1ISIA

Crystal structure analysis of bst-1/cd157 complexed with ethenonad
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
total genus 87
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1isiA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1isiA02
4ND1A 1BSVA 3KLPX 1B8UA 1JDJA 4TRRA 3A9WA 3U3XA 1MX3A 2YHIA 5G0WA 4HY3A 4GLLA 2RHCA 4CMGA 4J1SA 1XWFA 1Y9EA 3LU1A 4PLYA 3I9KA 4KMSA 2X23A 3M1LA 3OSUA 5TT0A 3RSHA 5AXCA 3ZHZA 2IZ1A 1KVUA 3JYPA 4PZEA 1F06A 1GYPA 1H2BA 2BH9A 2VWQA 3KRTA 3P2YA 1ZUD1 3VZPA 1UR5A 2BMAA 1NHGA 1HDOA 4IQ8A 5TNXA 1PQPA 1BDMA 4G2NA 4F45A 2EWMA 3KV3O 1Q2XA 3F5QA 3GN2A 1U4SA 2NU9A 3TJRA 1C1DA 4BKPA 4YT5A 4ZQFA 4CV1A 2VWGA 2X9VA 3UICA 2ZTMA 1LC3A 4QQRA 1ML3A 1B8VA 3TWOA 3F6YA 1B7GO 4ZICA 4JBIA 4O59O 4CQMD 3MWDB 4BO3A 5JMWA 2ZJ1A 1YO6A 2IYPA 3Q0EA 4GL4A 4AJJA 1GTMA 1VSUA 1HE2A 2FHSA 2X0IA 3H2ZA 4DC0A 2Y0CA 1WDLA 4RVSA 3QWHA 4W9NA 4TQGA 1U9JA 3N7UA 3FN4A 1QV7A 1G0NA 4HADA 1E7QA 1W8DA 1BXKA 2AQ8A 1NVGA 2I5PO 3NT5A 3VKVA 4YRBA 3JQAA 3U4CA 1E1MA 3G1UA 3GR6A 4DC1A 4WASA 2YYYA 2Y1OA 1I36A 3S1LA 3WJAA 4YEDA 1KVSA 3K92A 1HRDA 1HYHA 5JY1A 3GC6A 3CMMA 3RKRA 1VKNA 1N2SA 1LLCA 3GZ4A 4FC7A 3PLRA 1PZHA 5JMPA 3A14A 4RPGA 4JGBA 4D42A 3V5NA 2HO5A 1YDWA 4TVBA 5U1PA 1K5HA 4CR7A 4E21A 5JC8A 4OH1A 5K9ZA 3QWAA 2O3TA 5CPFA 3W4IA 4B8WA 3GRKA 4J6FA 1DIHA 1I3LA 4R3WA 3UF0A 1EFLA 2F1KA 1X15A 3S55A 3Q1LA 1FJHA 2JFGA 5AQ1A 1EUDA 4LK3A 1T2FA 2AQIA 4YA6A 4PLZA 1RJWA 3RBVA 2J5RA 1OC2A 1TB4A 1ZMOA 3C1OA 1K6IA 3OIFA 1PJ4A 3ITDA 1PZGA 4MKZA 2IRWA 4CMIB 5TLSA 4IQ0A 4N18A 4E12A 3ICPA 4BKQA 1UAYA 3WSVA 4OO3A 1NQ5A 3RQSA 3B6ZA 1UH5A 3E9MA 5A02A 2ZB4A 3GEGA 4IXWA 5C3MA 4O6VA 5K6AA 4OJNA 4RZIA 1QLJA 2Z95A 3H3JA 5ENDA 1KVTA 1HTBA 4IDBA 3QLJA 1PGJA 5G0SA 4E5KA 2RIRA 1P1FA 3JQ7A 2B36A 3NRCA 4ZHSA 1JN0A 2O23A 4DLBA 4Y8VA 1P1HA 3ZU5A 4D0SA 3I9LA 2HMUA 1C0LA 3I5MA 4CL3A 5L40A 4B3JA 2A94A 4RV9A 3WICA 4B4VA 3WGYA 4A2CA 3CZMA 1I30A 3RUAA 5BSFA 1K6JA 3NEPX 1H6AA 4A0SA 2BFMA 4Y9DA 1GPDG 4W7IA 5LDHA 4Z6KA 4ID9A 1CIVA 5EPOA 2H5LA 1C1DB 2Q2QA 2W8ZA 3EGOA 4IIUA 5BSGA 2G0TA 3IOYA 4FN4A 1E7RA 2B69A 3ONDA 4RORA 6ADHA 1E3IA 1UXJA 3LYLA 1R66A 1DSSG 3G0OA 4FGSA 5JXWA 2BGMA 1RWBA 3FI9A 4ILKA 1TT5A 5KJCA 3UXYA 4UVIA 4U6QA 2OP0A 1HDXA 2C7GA 5IJZA 2ZCVA 4RVGA 5L9AA 4G5HA 1CEQA 3JQBA 2R00A 2X58A 4XGKA 4CV2A 4MJLA 2JL1A 3RUEA 5CG1A 4NNJA 3WXBA 4KUEA 3AU9A 4ND3A 2ZYAA 5B12A 4GPD1 5HRUA 4FDAA 2O3UA 1LUAA 3H9UA 5KNLA 3X2FA 1Z6ZA 2G1UA 2IZZA 5AXAA 3TPCA 3DHEA 2J3HA 1O6ZA 4I5FA 1KBZA 1K89A 2VT3A 2I67A 2D2IA 3N58A 3GVPA 2DBZA 2WEKA 3IKTA 3IAHA 4BNHA 3GHYA 4NBTA 5ER9A 3Q3CA 1R0SA 2E49A 3P5SA 5T64A 3M6IA 4XGIA 2DFDA 5FI5A 3W4JA 4U8GA 3U4HA 4I9HA 4CM3A 1VM6A 3HQ4O 1ADFA 3RJ9A 2O3SA 3I4FA 4IPTA 4BGUA 3M1AA 1T2AA 5DOZA 3DC2A 4JJGA 4W99A 4UREA 2O48X 2BI8A 1VKOA 2VZ0A 4O0LA 1E3SA 3AI1A 4WOKA 5C37A 2Q1UA 4CM6A 2VZ9A 4CM7A 3NKLA 4NJMA 4DTIA 3HFGA 4GX1A 1V35A 3RAJA 2H63A 1O0SA 2G82A 2YFQA 1Q0LA 3WWYA 1LTHR 2NVWA 4J2HA 4MVJG 1NPYA 4BB6A 3LC1O 3GFBA 4XGNA 7MDHA 2VHXA 1ENZA 1U8FO 1Z82A 1Q0QA 1N1GA 2YHUA 4BGEA 4EW6A 1MLDA 2AQHA 3PHHA 4DYDA 3TZKA 4H15A 4BHTA 3AJRA 5I7VA 4JLWA 5HTOA 1PEDA 4FFPA 2WSBA 4R41A 3ASUA 3F4BA 1JTVA 4NU5A 1NP3A 4YJHB 5ICMA 3ZW9A 3JD2A 2UYYA 3PFWO 1WDKA 5IG2A 1DO8A 4HKTA 4TRJA 3VDQA 3ZNQA 3KOUA 2EP7A 3JD0A 2GASA 4NG5A 3VHRA 3ZV4A 3AFNA 5CEFA 1ZIDA 1KC1A 3S8MA 2GZ2A 1UZMA 3TN7A 2Y1DA 1YQDA 2VWPA 3NJ4A 4WPGA 3I23A 5KTKA 1CQJA 1YL5A 3IP3A 1ISFA 4G81A 3WNVA 3OJFA 2HLPA 4G65A 1GYQA 1ZZEA 3D7LA 5AXBA 2Y0DA 2GNAA 3BTSA 3AOEC 3ETDA 2BFAA 1CF2O 3D4PA 1E92A 2ZCUA 5DCYA 3IKVA 1GUZA 1U5CA 2C7VA 4B7XA 3GGOA 1B0AA 2J3KA 1PL7A 2EIHA 1OC4A 4BQRA 4OYRA 4R68A 1HLPA 1O8CA 2WMDA 5G4LA 3EY4A 1Y81A 5F5NA 4YPOA 1JLLA 1VSVA 1ONOA 4K28A 3RUCA 4U6SA 4JQCA 1SEPA 5G0TA 3ZWAA 1A5ZA 2GYYA 1O89A 3FNGA 5ES3A 2AE2A 2PGLA 1OBFO 4R9SA 3AW9A 2FOIA 4N5NA 1KS9A 3DZIA 1LDGA 3DBRA 4E5MA 2VOEA 2XF8A 3C1TA 1DRWA 1U5AA 2O50A 2D0IA 3ZV3A 4NH4A 4O5OA 4YAIA 3HDQA 4FBGA 4MP6A 2BD0A 4K6CA 4S3MA 4EEZA 4XRRA 2QX7A 1ID1A 1BG6A 4RCVA 5A9RA 1B8PA 1TXGA 1DEHA 2B5WA 4R54A 3BMOA 4LMRA 3A06A 4DA9A 3DZHA 4CQLB 4RDHA 4GKVA 4RQUA 4Q3DA 2AE1A 3AWDA 3FWNA 3GAZA 5HS6A 2AEJA 2Y67A 3DMYA 1CWUA 3IP1A 1E7YA 4OQYA 2IE0A 1R0KA 5AOVA 4MIOA 4TRMA 9LDTA 4B3HA 3GZNA 4RQTA 2Q4EA 2W4QA 1PL8A 3V1TC 3LF1A 4IS3A 3DOCA 3ONFA 2I6TA 5JYDA 4LVCA 4CUKA 1LC0A 3PWZA 2WYUA 4QXMA 3TL3A 1M75A 3ZWOA 1KVRA 1ZBQA 3HN2A 8LDHA 1PZFA 1PJBA 1QYCA 6LDHA 2B4QA 3O4RA 1V9LA 2FZWA 4ZVVA 1EVYA 2FRDA 3WYCA 2EXXA 2E4AA 1U3VA 4LCEA 4MP3A 4B3IA 1QYXA 3T7EA 2Q1SA 3OQ1A 3H9JA 5G4KB 2I9PA 4JXKA 1YBAA 1AGNA 3ZV5A 4J90A 4AJPA 4R1SA 2EGGA 3MJSA 4ZQBA 1YVEI 3WGZA 1PIWA 2PWZA 1PJSA 1ISGA 1Y5MA 5KVQA 1JKJA 1B3BA 1R6DA 3AM5A 2GERA 1KEVA 4AJ2A 4I8XA 4PG7A 4BO1A 2QIOA 4M54A 2NWQA 5H81A 5I7SA 4RPLA 3H5NA 3GT0A 4WCFC 3S2FA 3ZWYA 4MVJH 1FDTA 1CERA 3PJGA 3AU8A 3MJVA 4M1QA 2Z1NA 3VVBA 1J49A 3IUSA 4D43A 3E9QA 2LDBA 2X6TA 3ST7A 4KWHA 3WQSB 1E6EA 1C0PA 5HM8A 5F21A 2JFHA 1F12A 1H2HA 3KUXA 3RWBA 4CUJA 3CXRA 4TKLA 4PLHA 1LQUA 3OA0A 1A7KA 2RBEA 3ZU3A 4JN6B 