1ISIA

Crystal structure analysis of bst-1/cd157 complexed with ethenonad
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
total genus 87
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1isiA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1isiA02
5CP8A 2VHZA 3BHIA 5JW6A 1TA4A 1R0KA 3F9IA 2P9EA 1K3TA 2BF7A 2Q4EA 2C59A 4R4JA 4QFCA 4A2CA 1IHXA 2TMGA 4E6PA 4YDRA 4R69A 4D3DA 5B4TA 3U49A 2Y99A 4A5OA 2VOJA 2P4HX 3DZBA 4MVJH 3GT0A 2O2YA 3JTMA 1MUUA 1WZEA 1KVTA 3KSUA 4ND4A 1GUZA 3VOSA 3E9QA 4GGPA 3H9JA 1LQUA 1ZK1A 1LDYA 3H9UA 5TGDA 1T4BA 2OFPA 1QLJA 8ADHA 4XGIA 3IJRA 3N58A 4M49A 4MKXA 3I52A 3B1FA 3UXYA 4CV3A 3QIVA 4W7HA 1I3KA 5HA5A 2QQ5A 3MJVA 1HDZA 3GHYA 4HKTA 3HFSA 4IY1A 2OHXA 4GWKA 4Q3CA 2GNAA 4LRSB 2NTNA 1G0NA 1NPYA 1ZZEA 3R1IA 4NDNE 5F5LA 4HFRA 3DZJA 5DT9A 4Z6KA 2GN4A 2V7PA 4YTEA 3EGOA 3TZHA 3JYPA 3PK0A 3JD4A 1M67A 3K31A 4MOWA 1F14A 1LX6A 3RBVA 2FR1A 2JCXA 4D41A 4WLUA 4Y9DA 1P1KA 3KB6A 5DN9A 1K6XA 1GZ6A 4M86A 4U0JA 2YV3A 4MVJA 4E2ZA 1C0KA 4RVDA 5FEUA 3PRJA 5KIAA 3ZHYA 4XDZA 1Z73A 1F17A 2O7QA 1UP6A 2QX7A 2ZK7A 3KXDA 4FIZA 4FFLA 4LCJA 2NUAA 1GPJA 3L07A 4R1SA 1KVUA 3B1KA 1X1TA 2JHGA 2W98A 2WYWA 5G0VA 1DIAA 4I9UA 4NZ9A 2C20A 3P7MA 1ZIDA 3DBLB 1M6WA 3OIDA 2QG4A 2RHRA 2PKQO 3PP8A 4PG6A 4EGFA 1HYEA 1YXMA 4PLPA 3IOYA 5ILGA 4AL4A 1DC5A 4NR0A 4FQ8A 3RCBA 2ZYGA 1IPFA 4BNKA 1W6UA 4IDGA 5I7EA 5DBFA 1JWAB 2HMSA 2Q1UA 4I5GA 4J4BA 4FOOA 1TI7A 3DZFA 1GQ2A 1ZCJA 4CM1A 4I1IA 3DAPA 3GAFA 3I4FA 3WMWA 3ZV5A 1RYDA 2QHXA 5L3ZA 4B79A 4PG8A 2X23A 3DONA 4Z9FA 2DC1A 2O3SA 5TJHA 1H6CA 5EIOA 3AU9A 1YQXA 2CVZA 3VHRA 4OKIA 3W4IA 2Q3EA 2A92A 3VDQA 4JBHA 2NTJA 5I7SA 4IQ0A 9LDBA 4IGFA 1JKFA 4QO8A 2VHWA 2OOSA 4FC6A 1LLQA 1E1KA 4ALIA 2HDHA 3PTZA 2V6MA 3WGHA 1K0UA 3QWFA 1TEHA 1U3TA 4CM4B 9LDTA 1UXGA 3LZ6A 2CVOA 1GPDG 1E5QA 1B0AA 4WASA 4D0SA 3WWYA 3KYDA 2J6IA 4GVXA 4D44A 1I0ZA 4Y8VA 1DSSG 4JJIA 2ZB8A 5EMHA 3IIEA 2H5LA 4IMPA 5F1KA 1ZSYA 3DZIA 3W1VA 1VKNA 3MOGA 5T57A 3RU7A 1YQGA 5F3RA 3WJ7A 3JQDA 1YOVB 2NV6A 1JWBB 4CLOA 4BMNA 4QX6A 3FNEA 2BD0A 3INGA 2JAPA 4NK4A 2AMFA 4IMRA 2B69A 2FZEA 4FFRA 1HE3A 2VOEA 1H6DA 2I76A 4GAEA 5IF3A 4E33A 3VZQA 4FDAA 3CINA 3ZN2A 1DJNA 2B5VA 3GFBA 4TKLA 4X54A 2Z1MA 1TT7A 4BNTA 4AVYA 4LSMA 1GQYA 1IYZA 3I5MA 5T8KA 4ITUA 3WQSB 1BW9A 1PGNA 3RUHA 3I23A 2PY6A 1X15A 5BSGA 1A9YA 2EIHA 2I9PA 4GX5A 4YB8A 1B7GO 2W2KB 2RIRA 1IE3A 4BGEA 1L7DA 4EBFA 3AW9A 1N5DA 4N7RA 3RBXA 5COQA 2G1UA 2ZCUA 2HJRA 5G0UA 2FRDA 2NU7A 4EJ6A 3JQBC 5JAZA 3GGOA 3ROMA 2BI7A 2GO1A 4XGNA 5L53A 3UFXA 5JYEA 3PYMA 1ZFNA 1IZ0A 4XEHA 1BDBA 5MDHA 5AXDA 3EHEA 4B3HA 4XIJA 3ZDFA 1R4MB 1N92A 1U3UA 3WJAA 1YRLA 4HBGA 2YYYA 4ALKA 1VKOA 1UJMA 2Q1TA 3PIDA 1H0KA 2ZIZA 1EK6A 4LMRA 5KJ1A 1WP4A 3HN2A 3NGLA 1UZNA 3VKVA 3W4KA 1IOLA 1P1IA 4NG5A 3PJFA 4Y6PA 4MIYA 4CODB 4AJ4A 2Q4BA 4KUHA 4QFDA 1BXKA 2X5OA 4ALJA 3U4CA 3PLRA 4N5MA 2PD6A 