V1TC 2P4HX 4BV8A 2D8AA 2LDBA 1MP0A 3H4VA 2WTBA 3O8QA 4XQEA 2JFFA 3HDQA 4E4YA 3PYMA 4PLCA 3JYNA 3CUKA 3KETA 4CV2A 2BF7A 1NBOA 1DIRA 3VH4A 4ALLA 1CEQA 3DHEA 3RD5A 4B7XA 1DRUA 3GFGA 3M1AA 3V1YA 3WGYA 2O7QA 3ZWCA 5G0TA 2OOSA 3ICCA 2ZK7A 1HXHA 1V3UA 3VDQA 4PVCA 3FPCA 2C5EA 4WGGA 4UVGA 5KCZA 4XYMA 3EZYA 4IGFA 3M2TA 2WYWA 4RGBA 3RSHA 4B7CA 3F1LA 4YYZA 1IYZA 1EBFA 3EDMA 5C5IA 4E32A 1U9JA 4M1QA 3U3XA 4K6FA 4M8SA 4ZQGA 1OFGA 2X9NA 5KJFA 3OIDA 3OIGA 3FWNA 5A3JA 2BI8A 3QIVA 2FSSA 4HBGA 4BO2A 4GGOA 5TJ9A 4ESOA 1JVBA 1SZJG 2IEBA 2E37A 3TL2A 1NVTA 1QYCA 4KTTE 1H6DA 4FPXA 3LLVA 3ZN2A 4AJIA 4ZN6A 1KS9A 2YQ4A 3V5NA 4LMPA 2B4TO 5FI3A 2E48A 1Z73A 2X0RA 1E7MA 4J16A 5DOVA 4II2A 1N92A 2ZTLA 3S2FA 3WGIA 2VWGA 5JO9A 4CQMB 2IYOA 6ADHA 4F3YA 3GEDA 1X0VA 4BB6A 1O5IA 2Y1DA 4J7XA 5JY6A 3WX0A 2Z1NA 2BHLA 2GD1O 5JDCC 3D3EA 3A9WA 4WCFC 1GFSA 1T1SA 3U5TA 2AEFA 3DO5A 1NQTA 1SPXA 3QW2A 3OETA 1HDXA 1B14A 1U4SA 3DBLB 4P38A 5EQFA 1P45A 2UUOA 1EFLA 5AYVA 5DN9A 4IJWA 3DZIA 3RUIA 1B3RA 3I23A 4BNJA 4KTVE 4XIJA 4FS3A 4TKMA 4EUFA 5IG2A 1A71A 3KBOA 3EHEA 3AOEA 3ROPA 1G0NA 2DUWA 1KEPA 1DDOA 1RJWA 4ALKA 4N7RA 2C7GA 4GPD1 2Q2QA 1HL3A 2UAGA 1X7DA 1P0FA 2JCXA 2X9GA 3PQFA 1EDZA 3ZWBA 3MJCA 2PZMA 2A4KA 3I4CA 5G2OA 3TQHA 1D1SA 1I5RA 3D64A 5U9CA 1NPTO 3K2EA 3RROA 5HRUA 1D7OA 4BQPA 4EJ6A 2DTXA 2HMWA 1A7KA 4TROA 2OBYA 2J6IA 1U3WA 3PJGA 4DREA 4NZ9A 1PQUA 4JP2A 4KQXA 4A0SA 2EWMA 2GSDA 3PP8A 3NEPX 3E9MA 2UUPA 1NWHA 2X5JO 1SOVA 3JD4A 4K26A 3AUUA 1LC3A 3H6KA 3I83A 3H5AA 3S2EA 3GNQA 1E6WA 3JQ9C 1YDEA 2YFHA 3ZWNA 4WKGA 2BFOA 1Q0LA 1FDSA 4R3NA 1CYDA 4XX0A 3H9GA 4Y67A 2VRCD 4AJ1A 1P1JA 4A26A 5CEJA 4AJOA 4J1TA 1PJBA 3OJLA 2QG4A 4ALIA 3QVXA 1E3IA 3BMNA 3WNQA 1Q1NA 4RPLA 4NFHA 5ADHA 1V0JA 3DOJA 2ZYDA 4FFLA 4G5HA 5COQA 3U49A 4XRGA 5JYDA 5BR7A 4D3FA 2Q49A 1G6KA 4KDEA 4GLLA 4XRRA 2WE7A 1ZSNA 3I1JA 3L9XA 5AXBA 4BNKA 4GQAA 2RHRA 5CG2A 1P3DA 3DBVO 3WICA 4CQMA 2O50A 2GNAA 3PIDA 3GAFA 1YS4A 3X2FA 4RVUA 2BH9A 4FGWA 4ND1A 3CH6A 2I67A 3F47A 1B15A 1S7CA 4R3WA 4IXTA 3HB4X 3PGJA 1PL8A 5TQVA 1SOWA 3HB5X 3SVTA 3NX4A 1E6UA 2I65A 2V6FA 1DXYA 1OI7A 1KEWA 5ICSA 5TNXA 2PNFA 1B8UA 3WB9A 4RPGA 1CDOA 4R68A 2EW2A 4H3VA 2X1HA 4R4JA 5TS3A 5CEEA 5DDIP 3U4HA 1I32A 1PJSA 2CY0A 3B6ZA 1LNQA 2VHWA 1Y9AA 3GRPA 4NIMA 4P4NA 4RVGA 1C0IA 1YH3A 1ONNA 4YQZA 4IBOA 2C82A 3VTZA 5CEFA 1NQ5A 5EN4A 3RUAA 1L7EA 1ZJZA 4R5HA 3WG9A 4IQ0A 2CFCA 3QVSA 2EKQA 1S6YA 3GOHA 4JP3A 3KOUA 5DBGA 3DZJA 3G0OA 3S2IA 5L9AA 5TRTA 4UVEA 1DOHA 1YVEI 1UZNA 4OM8A 4BGVA 4R69A 2B5WA 5G0UA 1R4MB 3H5NA 4PVDA 4XGNA 3BHJA 4PLYA 3VDRA 3IAHA 1JLLA 1DC4A 3DMYA 3F6YA 1E3EA 1X7GA 4IDBA 3OJEA 4DBZA 1B3BA 3JYQA 1UR5A 5B4TA 3GQVA 1AXEA 1MX3A 2H9IA 1SC6A 3JSAA 2QX7A 5H83A 3AY3A 3Q1LA 3ZHBA 4ZU3A 5HA5A 3DQPA 1I3KA 4Q3EA 2X0JA 1EVIA 1WWKA 3EUWA 1XIVA 4MIYA 3F46A 2PK3A 3DL2A 4DYVA 1HDCA 1B8VA 1GYPA 2X0NA 4BIIA 4XQ9A 5CDYA 5HBRA 4OQZA 