3K8ZA 5LCXA 1I01A 2I3AA 2V6FA 3GNQA 4I5DA 3GDFA 3BA1A 2WYWA 4RL6A 3JV7A 1CDOA 2DUWA 2I76A 3R3SA 4BNMA 1EVJA 3TSCA 1I3KA 2B35A 4KZPA 1R12A 3VC7A 4GVXA 4ITUA 4CMKA 4Y98A 4EDFA 3DBRB 2BHLA 1K2WA 4OGWA 4EEXA 5BNTA 2PLAA 2Q46A 1JAYA 4R1TA 1ZNQO 2PNFA 3E18A 3RFVA 4L0QA 5CAEA 2GDZA 1E3WB 4LN1A 1LBEA 1IL0A 1DIGA 4RJTA 1LA2A 1L1FA 4TSKA 3BMQB 3SBOA 4JP2A 2O7SA 1HE5A 3GMSA 3ZNOA 4B8ZA 1C0KA 1NVMB 4JX8A 3QJ5A 5EQDA 4CLOB 5JDCC 1GU7A 3PDJA 4GGPA 1I3NA 4E2ZA 2DQ4A 5JCJD 4YQYA 4AJ4A 2GLXA 2PD3A 1WLYA 2FSVA 2GGSA 4II3A 3NX4A 4Z9XA 1HDZA 2CY0A 1HZZA 3MJTA 1DAPA 1U2DA 2BF7A 3TNLA 1FDSA 2ZYGA 3JYLA 3PQFA 3UGKA 5I9LA 1WW8A 5IAAA 4H16A 4QUKA 3FCOA 2BGKA 5BSHA 1ULSA 2WE8A 3B1KA 3E48A 3KTDA 2QRLA 1U3TA 1GZ3A 3AI3A 4GAEA 4CL8A 2ZKLA 4WGGA 5COAA 4FB5A 3F1LA 3ROMA 2G5CA 1WDMA 5GZ6A 1J4AA 3PRJA 3VPHA 1HEUA 1U8XX 3ZWVA 1ZH8A 1E1LA 3AOGA 1Q1NA 4XYMA 5T8KA 3JQGA 1NQAO 2VTDA 3QWBA 1VPDA 3OICA 1CJCA 4CMBA 5BQFA 1P74A 1SAYA 1Y8QA 1NAIA 3UUWA 3D64A 4GSLA 4CLRA 3OQBA 5JAQA 5JDIC 3SC4A 4ZQGA 3VVCA 4F6LA 4E2YA 3AM3A 5A03A 3GGGA 3RU9A 3WFIA 1ZW1A 3ONEA 4I9NA 3GDOA 2NTVA 5L45A 4NDNE 5EESA 2FSSA 2IYOA 4BO0A 4PRKA 4IM7A 4R1NA 1ENPA 4KDFA 5EQFA 2CDBA 3JQ9C 4WNCA 3V8BA 4AJKA 4YR9A 5JS6A 5CDSA 4XRGA 1I2ZA 3NTOA 4CQMA 4YB8A 4AG3A 5TQVA 3QVWA 3U0BA 1X1TA 5IXSA 4YRDA 4M86A 4AJEA 4TKMA 2O4UX 4IBOA 3QP9A 4CMAA 1E7MA 1YL7A 1GZ4A 2UVDA 1NWCA 2VHZA 2X9NA 1EZ4A 4KQWA 1ZK2A 4PZCA 3FTNA 1MA0A 3K73O 2PGDA 2E37A 2EF1A 1LX6A 3V1UA 3AY7A 5HBRA 4DMMA 3CH6A 3ZN2A 1P0FA 1DHTA 1WWKA 3EYWA 4LSWA 1HSOA 1H5QA 2NNLD 4IDCA 4JCOA 4DREA 2HUNA 4PLFA 1EMDA 4QX6A 3FNHA 3TZCA 3INRA 3PQEA 1DDOA 4JP3A 3I1JA 3ZZNA 2W98A 1DIBA 3L6DA 3JQ9A 3ZU4A 3RI3A 4IUYA 3GEMA 4J43A 2VT2A 3ROQA 3E5RA 4UUPA 1IB6A 2PH5A 3WOHA 3K9QO 2VUSA 1X0VA 4NMHA 1ZSNA 1QMGA 1V0JA 3RUHA 1NX6A 2ILTA 4UUMA 4QTZA 1E3JA 3OP4A 2JHGA 5CPBA 2ZB3A 4WUVA 1SOVA 2D3TA 1XKQA 3WG9A 4CODB 1QR6A 1C14A 1DIAA 1UXGA 1KETA 5ICSA 5T5QA 3OH8A 2GN9A 3BIOA 2PH3A 1S7CA 1YE3A 2QYSA 4PLPA 4RVFA 2AA3A 3SJUA 1HSZA 2VOJA 2DBQA 4EUEA 3CTMA 5TGDA 1RYDA 1YJ8A 3R1IA 3F4LA 3QIVA 3LT1A 3S2GA 4CUZA 1ADGA 1I10A 1NM5A 4TZKA 3B1FA 4AJLA 1H93A 3PJFA 4AL4A 1JU9A 4ND2A 2W90A 3GG9A 4CV3A 4NJOA 4PLCA 4GI2A 1A4IA 1QRRA 4DLLA 3HZZA 5CEEA 2PZMA 3VDRA 4IJVA 1PR9A 3KM0A 2YJZA 1SNYA 3ADOA 3PYMA 2FY8A 2XXBA 3GQVA 3L4BA 2VHWA 5JSFA 2NVUB 4OAQA 1PZEA 1NFFA 4M8SA 3PHJA 1GUFA 3MEQA 2ZTVA 3A1NA 3D3WA 4J4TA 4U5QA 3WS7A 5DCUA 4LRSB 5L3ZA 2O2YA 3GPDG 1XEAA 3L4SO 5TS3A 4XYEA 4E5PA 4M89A 3GG2A 3JYNA 1H9BA 3H8VA 1ENOA 5KKCA 4HFNA 2FZEA 2O2SA 2DPHA 2IZ0A 4MIYA 1RYEA 2OBNA 5EINA 4HFJA 3VZRA 2XAAA 5BSEA 2C2YA 4Y6PA 1I2CA 4DQXA 2YV2A 5EMHA 4GWGA 1K3TA 5L7WA 1V3UA 3SLGA 4YT4A 5IN5A 2QZZA 3VOSA 1LDEA 4ZRNA 1I5RA 1T4DA 2JFFA 1EVZA 3DONA 4NI5A 1XHLA 4AJIA 2VHYA 4KUGA 1R4NB 4J91A 5TSDA 4E3ZA 1BDBA 3GN1A 7ADHA 4W7HA 1ISJA 1LLUA 4K26A 1PGNA 1U28A 3PPIA 2C07A 5TIIA 3EC7A 4NU6A 4OM8A 4D44A 1ONNA 3LC7O 4I9UA 1GZ6A 1ZSVA 4YAGA 2J5QA 1B3RA 1YOVB 2FR8A 3ZNNA 1VLLA 4DMLA 4Z3KA 3WBFA 2GUGA 1PJ2A 4GSKA 4UUNA 1IPEA 3MJ4A 4MVJE 4L74A 3VPGA 5K6AC 3DBHA 3DFUA 3G17A 1GY8A 4CV0A 2X5OA 3RC9A 4J1NA 2OXIA 5GZ3A 2C0CA 2QZ9A 1P3DA 3HFSA 3BHIA 4EGFA 3DB2A 1UAGA 1LSJA 4HWKA 2OOSA 4TVOA 1EE2A 1HE4A 1YH3A 1FF9A 1P77A 2D5CA 5AYVA 3K2BA 2B83A 5H83A 3RFXA 2HAEA 3CUKA 1KEPA 3RU7A 4QO8A 1WMAA 2IDZA 1KYQA 2DTXA 1RM5A 4PLTA 4MVJP 1JKIA 4Z0PA 1ISMA 2FR1A 5ENVA 3BHJA 4FIZA 3WLFA 4WCFB 4L4RA 3O8QA 5J23A 2ZTUA 1AE1A 3RROA 1YBVA 4BNGA 4RF2A 5JAIA 4C7KA 4GMFA 1ISHA 3U5TA 9LDBA 1P1KA 3JQCA 2NM0A 2GD1O 5DNAA 5JCJA 3PP8A 1PJLA 3NT4A 5A04A 3W1VA 5JAZA 2X22A 5KOIA 1HWYA 4PFJA 1SB8A 3D3EA 4FOOA 4OXKA 1ZCJA 1DLJA 3FTPA 4FC6A 3CKYA 2NSDA 3JTMA 1U3UA 3UCFA 4NJMB 4Z0HO 5I7FA 1D4FA 5JC1A 2NU7A 1E7SA 5DN9A 3V2HA 1SZJG 5CDGA 2Q99A 3DR3A 2ZB7A 3D5TA 5L4LA 1T25A 4R51A 3OJOA 3E6AA 3K6JA 2YQ4A 3RUFA 5KJ6A 3DAFA 4JNKA 4IJKA 3OEWA 1DRUA 1J6UA 1HXHA 1QYDA 2HDHA 1C1XB 2J5KA 2TMDA 1DC3A 3FF4A 4BNZA 1T1RA 4P38A 1TLTA 5KVCA 2P4HX 4TROA 4YDRA 4XIYA 2GZ3A 4BO4A 5JYEA 5B4UA 2E6UX 3W8FA 1UP6A 3HE3A 1MV8A 2VCYA 3VPXA 3CPSA 1V3VA 1CYDA 1DFIA 1LSSA 2CDAA 3Q9NA 3MZ0A 3N74A 4O63O 1EK6A 2QG4A 3WNQA 1HYGA 4ND5A 4L76A 4NFSA 4DLAA 2IXBA 5COQA 1P1JA 2Z1MA 1BGVA 1UZLA 1EFKA 1R0LA 3QVXA 1HDCA 3LF2A 2HQ1A 2AEMA 4INAA 3PLNA 2JJYA 3QSGA 1XA0A 3U49A 3BTOA 4TWRA 3H65A 5I9NA 3OETA 3W6ZA 3DO5A 1T4BA 4J9VA 3UOGA 4E6PA 5I9MA 2Q1TA 1PJTA 1JA9A 1KVQA 2IODA 1D8AA 4UVDA 5I8WA 3ZCXA 2Z5LA 2X0RA 2WD7A 4I08A 3QE3A 3P2OA 4K6FA 4C7JA 5JE8A 3DFZA 4DL9A 2EW2A 4FFNA 2YV1A 4BNIA 3IQDB 3Q11A 3IJRA 4Z9FA 5JFOA 5T6BA 1YOVA 1Q0HA 5DT9A 1LLQA 1ZFNA 3STHA 5KJ1A 2LDXA 5A5EA 3GUYA 3HN7A 4E32A 4WLVA 2DBVO 3H3FA 3K30A 1QKIA 4U7WA 2A92A 1X1EA 4BO7A 2NADA 3EUWA 2DM6A 2CNBA 2C5EA 4LISA 2W2KB 4WECA 2OUIA 1PX0A 4KP7A 4UVHA 5DBFA 3ZH2A 2WTBA 5FI3A 4E2XA 3WGHA 4BB5A 3M2PA 2Y68A 3FNEA 2H6EA 2HMSA 3D5QA 2C2XA 3Q2IA 4L75A 3GDGA 5CDUA 5AVOA 5CDYA 2PTGA 1YGYA 3L6OO 4R4JA 4NBUA 2P5YA 1U3WA 3PWKA 1WZEA 2P91A 3VTZA 4AJOA 3PIIA 4P4LA 5KVVA 4NFHA 4BUCA 3RD5A 4XQEA 5T8KC 1S6YA 3TOZA 5IDWA 