3TRIA 4CR6A 5I9NA 3K9QO 1E7SA 2O3QA 1U2GA 1U8FO 2CDCA 5JO9A 2O2SA 3ZI0A 1K89A 3MWEB 2X58A 2RAFA 1MFPA 3LQFA 1E1MA 2HU2A 4ZA2A 4KMSA 4CPDA 5A02A 4II2A 5C3MA 3INRA 5AXBA 1ZEMA 1A27A 2I3GA 2X9VA 3PDUA 1PZGA 5F21A 3WSWA 2NVWA 4DREA 1EEHA 3F46A 3QWHA 1FDUA 3KYCB 4GLLA 4CQMA 2OZPA 3JQFC 4HADA 3WICA 4ID9A 1UAGA 3BMQA 4DBVO 3TDKA 1CYDA 4PZCA 4YJDA 5EINA 3KO8A 3NJ8A 1DEHA 3KBOA 4LN1A 2IYPA 4Z0TA 1JU9A 2P68A 1P1RA 3PJGA 5FFFA 3TWOA 5JAMA 3DOJA 3ZWMA 2PGDA 4BGUA 3RC1A 2Y0DA 2GZ3A 3ZWCA 5JAQA 1K6JA 2H1SA 4OJNA 4WUVA 3RIHA 1BGVA 3OQ1A 1GCUA 3KYCA 4ND2A 1P0FA 2YJZA 3GQVA 4RGBA 3EYWA 3LYLA 4OIMA 5CHEA 1DFIA 2IZ1A 3ZNOA 1E6EA 3PHIA 1NHGA 4RZHA 2D5CA 2GLXA 1UUFA 4J1QA 3VH2A 4HV4A 3CPSA 3QV1A 1NHWA 3ZCXA 4C7KA 4YT5A 2CDAA 5L51A 4BKOA 2C2YA 2DBQA 2Y0CA 4L8VA 2YZ7A 2J8ZA 2I3AA 2AE1A 1X7DA 4IIVA 3RC9A 5TT0A 3DAFA 3GMDA 4U6SA 1NM5A 1VE9A 1LBEA 3UCFA 2ZYAA 3AI2A 2E37A 1YQDA 4R16A 4JP3A 1HE2A 4GWGA 1U4OA 4NBTA 4YWJA 4CMEC 2O3RA 4BO6A 2I99A 5DP1A 3D5QA 4TVOA 3WG9A 2AEMA 4IJKA 4YR9A 3GA0A 5DNAA 3V2GA 3ICPA 4BMSA 5J23A 4O5OA 4YVFA 2Q50A 2WJPA 1GQQA 3VZPA 2J5QA 1FF9A 2EF1A 4J2HA 4P4GA 1Z7EA 1PGOA 4HFNA 2JHFA 4FBGA 4J1NA 5KJ6A 1WXDA 1EDOA 1GFSA 3DOCA 5B4UA 3RWBA 3U62A 2VRCD 4BB5A 5HM8A 3FTPA 2UUPA 2VUSA 3HNPA 4MVJG 1C0PA 2XAAA 1NWHA 1PZHA 3H3FA 4BOYA 5KCZA 1RM4A 2DTEA 2FZWA 4D3FA 2TMDA 3OH8A 1A4UA 3ONEA 1SAYA 4ILKA 2NTVA 1P1HA 4XYMA 5DDIP 1OMOA 3A28A 4G81A 2X86A 2EXXA 1NR1A 1LSUA 4GSKA 1YJQA 3H9GA 3O8QA 2EP7A 3O9ZA 3VPHA 4FC7A 1WDLA 1IB6A 4FPXA 5T67A 3WGYA 1W73A 4CM9A 3HJAA 3RFTA 4BNXA 2I5PO 2Y66A 4I08A 4B4UA 1D3AA 4RF4A 4RF3A 2HQ1A 2CSUA 4IINA 3NTQA 5L4NA 1GD1O 3SLKA 2VZ8A 3AI1A 2HK7A 3G49A 1BRMA 4YACA 2GR9A 3AY3A 3FNFA 4BNNA 2NQTA 3JQCA 1DOHA 1I01A 5B12A 1F0YA 2NU9A 1CEQA 1H6AA 4BVAA 2ILTA 1SPXA 5DOZA 4YT8A 4IS3A 3WLFA 5FWNA 3FR7A 2C07A 1E6UA 3ZWBA 3U09A 2DAPA 4KOAA 1ZJYA 4W99A 5DP2A 1WNTA 3BMOB 3WXBA 1K2WA 1QXSA 3JYLA 4G65A 5IN4A 5A1TA 1X14A 2BI8A 4N54A 4BO9A 1U4SA 3WYBA 3JSAA 2NLOA 5ER6A 3ST7A 1VRWA 3FHLA 3L9XA 3OA0A 1PZFA 3FCOA 2Y1FA 4JN6B 1U3VA 4MIEA 1ZO8A 3FPCA 3IDSA 1I36A 4TQGA 4OL9A 2FMUA 5I8WA 1SOWA 3N74A 2ET6A 5AXCA 2DTXA 4R01A 3HZZA 4LMPA 3E5MA 2CFCA 3TFQA 2EKLA 2X9GA 4WNCA 1JQBA 5LDGA 3UGKA 2YFHA 3UICA 3BTUA 4DMLA 2EEZA 4CMCA 2V6FA 4ZRNA 1KOLA 3LDHA 1N1GA 3H7AA 4AICA 4PLFA 1VL6A 4FGSA 1I10A 1Y6JA 3ZV3A 1MXFA 5A4DA 3L6DA 4DC1A 4GL4A 1Y9AA 2I67A 3AOGA 3SVTA 5CDTA 1QMGA 4FJ0A 1ARZA 1LJ8A 1SCUA 3U3XA 5A9TA 2X1HA 3KYBA 1DLJA 1Y8QB 2R6JA 4E5NA 3VZSA 1KYQA 4RPGA 2NU8A 5CDYA 1WMBA 4WLOA 5EQFA 3MTGA 2B35A 4DMMA 3RBZA 4IXTA 1QYWA 1R12A 2YHIA 1T2AA 3C1OA 3MZ0A 3GNSA 1CERA 5U1PA 1UDCA 3IKTA 2A94A 1Q2XA 1YL5A 3F5QA 2NSDA 4B3IA 3JQ8A 4FOSA 2O50A 3D4PA 4J49A 4WNIA 1NFRA 3BMNA 1H9BA 1ZMTA 2HO5A 4L4SA 4BGVA 2WD7B 4CV1A 2CMDA 1E5LA 1S7CA 4XRGA 3BHMA 3BYZA 5DCWA 4CUKA 1QYXA 3NRCA 2WTBA 5EPOA 3RUDA 