3NKLA 4HUJA 2A9FA 2Y1EA 4U7WA 3BA1A 4WOKA 3VKUA 3RC2A 4ROSA 4GX5A 3ORFA 4YJFA 3RVDA 4CM9D 1VM6A 3ZV4A 1T2FA 4TWRA 3WR5A 3NDJA 5JCJD 2PD4A 3V2UA 1EQUA 5JAIA 4CLXA 3KYCB 1YWGO 3BHMA 3E9NA 4QT0A 1TA4A 1PGQA 1I3NA 1P1RA 4MVJA 1A9YA 4RQUA 4XYLA 3HFGA 2EXXA 4ND2A 1HKUA 2EJWA 4ALNA 4IXWA 3ABIA 1GUZA 1PR9A 4QEDA 2QW8A 1H5QA 2B35A 2EJVA 3WGQA 1BWSA 1JKFA 3HN7A 4J9VA 2EV9A 5IDYA 4XCVA 3VH1A 3F3SA 2HU2A 1KEVA 1Q2XA 3QA9A 1DIBA 3WJAA 3EY4A 4RVDA 2FPGA 3HZZA 3W4JA 1SNYA 2X0IA 3JQ7B 2ZCUA 1KOLA 3ON5A 4GGPA 4R1TA 5AXCA 3QV1A 1HE2A 1PZHA 3INGA 3W1VA 4WLEA 4CLOA 4XGIA 3ZU2A 1YO6A 4BGIA 1CQJA 5HS6A 2DVMA 5LDGA 5THKA 2VUSA 1GV1A 1Q0QA 1ZIDA 1UXKA 4PLVA 4PG8A 1IL0A 3E8XA 4RLHA 3ZWWA 1GPDG 1UXGA 1K89A 5C7OO 4RVSA 4WK6A 2W90A 1ULUA 2EERA 1OOEA 4R9RA 3D4PA 3ZU4A 1H6AA 1YXMA 1T4DA 4OMUA 4B8ZA 3PJFA 4GH5A 4RF4A 2O48X 3QWIA 2W2KA 1GADO 4ZQFA 3JQFA
chains in the Genus database with same CATH superfamily
2PWAA 4P1ZA 3PGA1 2K4MA 3V1KA 1BXZA 4A8JC 2H63A 1X1AA 2ZFUA 3VPGA 4AY2A 5BQFA 3T5AA 1NQVA 2XKAA 4N65A 3TG2A 4NENA 5GGYA 1BTOA 3KK0A 4YJHB 1CR6A 3SN6A 3PDWA 3JTEA 2VBIA 1K6XA 1E5VA 1UWVA 1JIQA 4TQ9A 4B3IA 1VJ0A 4JA0A 4EHKA 8OHMA 3DCNA 4D6XA 3T3EA 5EP2A 3EH2A 4B09A 1VBNA 5BYKA 5CCEA 1REQA 3JQEA 4N0EA 2BHTA 3TZCA 3HJGA 2V45A 1YDHA 4MUNA 4URUR 3GT3A 3NXSA 3F7NA 2CZQA 1O6BA 1U5CA 4HAWA 2IUYA 4KI0A 1W88B 1HUQA 2IYYA 5CLQA 4EQZA 4Y2XA 3KAQA 3E5HA 1YMUA 4DMLA 4Q4AB 2QA5A 2Z2ZA 2W8BB 3ZW9A 2VP9A 1E7RA 1O96A 3OOYA 2COKA 3RTGA 4J6EA 1JEYA 2CXHA 4IVNA 5F9MA 3H05A 1ETHA 3AI2A 3HVHA 3WLMA 1GG9A 3ZXIA 4DJEC 1T8RA 3GEPA 3EG9B 1QGDA 3AETA 4UPVA 1E18A 4MVJP 3OMWA 3TF5A 4PTLA 2Z5VA 4MWSA 3ESXA 2R62A 4BMSA 2I66A 4WXRA 4V0OA 1CB0A 1XEFA 3WWEA 5KSYA 3B1FA 4TV9A 1WHTB 3G2QA 5I9TA 4OFZA 1CF4A 3GGOA 1MTOA 2JAWA 2ZYSA 3LO5A 3JVUA 1EM8A 1HZZA 1PJ2A 3EZGA 3FCSB 3GLVA 3I45A 4M1YA 1ZESA 2P2LA 4N7JA 4U5XA 3WKBA 5B7PA 3KQYA 3NI2A 1IVSA 1LDYA 4DLLA 2OTCA 5J2TA 3H1GA 1ZH8A 4N76A 2I1LA 1T0JB 2QT0A 4O2AA 2AE1A 5TT0A 4JCCA 1K68A 2PGXA 2WK1A 2BBSA 3ANNA 3EZFA 3SHOA 2WHPB 1Y3IA 3SKXA 3WMWA 5CYGA 3DD1A 1Z33A 5IVKA 1FIUA 2Z0MA 2J3LA 1MX1A 1LPBB 4LCBA 4UKDA 5EL0A 5ALWA 1TUBB 2VT3A 3QWAA 1WKBA 1FCJA 1ZITA 1HBJA 2QVGA 1UMKA 2A1UA 3PR2B 4REMA 3RI3A 3ZOKA 1GTSA 3JQ6A 5F1KA 3DCIA 4EHLA 2QVXX 3QVKA 3TW6A 1U04A 4ZI7B 1SOUA 3LHSA 1A5BB 3FUUA 1FYWA 4DJFC 4DQVA 3I2YX 2A6PA 4HTFA 4Q47A 3V2GA 3Q41A 2Q4EA 5LJLA 2ZUEA 3A3YA 1KK1A 4M87A 4LRXA 1Z0ZA 2QZ4A 3WDMA 4FFMA 1YFJA 2RAFA 2D06A 5A1TA 3QELA 1XTVA 3A8TA 3VYSB 5JSKA 1N2CB 5A9TA 1MG5A 4XR4A 4Z9BA 1AUPA 1Z4PX 1X13A 2HQBA 2ZB7A 3JTMA 2RKOA 1PT5A 3BZBA 1ZI9A 4Q0MA 5J4YA 3S1LA 4TL9A 5D3QA 3BZUA 1MRZA 1J24A 3LWBA 2ZRIA 3MYYA 5A7HA 3RAPR 1VC2A 4XEUA 1YR1A 5EJAA 3THOA 4AZVA 4BJ1A 1E2IA 4BKQA 4EY6A 2IL1A 2OFFA 1JR2A 1H0SA 4L76A 4V39A 5AHXA 1Y6QA 5BYJA 3ZJYA 2IYVA 1TTTA 1NVAA 1GTJ1 4QHYA 3ZEIA 4DNQA 4MWEA 1VIVA 3SYNA 