3B1JA 3GNSA 5C7OO 3WGIA 3PGJA 3ZWPA 3O38A 1G1AA 1EQ2A 1Y7TA 3FPLA 3ZHBA 5A3JA 1K6XA 2WYVA 4OL9A 5KJEA 3GF4A 2Y1CA 3JQFC 1DFGA 2OBYA 2GF2A 1Z45A 1ZK3A 1RM4A 2DVMA 3D3WB 4GVLA 3OQ6A 4CM1A 1PTJA 3KYBA 2ZB8A 3RC1A 1DAOA 4W6ZA 4KWIA 4Q3EA 3DOOA 4DGSA 4E5YA 4EZBA 1PQWA 1LLDA 1D1SA 5L7TA 2GN4A 2GZ1A 2V6MA 5DOVA 4N5LA 2YQ5A 2NTNA 2JCYA 1YRLA 2AHRA 3HDJA 4BMSA 1NBOA 4J3FA 5A3VA 3GOHA 1LJ8A 2AMFA 3CEAA 1Q7CA 4IJUA 2ZQZA 4RDIA 3LT2A 5BNIA 3BTUA 2ZIZA 3VKUA 2VYNA 5L51A 1Q7BA 2BGLA 3DAGA 3DOJA 2O3JA 2VQ3A 4BGVA 1GV0A 1C1XA 2HMVA 2H9IA 2POQX 4MO2A 3HJAA 4R5HA 4PG4A 1E3EA 4CMJA 3WGOA 3INGA 5LDGA 2B37A 2OZPA 3PIDA 2ZJ0A 3PJDA 1HKUA 5TT1A 4XYBA 1PQUA 3L6EA 1DLIA 1QYWA 1QXSA 2D59A 3UCEA 4RVDA 3QQPA 1F0YA 4D79A 3TF5A 3P19A 1P0CA 2EEZA 2JCXA 2PD6A 4IDGA 1BVRA 5L4NA 1VJ0A 3COSA 1O5IA 2O3QA 2OHXA 4EJ0A 1O9BA 1UP4A 2E82A 1OAAA 3JCZA 5DULA 4Q3CA 3R0IA 1LU9A 3JQFA 1NQTA 4E2WA 2NVBA 5T57A 3ANNA 4U0KA 4QSMA 1YKFA 5ER6A 3WTCA 1M6HA 3AI2A 4MVJM 3PZBA 2NU8A 5KJFA 1NFRA 1ZO8A 1P9LA 3NDRA 3JQ7B 1GADO 4FFLA 5B1YA 1T24A 3RVDA 2P9GA 4MDHA 4WEQA 4I1IA 4RPHA 4U0JA 1KC3A 1Y8QB 1BTOA 3FHLA 3AK4A 1F8FA 4Z3DA 4DWVA 2JCVA 4PVCA 1JWAB 1W73A 1M67A 2O3RA 4P4GA 3NDIA 2XXJA 3I9NA 4BKOA 1RKXA 2WD8A 5KKAA 3MWEB 4FD3A 3I9JA 3GMDA 1Y6JA 3GGPA 2D1YA 3MOIA 1SBYA 2E48A 4ZD6A 4KTVE 3ABIA 5BNFA 1D3AA 5AXDA 1JW9B 3ZWBA 3TQHA 1IZ0A 4DQVA 4OOFA 1DJQA 4O1MA 4BQPA 3SVTA 3PI7A 4EJ6A 4DIBA 3NDJA 1FDVA 1A7AA 3TZHA 3VPSA 3AOEA 3KEOA 1ZK4A 3OEYA 3HDYA 4GX5A 3C3XA 1K0UA 1YBMA 3ZGYA 2OP1A 4BV8A 1NASA 4S1VA 2JAPA 1WPQA 4BNWA 1YXMA 2X0NA 1UZNA 2PR2A 2RH4A 3CIFA 4AJNA 4FSHA 1DC6A 3NAQA 2WJPA 4NBVA 3ZWNA 1Z7EA 4OXYA 1JQBA 3MCVA 3NTRA 1M2WA 3ZW8A 5A1TA 1B2LA 1PS0A 1W0CA 3VTFA 1ADBA 3DQPA 3WYEA 3ZHYA 4B79A 5FWNA 4XWYA 2X86A 2YV3A 1D1TA 1EBFA 1W4ZA 2X1HA 4M49A 4MVJF 4DXHA 4J9UE 3H4VA 2Q2WA 1E3LA 1N8KA 2DAPA 3KYCB 5CHEA 1DHRA 4BO5A 4GKBA 4Q39A 2HK8A 3KO8A 1F14A 5HS4A 4BNVA 3I3OA 4BMNA 3KYDB 2J3JA 3QA9A 4PVDA 3PTZA 1VRWA 1KIFA 1ZEJA 2VUTA 3LDHA 4OOEA 4BKUA 1M66A 4N5MA 3ZHXA 1UDCA 2QRJA 3C85A 4CR8A 3RIHA 3DBLB 3E03A 2CSUA 4DQUA 2CVZA 3Q9UA 2X5JO 4RPKA 3WQQA 3JD3A 3D0OA 3C24A 3A28A 5F3RA 1PWXA 5IXYA 4IDEA 4F3YA 3HADA 4R69A 4IQGA 4CMEC 1MGOA 3EVNA 3PHIA 2PK3A 3UHAA 4Y6SA 4YAKA 1IULA 2G17A 4IZHA 1IOLA 2CD9A 3INTA 1QV6A 4IMRA 1FXSA 1XCBA 2O4CA 2UAGA 1JVBA 4MVJD 4CJXA 3HB4X 3TZ6A 3ITKA 4E30A 3C1AA 1A9ZA 2VNSA 1Z7BA 2UUPA 5B4TA 4BO6A 3FR8A 4NIMA 4UEJA 1GAEO 3IL2A 4PN3A 3JQEA 5HA5A 1PS9A 1T2DA 3NTQA 2HK7A 2P68A 3RUDA 4UUOA 1A9YA 4YBZA 1NYTA 3ANLA 2HSDA 2DPGA 4ROSA 5CDTA 1YDEA 1YB1A 2DC1A 4IXTA 4ZGWA 3WGQA 4B4UA 1N5DA 3G49A 1MUUA 3LT0A 3NT2A 5ADHA 3PJEA 3I83A 3KLMX 5IDYA 4YJDA 2PGJA 1WVGA 3I4CA 4MP8A 4YCAA 4R1UA 4CM8A 3ICCA 4HBGA 2P5UA 4BIIA 3SEFA 1VL8A 2NTJA 3IMFA 2R00C 3SX2A 4BOYA 1Z74A 1I24A 1DC4A 5KWEA 1PU2A 1YWGO 4BL5A 4YWJA 3T4XA 4PLWA 1YL6A 4ALMA 4A03A 4J16A 4PRLA 1Y1PA 1E5QA 2HRBA 3GAFA 3W8DA 2IEDA 3QW2A 2GR9A 4DPMA 1AN9A 3DTYA 3ON5A 4UULA 3QWFA 1NPTO 4E33A 1T2EA 3LZ6A 3M2TA 3EVTA 3RJ5A 4J2OA 3U09A 1B15A 4R16A 3S2IA 5KVSA 1E3WA 1BXGA 1EK5A 3E1KA 1AXEA 2RCYA 1R4MA 2QQ5A 5A9SA 1ZXLA 4FJ1A 4HV4A 1U1IA 3DBHB 2RAFA 4LMPA 4BVAA 3WDSA 4CLHA 1HETA 4X54A 4ONEA 2Q3EA 3PXXA 4A73A 3PYXA 1NR7A 3BMNA 4YQZA 1IY8A 4IJWA 4P8RA 2OORA 4J1TA 5B4VA 3D4NA 2HJSA 3CINA 4GGOA 4PG8A 1T26A 3JD4A 3BYZA 3PHGA 3BAZA 3U4IA 3HWRA 3JYOA 1SEVA 4GBJA 3E8XA 5A4DA 5IFLA 3LT4A 4Y67A 2OFPA 1GQYA 4CQLA 5L53A 1LNQA 1ZJYA 2BFOA 4CM9D 5TJHA 3WX0A 5JY6A 1XR3A 3GK3A 2PV7A 4PIVA 3EW7A 1N7HA 1BRMA 1I0ZA 4XYLA 1LRJA 3E5MA 2I66A 3LLSA 3ZU2A 1P33A 3EAGA 2NVUA 3WBBA 4J4HA 4ALLA 1LQTA 1N92A 4AJHA 1KOLA 1E6UA 2YDYA 4J7CA 4ALJA 5K0ZA 4PGFA 4TRNA 5DP2A 4E13A 3PYLA 2D8AA 2X7HA 4IZIA 4JBGA 1ZVMA 4L73A 5EERA 2D4AA 4XJTA 2YUTA 5I8ZA 4MINA 3I52A 3NV9A 1Z73A 3UCXA 5DZSA 4XYGA 3R6DA 1EE9A 5FFFA 8ADHA 2X0JA 1Y8RB 2GSDA 1LDMA 5DP1A 4HX5A 3WWZA 1R37A 1DIRA 3ZV6A 1GUYA 1JVSA 3OM9A 1X13A 3L0DA 2HU2A 2JAHA 1XU7A 2OL4A 3JQBC 4HP8A 4RVHA 3WGGA 1DJNA 4FW8A 3KSDO 4DRYA 4XQGA 1FDWA 1I33A 3MJEA 4WLNA 1U4OA 3VAZA 4AICA 2BLLA 2OO5A 4WLUA 5CG2A 1YONA 3QVTA 2A4KA 5ILOA 4WE3A 5F1KA 3FRJA 1NXQA 2GN8A 1JAXA 2EV9A 2FMUA 2NV6A 4MIEA 4NZ9A 1SO8A 2EP5A 3OJEA 1L7DA 2QYTA 3F1KA 5KIAA 1P44A 4QT0A 2CF6A 3OIGA 4EJMA 3LSYA 1U7TA 3DTTA 1R4NA 4P22A 4ZN6A 2PZLA 3GNTA 2RHRA 4JJFA 3GH3A 2VRBA 4W4TA 3VH4A 1MXFA 4YAJA 2C20A 3DWFA 4CM4B 2Q49A 1N9GB 5TRTA 4FPXA 1PJQA 3UAGA 3ORFA 3H9QA 3WJ7A 2V6BA 3TFQA 1UXKA 1GFSA 1F8GA 1VE9A 2ZTLA 2Y1FA 2XPCA 3SLKA 4YYZA 1HT0A 1VI2A 1KERA 2HJRA 2CUKA 3CSDA 2VNAA 3I6QA 3OA2A 5H82A 3IDSA 3G3EA 4DBZA 4J7XA 2PKQP 4YAEA 3RCBA 1LXCA 2PKQO 2AQKA 3ZWCA 2EKQA 1ZKMA 3JD1A 1BVUA 4E0BA 3BMNB 3L9XA 2BRUA 2H1SA 3AUUA 1WP4A 4DIFA 4BNXA 3H5AA 1F17A 2Y93A 3DBVO 4WEOA 1BXGB 4KUHA 2BKAA 3FWZA 5JLAA 3U4DA 5FEUA 3GFGA 2CF5A 4RF4A 3DZJA 3E82A 2G76A 1EDZA 3ASVA 3UN1A 2HMWA 4WKGA 4Q3NA 2R6JA 2VN8A 4ALIA 4OXNA 4B4WA 4NHEA 5CEJA 1LSUA 1WAMA 4D46A 3ZNPA 5MDHA 3F3SA 3ADPA 3O8QB 2HRZA 3PEFA 3H5RA 3PZRA 3IUPA 4R01A 4CR6A 1TT5B 2IEBA 2FR0A 1WZIA 3GY0A 1D7OA 