3LF2A 2IEBA 7MDHA 5COBA 4CM5A 3RI3A 5DZSA 1ZXLA 5C5IA 5CDGA 1LXCA 1DAOA 4EEZA 4YJGA 1NVGA 1ADGA 4ZRMA 3E82A 3JQAA 5F5NA 2D4AA 4CQMB 4B7UA 4EYEA 3K8ZA 1LDMA 2HK9A 3E9NA 3RSHA 2JD0A 3DBLA 2YW9A 4BNHA 4NH4A 5A03A 4DLLA 2CUKA 3U4DA 4E3ZA 3KYDB 3ETGA 3O8QB 4WKGA 3FF4A 3ZWPA 3S2FA 1PL7A 4DIOA 1U7TA 2SCUA 4YJGB 1LUAA 3QJ5A 4JX8A 1UXKA 3LU1A 3GVHA 1N9GA 3JQBA 3PZRA 3DHYA 3DAGA 3F4LA 2Q49A 4R54A 1YO6A 3PGXA 2EGHA 4H15A 4DQXA 5AVOA 1VL0A 3H8VA 3MJSA 4BKUA 1V3UA 1MLDA 4XWYA 4RDIA 4MKZA 1QYDA 1SEVA 2AEFA 4A27A 1RM0A 1E7MA 3S2EA 1JVSA 4RZIA 3GG2A 3GGPA 2JAHA 2QRKA 1N7GA 4CL8A 4YT2A 1IZ9A 5DOVA 4BV9A 5KVVA 2QZZA 2HSDA 1TB4A 2E82A 3I4CA 1U5AA 5JY1A 1SMKA 1NTOA 4IDFA 2FN7A 2Q2WA 1KEVA 5LCXA 4EITA 3TL2A 2WDZA 3ANMA 4XQGA 3B1JA 5JAIA 4JIGA 3UW3A 4C7JA 5JBIA 2J5RA 3GRKA 4OMUA 3S55A 1EUCA 4CQLA 2X8LA 4S3MA 3QLJA 3PHGA 4WOJA 3E5RA 4J9UE 3CUKA 3E6AA 4GX2A 1E1LA 3LF1A 2AXQA 2UVDA 5C37A 4YAKA 5A3VA 3BMNB 2FPIA 3GVCA 4ESOA 1UDBA 5JDCC 3PGJA 3Q6IA 3MEQA 4RLSA 3DBHB 4J7XA 3KUXA 4A10A 2C54A 4FCCA 4NMHA 1ISIA 5CEEA 3NUGA 1ZKMA 2B4TO 2UUOA 4DIBA 4M8SA 2QRJA 3ZHXA 2C7GA 1ENPA 1WLYA 4FJ1A 4DPKA 1PJ3A 2BKAA 3L6OO 2UAGA 1ULUA 2PA3A 4BKQA 1H2HA 1I24A 3SJ7A 3CMCO 2IXAA 2F00A 5TX7A 1PR9A 1DFGA 2CVQA 2PGLA 3C85A 4W9NC 4XX0A 4UREA 3SC6A 5AQ1A 1HT0A 4ZU3A 3K2EA 4NIMA 3ZWVA 1GR0A 1HYHA 2CNBA 1LDBA 4PGFA 1XG5A 4JROA 4PLYA 5JDIC 1P45A 3ZU2A 1S6YA 3NKLA 3KTDA 4BNUA 3PXXA 4LCEA 1A9ZA 1YBMA 2W4QA 3VTZA 3ROKA 1ZNQO 1PJ2A 1T2DA 2GCGA 4JBGA 1D4FA 2GYYA 1R4NB 1GV0A 3RJ9A 1VJ1A 3ZU3A 4GMFA 4AJHA 5TLSA 4R5HA 3WQQA 2DPHA 1WAMA 1OBFO 5I9MA 1PJBA 4IZHA 4AJOA 2VWHA 2I66A 4ZVVA 3VPSA 1SNYA 4TRJA 5T6BA 2Q99A 3JQEA 4R1TA 1EZ4A 4XJSA 4JJFA 3H2ZA 4R3NA 3JQGA 2D8AA 1XHLA 3VPXA 2G76A 3WIDA 4J90A 4NBWA 4J1TA 5L4LA 2B83A 1ZMOA 2HAEA 4DPLA 4P4LA 4G2NA 3T7EA 1JN0A 1HLPA 2Q46A 1I2ZA 1TT5B 2E48A 2OMEA 3V1YA 1PTJA 2JL1A 5T8KC 4J0FA 3PYXA 1R4NA 3DTTA 4TMFA 2WYVA 4M89A 4YRBA 4EUFA 1GADO 4CM6A 4IDAA 1UR5A 4S1VA 3OEYA 2O3UA 4M55A 1CWUA 4AJKA 1R0LA 2OBYA 1E3JA 3JV7A 2NQ8A 1R4MA 1YS4A 3DO5A 3E03A 1HDOA 1H2BA 1H9AA 3H5RA 1PS0A 1ADFA 3IUSA 4KWHA 4I8XA 3ADPA 3ZWAA 1U9JA 2Z5LA 4L4XA 1YJ8A 5TT1A 4BNWA 1EBUA 3GUYA 4C4OA 2I6TA 4WECA 3I83A 1P44A 1J4AA 3ZWOA 1V9LA 4AJPA 2VZ9A 4KP7A 2Q2QA 1WWKA 1HZZA 1VLLA 1Z75A 2WE8A 5AOVA 3KEQA 2E6UX 1CDOA 4UVGA 3VAZA 4NJOA 2XXJA 3COSA 5C7LO 1QYCA 1E7WA 4RJTA 4AG3A 4DLBA 5IDQA 4PLZA 1LNQA 1KEUA 2JCVA 3OIFA 4EUHA 1ENOA 3TQHA 4FS3A 3A14A 4CM8A 5U4QA 3O03A 3U5TA 3DTYA 1SB9A 4CM7A 1LEHA 4XB2A 1I2CA 4QECA 5DULA 4QEDA 3W8DA 4UVIA 3ICCA 3ZU4A 1ONPA 3WQRA 5IDYA 1B3BA 3PJDA 3CH6A 2GGSA 4BNGA 5TRTA 5FYDA 4AJ1A 1XYGA 1SB8A 3WGGA 1H5QA 2VWQA 4U7WA 4D43A 3LLSA 3NEPX 5EN4A 4BO1A 1N2SA 3OIGA 4E21A 4FFMA 4DA9A 4BUCA 4ALNA 2IRWA 1U7HA 2QZ9A 3H65A 4GLOA 2BELA 4U5QA 1ZSVA 4K28A 1NFFA 3DFUA 4PG7A 2ZTVA 3BAZA 1X0XA 5LDHA 3ASUA 2GZ2A 4ZQHA 