2O2XA 1C3LA 1XTUA 1ZI8A 3PNLA 4GO1A 4OI4A 1OAAA 2GSWA 3WA7A 1FW8A 2ZSAA 1EDBA 1GKKA 3BEOA 3LVRE 4MJXA 1E69A 4JJGA 1ATZA 4MWGA 5HRAA 4PGAA 1CRPA 3LWZA 3PV0A 3OJOA 2EL7A 3E9CA 1ZYUA 4QTUB 3VC3A 4Z4GA 1G3RA 1WBJB 3M5DA 3FVVA 1SCBA 1WMEA 5DTIA 5E6SA 3T35A 4EKNB 2Z2JA 3P94A 3G2JA 2Q9AA 2M6RA 4Z4CA 3PVZA 3QKUA 4PG7A 1J2TA 2MHCA 2B37A 2HIAA 4R3UC 2EQ5A 1JW9B 4EG8A 2BFFA 4YUXA 5C9ZA 5LLDA 2JGDA 3ZGVA 3SEAA 1WUHS 4QG7A 4UJ3A 3KHTA 3U4AA 4DLNA 4KHPB 1SHJA 3T1TA 1QMPA 4E6PA 4Q5IA 5K0ZA 4OQYA 4EB6B 4R6XA 1J2EA 2I0FA 2JEYA 5TARA 4UNRA 4D97A 3FZEA 3QKRA 5EMHA 1M8JA 3UMBA 5EXSA 3ZR4B 4EG4A 3DNPA 2XB9A 4DFDA 2CXQA 3NUGA 3RC9A 2WFAA 1QX3A 3PDJA 4OB8A 1D6MA 3EA0A 3A06A 3KB6A 3P97A 4KH0A 4L3VA 5FL3A 1E3MA 4JODA 1NW8A 1TF2A 1TT5B 2QSUA 4K28A 2QTWB 1QCYA 1TU3A 2Q4OA 2JBHA 5HE9A 2ZI5A 2D62A 1U7UA 2HLHA 2JAHA 1N9GA 3AV0B 3EF1A 1R8QA 1RZ3A 2W9XA 3G8BA 3K0HA 1ZXXA 4X65B 2FY8A 1TM5E 1XZNA 3FYUC 3L7MA 3O38A 1H23A 1FEZA 3E8SA 4WL0A 3SNKA 4BNTA 5JCJA 5JC1A 1IU9A 1N6LA 1XLUA 5CA1F 3WQQA 2P5YA 3OT5A 3PT5A 1MVOA 4BY9E 1JL3A 3IAM1 2OORA 5DCWA 1PSDA 4UNQA 3L1HA 3L04A 1FU8A 2OHXA 3L7OA 1E4EB 2XYHA 3W9BA 4BVJA 1J39A 3P5BA 4YUAA 3ZWDA 1JKJB 2VA9A 3I9OA 1G8MA 1XELA 1RJDA 2Y67A 3YASA 1JBEA 3LU1A 3AVXA 1MW9X 4UXIA 3VYUB 4RLQA 3ZCQA 4QECA 3KAPA 2PL9A 1XQ9A 5JQGA 5EZ5A 3P2YA 3E1KA 4Q4JB 1SIWA 1DQRA 2I54A 2P79A 4B7ZA 4KPEC 2HUNA 2BI7A 1QQBA 3GGSA 4RK1A 2ZJ7A 2UYYA 1QORA 1LZLA 3QJGA 1I4EB 2WVHA 1L4FA 5FL7A 3UMJA 2GN8A 3C7DB 4GU5A 4K9LA 5D5HA 5AKKA 5BOSB 4D3DA 2QBYA 5JH7B 4GOOD 4M76B 4R7TA 1DX4A 2CW5A 4WVLA 4YRPA 2GKOA 1O5OA 4GPAA 4M1WA 3O90A 1EVQA 3SDSA 2J4DA 2JGJA 2NO0A 4O4LB 3MILA 4L8YA 5ALJA 1PP4A 3FTPA 3BXEA 1JDVA 1UBUS 4GEGA 5FHQA 4BBZA 5C18A 4YJGB 1S1CA 4GXTA 3BMOB 3VHXA 1YS2X 3UVEA 4S35A 1RHUA 2MSWA 4PO3X 2PV0A 2FG6C 5FUYA 3SXUB 1EFAA 2X0EA 2FKNA 4P5EA 3AVYA 1JILA 4IRMA 1ST2A 1R7RA 1VMEA 4RPJA 3S2EA 3OBIA 5DGIA 1HF3A 1QO7A 4B7AA 2G40A 2GNOA 3DBRA 2HHCA 1QH1B 3AFMA 4IG4A 2ZETA 4E2FA 1P8JA 3DONA 4Y9RA 1PTJC 4QBTA 2ZKLA 4KE9A 5CFNA 2NZYA 4MUYA 1T24A 5HKKA 1AKQA 3DEFA 4XD2A 2W6ID 4ER7A 1ZNQO 2FKAA 1HQYE 5A3VA 3B13B 5JLJA 2ECPA 1T2VA 1ZNWA 4IIYA 2Q3JA 1R4MA 3PR1A 2O0JA 5J4VA 4Q7QA 4OQPA 2W4MA 2FPGB 3LUGA 2FXVA 1WMSA 2PVPA 1GZ5A 1HRKA 2VDMB 1UODA 3HJAA 3IQFA 3GZNA 3I6BA 4H7KA 1WPGA 4UULA 2O0MA 4ZOLF 2ZXFA 2Z58A 3PUZA 4M1KA 3KPVA 2ADOA 4ZO6A 2VNSA 5SICE 1YGYA 3JARB 1DPGA 3TTWA 1AN9A 1EINA 4P58A 3FZGA 4D8TA 4MGZR 4TXHA 4NJEA 4HWPA 2DQSA 1XYVA 3MMSA 4B3JA 2V6BA 2AB0A 4L6AA 3LPLA 1RYMA 4JFAA 2XJ9A 1CJKC 1DEXA 1M1NA 2RH9B 3OC0A 3K0EA 1QHFA 4KAXA 4Y1GA 3OOWA 1OZAA 1R4NA 3VKWA 3W9YA 4ETMA 3D4NA 3SFVA 2QNRA 5FOVA 2BGTA 8AT1A 4P4TA 2O8CB 1I6KA 4KXLA 3I6IA 1A9QA 1OIWA 5L4SA 4RX1A 3O9ZA 3T4XA 2J5XA 4GUAA 4W1PA 4QM7A 5B7QA 3KPYA 3JD1A 3AEQA 2RGGA 3LUDA 4HDNB 3UT5B 4WBNF 5E9QA 1X6VA 3PEFA 1XAHA 2X2PA 2NZ2A 3IILA 2YZ7A 3UF0A 1NSTA 4U8GA 