1YQGA 5TJ9A 5ILGA 1XDWA 4IY1A 3NUGA 3BMCB 1SB9A 2P9CA 2AXQA 3AUAA 5IDQA 4WK6A 4A10A 3O26A 1SPXA 2UUOA 3W8EA 4OIMA 2OGUA 1UP7A 1KEWA 1YS4A 5JDIA 3ULKA 1ISIA 4RF3A 1QLHA 2X4GA 1E7WA 4NR0A 2QRKA 1XU9A 3UH1A 3EK2A 1OZAA 2ZYDA 4F46A 3OHSX 3EZLA 4H7PA 1KY4A 2Y0EA 1ENYA 4GH5A 1H6DA 3LVFO 4DIOA 4FFOA 1AXGA 1P45A 3H2SA 4ALKA 4HNHA 4JJIA 3OECA 4YTEA 2GRAA 3KHUA 1EUZA 1GCUA 1P1IA 1Y8RA 2XOXA 4XQ9A 3EMKA 2I3GA 2WWRA 5JCXA 1PS8A 1M76A 1CQIA 3W4KA 2JD0A 2DTDA 4A7PA 1ZXBA 1EUCA 2C59A 3EDMA 1T2CA 3MJCA 3OJ0A 5TX7A 4CQMB 3ENNA 4WCDA 5F1OA 3I6IA 2V7PA 3F9IA 4XZ3A 3WIDA 3OJLA 4BNTA 3DBLA 2A9FA 2BFPA 3H6KA 2PKRA 4TMFA 1PGPA 2YDXA 4ALNA 4GLOA 4J49A 1FDUA 3PDUA 3WIEA 4RF5A 2YY7A 2FPPA 4PCVA 4A5OA 3DDNA 3AM4A 1HE3A 1PJ3A 5U4QA 1OMOA 3GHHA 4GMGA 1N9GA 5JDCA 3HDHA 4GX0A 3V2UA 4NQZA 5A05A 3GVHA 4HFMA 3MOGA 2HK9A 3OFSA 3C7AA 4BO2A 4CLXA 1SOWA 2BELA 4ZRMA 4F6CA 3RC2A 2Y99A 3ZDFA 5L95A 2VYVD 3K31A 1NQOA 5JNLA 4UAGA 4D45A 4NBWA 4YACA 1R4MB 3CE6A 3K5PA 1EEHA 3W6UA 2WM3A 1NTOA 1MFPA 1PR3A 1XG5A 1PL6A 1ULUA 3ZWMA 3RUIA 1U2GA 4QO7A 4EUFA 1E5LA 4FJ0A 5C5IA 1TA4A 3FBTA 4ZJUA 3BHMA 4E31A 1LSOA 3FSRA 2RH8A 1VC2A 2VTEA 2UV8A 4RVUA 4XJSA 1GR0A 2VYND 1PGOA 5KCZA 4MKRA 5A5FA 2NUAA 2W2KA 3D1LA 1EBUA 4II2A 3UW3A 3EZYA 4Q3BA 4IGFA 3ZWWA 4FGWA 3HSKA 4YXFA 2O7QA 4DVJA 4K9DA 1GCOA 3ZWXA 3LQFA 3PHLA 3U9LA 3L9WA 3GVIA 4OKNA 1MG0A 1AUPA 1UJMA 3WMXA 5U9CA 1Y5RA 3AUTA 1GPJA 4GX2A 1TI7A 5G2OA 4WCFA 1GL3A 1LI4A 1IZ9A 1SC6A 4PZDA 2CVOA 4WOJA 3VH2A 5JO0A 4XB2A 4D41A 4J4BA 1V6AA 4FJ2A 4QFDA 1W6UA 3WYBA 4UVGA 2I99A 2J8ZA 4KTTE 5BR7A 2VYVA 2ZK7A 4IIVA 5COBA 4PLVA 4ESOA 2VZ8A 3BMCA 5A9SB 1JKFA 1J5PA 1UDBA 3IJPA 1ZMTA 3PQDA 3QVSA 4LRTB 1FK8A 1XQ6A 2EW8A 4L8VA 2X9GA 4URFA 4XDYA 3IS3A 1OFGA 3T4EA 3TL2A 3UFXA 3ANMA 4CLOA 1V3TA 3TDKA 2YZ7A 1I32A 3TFOA 2X5KO 1DBVO 3QV1A 1NHWA 3QWIA 3JQAD 3NYWA 2YFHA 4BNNA 5JW6A 3GZNB 4I5GA 1B26A 1N7GA 3BMQA 3JQ8B 2EGHA 1X7GA 2B4TO 2PZKA 3B70A 4HXYA 4RLHA 4AFNA 4HNGA 3HG7A 4OQZA 3MTJA 3H9EO 3DL2A 3UKOA 1HYEA 3AUSA 2NQ8A 5A9TA 1HDGO 1RM3A 4E5NA 1AHIA 1GDHA 4RPJA 4CLDA 4DPLA 1X0XA 1SMKA 3MTGA 1ZEMA 5FF9A 3GRPA 5MGBA 1OI7A 4YJFB 4OSOA 1RM0A 4YJHA 5DF1A 1QYVA 2GN6A 3O03A 1X7HA 2ZATA 1GQ2A 4ZU3A 2UDPA 4NK4A 3RFTA 3O9ZA 1ARZA 1WXDA 3K2EA 5GY7A 1HZJA 3WB9A 5FYDA 2ZQYA 3DXFA 3PFFA 3L77A 1ADCA 1ZSYA 4XDZA 4JK3A 4YJFA 2Q2VA 5IZCC 1GEEA 4XIJA 2B5VA 3G79A 3WQRA 1ZJZA 1ZK1A 1DRVA 3QHAA 2W2LA 2V6GA 4KQXA 3ROPA 4ZA2A 3NJ8A 4XCVA 5JAMA 4RO0A 1JWBB 2GCGA 2DUUA 4A26A 4YVFA 2I65A 2VWHA 4LCJA 5DBGA 5IN4A 1I3MA 1E77A 1BWSA 3DMTA 2NQTA 4NFYA 4NPCA 4WJZA 1WNTA 5G0UA 4NK5A 1HDYA 1MC4A 3KETA 2CDCA 4J1QA 2DT5A 2Y66A 2C29D 1BW9A 1R16A 1IUKA 1UXIA 1AHHA 2DLDA 2FN7A 3LLVA 4M87A 5L7YA 4Z9YA 4B7UA 4DBVO 1YQXA 2IXAA 4FFRA 2HKIA 4N7RA 5TF4A 1RPNA 3FBGA 1I8TA 1V8BA 1HDRA 1NPDA 3VZQA 1LRLA 3Q6IA 2FP4A 4WNIA 4D0RA 3JQDA 4OMUA 1O95A 3JSAA 1CETA 3HHPA 1IE3A 4ZQHA 2EG9A 1QG6A 3DMTC 5EL0A 4L9RA 2BI7A 2OMEA 1PWZA 3BXXA 4EITA 4B4OA 1J0XO 4XX0A 3SXPA 1DB3A 2DBRA 1VJ1A 1P1RA 2PFGA 2AG8A 2Q50A 4CMEA 4CPDA 4XB1A 2PD4A 3FNFA 3KYDA 4BO9A 4IINA 2EERA 3KEQA 3A4VA 3LC2O 3C8MA 4CM9A 4MVJI 4JBHA 1A4UA 3RC7A 4BNFA 1E1NA 2P2SA 3P7MA 1GYRA 1UXHA 5IDXA 3KYCA 4IS2A 1Z75A 4IMPA 4MKXA 1O94A 1SCUA 3AFMA 3PVZA 4H3VA 3QY9A 1Q7GA 5TC4A 3WLEA 4D7AA 3KSZO 1GD1O 2Y1GA 2JD1A 3ETGA 1DXYA 4PG6A 2V65A 1OOEA 1XLTA 1XYGA 2QW8A 5ITVA 1DC5A 4FCCA 4BMVA 1IPFA 1GQQA 5I7EA 1VL6A 3BMOB 4BV9A 2YW9A 3DZKA 4A27A 4UVEA 1IHXA 1BXZA 3OBBA 3RASA 2C5AA 1QORA 1ORRA 3R3JA 4BO8A 4RLSA 4CMCA 1DPGA 4P4NA 4XD2A 3SC6A 3H7AA 4CLEA 1GV1A 4BGIA 3GEDA 4EYEA 4FQ8A 1NVTA 2C82A 2VHVA 3JQGB 2VRCA 5C7LO 4FFMA 1B14A 3VPFA 3VH1A 2P9EA 4DYVA 4QEDA 1XIVA 4MOWA 5THKA 2JKVA 4DUPA 3NGLA 4M55A 5EN4A 1DFHA 3CZRA 4YT2A 2TMGA 3BZUA 2EJVA 1U7HA 2Q45A 3HB5X 4GQAA 4J0FA 3OIDA 1TEHA 3X2EA 2P4QA 4IDFA 2CFCA 3DZFA 1LEHA 3FD8A 5DDIP 1MC5A 4WLFA 5CP8A 2FPIA 4DPKA 3C7DB 4EI2A 3WGTA 1XGKA 2WD7B 3C7CB 3HNPA 3KBOA 4ZQEA 3Q2KA 4EUHA 4PLGA 3K96A 4R3NA 4B7CA 1R15A 2Y1EA 3B20A 1NR1A 1XELA 1E0DA 3GVCA 1QSGA 1KY5A 5EIOA 1HF3A 3QRWA 4BS9A 3ENKA 2GPTA 2DU8A 3F46A 3WTBA 5C7IO 2B0JA 3VZSA 1BMDA 1I2BA 1LDBA 1IHYA 4N54A 4Q9NA 2Q4BA 3OF2A 3E9NA 1UUFA 4XKJA 4BNJA 4CMIA 2D5AA 1L7EA 5DBIA 4L4XA 2AW5A 4BNUA 4FOSA 3CMCO 5T67A 3TOXA 3G1TA 1WMBA 1M6WA 1XQ1A 2AG5A 4K1LA 2VUUA 4YRAA 3LK7A 1ONPA 4I5EA 1YB4A 4LW8A 4UEKA 4J0EA 3S2EA 5IZCA 1H0KA 1PGQA 1YJQA 5GMOA 5THQA 2NACA 3PK0A 2EHDA 1N1EA 1EDOA 2ET6A 3EHEA 2YHIB 3ETEA 4JIGA 3VH3A 3TRIA 1E1KA 3H9GA 4C4OA 2Q1WA 2R2GA 3F5SA 5JBIA 2JHFA 3I9MA 2VRCD 5EJ2A 5ITWA 1A72A 4R9RA 4ND4A 5JPIA 1C3VA 2A35A 4MVJA 1YB5A 4IDAA 4Z0TA 2W2LD 5IF3A 1H6CA 4TZTA 3TZQA 3D4OA 3QVOA 1MB4A 4YT8A 2DFVA 4BNYA 1E6WA 1TT7A 3KXDA 1CRWG 3JQ8A 3KB6A 5F5LA 4CM5A 3DEYX 1LDYA 4XQCA 4LVUA 3F47A 1B16A 3AY3A 1HLDA 4FS3A 3HUDA 4XR4A 5JO9A 4UEOA 4NBRA 3L4BC 2PZJA 2HMTA 2DKNA 1BHSA 3DHNA 1QP8A 1H94A 4R5MA 3V1YA 4HFRA 3L07A 5HWSA 1NNUA 4LSMA 1EVIA 1G6KA 1MP0A 1Y9AA 1GEGA 5IZ4A 3OMLA 1EQUA 3DAPA 3DHYA 3GA0A 1PSDA 3JYQA 3BTVA 4E4YA 2CVQA 3IC5A 5G4KA 1XSEA 4PG5A 3ZI0A 