2W2LA 3OA2A 3FI9A 4B4VA 3A06A 4DUPA 3QVWA 4R1UA 2C82A 3C7AA 5COAA 2X6TA 1P1JA 1AHIA 1N9GB 1NAHA 4J2OA 4L74A 3RJ5A 3WYEA 3FD8A 3ADOA 4U0KA 4BNIA 5TSDA 1KVQA 1Z7BA 1CRWG 4GKVA 4E2YA 2WMDA 1P9LA 2PKQP 1JA9A 1I3LA 3AWDA 3G79A 4BO0A 1NX6A 1ZH8A 2PH3A 3ONFA 2R00A 3AY6A 2BH9A 4I5FA 5TJ9A 1VSVA 1BVRA 1TT5A 1IHYA 3KSDO 4QSMA 1DHTA 4DQUA 3JD1A 4CLEA 2ZJ1A 1KETA 3GEGA 1BSVA 3OICA 1EBFA 1A4IA 1EFKA 4R1NA 3JYOA 3UCXA 2NU6A 1YONA 1EFLA 2J3IA 3PHLA 3ZWWA 1NQ5A 2NACA 4CLRB 1HZJA 3OBBA 2R2GA 3LVFO 2CF6A 2VWPA 1TXGA 2B36A 1C1XB 3VPFA 4AJLA 5JFOA 1Y5MA 4I5DA 1YOVA 1XLTA 1VJ0A 3DBRB 2DU8A 3OQBA 1QYVA 3D64A 3GZNB 1P31A 3WX0A 5L7YA 2E4AA 4B4OA 5G4KA 4UUPA 1HF3A 1JW9B 2HCTA 4CM4A 4QXMA 5H82A 1XU7A 3X2FA 3H6KA 4ROSA 4B8WA 4ZQGA 4IDEA 3CTMA 2CDBA 2GF2A 3W8FA 4RV9A 2R00C 1YVEI 3LC2O 3GF4A 2IE0A 2VTDA 3H5AA 1JKIA 3U9LA 2NM0A 3OECA 2ZB4A 1NYTA 7ADHA 4GH5A 3TZ6A 4R68A 4YA6A 3D1LA 1XQ1A 1OFGA 2WM3A 1A7AA 3FWNA 3R3SA 5ITWA 1XR3A 1T25A 1O5IA 3TPCA 1K6IA 4MVJP 1PIWA 3JQ8B 3ENNA 4JK3A 1Z6ZA 5DF1A 2B5WA 3DZHA 1O0SA 3WNQA 4PVDA 4XB1A 3OSUA 3MOIA 1T2CA 2D1YA 4W7IA 2DLDA 3BXXA 1DHRA 1OAAA 1AUPA 1XELA 2P91A 4QO7A 4TVBA 1OI7A 5GZ6A 3GDGA 1B8UA 3IP3A 2NVUA 1I30A 3L4BA 2BLLA 3PPIA 3VPGA 5L40A 4PZEA 2ZQYA 4CMEA 1N8KA 1AGNA 1IY8A 2C29D 4BO2A 2PTGA 1Z74A 2EJVA 1NR7A 2YQ5A 1ZW1A 1YE3A 4Y6RA 3ULKA 3FWZA 4H7PA 4RVHA 2PD3A 2IYOA 2FY8A 4P38A 1QR6A 5IJZA 2PZJA 3PWZA 4O63O 1EK5A 3TZQA 2PKRA 1I8TA 2C7VA 5KVQA 4BNZA 1CQIA 3UKOA 2E49A 2JD1A 1B16A 1UP4A 2PV7A 3DB2A 1LU9A 3I1JA 3R6DA 4BQRA 1BXGA 2HMUA 4MPDA 4YAGA 1IL0A 4MDHA 1I32A 1XDWA 2PH5A 4Z9XA 2PZKA 5B37A 3GH3A 1LC0A 3ZNQA 4W9NA 4FFPA 3FBGA 2YDXA 3BMCB 4CQLB 5ES3A 1NQTA 1UZLA 4UVEA 1ORRA 2JD2A 4A03A 1WPQA 4MINA 3HQ4O 4RORA 4NPCA 4WCFA 3WFJA 4A7PA 3KRTA 4Q3NA 2FOIA 4GQAA 4IM7A 2BGMA 3RD5A 1DLIA 5KJEA 1M2WA 3I9OA 4BNMA 4FB5A 4DTIA 2BGLA 1ISJA 1EVYA 1DBVO 4JLWA 1M66A 4FGWA 2RH8A 1E7RA 4QT0A 3F4BA 1LRJA 3N7UA 3GR6A 1DJQA 3L6EA 4J4HA 2EJWA 4OSOA 2DFDA 3IQDB 1PQWA 5DCUA 4CL3A 3DBRA 2PZLA 4XJTA 3RQSA 3FN4A 2PZMA 3QWAA 2HUNA 3HUDA 3T4XA 4GBJA 3MJTA 4E4YA 4J16A 1HE4A 3AM5A 3WBBA 5G0TA 3CSDA 2RHCA 3HE3A 1ONNA 4OO3A 2C2XA 4Z0HO 1KS9A 1MV8A 2O48X 1O8CA 1VI2A 1SC6A 2P2SA 3NTOA 4II3A 3IMFA 4DRYA 2Y1EA 4UULA 5GZ3A 1YWGO 4RVUA 1A72A 2VRCA 3ZWXA 2JFGA 3BHJA 2C0CA 3VH3A 3GRPA 5ENDA 1T2EA 2PFGA 1M76A 3UAGA 2FSVA 4IZIA 1J0XO 3HB5X 5HBRA 3VDRA 5IZCC 2DTDA 3GG9A 2IODA 3ZNPA 4TROA 2X0NA 4UUOA 1PJ4A 1HRDA 2VHXA 5I9LA 1EQUA 5JYDA 3O4RA 1P1FA 5CAEA 4IDDA 2A4KA 3JQAB 1D1TA 2IXBA 2WD8A 1AHHA 1O94A 3WGQA 1ZK4A 2LDBA 1PX0A 3JQ7A 4ZQEA 3SBOA 5KKAA 4RQUA 3I9LA 1ISHA 1LRKA 2X0IA 4IBOA 4ZQBA 3SLGA 4KTVE 1BWSA 5LC1A 1E3SA 3QP9A 4U6QA 5EJ2A 2VCYA 1GCOA 3LT4A 1SEPA 3WGIA 3GLQA 4BKPA 4D79A 5K0ZA 5JSFA 1F8GA 4W4TA 1SBYA 4HY3A 3U4IA 3DMTA 1BXGB 1VL8A 1XIVA 2B0JA 5CG1A 3EZYA 4IJWA 1FMCA 3PHHA 1GL3A 2UV8A 