1E1YA 1EFPA 1ZM7A 4C4YA 1R0SA 4LV8B 4LZZA 4YJ3A 5K3FA 4XA8A 1HE4A 1CJUC 1L8XA 1WCV1 1JE0A 1GCOA 2G07A 2XUQA 1KZYC 5LOVF 1C1HA 4UOEA 5KB3A 3Q5EA 3W5JA 2OCGA 4FDTA 3MJVA 3LL7A 2YCBA 1M3SA 4US1R 4BNIA 1R4AA 1UEIA 5TR9A 4ACAA 1M33A 5SZHB 2IU0A 4CF5A 1KI1A 1KBOA 1PUIA 2V9CA 3CTMA 3L82B 3LC1O 4DCTA 1COZA 3KKKA 2PYIA 4LWZA 2BL4A 3DL4A 4CLEA 3BK2A 3PFHA 3CINA 1YRLA 2NSYA 3THYB 3UZUA 2D5BA 4O4LA 2QP9X 4Q4DA 4DQ0A 3AHJA 4P84A 3UJ9A 1DJNA 2XW6A 2ZUDA 3MNFA 3NT4A 5EWJB 4F1KA 4FUTA 4AK9A 5BVHB 2CYBA 2CD9A 5K09A 3ZJTA 1LS1A 2DG2A 3H13A 2JRCA 2O7NA 3BIXA 3A14A 1GPH1 2I7VA 5IJ0B 4DV3B 3CUYA 5EIOA 2UZ4A 4EA9A 2P9CA 1I2CA 5E1BA 3V8QA 2I2CA 4F21A 4HXGA 1VIDA 2J1LA 5KOIA 2V5AA 4BRWA 1IZ9A 1QVZA 2QHXA 3IMCA 3L8CA 1OJLA 3OCVA 2P35A 4M54A 2ROQA 4RYLA 4BJ5A 4D45A 1U28A 5CH5A 3TTXA 2PAFA 1JTFA 4EMTA 4CKYA 4QPDA 2P2CA 1TAQA 1AKEA 2V3CC 1T8YA 2WICA 4MVXA 1TVEA 2NV0A 4OSPA 2WHPA 2ZBPA 4JSTA 3D7RA 1LD3A 1SCUB 1P81A 1VKZA 2QSJA 4MQFA 1OGYA 3R2JA 4Q7LA 3T7CA 4NCAA 5BVHA 3BJEA 2HMTA 1UKVY 1W87A 2LKDA 3EGDA 4UBLA 1KK0A 3G0GA 1XCPA 3B1XA 1NQAO 2PKQP 2Q0QA 3ZD7A 3FWKA 5B7GA 5I7SA 3BMQB 4XYGA 1K97A 4FE3A 4I2VA 1GDDA 4MNTA 5ARDA 1IRXA 1BZYA 3ROKA 3RIYA 1A2QA 4P82A 1MPTA 2O2EA 1N2OA 2JLCA 4GHWA 4CKCB 4FBGA 4Q03A 4GOLD 2ONKA 2AEMA 1KVSA 1SVWA 2BKUA 1V6CA 4JXJA 4AKSA 4L3OA 2XSZA 4CVNA 1SUWA 2R0QC 3IR6A 1PQPA 4IXMA 3M33A 1USIA 2R9VA 4QOIA 4UHEA 5FYDA 5AK0A 2VHXA 2CF6A 3O74A 4LZAA 4OQQA 5E6RA 3U31A 3EVZA 4KIWA 4QPJC 3DLCA 4AN1A 3PX7A 4P0QB 1TE2A 4TM8A 2DOKA 1ZGBA 2CHFA 4HMQA 3KLMX 5CJJA 5T57A 3ZV3A 2QRLA 4F2PA 3MLBA 3AX6A 4TRNA 3L0SA 1SWWA 1UP4A 4C7MA 2ZRFA 3QU5A 1HEYA 1O95C 1U7OA 4NLLA 3ZPXA 2J3KA 3HADA 2PTGA 2ZJ1A 1KOJA 2PSSA 1W4LA 3QX7A 3THWA 1UBMS 5JD4A 4AECA 4R8SA 5AI5A 4ARSA 3IVAA 1XJWA 4LDRA 5DGDA 4NNPA 3ROFA 1JSZA 1IWOA 4RKEA 3LO8A 3L8GA 3N70A 4JYPA 2ZTVA 4Q7MB 1OWOA 4G5OA 1U8AA 1E2MA 2C3OA 4D41A 4DHEA 2OENG 3OCJA 4IDOA 4LHYA 5ISMA 4B6SA 3GRVA 1DBSA 1X8JA 2F8LA 1NYTA 3TE7A 4IPTA 1U7TA 4HF7A 4WACA 3T1VA 2HDHA 2EG5A 1XNJA 1ZKMA 2PKRA 4ZYWA 1NU8A 3FZQA 3OLVA 4EG3A 1ZUNB 1DGQA 1R4ZA 1IWBB 1E1QA 2PYDA 3AI3A 1BMDA 1P1HA 1UFQA 3ETHA 3FPBA 4RVFA 1S8AA 2DM6A 2NUTA 2QJFA 4XB1A 3T7SA 1Y3AA 1M2WA 3HO6A 4U2FA 5AHRA 4CM8B 1I3OA 1WXGA 4EX6A 1AO3A 1AZSC 1D2NA 2I55A 4ZEOA 1I8TA 3A9CA 2FPPA 4J1TC 3DGFC 2EEZA 4N6GA 3M5PA 3P4XA 4LRSB 4WMLA 4CGYA 5DHAA 3K5WA 5DLYA 3QX3A 4KQKA 2H1SA 3OEWA 3C7AA 3VR6D 3R9XA 2E49A 2PMKA 1V2HE 3ROQA 5DI9A 4W8OA 2ZJOA 3GFOA 2ZE8A 2XDQB 3B9RA 3TAHA 2C7BA 1HI9A 1CJTC 1OI3A 3ECCA 2FUNB 3PYXA 4LPSA 4BP1A 5CB6A 2XTNA 1VLLA 1YRBA 3VHRA 1PKEA 3NAZA 1TIKA 2VXBA 2XUFA 3F6PA 4FLFA 1PG2A 2NIPA 3NCHA 4WUTA 3K1TA 1WF3A 4ZOLB 3ETGA 3VAYA 4ZP1A 4JQZA 3SJCA 5GGXA 2DCMA 2P4SA 3WNCA 2IQ5A 1KMIY 1RNLA 1PL0A 1ZXLA 2A9JA 5B4UA 5BV0A 1E1NA 1U1DA 4MO2A 3HCOA 3H9BA 3NBZC 3WWDA 5LOVB 1X2EA 4KN8A 2A94A 2XE4A 3TBFA 3MFQA 3VX4A 