3WFJA 3SJ7A 2QHXA 3KVOA 3KZVA 4IGEA 4EBFA 1MFZA 2NU6A 4OKIA 3UVEA 5BT9A 1P31A 1FMCA 1LRKA 4GWKA 4QFCA 1PJCA 5A06A 2WDZA 1T1SA 4CMHA 2GO1A 3KSUA 3PWSA 4XR9A 2FWMX 4Y6RA 3GVXA 3JQAB 4BKRA 2EKLA 3WMWA 2SCUA 2WE7A 3GUCA 3V2GA 4D3DA 4KOAA 2AEFA 4W82A 5DCWA 4Q3AA 1DOHA 3WR5A 4L4SA 2J3IA 4QECA 1NWHA 2CMDA 1LDNA 5LC1A 2NLOA 4MPDA 3NGXA 3WSWA 4AVYA 1H6BA 4CLRB 3DZBA 1VJTA 1C0IA 4J7UA 4BNLA 4JROA 4D3SA 4XA8A 3JQ6A 4LGVA 4RGBA 1G0OA 2FPGA 2J6IA 1A71A 2CZCA 5F1PA 5G0VA 4BNKA 2C54A 3ROKA 3RKUA 4AJ1A 1MXHA 3RBXA 3RBZA 2HCTA 2JD2A 4W9NC 1UDAA 1BW9B 4IDDA 1ZK0A 4CM4A 3DZGA 4D3FA 2EJWA 4FR5A 3IIEA 4CM8B 1VL0A 2Y05A 3U62A 4OSPA 2F00A 1A27A 2B4RO 3FR7A 1NFQA 3AY6A 1KEUA 3GPIA 2PA3A 3T7CA 1IYZA 3I9OA 1H9AA 1TVEA 2DTEA 1HL3A 2EKPA 1X7DA 4HUJA 5B37A 4XEHA 2PY6A 5L4SA 3GLQA 1X14A 4YJGB 2X8LA 4RZHA 3FPCA 4YJGA 4WLOA 3PGXA 1MG5A 1NAHA 4KDEA 5CFZA 5GZ1A 4OHUA 4WLEA
chains in the Genus database with same CATH superfamily
4NPHA 1ETHA 2JLWA 1GLGA 2IIBA 1IBCA 3EIEA 2CYAA 1JDJA 3G2OA 4TRRA 1QRTA 1NVUQ 3QKIA 1YF3A 4B6PA 1QRUA 2KBFA 5C8XA 5LQJA 2YHIA 3HYLA 2BBWA 4LHZA 1Y7PA 1GRRA 1JR3A 1Y8AA 4HNSA 4NESA 3RS9A 3M70A 1ESEA 2RHCA 3KZNA 3BH6A 1WZCA 4ZWNA 3PG5A 2XGJA 4JX9A 2CUZA 1W9HA 4PLYA 1EGAA 1K75A 2AXNA 3JAWB 2X23A 3OOWA 4KMSA 2ZVQX 1FSFA 5IVDA 2IH5A 1NDUA 1G6HA 3KPWA 1WXQA 4KWCA 5K3BA 3ZHZA 4R0VA 2ATEA 4JOCA 4F4FA 4RA6A 2EBFX 4PZEA 4JT4A 1T5DX 1H2BA 2VWQA 3K71B 3VZPA 2BI4A 3ESQA 3K9WA 3HRHA 1HDOA 5TNXA 2CHQA 5D86A 3O4GA 1CEXA 2L69A 4U3JA 3R8CA 3KV3O 1O6CA 1W6RA 4UBMA 1W85A 5H7XA 2ZSIA 1TVCA 2EFCB 2RJOA 2YOGA 2FHPA 3E7PA 2Z1DA 4KFUA 1U4SA 4JSTA 4CN8A 4EPTA 1JDUA 2HA5A 2JLQA 3TJRA 5B5SA 3N0XA 1PYGA 4CV1A 2X9VA 2C58A 1NIJA 2KQUA 4BMDA 2O2HA 4GPTA 3WSTA 1EP9A 2Q6VA 5IVPA 1BMTA 4XWGA 1Q1BA 3ESYA 1QE3A 3AEUA 4RK7A 1N4AA 3RQIA 2I6XA 4LDPA 4I3HA 3SR4A 1C4OA 3TLGA 3GP3A 5JMWA 2AUNA 3GQBB 3GP5A 2W37A 3C5EA 2RHLA 2BDUA 2E0IA 5FAXA 4IJ6A 1YO6A 5HQ3A 3KQKA 3FZEA 1CJBA 1YR8A 5AOCA 4JYBA 1QVZA 4NYMR 1VSUA 1O8BA 1AG9A 3UJNA 1P2VA 4C0LA 1H2WA 2ZAIA 3KTAA 4CBVA 2Y0CA 1NW5A 4FX5A 4RVSA 4UBIA 3U39A 4W9NA 5JV5A 3FN4A 5EMLA 2C9DA 1QCYA 2XQKA 1ABFA 4XOUA 1AKTA 1W8DA 3H2HA 5EMNA 1BXKA 1LFDB 1OUMA 4JUBA 1NVGA 3NT5A 4QATA 4YRBA 5AVRA 2ZQ5A 4WY5A 2R8PA 3CUWA 3F6BX 7ABPA 5C46F 4DJFC 2Z0MA 3MWYW 5CU7A 1I36A 1WXFA 3Q3EA 3UNXA 4GUAA 2VQEB 1KVSA 2CYBA 2LTAA 5KAMA 1HRDA 4KDRA 3F2VA 4RM2A 1E2MA 3GIWA 3IVAA 4GF5A 2Q9UA 2JDIA 3VGPA 2GYWA 4TMXA 5C4IA 3FBWA 4AYTA 1DKOA 3EBPA 2BCJQ 2V58A 3PLRA 5JMPA 5FLYA 3MBKA 1L8QA 4Y1GA 2HHJA 1JPNA 2EBWA 3H1FA 5DYGA 5EKTA 5U1PA 4L16A 1X8XA 1YRWA 2ZSFA 2YHAA 4XD7D 2D1QA 3QWAA 4UW9A 4LA4A 2MMGA 3F6RA 5CPFA 4B0OA 4Y0NA 4B8WA 2IEGA 5FLKA 3R6WA 3JAMA 5IVHA 4TSFD 4JOSA 2F1KA 3HLKA 2CNNA 2H7CA 2ZAGA 3Q1LA 4UZEA 1PG2A 3M0EA 3BGVA 4AYXA 4LF8B 3EPRA 4EHNA 1C2YA 2W0MA 2GK4A 4LK3A 5DI9A 1T2FA 3L7YA 4FHDA 2H4FA 1KFJB 4LK2A 3RIYA 5BR1A 4B3CA 3WO1A 4UKDA 1Y6FA 1OC2A 2IOFA 3C1OA 3NOOA 4WADA 4UM9D 4WFIA 1WTAA 4CMIB 4EI9A 4BLUA 4N18A 5DYWA 4EENA 4HX9A 1XDZA 4HDOB 4PFKA 2R6GA 4BKQA 4V1CA 4LJ8A 1NATA 1SVOA 5BWOA 1OGYA 1NQ5A 2NX2A 2RGYA 4HH0A 1UH5A 3WWPA 4CYMA 1RXYA 4IXWA 4RVNA 5J2TF 3OUTA 2A9PA 4RZIA 5LMZA 4L27A 4OUKX 2Z95A 2XT9A 4BX2A 2FN8A 1Z33A 1WIWA 2ENUA 4RA9B 5CLLA 2IXTA 1HTBA 3QLJA 5G0SA 3KQMA 1DWOA 5TQ2A 1QS0A 1AZSC 3EIFA 5JSZA 2C99A 1SD5A 1P1FA 3UMFA 3JTEA 3NRCA 4MLZA 3CH4B 3ITEA 4DLBA 4FM9A 4IG4A 3ZU5A 4BMXA 2HJGA 4D0SA 1G20A 2KWIA 1IOZA 1BN6A 1UBCA 1QGYA 2A94A 2C4UA 2HCFA 4MQFB 3WGYA 4B4VA 4B3JA 3CZMA 3EXIB 4Q21A 3O2SB 3RUAA 3UK1A 1H6AA 5FPYA 2ZRJA 2M6LA 1FTGA 4DEXA 2GS9A 2FWPA 4MPPA 3ZHSA 5LDHA 4ID9A 5EPOA 2H5LA 2R8EA 3ISTA 2RGGA 3V42A 4IIUA 5BSGA 2G0TA 2XNKA 3IOYA 2YRFA 1XJ5A 3ENVA 3O8OA 1J8QA 2KB0A 1R66A 1DSSG 1CUHA 2AI3A 2DFNA 2EC5A 3E23A 3SZOA 2HZ7A 1TU0A 3MERA 5LL6P 4A5SA 3ZK7A 2ZU6A 1DT5A 2C7GA 2WKPA 3D1VA 3EY9A 5IJZA 4N5HX 1N7JA 4G5HA 2G09A 1RWQA 1JA0A 3JQBA 2X58A 4PQGA 2WF7A 1F2UB 5AP9A 3RUEA 2BCEA 3PQ5A 5ALPA 4NNJA 1T2VA 4RHXA 2VF8A 2VSOA 3HWX1 3Q7TA 2CBZA 3SYLA 1XTBA 1XPUA 1GCIA 3MLAA 4LCBA 1GPAA 2RONA 2OCYC 4ND3A 1IZYA 5B2EA 4LAFA 1CEYA 2GBFA 4GPD1 4P3NA 1CUWA 3H9UA 2P11A 2ZS9A 1V5FA 1OFIA 2AL7A 2BSAA 3LZCA 1Z6ZA 4ZIRB 2ZUVA 1EVLA 2GT1A 4GNRA 4TL7A 3DHEA 3FHOA 4X61A 4F0JA 4ABTA 3TLMA 2VT3A 3N58A 1Y9DA 1B00A 5EP3A 3UT5B 3EB9A 3Q8MA 1VCNA 1CQZA 1R0SA 5EXSA 1UPAA 1TF7A 1XQWA 4J0DA 1N2CE 3OOYA 4L7VA 5T4FA 3SZ3A 3LUCA 4OJQA 4ER3A 1YVPA 3O1LA 1G3UA 4DV5B 1TK3A 1B6TA 1SC1A 2JCGA 2Q9AA 2H48A 3CLTD 1NVBA 3UMVA 3W4JA 2H7VA 5JZOA 5CNIA 3WLIA 3I34X 1WCIA 1E69A 3RJ9A 3ZE7A 2O3SA 1UIMA 2ILVA 2XW6A 2ATCA 1W0JA 1XTKA 3I4FA 2A0YA 3IO5A 3M5DA 4MDYA 5EXEA 4F1JA 5DOZA 5I9IA 5K3OA 1XNHA 4YCMA 3OO0A 1GT6A 1E3SA 1J2RA 1KYIA 1XT6A 2AZXA 2O8FB 4HWTA 3NKLA 4NJMA 4ARUA 4GX1A 2LGJA 5JXGA 2JJ2D 1V35A 2IXDA 1O0SA 3SHTA 2G82A 1COZA 1G5IA 2YFQA 4N76A 1KP3A 2FPWA 1SG6A 4CTKA 3OUZA 2NVWA 4WBSA 1II8B 2OAEA 5EHZA 2H2AA 3I2YX 3LC1O 1VP9A 3U80A 1RRKA 2VHXA 2VNKA 3KOWA 1ENZA 2YHUA 3E22B 4KV7A 1J7JA 4ZFNA 1MLDA 3I2IA 3TZKA 3WE7A 3TNJA 4TQAA 4TUYF 4BHTA 3WL6A 