1Z45A 1DRWA 4HNGA 4GPD1 1GAEO 1HDRA 4CLDA 3CXRA 1GZ4A 3TOXA 3NGXA 3HDYA 4CUZA 1SZJG 4MO2A 4BNVA 5KVCA 1EVZA 1I5RA 1ZK2A 3I9KA 3Q11A 3OHSX 3KVOA 4TRNA 3F6YA 4K6FA 5G4LA 3W4JA 1C14A 1Y8QA 2RBEA 4NU6A 5L95A 4CMIB 3OM9A 4D3SA 2AEJA 2P5YA 4I5EA 1L1FA 3S2GA 1XWFA 1FDTA 4JGBA 4R5MA 1UH5A 3DC2A 3PQDA 3Q2KA 2ZYDA 5I7VA 2ZCVA 3VTFA 3NDRA 3U0BA 4UEJA 1Y81A 3NDIA 3GK3A 3OJOA 4W82A 2P4QA 3CE6A 1YBVA 3CIFA 3PVZA 1O6ZA 1RYEA 3QY9A 4GX0A 1GTMA 4N18A 1UXJA 1F06A 4RVGA 1FDVA 1EE9A 2YDYA 1E3LA 4PZDA 1KBZA 1GYRA 2G17A 3L77A 4ZN6A 2XOXA 1LDEA 1T2FA 2AQHA 4Q9NA 3OETA 4IS2A 2V6GA 1HDYA 4EI2A 2PR2A 4DXHA 1HDGO 3M2TA 3Q9NA 3TZKA 3WNVA 3DWFA 4YJHA 1PS9A 3MJ4A 4J7UA 3LC7O 4B7CA 2Z95A 1G1AA 3JD2A 1YL7A 4K1LA 3KHUA 5G4KB 2DBZA 4CJXA 3C3XA 5IAAA 2HK8A 3ZU5A 2GN8A 2PD4A 3WOHA 2P9CA 4JXKA 2AQKA 1T24A 1Y8RB 2W90A 3C7CB 4FW8A 3FSRA 3AFNA 3C24A 1B2LA 1R37A 3HG7A 3LK7A 1B8PA 5T5QA 1EVJA 1FXSA 4NFSA 1KEWA 1NNUA 3AM4A 4EZBA 1Z82A 2J5KA 5A9RA 1LSOA 5HWSA 1CJCA 4RF2A 3GN1A 4YAEA 2VZ0A 5JMWA 2XF8A 1G0OA 2O3JA 5EQDA 3JQAD 5HRUA 1D1SA 1LTHR 3DMYA 5JCJD 4LK3A 2FSSA 4UVHA 1IUKA 3PHJA 3ANNA 4RL6A 1R0SA 3RAJA 2DT5A 3JQ7B 1ML3A 4J0EA 4D46A 4L4RA 3GEDA 1HSOA 5ICSA 5JC8A 3F5SA 1PGPA 3QWIA 3UCEA 5IDXA 4J43A 3DMTC 1Y9EA 4HXYA 4BO3A 3WS7A 2ZB3A 2DFVA 3PQEA 5CG2A 4MVJD 1NAIA 1FK8A 4MKRA 1FDWA 2GSDA 4YJHB 3RROA 1DO8A 5K9ZA 5DBGA 1C1DB 4DYVA 3IS3A 1H93A 4Z9YA 3WDSA 1JLLA 5T64A 5JLAA 1KY4A 2GASA 2ZB7A 3K5PA 1PS8A 3RC2A 1X1EA 4PG5A 5FI3A 4N5LA 4MJLA 1D7OA 2JFFA 3V1UA 1YDEA 4OAQA 2YV2A 2AA3A 1UXHA 3RUEA 5TC4A 3M6IA 3D3WA 1NWCA 2P5UA 1GU7A 2VQ3A 3BIOA 4KTTE 3ABIA 4L75A 3RUIA 4ND1A 4YAIA 5JNLA 2X0JA 4YAJA 5L45A 4D0RA 1AXEA 4K26A 2EW2A 2VYND 3IJPA 4JJGA 3W6ZA 4L76A 3V8BA 1T4DA 3FRJA 2O3TA 1E3IA 3T4EA 5CEJA 4MP6A 2VYVD 4E0BA 3ZZNA 2J3JA 5IXYA 3GMSA 1L7EA 3JYNA 2LDXA 4OSPA 1HKUA 4P8RA 1KVSA 2PNFA 2Q1SA 1VJTA 3PWSA 1VM6A 1PR3A 2OP1A 2EKPA 2FPGA 4MVJE 4E5PA 5C7IO 3D7LA 4DPMA 4XD2A 1HLDA 2BGKA 1XQ6A 1A5ZA 3I9NA 2A9FA 3OJFA 3WGTA 4Y67A 3ZGYA 3RFXA 2IZ0A 3R0IA 4OQZA 1DB3A 1QSGA 4BL5A 3E18A 3IL2A 2EHDA 5G0WA 4TRMA 4OGWA 3EK2A 1EUDA 3VC7A 3EMKA 4WCFB 2VT3A 3NJ4A 1E7QA 3QHAA 4NU5A 4YQZA 5MGBA 3JQFA 1CQJA 2DUWA 4TZTA 1JDJA 5A05A 1DIGA 4IJVA 1H94A 1DC4A 1EE2A 1QV7A 3VVCA 2OO5A 1MP0A 3GPIA 3JCZA 2PK3A 2J3KA 5EESA 3ZW8A 2FR0A 5L4SA 3SEFA 1Q1NA 4EDFA 2VWGA 2C5AA 3WTCA 3R3JA 3F1LA 1TLTA 2NNLD 2ZTUA 1ENZA 2V65A 1HTBA 3JQGB 2YV1A 2NWQA 4OKNA 3AUSA 3OF2A 4D7AA 3QSGA 2QW8A 2YHUA 5THKA 3PQFA 3NTRA 2H63A 4FN4A 3I9JA 1KIFA 4MVJF 2OXIA 4E5YA 2OBNA 5JCJA 4RDHA 1NQAO 3F1KA 3AOEC 2GERA 3DHNA 4FD3A 1E7YA 5G2OA 4LGVA 4WEQA 1T1RA 4IDBA 4KQXA 3LT1A 1N7HA 2GDZA 2AE2A 4XQEA 4YQYA 3KM0A 4XGKA 1ONOA 4ND3A 3PDJA 4KDEA 4IJUA 5CFZA 5DCYA 3L4SO 4HP8A 4O6VA 2NVBA 3MJEA 5JS6A 1BMDA 1Q0HA 1DDOA 2I65A 3D4NA 4HNHA 4HUJA 1XGKA 1VSUA 4F45A 4DWVA 2VNAA 4P4NA 4YBZA 1ZVMA 4R41A 