1AJEA 4L2IB 2GM3A 4DRZA 1GPNA 1UJ6A 1C7RA 5LXTF 3VO9A 5YASA 4YCAA 4CLHA 1WJGA 4HFJA 3NASA 1XRQA 2HGZA 2ZRDA 3JQRA 1H9AA 2M32A 3N05A 2Q5EA 5CX1A 1B74A 1IULA 1YC2A 3LVBA 1VE7A 1MW8X 1ECBA 1QJCA 1DRWA 2HQ1A 1NUHA 1EBBA 4ME6A 4PGGA 3O0DA 5LSAA 1AQYA 2IDMA 4BKOA 2JJQA 2WFLB 3RS4A 4RIIA 1HFEL 3FKQA 1ACLA 1RYBA 1CRLA 1PV4A 3N6VA 4ZT4A 1NW6A 3GLRA 3ZU5A 2R1VA 4MIOA 4GE0A 3OFVA 3OM1A 3LVFO 3D8UA 3TQRA 2YCLA 3FPSA 3IERA 4UUOA 3CLKA 1EK1A 3TOCA 1FYVA 5DM2A 1WDKA 3K9BA 2HEGA 1F7VA 4XGKA 4JS0A 2EX4A 2JFZA 5AJTA 4C04A 4E30A 5K20A 4MS4B 1GL3A 3VNVA 3LTNC 3KXIA 3OQ1A 2WU4A 4AZ3A 1II0A 2XV1A 3B3QA 2DWUA 3BB1A 1RR6A 2RHWA 4S1OA 4OJKA 4Z86A 4BUCA 3NJ4A 4DBLC 5F78A 5BSVA 4HB0A 1EFKA 2CF5A 5JTUA 4AKHA 2IYAA 4FGLA 1OFTA 1X1EA 4JT9A 4MW1A 5CNJA 1P2GA 2WF6A 4C6SA 4KQHA 1OKKD 1IN5A 4EWLA 5ES3A 1OZHA 3K16A 1HSZA 1A8QA 2BCJQ 2XHZA 3FFWA 5BQ3A 4KFUA 3E5MA 3MMNA 5A9RA 4EI7A 2MR5A 4KR7A 1EP1B 1UEXC 1CVRA 2BEWA 4JOBA 4P0PB 2R25B 3AJDA 3RRFA 5IU6A 2XCSB 2HPZA 3DZ8A 4NV3A 1QAMA 2D00A 4Q3OA 4UZFA 1XJQA 2B69A 2QMOA 2FN7A 3GEEA 4TKUB 2JGLA 4BQRA 2VYVD 1EUDA 1UBFA 4YYEA 3HDHA 3ZVKA 2BGIA 4WCFA 4I14A 4A2QA 1UADA 3LQRA 4RV5A 4JH0A 1SGWA 1CP2A 4KQ1A 4G89A 3RK0A 1CS0B 4GPBA 3TNLA 4TTPA 5E3HA 4E5VA 5LZ2A 4TTSA 3KZXA 3BJIC 2N1BA 1BFUA 1BWQA 1N6KA 4N6NA 4WXYB 5E1OA 1NAIA 1TGVA 2F43B 5I5GA 5IH3A 4KJZA 3QWHA 3SYKA 1GDTA 2OV2A 3KUXA 1JFFA 5L3ZA 4BLPA 3M2PA 4LMBA 1PK8A 2CFSA 2I3AA 3RVRA 3VO2A 5JH7F 3KJIA 3CLUC 1D9XA 4QELA 4PG5A 4D7AA 1ULBA 1C7ZA 2XMGA 2Y9PB 1ZVVA 2V7VA 2X8BA 2YBDA 3CX6A 4PS1A 3DT6A 2XRZA 3GLKA 3BD8A 4GZ5A 4F72A 1XXHA 3WXBA 3OD5A 2JZNA 4B9AA 3H8WA 4DJJA 2H4JA 2FMIA 4NP6A 5KJCA 1E79A 2PQ2A 3ROMA 1B0AA 1KAQA 1HYGA 1QRTA 1BD3A 1XZFA 1Z25A 3HDYA 2Q2OA 2ZULA 3NUZA 4QRHA 4U0JA 1BFKA 2IY8A 4ID9A 2M6LA 3TLBA 1BS1A 2XRMA 1D03A 3PZRA 1P2UA 1PFGA 2IPXA 1DRKA 2QX6A 4RULA 5AW6A 2IS1A 3S0JA 1D1PA 4QARA 3FOZA 1VA4A 2WJVA 4BKUA 4ZDKA 3CB2A 3ENQA 1CJBA 4M53A 3ND8A 3B2NA 4X1KB 5EVCA 4PN3A 2PZFA 3I37X 4PNEA 5DU2A 5I47A 5IC6A 4TLEA 1L5HA 6ABPA 1RWPA 2A33A 2J4FA 3FGZA 1RBZA 3PGXA 4WY2A 3I9NA 3VC7A 3E22A 4HNVA 2IYEA 1ZCAA 2JKZA 2HRBA 2NUPA 1R8JA 1TYBE 2CEKA 3PDUA 3GHHA 2Q0XA 5T4BA 3WIDA 2R7AA 2XYRA 3D8RA 1GAJA 3U0BA 3OIVA 2XJ4A 1ZH4A 4YDHB 3WLHA 1QYXA 1U4OA 1Y5MA 3N2IA 4QVKA 5CIWA 2JLXA 3H2ZA 4NKRA 3WIBA 1O1YA 1NQUA 1PLJA 3EAFA 3PDIA 3WNVA 4LWQA 1G7CA 4CG3A 1V1RA 3E9DA 5J5CA 1R6XA 3UMSA 2A0YA 1H1LA 1YHNA 5LKAA 1E2BA 4JUDX 1XD8A 1K4YA 2ZBGA 4W9NC 2EOAA 2IIQA 2KSQA 4OUKX 4FMPA 1EHCA 2MDTA 5TPWA 5H02A 4H7IA 4CM1A 4FDMA 2EIXA 3ML1A 2WSBA 3CVWA 4Q21A 3IQXA 3VTAA 2AOTB 1KRHA 3SC3A 4YT8A 5BN1A 5J4HA 4M6WB 4KN9S 2BFMA 3ZE1B 3SMQA 4EENA 4P32A 3NR2A 4MOWA 3ZNOA 4HDKB 1NFFA 5T3YA 3LUPA 5JD6A 3ZZ1A 1KMQA 3V4VB 1XU9A 2Y2VA 5FULA 1EJ0A 3TW8A 1UZMA 4CNQA 3EVCA 1E61A 2BCEA 3INRA 3LFUA 2G06A 1SBQA 4TWAA 2QN6A 4YH1A 5MF6A 4LJRA 1RKXA 1E6CA 2YBEA 2ZIXB 