3AJRA 3RFFA 4I4IA 4JLWA 3WMRA 5AESA 1WDWB 1Q74A 3DUWA 3PEUA 4WZBB 1CY6A 1V43A 2MYNA 2QG6A 2WJYA 4P5DA 5AK0A 1X86B 1J39A 4HWOA 5I7UA 3T1TA 1T5SA 3U6BA 1NF8A 4MS1B 3ASUA 1JRLA 4PXAA 1M1ZA 4UPDA 3QYAA 5LBUA 4H1VA 3Q7IA 5AI8A 4YP0A 3T5GA 3VRHA 4KITB 4DR5B 4YJHB 1P17A 4F91B 1KJNA 2Z2JA 4Q02A 4PZ9A 2I34A 4HDMA 1ODCA 3JD2A 3ZW9A 5BN3A 5BXQC 1IBKB 3O74A 3G8AA 4Q00A 1T1IA 1NE2A 4TRJA 5BYKA 2HU5A 3RHZA 3ZNQA 2QU7A 3KOUA 3PEVA 4CCWA 2WFAA 1T0PA 3AFNA 1SM4A 3DLBA 1KC1A 1N5IA 3IKLA 1TJPB 3U3ZA 1O94D 2I55A 2UZ1A 3KJZA 4TTAA 3TN7A 4D74A 4WPGA 2QG9A 1S3IA 2JEZA 5KTKA 2QTVB 2WV7A 1CE8B 4GXRA 4JYPA 4AYWA 3OJCA 2AI2A 3C1UA 1JALA 1NV9A 5KB3A 3EDOA 2P75A 1RPZA 4KNYA 1WHTA 2PHZA 2GO7A 2Q0HA 4HVLA 4H6WA 2Y0DA 4BPRA 4IKEA 2YWDA 4UQPA 2YXLA 2BFAA 5CK5A 4TV8A 5I51A 3MGGA 4U8HA 4IWYA 3T3DA 3IKVA 5JFTA 3GA7A 1DWUA 1HRKA 4I55B 2CXOA 4JJ7A 1IB0A 1VTKA 2J3KA 1PL7A 2ODQA 3P9KA 2Q5IA 3EH2A 5JOQA 3T9CA 3N7TA 2OHVA 4C6RA 1HLPA 1LF5A 1V16A 5G4LA 4YCDA 4YPOA 3IUNA 5F5NA 4RTPA 1JLLA 4R40A 1VSVA 4N40A 4DOMA 5EZYB 1YGPA 3FUUA 1DV1A 5LQKA 821PA 2K6GA 2H1HA 2A2ZA 2Z08A 5AJVB 3REOA 2PMWB 4JQCA 4IG9A 4TYNA 2RHWA 2YXDA 3SC2B 1TD9A 1NW9B 5G0TA 4EPWA 4IDNA 3KPJA 4Q9HA 2PL3A 1E6LA 3FNGA 1U8AA 5CCBA 2PGLA 1OBFO 1QFMA 4JDUA 1LK7A 2QXUA 3ZCSA 3DDUA 1LDGA 2O9JA 3SHFA 3UHJA 3ZQ4A 2XF8A 3ANXA 2Q3DA 4O5OA 3D2LA 3E58A 4FFVA 4Z86A 2RE8A 1MTZA 1Z35A 4RAQA 4I5IA 4FBGA 3IIIA 1ZRNA 4K6CA 4M8NE 4PYLA 4URYR 3KOYA 5BQPA 3AH8A 1AB5A 1XN1A 3TMAA 2RG7A 4AJPA 4RYDA 1M8PA 4C14A 4DABA 3D8RA 1DEHA 2RIPA 3F90A 3HI4A 2OO5C 4JLAA 5KTTA 3A06A 4DA9A 4HUQB 1RWXA 4CQLB 1GGHA 3ZZ1A 4HQOA 3GAZA 4PQEA 2AEJA 4C4SA 2Y67A 3RREA 1T0UA 4K9PA 5EJ5A 3IP1A 4JLJA 2YV4A 4LYGA 2VP6A 1R0KA 2Z4TA 5AOVA 4XWWA 1C3XA 3FPBA 4EHJA 1HZZC 4GP6A 3LBFA 2PYZA 2FW6A 3DXYA 3GZNA 4L4UA 4RQTA 4B3HA 2ZAOA 4LDAA 5NLLA 2QTZA 4F2GA 2NXWA 1WV1A 1NW7A 3O8CA 3QEMA 3ILHA 1RLTA 4JLSA 3DOCA 3W3AA 1TQHA 1U9IC 2I6TA 3R3VA 5DHPA 1UDWA 5JS2A 3FVQA 2DLCX 1H2EA 4OY3A 1KMMA 4BZWA 4CUKA 2W6MA 3KTAB 1K7XB 2G88A 1ULTA 3PWZA 4XJVA 3R7SA 4QXMA 3V80A 1M75A 3ZWOA 1YIAA 1KVRA 2WIDA 3MWLA 2ORVA 4C03A 8LDHA 1PZFA 1QYCA 2B21A 3HJHA 4YJ3B 1EXMA 6LDHA 3GJ4A 2X19A 1O0BA 2BISA 3JR3A 1E5TA 3O4RA 4NL4H 4O4LB 4WFJA 5JMOA 2O8DB 4PRZA 1EVYA 2XCSB 2FRDA 3WYCA 4RDXA 1H1DA 2EXXA 2YIJA 5CCDA 1L5ZA 3LW7A 3T7EA 1CY7A 3T1QA 2GSWA 2YINC 1R1DA 1UBOS 3H9JA 2HSGA 1TTQB 4MQEA 4QU8A 5DXJA 2ACEA 5GVRA 3W5JA 2PZAA 4JXKA 5ALRA 1RRFA 3L82B 3WKBA 1K63A 2MTBA 2FSFA 2IPOA 5EJGA 4R1SA 1PTJC 1UBEA 2EGGA 3ESDA 4AP5A 2KLBA 2PWZA 3WGZA 2H9YA 3B1ZA 4LV6A 1PJSA 3DG9A 2OPHA 1ISGA 1Y5MA 1Z2OX 3CVOA 3MD0A 5KVQA 3DD1A 3L7BA 4C7OB 2NO0A 5CB8A 1JKJA 1SCBA 1B3BA 1T15A 3O9VA 1KEVA 1PDWA 1H8HD 3OKFA 4NZZA 3DOFA 3ROXA 4TYMA 4O2BF 3S5UA 5F9FA 2Z8YM 1U9YA 2NWQA 1FMFA 1DX9A 2F48A 4RPLA 4R8KA 4WCFC 4DY6A 5AM0A 4DJJA 3WRYA 2QPOA 2XYQA 1FDTA 2FR8C 3E5HA 1OIWA 5BWNA 1QRSA 1ZVKA 5C5CA 4U7FA 4PHHA 1BS1A 2XI4A 3BIFA 1ZN7A 3QVVA 3FWYA 3WYDA 1GSOA 3U1BA 2VPTA 2E4WA 5K01A 3HFJA 2X6TA 1KGDA 1Y6ZA 4KWHA 3ST7A 1JQKA 1C0PA 1ORDA 1P5ZB 5F21A 1F12A 4QPPA 1N2JA 2GTPA 1CVLA 1W0KD 2XTZA 3EXFB 4RXUA 4HGYA 4IOJA 1LPSA 5DEOA 4TKLA 1QP7A 1H5NA 1LQUA 3N0VA 2C4HA 3T3GA 2Z2IA 4ZEXA 3DL7A 3ZI7A 3OA0A 1A7KA 5DHRA 1UK6A 3NHAA 3QVLA 2K87A 2X1VA 2JJ1D 4KI0A 2I3AA 2V6FA 3GNQA 4QDKA 4US1R 4XWKA 3BA1A 3F0TA 2ZVPX 3T7TA 2YYZA 1CDOA 3R3SA 3EQ2A 3FOEC 5EVCA 3TQIA 3F74A 4F21A 1R12A 4GZ6A 3VSAA 1U8EA 1MDBA 4ZPJA 5BPHA 4Y98A 1GTG1 1EGVB 1L1RA 1K2WA 1OKKA 2PS9A 4MGYR 4UDXX 2Q46A 4CF5A 2OVFA 4URVR 1QQ5A 2HREA 2BCGY 1CZUA 2DP4E 5FBRB 3P97A 3LPDA 2A67A 4XVRA 3VU8A 2HY7A 2ATVA 4I50A 3AG6A 3D8TA 1LQ2A 4Y2GA 4DG5A 1DIGA 4RJTA 3NQ41 1QPZA 2XA9A 5FB3A 4RACA 4TSKA 5LDDC 3BMQB 3D0KA 3EH1A 3BFVA 4JP2A 1QM5A 4PE5B 2K7FA 1HE5A 1L5GB 3GMSA 5CRIA 3ZNOA 4B8ZA 2ZIWB 3WK9A 2R7NA 3QPDA 5EQDA 4NULA 4ES6A 4CTOA 2H92A 5DVZA 4GGPA 3EVEA 1I3NA 5LLSA 5I3ZA 2FN3A 2JLSA 1D6SA 2DQ4A 1TYDE 5J1TB 4AJ4A 1QGUA 1WLYA 1NN3A 4QYTA 4F06A 2C83A 2ZJBA 3AEZA 2XUFA 2NVOA 4ND6A 5LA6A 5HOEA 1XMQB 1IWPB 1HEYA 3FMGA 3GLIE 4QG7A 5EIAA 3TNLA 1JEYA 4OQDA 1FDSA 2ZYGA 3PQFA 1FLDA 4I99A 3N86A 1ACMA 1JLHA 4XARA 5AVWA 2F7SA 3OEEA 5F9MA 1G18A 5BSHA 1ULSA 3B1KA 2QRLA 1U3TA 3AI3A 3DWIA 3SS8A 1QZTA 4CL8A 5COAA 3GYGA 4FB5A 1C3OB 1G9SA 1I4DD 3N8NA 4Q15A 1I2AA 1ZD3A 4JLMA 3SQNA 3FSGD 4RMNA 1F60A 2G5CA 1BKSB 3EX7C 4M98A 1MPTA 3STTA 4C0HA 4OFBA 1FS6A 3UK0A 1U8XX 3NC0C 1GTVA 1E1LA 1EJ6A 3T38A 3TXAA 3VXKA 2V0NA 4BNDB 1L7AA 2BONA 1MHTA 1KR2A 1QH8A 1GRCA 1ZJ6A 3CRZA 5DFAA 4JFRA 5FULA 1VPDA 2IPMA 1DDGA 1M2FA 4YPVA 1P74A 1IZZA 1IHPA 1NVAA 2I2FA 5J2UB 3AKDA 3CW8X 4LY6A 3T5BA 3OQBA 5DM2A 3UBTA 1MQ9A 4D0NA 4ZAFA 1JG1A 3MCZA 3SC4A 1M1YB 3UUGA 4N9QA 1H3NA 4AZ0B 1SBTA 4L7QA 1IWBB 4NBKA 4EO4A 3KKNA 1HPLA 3GGGA 3RU9A 4F4DA 1ZW1A 2FPRA 2JFZA 2REXB 4I9NA 5AKYA 2GQ0A 3DF9A 2BZ0A 1TX4B 3ORYA 4MQEB 2IYOA 5ICCA 4PRKA 2ZXEA 1XVVA 4ARCA 4G36A 1UMCB 2QLJA 2CDBA 1N34B 4AJKA 5JS6A 2F64A 3AV0B 3KEMA 1O08A 3NTOA 4JB3A 4V0RA 4YB8A 4QOJA 5KSZA 4B43A 1VLHA 5FL7D 5JWOA 4AJEA 4TKMA 1HL7A 2P9HA 3NG1A 