3Q1LA 4CLHA 4XRRA 3V2UA 1U8XX 3FTNA 4I9NA 5TF4A 3SJUA 3LT0A 1OC2A 3DBHA 4YT4A 4BIIA 2GD1O 4JQCA 4WPGA 3EW7A 4XCVA 2Q2VA 4BQPA 3ANLA 3ZWYA 1O89A 2DM6A 5ENVA 4OOFA 1LA2A 4LW8A 5KNLA 1B8VA 4L0QA 2CZCA 1V3TA 3PIIA 3ZV4A 4LRTB 3OJ0A 1BW9B 1HEUA 3EVTA 4CLXA 1LQTA 4AJNA 5JY6A 4IIUA 4YEDA 3S1LA 1YH3A 4BNJA 2ZTMA 2X5JO 5L7WA 2HKIA 3M1LA 5KKCA 3ROQA 3NT2A 5KTKA 1F8FA 3EAGA 1ZK3A 3OEWA 4PRLA 3QWBA 3OP4A 1YB5A 1MG5A 3L4BC 3INTA 2VYVA 3TFOA 4BB6A 5L7TA 3HDHA 3VKUA 3NAQA 2AHRA 3HDQA 1BHSA 4CLOB 1QRRA 4YCAA 3QQPA 1ZEJA 3H3JA 3GHHA 4GKBA 5JO0A 3MJCA 2D59A 2FHSA 2JKVA 4AJEA 1E77A 3ORFA 3KZVA 2XXBA 1LLDA 3LLVA 1R16A 2WD7A 4UEKA 5BNTA 4CQMD 3K30A 2DBVO 5JXWA 1E3WB 5IZCA 3GC6A 1U3WA 2PLAA 3GZ4A 4WE3A 2BFPA 4MP3A 1Y5RA 1BDMA 5B1YA 1A71A 1PEDA 4KZPA 1DIBA 3FR8A 2AW5A 4CLRA 1WVGA 3G3EA 4CR8A 4D42A 4EUEA 4PG4A 2D5AA 3C8MA 1F12A 4IPTA 3V2HA 2FWMX 1GEGA 2OL4A 4TRRA 4CUJA 3QA9A 4QUKA 1FJHA 1B3RA 3GN2A 3IUPA 1NVMB 1XEAA 4MVJI 3TN7A 2BFOA 4BNYA 3GDOA 1KVRA 4GMGA 4Z3KA 2GN9A 4Q3AA 1LLCA 1P3DA 3A1NA 3DFZA 4YPOA 4GI2A 3KV3O 5EERA 8LDHA 3G0OA 4PN3A 2VT2A 4DL9A 1MG0A 2EP5A 5TNXA 2X7HA 3T7CA 1C0LA 4YRAA 3H9QA 4CMKA 3UH1A 3WWZA 5A5FA 1E92A 2OP0A 4LISA 3ITDA 2J3HA 3VH1A 3SX2A 1NXQA 1PJLA 6LDHA 1ISMA 4A0SA 1I3NA 1VC2A 1RPNA 4GSLA 4EEXA 4UVDA 4F46A 2Q1WA 2AQ8A 5K6AC 2X5KO 5IFLA 1Q0QA 1XCBA 1AE1A 5A04A 4PLHA 2WEKA 2HMVA 2X22A 4JNKA 2BFMA 3P19A 4RVFA 4XR9A 1HYGA 1Q7BA 3ONDA 2X4GA 4XYGA 4Z0PA 2BHLA 4CMGA 5TIIA 5IZ4A 1LSJA 2VRBA 1U2DA 3L0DA 5THQA 3QW2A 1ZK0A 3GAZA 3KOUA 2YHIB 3KLPX 3Q3CA 5EL0A 2GUGA 2O23A 1W8DA 4PLCA 1PSDA 3AY7A 3H4VA 1ISGA 3DZGA 3GVPA 5BSEA 1MXHA 4HWKA 2JFHA 2NADA 2WWRA 1I3MA 3GNQA 3QVSA 4PLTA 1W0CA 3TJRA 3P2OA 3P5SA 4JP2A 1GUFA 2B37A 4BMVA 4L73A 2F1KA 2Y1CA 4CMJA 5A5EA 3DHEA 1KC3A 2BMAA 5ER9A 6ADHA 3ASVA 4MIOA 4PRKA 4BO8A 2VTEA 4E13A 4XIYA 1YBAA 4CV2A 3CEAA 3PFWO 3IKVA 3UOGA 1YB1A 3ON5A 4B7XA 3K73O 4QTZA 3KSZO 1OZAA 4JBIA 1PQPA 5JC1A 4BO4A 3TL3A 4FR5A 1ZBQA 3ZHZA 5BNFA 1PJTA 4ZJUA 1EMDA 4RLHA 4BV8A 1KEPA 3I6IA 4PVCA 2OGUA 3DL2A 4ONEA 3AK4A 4Z3DA 3LT2A 1PJQA 2HMTA 1LRLA 4XKJA 3H2SA 1X7GA 3CZRA 1T1SA 3ENKA 2HLPA 1CETA 3ZWNA 1IULA 4XR4A 1DC6A 3DQPA 3M1AA 4KUEA 2RH4A 3TF5A 1JTVA 2CF5A 4L9RA 4QQRA 3HADA 4EW6A 2JCYA 5CPFA 1GV1A 1D8AA 3WIEA 4OXNA 4BO5A 1YL6A 2GRAA 1BTOA 2X9NA 4J91A 1WDMA 2FPPA 1X7HA 3MWDB 2G82A 1U28A 2POQX 1P0CA 3QVOA 4OXYA 5DBIA 4URFA 4RCVA 1LI4A 1ZXBA 5GY7A 4WLVA 5AYVA 3HWRA 3ETDA 4UUNA 5IN5A 1MC4A 1R6DA 4ND5A 1M6HA 2DPGA 1E3EA 1CF2O 2IEDA 1NASA 3E8XA 3NT5A 4R9SA 2EGGA 4GVLA 3AI3A 1DC3A 2D2IA 2Z1NA 2HRBA 2Y1OA 4WLFA 2JJYA 3Q0EA 4RPKA 4D45A 2GN6A 4WLNA 3DOOA 1Q7GA 2EERA 3KLMX 2W2KA 3K2BA 3C7DB 4E30A 5L9AA 1OOEA 1NBOA 1KY5A 1QG6A 1JKJA 1HETA 3E9MA 4NHEA 1J5PA 3GPDG 4I9HA 4XA8A 3SXPA 3ZNNA 4EJMA 2RCYA 3WGZA 2HRZA 4K9DA 4O59O 5JDCA 1OC4A 4LVCA 1ADCA 1EQ2A 2AG5A 1QORA 2OUIA 3NX4A 