5FX2A 3QLVC 1OYOA 3O8LA 1N6OA 1UZAA 1KQNA 5CDUA 1KEZA 4D92A 3ORQA 1U0HC 4FSDA 3A32A 2HR1A 2QX4A 1DWPA 1EVKA 1Y1PA 1Z56C 1XZLA 5AH0A 4CTOA 2DSNA 2ZIAA 3OU6A 2OCDA 1LSSA 1GZ6A 3S68A 3ILYA 3SAJA 5HKBA 2MOKA 5KVAA 1CS0A 1WW2A 4OHWA 4JKOA 4WHMA 3QMWA 5E7MA 2RBKA 3TXYA 5JNSA 4G5QA 4D25A 2FPUA 1MR3F 3EXFB 4GAEA 3OQBA 4JZYA 5IAJA 1C29B 3MWEA 3LK6A 3GEMA 4EKGA 4F11A 4XAQA 2QUIA 5GOZA 3CVUA 3LZDA 3DWEX 3WGNA 1YZUA 4N3CA 4WI1A 3JVVA 3LT4A 4OLJA 3GR6A 1AK2A 2J9ZB 2XKJE 1VJCA 2WHRA 2XCUA 3B6IA 3P0EA 3U39A 3KQHA 1Z3CA 2IU3A 2JIPA 4C29A 4C0KA 2OCAA 1VL6A 1N4DA 2QD5A 4FS8A 4OHMA 1QQTA 3EFBA 1NXPA 4ICIA 1LCIA 1VIAA 5JJCA 3IE1A 1BDHA 2AF3C 1E9BA 2RCYA 3BMCB 2C5FA 2IYNA 1YDMA 1U8UA 4I50A 4UM9B 3ZIAD 1EUCB 1XG5A 1W2HA 2NU6B 2J9FB 4UEQA 1FPMA 3NDRA 2CFOA 4UHDA 3C85A 2EIHA 1QE3A 2RGAA 4F97A 1JAIA 5GTDA 2JLUA 4V0LA 2FOIA 2NUAA 4OQDA 2YC4C 2A9RA 4QREA 5LP1A 1I3MA 1W49A 2VQDA 4BECA 3TFQA 4WJKB 4V1CA 4A73A 2P4EA 1F2UB 3AVPA 4LJ5A 2R5WA 3KSUA 4IQ4A 4OB6A 1P0MA 5P21A 3THXA 2PGLA 1FMLA 5DLPA 2FZLA 4W9NA 2AKAB 2XZDA 1J8QA 4KO8A 4ISBA 3ILXA 5DSXA 5T7BA 3A4VA 1BU8A 3K5IA 3I9MA 3EWAA 4C0QC 1CUBA 2H3HA 2XBLA 1ILWA 1IDN1 3C3WA 1G3IA 4WNCA 1MAHA 5EXDA 5BURA 1O8BA 1XF9A 2I9KA 5E0OA 3UOAB 3T52A 3MD0A 1KDZA 4B6JA 1ADJA 3DDUA 5F7ZA 1H85A 2D59A 4HAUA 2I91A 1TA0A 4M4SA 4UCXA 3DCJA 4H1WA 3JQQA 4HVAA 2H85A 4ZVUA 2HBZA 1FFSA 2C04A 1VZ3A 3I2HA 3T34A 5BUSA 5CLFA 1EZ1A 1TZ2A 3KWJA 4G4SP 3N8DA 3QPUA 4MMXB 5EHGA 5AW3A 4UZSA 3VKFA 2FRDC 2QB5A 2BGWA 5IZCA 3WYNA 4XX1A 3X1ZA 1A7JA 1P62B 4I5GA 4JC5A 4YLEA 5I9MA 1GNTA 1NUAA 4G6ZA 1POXA 1FZTA 1EWTA 3IUQA 2PSDA 4ZCQA 3TNJA 2HWYA 4NXNB 5FB3A 4YWJA 4R0MA 1CQPA 5FT9A 4HY3A 2QMEA 1KNXA 2H31A 2C7VA 5FLEX 4UEOA 1L5MA 3BAZA 3NATA 2AD5A 1KEKA 3FDJA 1KRWA 1GQRA 1OIXA 1KSHA 5EWJA 5FTMA 4MRVA 1GKIA 2R7KA 3QVVA 2C7QA 2CGEA 2BN4A 1JEEA 1U0SY 1XAGA 4G5SA 4EF5A 1PWYE 4EYEA 3K0AA 5E4TA 1HQCA 3D8TA 2UZ1B 3TZQA 1L4HA 5HM8A 4JAVC 4AYWA 4LBZA 4D9CA 3TSAA 1SXPA 3BE6A 4W8GA 2FLVA 5AOBA 1BWPA 2GYYA 1PUJA 2GJSA 2I2WA 3LX6A 2VJMB 3AJ9A 4XD7D 4UU0A 4Y2UA 3VVLA 3W8FA 1DJPA 2VKQA 2WSIA 3ZQUA 4ENVA 2I3ZA 1H0RA 1ZM2A 2XAAA 4TT8A 4CEJB 3NRBA 3GY0A 1PJLA 3SU8A 3DFUA 4E21A 3O73A 2I22A 2NGRA 4K9NA 1JFTA 1XC7A 4M9ZA 1YNOA 1U0TA 1KSFX 2ZUTA 1HR0B 1LS6A 3TBKA 2YWBA 3H11A 5IM5A 1G7SA 1IONA 3UMYA 1SUDA 1MB9A 1OMOA 1R0KA 2YWGA 5FPTA 2FRVA 4PC3A 5LA6B 1QR6A 2R47A 5EP3A 5C8ZA 3NNSA 5KWIA 2GF2A 4YO7A 4G23A 4ZDWA 4QNNA 3TNFA 5HF6A 4DAOA 3GVPA 4WVFA 1KBZA 4CUKA 3DYVA 3T5BA 3V48A 2WZBA 2AOWA 4HOYA 1TK3A 1YL7A 4Q9LA 5AVJA 4K6GA 5JPIA 4G0PA 3L05A 4E07A 5LQMA 4MR8A 2QD4A 5COBA 4V38A 1DQYA 3L4EA 2VAXA 4HWTA 3DZGA 1SUCA 3TPFA 4EA8A 3PIRA 1QHXA 4C3ZA 2FMUA 3PZBA 4Z0TA 1JE1A 1K6IA 4ERXA 1M7GA 1ZI6A 1SKYB 4FKMA 4IIEA 1Y82A 4PCLA 4I9NA 4YRTA 1BMFD 1BS2A 4BP9A 1SXQA 3B82A 1I2BA 2VAWA 4A9AA 1VOTA 1PZMA 1QGUB 4I9HA 2X40A 2P6RA 1XKLA 3CZMA 5EZSA 