3QP9A 3CEPB 1ZL0A 2KMLA 2OC4A 4NCIA 4CMAA 1NWCA 2VLBA 1Q15A 2A5DA 2X9NA 3PSHA 3CW2A 1VRCA 3NDPA 4B6JA 2XJ4A 3FTNA 1L9XA 4PRYA 4PO9A 2DCMA 1IK4A 1X39A 3LT5A 4CEJA 1XNRB 4JVMA 2EF1A 2L82A 4ZO9A 4C05A 3MGKA 2Z9DA 4RCYA 3V1UA 3RWOA 1CUXA 4QNRA 2GN0A 1AN0A 3B13B 4N12A 4PF1A 4R6WA 5CR9A 3TRKA 1MMFB 1QK3A 1XMXA 1AQUA 1RJ9B 1E1RD 4IIJF 5A3SA 5IH7A 4LSWA 3G5TA 4D9HA 4MB0A 2P3SA 4P7JA 1O97D 1XYVA 3F4KA 2NNLD 4GR4A 4A8PA 2P35A 1RAEA 4X64B 2CFTA 4RESA 3PFKA 1A8QA 1JX6A 1W47A 2IDJA 3FNHA 1CUBA 4Q7LA 4FOPA 2ZXUA 2IIQA 2UZ3A 3I1JA 3LUKA 4F9FA 1KZ7B 2AWNA 2XBUA 3ZZNA 3HK2A 3Q3VA 3L6DA 1X1BA 3JQ9A 2V3VA 4RTMA 4J43A 3E5RA 5EKXA 2I1VB 3ZBPA 1M10A 2D3WA 4QYXA 4B32A 1TEZA 1YQQA 1HQKA 3EPJA 1WB4A 1Z2NX 2CHEA 1QMGA 3ELBA 5HEKA 1K97A 2VJCA 1UXOA 3JAWA 3J7TA 2PX2A 4H7FA 1IBRA 5EAIA 3TW8B 3VVLA 4QTZA 4AN1A 1NY5A 4L3WA 4EF5A 3R2JA 3I72A 4XVQA 5CPBA 1Q2UA 2ZB3A 1BMFD 1XKQA 4C0WA 5EHIA 4UTNA 2Y27A 1C14A 2JVIA 2IX3A 3OFKA 2E21A 1KETA 5ICSA 4TXMA 2I29A 1IH8A 1YE3A 3O2JA 1ZJ5A 2REOA 3LY5A 2DWCA 2IU3A 4KJZA 4XWTA 1V8PA 5DNWA 5GJCA 1HSZA 4KVGA 3D7RA 3BB3A 1Q22A 1MNAA 5HMMA 5KNDA 4EYGA 4NE2A 2P9BA 2OMKA 2ZOSA 4FSDA 2PH1A 3U3JA 2JCSA 3NYRA 3REQA 3IP9A 3EXEB 4KQ6A 1RXWA 2O05A 1XZDA 1OU0A 2GPNA 3WIVA 4HQRA 4JJAA 3HL4A 1GQOA 4WRRA 1TD1A 4MS4A 1KZ6A 1ZOLA 1DTWA 4PR0A 4AJLA 3LWNA 4ER6A 3V32A 1QRRA 4I4LA 2O1SA 5CEEA 4IJVA 4F4HA 1MTOA 5C8YF 1QIIA 1U8CB 2RGBA 3KM0A 3LD9A 4HRVA 4AZTA 1NJ2A 3ICEA 3CLVA 3JASB 4KYTA 3ADOA 3PYMA 3T12A 2KJQA 1GPKA 2FY8A 4B73A 3H2YA 4KNVA 1SA0A 1OLUA 3L4BA 5BQ5A 4PSCA 4C7MA 5AICA 4KVFA 1S2GA 3Q10A 4K1XA 1NNLA 2JAQA 1GUFA 2ZTVA 4DMRA 4J4TA 3FKSD 2JGJA 1I6LA 1W581 5E1BA 3WS7A 4N7BA 2I4NA 2XDAA 3GPDG 2PQMA 2XRMA 1XEAA 2XTNA 1AA6A 3FOBA 5CXSA 4EH1A 4OYHA 1YUBA 4M89A 4Y1FA 5HCIA 3W9SA 2V3WA 2DPLA 1H9BA 1VLZA 2YJTD 3AFOA 1ENOA 2C61A 1EHIA 4ZEOA 1XKLA 4HFNA 2O2SA 1UWCA 4BBAA 3O93A 2H5EA 3GUZA 4J29A 1RYEA 2OBNA 4I4NA 4MLDA 5EINA 4ATNA 4HFJA 4CIDA 4E1BA 1A04A 3QEAZ 2CZGA 2XAAA 4FUTA 2C2YA 4O2AB 4Y6PA 2R0QC 3OQHA 4Q3LA 4A6XA 4DQXA 3AFGA 1V39A 3DAOA 2YV2A 3A6KA 4QTYA 1K3TA 4UCWA 3J80A 2Y3IA 1EFPB 1KZGB 4WK2B 1L9KA 1ZPDA 3E7DA 4K3UA 1NF3A 4IH1A 5EJIA 4Z3OA 2X15A 1FNNA 1F5SA 2JH9A 1KNQA 3L4KA 2M98A 3VC3A 5IT0A 4KIUA 1EG7A 5C8YB 1QE5A 2VTVA 1M1UA 4PZUA 1IUPA 1ML4A 4H1TA 4R2MA 3SOZA 1Z6GA 4EKIA 2AZMA 1FP2A 4J91A 5DLQC 5AVQA 2I4MA 3DNFA 1BDBA 1EFTA 3VSBA 2D0PB 4AMBA 4BE4A 2XCOA 4MW7A 4AP9A 4K26A 3FPEA 2ZZKA 3L18A 3ZYCA 2VJLA 2JFOA 4OM8A 4CI9A 4D44A 3LC7O 5H70A 3CUYA 4OD0A 4RV4A 4I9UA 4DGQA 3B6JA 2G71A 1N2CA 4Z4QA 2J5QA 3HLTA 2VS1A 4LWQA 5CFQA 2ORYA 4QBHA 2FW7A 4H6VA 4RADA 3LFTA 4UUNA 4PN7A 3KPVA 3MJ4A 3PX3A 3BE4A 1RYYA 2O8EA 3WC4A 1TK9A 1XXHE 2QTTA 3EC2A 5G40A 1F2UA 1R9JA 2X5OA 4LXQA 4RJLA 3RC9A 2H0RA 2V03A 3WGVA 5J40A 1C3LA 1USGA 4X1YA 5GZ3A 3GLHB 5IT9A 1WV0A 3LPCA 4L9WA 3WA6A 4ZK6A 3PCRB 3A9TA 4RFVA 1MENA 3DB2A 4EGFA 1LSJA 4ZVOA 3ECAA 4D92A 1XZMA 5EXPA 4H1WA 1HE4A 1ZCZA 2E3JA 3BWYA 1I9CA 1UQTA 1XRJA 1M74A 1X77A 2B83A 2GHQA 2HAEA 1KEPA 3D7SA 5H83A 3RFXA 1KRXA 2IDZA 1A95A 3OCXA 3WOVA 3NRBA 1U4NA 3C87A 4MVJP 4Z0PA 3IB6A 5KSWB 2GJAA 3R5TA 4FIZA 3BIXA 3LYHA 1PBTA 2AN1A 1PT7A 3AG5A 5KMGB 1YR6A 8ABPA 1KPHA 2ZTUA 1XDBA 1AE1A 3EA5A 1ZINA 1B42A 3FPKA 2GBLA 3U17A 3RU3A 5HMLA 5JCPA 1ISHA 1ESMA 4N6NA 9LDBA 5BO5A 3U5TA 3JQCA 4DA0A 3U56A 5JCJA 5FUMA 1XTJA 1KRWA 4K0RA 2Q7DA 2IVFA 4S35A 5A04A 3W1VA 5JAZA 3CNHA 2ORWA 2X22A 3AINA 2BFWA 3U9TA 3OCWA 3UT0A 1WG8A 4NYIQ 3K4HA 2V7QA 4I55A 4PFJA 2NP7A 4P31A 5IK2A 1RZVA 3ED5A 3K1YA 4HI0E 1BX3A 4O02B 4EVQA 4EB6B 1GAQA 4FC6A 3CKYA 1MNQA 3CW9A 3RVNA 1SCIA 1U3UA 1RC8A 4NJMB 4RIFA 4KQGA 1L5QA 2GVNA 1E7SA 4RD1A 4DLZA 1SZJG 4P2BA 5F7ZA 1THMA 1ECPA 1G21E 3BZBA 5ED0A 1U90A 1JP7A 1OFVA 3D5TA 5A6SA 4X9XA 2I7VA 1KIMA 1FRVA 3NBKA 2XA2A 4BRSA 5ADUS 1X8KA 4ITRC 4R51A 5J4YA 1SG0A 2P77A 5LMNB 4H59A 3WAKA 5IT4A 1JFLA 2C04A 1TNDA 2H4YA 4MA4A 4M0MA 5EZYF 4I4TB 1OI3A 2AD1A 2ZDQA 3E22A 3SS9X 3URKA 4C0AC 3RUFA 4KR3A 2PTHA 3GAMA 3HEAA 4IJKA 4OHVA 3AIIA 3NYQA 4QU9A 4XOIA 5A2QA 4M1ZA 1HXHA 5DX1A 1QYDA 1UK9A 2NQ2C 4OJKA 2TMDA 3OM8A 4BNZA 1YUMA 4V0OA 4WGFA 5G1OA 5IHPA 3KQHA 4UZSA 1KJYA 4C07A 2HD4A 3G2KA 4NYMQ 5KVCA 2P7HA 2P67A 4ZJZA 1WOMA 4BO4A 2HDWA 1ES9A 3HCAA 2CCJA 2ODAA 3HE3A 3D3JA 5AJZA 3EGWA 4DBLE 1ACLA 4OX9Y 3BN3A 4ZJPA 2C9MA 3IDOA 2JANA 3MZ0A 3Q9NA 1ULBA 1XX6A 4GLFA 3W04A 4ABYA 2GOYA 4KV9A 5SY4A 4RIGA 4IOMA 1JDBB 3RSFA 2PMEA 2RK3A 5DIFA 4ND5A 1TM5E 1XU4A 2HEGA 1ZNYA 2TSYB 4WN3A 5COQA 1P1JA 1WPXA 1UZLA 1EM8B 3DL4A 2XUHA 4HGRA 1HDCA 5A4MS 3L0BA 4JJKA 2AEMA 3QSGA 1XA0A 3DNMA 3WGJA 1USWA 2P1DA 1TE2A 2QQ0A 4LQLA 5JAPA 5I9NA 1CR4A 3OETA 4M1EA 1YU6A 3W6ZA 1T4BA 1C30A 2H2FA 3VNBA 2CMGA 3DOIA 4GOJA 4FZ3A 1ZOSA 1M1YA 4BEBA 4E6PA 4V1CI 4U3JB 4RZ3A 2AJLI 1F1JA 5I9MA 5IPFA 1MZPA 1JA9A 1KVQA 3EXHB 1TFUA 3GH1A 3DOHA 1M2VB 3RVOA 2MR6A 5I8WA 3ANYB 4NENA 4EGSA 3N2IA 2JLVA 5GONF 5DSZA 2V7EA 2V9CA 2WVAA 4DR4B 2VIIA 2BM9A 4ZVLA 4RKWA 3K1ZA 3ORRA 1NUAA 4BAGA 3DFZA 4DL9A 3RPEA 1N6HA 4HEA6 4G5FA 1WHTB 5CDHA 4LOLA 4IX9A 3CKLA 3IJRA 4Z9FA 