1DIHA 5C7OO 1PL8A 3RVDA 2P9GA 2Q45A 1VPDA 4NNJA 4DVJA 1RM3A 3C1TA 3D4OA 3O38A 5KVSA 2WSBA 2Y05A 3HHPA 4YJFA 2UYYA 3KEOA 4LVUA 3A9WA 4U8GA 5A06A 1TVEA 1NPTO 1NQOA 4A73A 3B70A 1N1EA 2ZTLA 3GOHA 3WBFA 2X0RA 1E1NA 4PCVA 4UAGA 4CR7A 1J6UA 3ZHBA 1YB4A 4AJ2A 4E5KA 3PJEA 4AJJA 1ZJZA 3TNLA 4IGEA 3DXFA 3I6QA 1C0IA 4ZD6A 1DFHA 4YRDA 3ITKA 3LC1O 1HXHA 1MC5A 1PU2A 2B4QA 3IP1A 3BA1A 4BNLA 5JE8A 4DC0A 2BFAA 3QVXA 3G1TA 2NVUB 2ZJ0A 5TQVA 4YXFA 3AUUA 4J1SA 4N5NA 3JQ6A 4WK6A 4Y98A 3GVXA 4NJMB 2DQ4A 3K96A 4PLVA 4CMBA 3EVNA 4R3WA 3W8EA 1GY8A 4WCDA 5A9SA 3BMCA 2ZATA 5HS4A 1PJSA 2OORA 3ROPA 1DRVA 1IPEA 4Q3DA 4WGGA 3BMOA 4OXKA 4XQCA 5B4VA 5BSHA 4WOKA 1E3WA 1NPDA 3FPLA 5H81A 1A7KA 3FBTA 4J6FA 4NFYA 4BHTA 3ZV6A 5ITVA 1PWZA 3GY0A 5ADHA 3MTJA 2O4UX 4M87A 2WE7A 4NBVA 1NFQA 4OM8A 1RJWA 3VZRA 5BT9A 3NV9A 2Y67A 3P2YA 3WGOA 3BTSA 2DVMA 3PEFA 4XDYA 4DYDA 1Q7CA 1C1XA 2DKNA 1AN9A 1X13A 3GEMA 4PLWA 3PI7A 3G17A 2W8ZA 3S2IA 5CDUA 3BTOA 3WB9A 4FSHA 2VHVA 4G5HA 1R15A 1AXGA 2VHYA 2Y68A 2Y93A 2PWZA 4RO0A 3AUTA 3RU9A 4B8ZA 5GZ1A 4RQTA 4OYRA 4IDCA 5A3JA 4NBRA 5HTOA 2A35A 4PIVA 1O95A 4E2WA 5BNIA 4O0LA 4UEOA 1G6KA 2EW8A 1UXIA 3DEYX 3GFGA 4Q39A 5ICMA 3WFIA 4DQVA 5KWEA 4FJ2A 4BS9A 4Q3EA 4M1QA 1V0JA 1GDHA 2CD9A 4ZHSA 4J7CA 3S8MA 4CMAA 2QYTA 2YQ4A 1ISFA 4CMHA 2D0IA 4CM9D 4ALMA 1SOVA 1BG6A 4WCFC 3E1KA 1HWYA 1T26A 3CMMA 5H83A 4LSWA 2CY0A 1PWXA 4DGSA 3H9EO 3UHAA 1DXYA 1K5HA 3Q2IA 4DBZA 5KJFA 2AG8A 4J3FA 4H16A 4XYEA 1R66A 3ZH2A 4AFNA 4WEOA 2VUTA 1DRUA 3O26A 3RASA 2Y0EA 1EVIA 1MGOA 5BR7A 4RPJA 1YKFA 3ETEA 3RKRA 3GNTA 3E48A 1ADBA 3AM3A 3NYWA 3UUWA 4IXWA 4F6CA 1H6BA 1UZMA 3GGGA 1V8BA 1DIRA 5AXAA 1WDKA 2ZQZA 2UDPA 4TSKA 5FI5A 4BGIA 1HSZA 1MX3A 3TSCA 3ZW9A 1DAPA 3NDJA 3PZBA 4AJIA 1PGQA 4M54A 1O9BA 4FFOA 4NK5A 3RUCA 4XYBA 5TS3A 2EV9A 4ALLA 3OMLA 5IDWA 3OJEA 3TOZA 1P74A 1Q0LA 3K6JA 3WYCA 3F47A 3BMQB 4IQGA 1U1IA 3RUAA 1XU9A 2YFQA 3PWKA 4PFJA 4UUMA 5IXSA 1ID1A 1LDGA 4XQ9A 1X0VA 2QRLA 3EUWA 3IAHA 3DDNA 4TKMA 3CKYA 1SO8A 1ZSNA 4GX1A 4BNFA 2C5EA 2DUUA 3AFMA 4HFJA 1MFZA 3TZCA 3G1UA 2PGJA 4INAA 5CDSA 1U5CA 1ULSA 3LSYA 5A9SB 3SC4A 2XPCA 4K6CA 3WLEA 1RWBA 3AJRA 2H9IA 3JQ9C 4BO7A 3AUAA 2BRUA 3RC7A 4CM3A 1QKIA 4DIFA 1E6WA 3D0OA 2WYUA 2G5CA 1V35A 3I3OA 1GYPA 4O1MA 3DBVO 2DBRA 5CPBA 1BVUA 5K6AA 1ZUD1 1PGJA 1GYQA 1MB4A 1GZ3A 5FF9A 1RKXA 3H5NA 4KUGA 4TZKA 4ZICA 4TWRA 5JCXA 1P33A 1PL6A 3M2PA 3HN7A 3RUFA 2VYNA 3OQ6A 5JDIA 3D3EA 1E0DA 1JAXA 1WMAA 3WR5A 3IC5A 4W6ZA 3K92A 1HDXA 3RKUA 3GUCA 5I7FA 4GGOA 1C1DA 3D5TA 4H3VA 3CZMA 1B26A 5HS6A 4OQYA 1PZEA 4B4WA 3JD0A 1QLHA 1B15A 4RPHA 1PQUA 1XKQA 1YDWA 3AOEA 3DR3A 5G0SA 3JQ9A 4R51A 4IQ8A 3EZLA 3GVIA 3X2EA 3HSKA 5CEFA 1P77A 2H6EA 1EUZA 1XSEA 4CM8B 3D3WB 3WTBA 3DZKA 1I2BA 1WZIA 1CIVA 3FNHA 4KDFA 2IZZA 1QP8A 2B4RO 1MA0A 4IUYA 4KWIA 5JPIA 3HFGA 3VH4A 4EJ0A 3MCVA 1NP3A 4XYLA 4YYZA 1M75A 1GEEA 4CV0A 2W2LD 5IG2A 