2GEVA 3W5CA 4UCFA 1E98A 1RWOA 4BUZA 2H5EA 5HZHA 3K8QA 3QLJA 4FFOA 3IKJA 2XTZA 2PZEA 3T94A 2VK1A 3QY9A 4G0XA 3MUFA 2XZPA 4LV6A 2A8YA 4D56A 3GGDA 3O31A 2BHRA 2RJ3A 1RBYA 1J5PA 4LJLA 3CYFA 3H5VA 4IWXA 4F4IA 5HGXA 2QE7D 4PR0A 2H5IA 1ZK4A 1L8OA 4RK4A 1C0LA 1NP3A 1VPEA 1Z7EA 3LL4A 4O4IA 3TOSA 1CP3A 4Y7CA 3UYLA 4LQ4A 1WUIS 1YBFA 3QE4A 4H4EA 2ZJ2A 3BBPA 4F0JA 4YP7A 3CSSA 3ZXUB 1Y3FE 1HURA 2WEKA 2IKQA 3AK4A 1AMUA 2H2DA 4HGPA 2GXSA 2C1EA 5BQ5A 1ELOA 3ONDA 3PA8A 4LRQA 1L5GB 3SM9A 1JEAA 2XMBA 4S1TA 5KTMA 1LSJA 3CZQA 3MCVA 4OFWA 2HV8A 4YREA 3PKIA 5B58T 4EATA 3E58A 4RIHA 2YS7A 3MK31 5LMCA 3NG1A 3GFBA 3P0HA 1PBTA 3G9QA 4V2UA 1E1CA 4RDIA 3KYCA 2CLKB 4L9RA 5ERGB 4AKEA 2O8FA 5ALEA 3ZCPA 3KYBA 1GTVA 2JAOA 4HQOA 3LUJA 4UU7A 4D3SA 2Q1YA 2Z98A 4REQB 1HETA 4C3OB 1ZQ1A 3O1HB 5AESA 1C30B 4LRYA 1GD1O 3QE0A 4C20A 4MGEA 5MGNA 4CV1A 1S2LA 3F5QA 4JI1B 2VK8A 4BNVA 1VG0B 2QM8A 3G79A 4MW0A 1Y3HA 4PFJA 2CJFA 4L5JA 4HTAA 1GYQA 1IY8A 1VP9A 2ECQA 2Q4BA 3L1VA 3O8OA 4PV7A 3EXAA 5FJJA 3O93A 2VF4X 3L06A 4KFSA 1AN0A 4OJNA 2EGGA 2X22A 1HORA 4QOEA 4YJ2B 5AKXA 3WY9A 2LPMA 3HB7A 4K40A 3CLRC 3CJQA 4M8KA 5B30A 4OHOA 3EOBI 4BCBA 1XL1A 3G8DA 1X15A 4Q93A 4CE6A 4CEIA 2PLWA 1ULTA 2ZRJA 4WXEA 3RWBA 3W79A 5JNWA 4WK0B 4PCAA 4JIMA 4QTXA 4BGEA 5HIIA 1ZD4A 2AJDA 2WP8J 3MMXA 4NS4A 4OP1A 5DW0A 5CFLA 1GUAA 4ZKEA 2ONYA 5F1PA 4Y1FA 3DZHA 1K8YB 2GM9A 4ND8B 2WWRA 4JI5B 1QHHA 1VKNA 4Q1VA 4G56A 5CYOA 1S2OA 1BD4A 1GG5A 2GAIA 2MTBA 3KT0A 1S01A 1BDBA 1J0BA 1RP1A 1D0SA 3RT9A 1I2AA 5I4KA 1TKCA 2IPAB 4OSEA 2GTHA 2ZAOA 3WLFA 3BFJA 4JT2A 1THZA 4KIUA 3FLBA 2XUIA 4YR9A 1BMQA 5JJKA 4KMSA 2REQA 4LIPD 3DMDA 4M83A 4RZIA 1TO6A 4G0YA 1A7AA 2GN1A 2ZPAA 4AU1A 2K5UA 2X58A 3UWOA 5EJ4A 4IP0A 3B6MA 3PHLA 4IIUA 3KQOA 3BTUA 4RKYA 3O1LA 3HS3A 1CDEA 3NUQA 3U37A 4CM3A 3L77A 2IZ0A 3G1WA 1Y42X 3K4PA 1XF1A 1Y8RA 1H66A 3NCTA 3O8DA 3ZXYA 1I2ZA 3I0MA 3OZVA 2IV3A 3ZCUA 1SUEA 3GH1A 5C80A 4LYDA 1NBMA 1KMCA 2CVQA 2NXJA 2VQ3A 3GJ7A 3NGXA 1HEUA 3UAOA 4IINA 3ZQ6A 4PY2A 2OECA 3FNFA 4MQMA 2PFKA 2Y1OA 3NWPA 1TM7E 5EE1A 3RTDA 3CWZA 2IW1A 4TX1A 1GZVA 4ZXFA 4MI1A 1TCUA 1NLYA 1N9ZA 2XUOA 3DAHA 5LYYA 5BXQC 4MGIR 4XLZA 3W6UA 2OFWA 1Q0PA 4YRQA 1HNWB 2CLFB 3I4LA 3DLBA 5IMBA 1NURA 1KQOA 1G8YA 1Q14A 2R6AA 1DIGA 2FVXA 2FW8A 1KY5A 2ANCA 2WP0A 5IANA 4L8WB 1YCDA 5EEHA 4RKQA 1VP3A 1W96A 4QQFA 4BU1A 3I6QA 4A0HA 1A4XA 2BEUB 1SEVA 3RG2A 1E2JA 1W9HA 3S2SA 1MPXA 1L0BA 3JYOA 3MIZA 2ZRAA 1I7LA 3UN1A 4J3JA 3VTKA 4RXUA 2I03A 4BEBA 3TCXB 5DM4A 3FNEA 4TMZA 3HYTA 4BEWA 4EKDA 4C87A 1CIVA 2H6EA 3IODA 1ODIA 4AN0A 1N9GB 1DO2A 1T5DX 4KAJA 2JAXA 4P80A 1NC3A 1GQSA 3C74A 1NSFA 4FHDA 4FMDF 1RD4A 2OOKA 3WGZA 3OPVA 5JWHA 2PXXA 5LC1A 1W85B 5CHEA 3C6XA 3VYRB 1NR7A 1ZD1A 4IAOA 1Q44A 3DBHB 5EKXA 4FOLA 5T8KA 1E4YA 4E5YA 5JDCA 4NR0A 1OX6A 2BIFA 1CJCA 2G5TA 2VHZA 3PUYA 3Q1KA 3VR4D 3G2MA 1JLLB 1UJBA 3O4RA 4ZYTA 4I55A 1GA6A 1YNSA 