1SQ5A 4DCMA 5JFOA 1Q0HA 1ZFNA 3LX4A 3STHA 2QL9A 1GZVA 3GUYA 3HN7A 4U7JA 4C4AA 5KYYA 1XLWA 3NHKA 1OZFA 1YZNA 4HN4B 4WLVA 4BXOB 2GEKA 1J00A 1E3QA 2CMKA 1XWIA 1J2YA 3CT4A 1X1EA 4BO7A 1M6EX 1HT2E 1XZFA 1AUQA 1JJ7A 1FTQA 3NBYC 3SWWA 3EUWA 3HMQA 5DWQA 4KHZA 1S3FA 1AGXA 5B7PA 1CDEA 3AHJA 3W3AD 2B8EA 2OUIA 1PR4A 3FPAA 4TL8A 3N0WA 1CCWA 5FOQA 1OSNA 4E2XA 5FI3A 3KT8A 4BB9A 1TRHA 3M2PA 3FNEA 2H6EA 2WB4A 2C2XA 3Q2IA 2QAGB 1I3CA 4D9NA 5CDUA 5CDYA 2PTGA 4KBFA 4NBUA 2P5YA 3AT1A 3W8NA 3PWKA 1WZEA 1BZYA 1IG0A 1Y1SA 3BXHA 5JAOA 4XM1A 5KVVA 3EIOA 4P4LA 4NFHA 1M7GA 3IQWA 4JFAA 3DDWA 5FNVF 3VYUB 4COKA 1OAOA 5IDWA 3C45A 3ZVKA 2WU8A 5EZYA 3B1JA 1EFVB 2WQZA 4P58A 3O38A 1EQ2A 3FPLA 4EGJA 1M1NA 2DHQA 6YASA 3GLGB 4MK4A 1GL7A 2GI4A 5ALDA 1DFGA 2P6PA 1TTHA 4DT1B 3OJWA 2FQXA 3AERB 4LXYA 5GJWC 4N6GA 3VPDA 4WV3A 3AC0A 2JH8A 1QFXA 5AI0A 1UWVA 2ZB8A 3ELYA 3OZXA 2CLSA 4P53A 1DAOA 1ZRHA 1RPTA 2GCNA 3QVGA 2NP6A 4FXOA 4Q3EA 1O87A 2NPOA 1PI3A 3DOOA 4R0MA 3HV2A 3E1GA 2Y9PB 3HYRA 1BHQ1 3BF8A 1JG2A 4ENUA 1UBTS 4Q0MA 4R3UC 1TGYA 3MT0A 3UJ9A 2ZZNA 2ENWA 5L3SA 3O92A 4N5LA 5FTNA 2YQ5A 4ACBA 1FX0B 1P5JA 1RHJA 2JCYA 2QTFA 4ZYYA 4QQ8A 3ECSA 2AHRA 4X6YA 3QUCA 5A3VA 1RMQA 1QQ6A 2RFLA 3A6GA 1Q7CA 2ZQZA 3TSAA 4YUAA 2D0DA 3K9FC 3BTUA 3TR6A 4EHLA 5L51A 3TSZA 2BGLA 1FVHA 1E79D 4DJ5X 4EEKA 4IYRA 3DOJA 3USZA 3THWB 3FRIA 4BGVA 1TMYA 4BVGA 1C1XA 2ZRKA 5IS2A 2QR2A 3P20A 2DZDA 1E3EA 1T6YA 4TM8A 1XKTA 1NLMA 5LDGA 4DY4A 2YKGA 4ZHQF 2R4QA 4BFYA 1W96A 1SD1A 1YASA 2ECOA 2M9MA 3LUHA 4B3TB 8AT1A 3L6EA 3W5AA 1DLIA 2O2EA 3H75A 3E15A 2HXSA 3B1WA 2G70A 5LP6A 1P8AA 2VDVE 5EXXA 1KEEB 3IPCA 3WDMA 1W2WB 2EP8A 1JE1A 4LDZA 1V8DA 1AVTA 2UXCB 5LLTA 3PHCA 2CLFB 2NXJA 5L4NA 2IH4A 2FSPA 1O9BA 2FUCA 1UP4A 4GS5A 4UOZA 1ZGCA 4M88A 2J9RA 3R0IA 1NQTA 4RE6A 4EMTA 3ZLVA 3O75A 1F9EA 4YJ3F 1TJ3A 2ZYWX 2C8JA 4YUYA 3HGTA 3I6YA 5JRDS 2DSNA 3WHKA 2V7VA 3AI2A 4IWXA 5BNWA 4EG5A 3V6MA 5CFLA 2RSLA 2CV2A 1ID8A 4YCLA 5FI0B 3JQ7B 1XDDA 4IHJF 4FFLA 4EZEA 2O59A 1T3ZA 1QHIA 1X7ZA 2AFHA 2WKWA 2SKDA 4HL6A 4I1IA 5GM2A 2B8WA 3DQZA 2O2XA 2IH2A 1KH3A 1Y8QB 1BTOA 3UG7A 1F8FA 2JAUA 5LYJF 3P96A 4E08A 1W73A 4JP8A 1ODKA 2PRZA 2EJBA 2XXJA 3FB4A 3IAS1 4OF4A 3CO5A 1OX5A 1RKXA 1RRVA 2WD8A 2ZRAA 3KQOA 3MWEB 5CX4A 1ZJJA 3GMDA 4ZAWA 1CPYA 2X3UA 5B1IA 1OBVA 1JU4A 3V5NA 5T7BA 4U39A 3OEHD 4DMFA 5SZHB 1WL8A 1NUSA 4Y30A 4W8HA 4XJXA 1SBYA 3ZLTA 3RGWS 1P9NA 3IBYA 4KTVE 1D3AA 4HGOA 1Q1AA 2EG5A 2XE4A 2HIMA 4Q7QA 2B8JA 3PX7A 4IW3B 1BDJA 4OOFA 5AJWA 5BVHB 1CIJA 1O6BA 4BQPA 1QCCA 3M82A 3NM5A 3PCTA 4YWHA 3KEOA 4DUGD 1ZK4A 4JVNA 3GRUA 4G1FA 3MYRA 5JQWA 2BEVB 3C3XA 2I6UA 1P7CA 2QP3A 4F3TA 1OLOA 4ER7A 1NBWB 2WYIA 3CLTC 3AVXA 4KACA 4GZMA 2RH4A 3CIFA 4MI3A 1GLVA 3ZY5A 4V39A 1XCPA 3HUEA 4DFDA 1L3BA 2WHEA 3DCIA 1Z4QA 2JGFA 4YMUA 2IPLA 2JS7A 2WSMA 2X77A 5DNEA 2JIOA 2PVPA 1OX4A 1PNQA 1M0WA 2R87A 3BX1A 4JLDA 3PGA1 1EJ2A 4N8SA 1Y4SA 1JQBA 3MCVA 1SWVA 3DLTA 5DHTA 1M2WA 3L0YA 1FC0A 4P4UA 3GGSA 2C9CA 3RG2A 5HK9A 4CEIA 5BSWA 3FWKA 2ZVJA 1B2LA 1PS0A 3NHLA 3R5SA 2H1WA 1C7RA 2XYHA 1J70A 4NEGA 4RIIA 3TYXA 2WTEA 3ZHYA 4DV3B 1YNSA 4IZ6A 1VSQA 4GEKA 3NM6B 2X86A 2XMPA 1FYFA 4L9AA 2DFKB 4XWYA 3RM3A 2YH2A 1GNVA 5F33A 3PQ4A 3R7BA 4AN0A 2DRIA 4FBLA 1W4ZA 3MT7A 1V7PC 4W1SA 4A6DA 4FCWA 2XSZA 1N8KA 2J3DA 3N6RA 3AERA 2XUDA 4OXIA 4EAQA 1AQYA 4CXMA 2OAGA 3KO8A 4JJEA 1EKXA 1F6DA 4F9EA 1JQJC 2CV1A 3ZHUA 1FW8A 3T3MB 1X80A 3W9YA 2OVBA 1QZZA 2WSLA 2LIPA 1ZEJA 3OZFA 4B44A 5AUPB 1PFYA 3ZXSA 2XVXA 1UWLA 2J31A 1UDCA 1WCXA 1FL9A 4F2HA 4IQ4A 4BN5A 3RIHA 1ORHA 1U7XA 2CSUA 2P6UA 5I4BA 4L6IA 4DQUA 4F84A 4OI0A 2X5JO 3K0BA 4OB8A 4OP1A 3WQQA 2QYOA 3C24A 3F6CA 4JWKA 2GTHA 4H7HA 4CKBB 2CWWA 1QYRA 1ZG3A 1J99A 2HPVA 4I3FA 5B4VA 1SQSA 2EQ5A 4RHYA 5IXYA 4YUWA 2R8RA 4DUGA 4AQ7A 3HN6A 1WP9A 3BM5A 3I73A 2DUNA 2BOVA 2CUNA 1DBRA 4IQGA 2XZTA 4YO8A 4TT8A 2PK3A 4WI1A 4ZT7A 4Y6SA 1KZ1A 1QANA 4YAKA 4EPVA 4RZXA 2GA8A 4KODA 4LF4B 2IZ7A 2FFAA 4RGVA 1UFKA 1D07A 3H1EA 2I6GA 1LLFA 3Q0TA 3OF3A 3AZQA 4QZVA 1ECJA 2O4CA 1JXOA 2UAGA 4J6EA 4MVJD 3UWKA 3WLOA 4CJXA 3QOWA 5CVCA 4XX1A 1X7YB 1FP6A 4X71A 1L7RA 4QGFA 2IV7A 4AF8A 1Z7BA 2NU8B 1QH8B 4OLHA 2G1KA 3VC2A 4BO6A 3C74A 3NLLA 1EIWA 3PITA 4DADA 1DJMA 4B47A 1JMYA 3HU3A 3LOPA 4PN3A 3K0SA 3NTQA 1F48A 2HK7A 3RUDA 4B3RB 3JASA 4ZDJA 1NYTA 1RLUA 3ANLA 2CXSA 1YZVA 3BPSA 2DPGA 4F11A 4YGYA 2C3OA 5CDTA 2OBMA 1LS6A 1W5TA 2PCLA 3E5NA 4IXTA 3R0ZA 2H54A 3MGCA 2W7TA 1YZTA 5DE3A 4DSUA 1N5DA 1ESNA 1MUUA 1ZI9A 2AR9A 3JWHA 3NT2A 4UUBA 2X2PA 2WK1A 3SHOA 4QLBA 2IZ6A 5KI6A 2GCEA 1M8FA 2IYZA 3A6JA 3BFJA 3I83A 3O95A 5K0NA 2WQ6A 5IDYA 4Q93A 2PGJA 1SBIA 4V0MA 5B57C 1QE0A 2XVYA 3MSXA 4CM8A 4W5JA 3AR7A 1T5BA 4S2EA 1DXHA 3D4LA 2R00C 3LX8A 2G77B 1Z74A 1I24A 3VTKA 3C70A 4UHCA 2FOXA 2PUJA 3HCNA 3DUFA 3PC6A 3RAFC 2PSSA 2IXFA 1VHQA 1M72A 2GF0A 2O8CB 1YL6A 3KKKA 1U6KA 5DTEA 1GSIA 4A03A 4J16A 2ZRDA 4KFCA 2HRBA 1BWQA 1ZH0A 4XGRA 2XQJA 3QW2A 3SNKA 2AMVA 4ICIA 4PBRA 1PUJA 2OY0A 3GEEA 4FGUA 1I14A 4MYDA 5C81A 1UT8A 1NPTO 4LYJA 4C2UA 3HXQA 3P2EA 3EVTA 3SCZA 2X0KA 3U09A 5KVSA 3GLFB 1BXGA 1EK5A 2QLBA