1Z4JA 3GLSA 3VYWA 2Y8EA 3DDNA 4DYHA 2QYTA 2VHUA 3PPVA 1C5KA 1P2SA 4YAFA 4B17A 1YFKA 1WEHA 3HL0A 4F96A 2XDAA 1YULA 2O6HA 1PG0A 3EDOA 4JJ8A 4ALJA 4AKGA 2ZAGA 1XKXA 3LUHA 1HK7A 2SBTA 3AY0A 2YOHA 4UW9A 3E18A 1PFKA 3WYDA 5DM1A 4E0BA 2WF9A 3ZY5A 1NF3A 4P9NA 3V8MA 5JNLA 1ZN2A 2R8RA 3IL2A 4P2GA 3HVKA 5FYQA 3ZH9B 3HI6A 5FBLB 4YCCA 3SEFA 4QA9A 2EWWA 4DN6A 3RVNA 2CHUA 4P4UA 4ZRMA 5BWCA 1N0IA 2H8GA 3I39X 3Q87B 2DX7A 2XA2A 1RWWA 2RDMA 2X8LA 2P5TB 3TLGA 4ARIA 2Q3DA 3I58A 5I9NA 5JWOA 3RJMA 3BL6A 4J9UE 1ISPA 3MGGA 1OBCA 1VLZA 2LD4A 3P9PA 5KHOC 2IH5A 2DQYA 4AJ2A 4NNJA 4RF5A 1XNQB 4NMXB 1O4VA 1DADA 2DJIA 3EVBA 1OZ0A 1YB1A 3AUSA 2PGIA 1GITA 4DHWA 2UKDA 1RTKA 3C5EA 1TW3A 4HMPA 4CMIB 4OIMA 3NDBB 2TYSB 1XR3A 5GINE 4QE3A 2YTZA 1NM5A 1JV2B 1QBGA 4FN4A 4JKYA 5FR2A 5IYZF 3S1AB 1H4TA 1KEUA 1NKSA 1U4NA 3ICVA 4Q6BA 1FFWA 2Y77A 3GMSA 4RNDB 4NDZA 4BAGA 1TM2A 1NBME 4TL8A 3FKSA 4P35A 3PXGA 1CETA 1LGYA 1VPDA 3QHAA 4JN6B 4YO8A 4DXDA 4MICA 2E82A 2Q7DA 3CY6A 1PDWA 2YOFA 5BQPA 1FSSA 3V97A 1ONPA 4NZPA 1C1XB 4PRYA 2QAGB 5IFLA 5ITWA 3AMVA 2FMKA 2ZBUA 4ZYYA 3F8SA 3ZK7A 2EWVA 3PCRB 2QDKA 5JNRA 3WA6A 3HJFA 3O8CA 3DB1A 4E14A 3AONB 3U3KA 3QUCA 3EHDA 1TKAA 2O57A 3NHFA 2OXIA 4FLEA 1QF6A 2WFLA 2LW7A 2XUHA 2MYTA 1KYVA 1JJBA 1Z34A 2QLNA 4NG5A 4BX2A 1NSYA 3HY3A 4PC7A 1MIOB 3H9UA 2ISSD 3AZOA 3R7WB 2PUDA 4IV8A 4FD2A 3CR8A 2G83A 4J94A 2IBTA 5FTWA 1Z4NA 2C0CA 3E70C 3NU1A 4G5XA 1DIOB 1D4OA 3SOPA 1DIHA 3VTZA 2FPIA 3B1YA 4U02A 3TLYA 1IH8A 5C7IO 1QCCA 3CRZA 4Y98A 4QO8A 3ROEA 3I2FA 1YQ9A 1D2AA 1ODCA 4CI0B 1M2OB 5DBFA 1TFUA 1E2PA 4FCWA 1CFZA 3RCBA 1AZLA 1CUJA 2XA9A 3TOXA 4YA6A 2WD7B 1DG9A 1DQNA 1GUDA 2CB9A 2ZTSA 3HU2A 4BLWA 4ZMRA 5JEEA 6LDHA 4AZ3B 2OK8A 1FTNA 2FPLA 3L4SO 4XH9B 1M72A 2BF4A 1ENYA 1JG3A 2YZMA 4FFBB 3F9RA 4HGRA 4KUGA 4PSVA 4UNIA 3P52A 3CG0A 4CWAA 2QROA 4ZCMA 4PANA 2QXYA 2ECOA 1XMOB 3HCRA 3N2KA 1YZ3A 2ZB3A 5CFZA 1QQ7A 4BO0A 1IZ8A 1S02A 2JIQA 2QL6A 1TJ4A 2PG3A 1JG1A 2HK7A 1RS0A 2HLNA 2R6DA 1RQ2A 1USKA 3DE6X 2CYCA 4K1XA 4M89A 4PPGA 3MMZA 3NTXA 4QSMA 3BX1A 3F97A 3TZEA 5EHXA 4QVIA 1WD5A 2CVPA 5J59A 4IFBA 1FDOA 3AHIA 4ZDIA 2OO5A 5EWLA 1VCHA 4FNMA 2BFBB 2Y3IA 3NBFA 4B6PA 1ZN9A 3RU9A 9LDBA 5K2OA 1UPUA 3SICE 2X76A 4JBYA 4YJHA 1QPGA 3EUAA 4BDTA 2FE4A 2WJIA 3CGWA 4H1VA 3V00A 1LJ8A 1T5LA 2WFZA 3AESB 3Q7PA 1M2FA 4BWYA 3E7XA 1P9NA 3HO8A 3VH2A 5IEJA 1B8PA 1IE3A 1OREA 3JWHA 4YAKA 2ZWAA 3CNBA 3R5FA 3A3NA 2G9NA 4BVAA 2O2GA 1TFRA 1PDOA 1RPJA 1PR3A 4YECA 4KODA 1M6HA 2NQ8A 4MWZA 2K7ZA 3MYRA 4FR0A 2YFQA 3L8MA 3FDZA 5ALFA 3ZW8A 3WBKA 5FNVB 2RBGA 4F8JA 3BTSA 3SM3A 2AC4A 1Q21A 1HGXA 4EKYA 4WBNB 2FZ4A 3NIGB 3N0TA 3QYFA 4DV4B 1R5OA 4PBRA 4E5MA 2P9TA 4LFBB 3OPYB 1MOSA 1S89A 2IP4A 3AC0A 2I7CA 1PO7A 1XXHB 2GVDC 3W2IA 1R6BX 4W1QA 1VSVA 4W7SA 1FTQA 2YVQA 2X19A 5AHKA 1B6TA 4OP3A 4QLOA 3I4FA 1YQTA 1A9SA 4NY1A 5I9LA 3KE8A 1LA2A 5EJIA 2NU8B 3TLAA 4F91B 4DDHA 3ZV7A