2HMWA 4NJMA 3L9WA 1Y7TA 1V6AA 4ZQFA 3WSVA 1I33A 3VVBA 3QE3A 2AQIA 5GMOA 4OH1A 4R9RA 3AU8A 1NVTA 1XA0A 4F6LA 2O7SA 3A4VA 1W4ZA 5KOIA 1BXZA 2FP4A 3JYQA 4ZGWA 5KJCA 5ILOA 5F1OA 1C3VA 1Y1PA 3QRWA 4E5MA 4PLGA 1JVBA 2ZKLA 3HDJA 2VNSA 1B14A 2G0TA 4HFMA 3B20A 4KQWA 1HL3A 5F1PA 1UP7A 4NBUA 1EDZA 3V1TC 2V6BA 2YUTA 2QYSA 3BZUA 2D3TA 4YJFB 1Y8RA 2QIOA 4B3JA 3PYLA 3KETA 4E31A 3WMXA 5U9CA 3OFSA 1LC3A 1J49A 4Q3BA 3OJLA 2GZ1A 1DPGA 3C1AA 4J9VA 3V5NA 1PJCA 1WW8A 4J4TA 3F3SA 4XZ3A 3NT4A 2VN8A 3BTVA 3Q9UA 4WJZA 3UN1A 1KERA 1HDCA 1FDSA 2EKQA 4NQZA 4RVSA 2O4CA 3HB4X 4NI5A 3UVEA 3GDFA 1YGYA 4HX5A 1QV6A 1ENYA 5I8ZA 4A26A 1UDAA 3B6ZA 2HJSA 3UF0A 1JAYA 1HE5A 4E12A 4MP8A 2Y1DA 1RM5A 5JMPA 3EC7A 2EWMA 4E32A 5BQFA 3GZNA 2Y1GA 1GUYA 2YY7A 4OOEA 3PFFA 4JCOA 2IDZA 4WLEA 4Y6SA 4RF5A 4E2XA 4F3YA 4FFNA 4OHUA 3I9MA 1KC1A 4P22A 4NFHA 1V3VA 4MVJM 2EG9A 3FNGA 3EY4A 1LDNA 4RPLA 3W6UA 3PLNA 3U4HA 2GPTA 2VUUA 4DLAA 3EDMA 4CMIA 1LLUA 1UAYA 3QVTA 3RFVA 4BKRA 2FR8A 3STHA 3JD3A 1LSSA 5BSFA
chains in the Genus database with same CATH superfamily
3BHIA 5JW6A 3H87A 5B30A 3DM9B 1W1UA 3F9IA 2Z4SA 4D6YA 1FU4A 4HAOA 1K3TA 2DFPA 3IEKA 2FG5A 3CUWA 4LXHA 3ZY5A 3O3NB 2C59A 2HEIA 3NANA 1UPUA 2NUPA 2WNSA 1V5IA 4Z9AA 4R69A 3IODA 1RYNA 5EXTA 2XCOA 3T52A 5B4TA 4FXOA 4CDRA 3KK0A 2YJGA 4OFBA 4URYR 4X71A 5A6VA 4JXXA 1Z36A 4F3TA 1XVAA 4CXMA 1MUUA 3OOWA 1TO1E 2B92A 4R8VA 4CW7A 5EWMB 1SKBA 1IXZA 1H8EA 1Z37A 2HNKA 4ND4A 1ZX1A 3E9QA 2RE8A 1RC8A 4P0PB 1UPCA 1LDYA 2FMKA 4IZ6A 3U3RA 1C1YA 3M4JA 3QLUA 4HB0A 1ZD1A 2XT6A 1NJFA 4XWKA 3PXDA 4GXNA 3EIWA 1QLJA 1ZCFA 5DX0A 3C8DA 8ADHA 9MHTA 1W5AA 2AJCA 3CSSA 4MKXA 3I52A 3B1FA 3SYTA 4N7MA 1EK1A 5BWMA 2I7VA 1I3KA 1DTWB 3V7NA 1XX6A 2W37A 2I6UA 1X7WA 1FLAA 1HDZA 3MJVA 1Q16A 4ZAWA 3FMGA 5C8ZA 4Q3CA 4OV6B 3DF9A 5HUHA 1YVDA 4UW9A 4Y0NA 1Y8AA 5F5LA 1WE2A 1V41E 2KBFA 3X1ZA 3WRVA 1DAGA 4LXQA 5JLJA 4IIYA 2C3OA 1G6OA 4R84A 1PVOA 3JD4A 4WXHA 1M67A 1FTWA 1YQTA 1WY7A 5I7RA 5BR8B 3L6BA 4HBZA 1PFWA 1OVMA 4JODA 1F14A 1U9ZA 3C5WP 5CK5A 3ZGNA 4IHAA 5FPTA 1LX6A 2CW5A 3M6VA 3RBVA 3L8DA 3GLHE 3RHZA 3SYRA 3WGJA 1ND5A 5KAMA 4F4IA 3I1IA 2C2GA 4H7JA 1IEQA 1P1KA 4OYLA 4O2AA 4RAQA 4RK1A 3RSCA 3ISJA 2G06A 1R74A 4M86A 4U0JA 4NF2A 2R11A 1BS2A 1FW8A 1D1QA 5LXTF 4E2ZA 1C0KA 2QE6A 2QTLA 1W36D 5B53A 3PRJA 3WADA 5FEUA 2Y6UA 1KY3A 5KIAA 4ZPJA 3NYIA 4PM4A 2HYIC 3K8QA 3OPYB 4DC0A 3M49A 4KQ2A 1VHQA 4FBLA 1O6BA 3OHMA 1E9CA 1XA3A 2CKDA 1QJ4A 3L07A 4N7JA 1X77A 1KVUA 2ZBFA 3BEOA 3B1KA 2V7QD 3K32A 1M1UA 2W2OA 2W98A 4UUBA 4ZI3A 2XUKA 2WYWA 4L9AA 3SS9X 1HNXB 3R9XA 3FTEA 2AFRA 3LIPA 2A5LA 3P7MA 4JDUA 1RE1A 1T3GA 1M6WA 3FPAA 3OX3A 2RHRA 3PP8A 2YKGA 1E60A 3KVVA 4QYMA 1JJVA 2LGJA 3A6GA 3OFNA 1K7FB 4PG6A 3E05A 4JL6A 3VR0A 4EGFA 4D5EA 5F77A 4AL4A 2P2DA 4MR8A 5DGIA 2LV8A 2ZYGA 2OCLA 1W6UA 4D9MA 621PA 1JWAB 3CB4A 1N77A 1BU8A 2Q1UA 4I5GA 5L3SB 3S0JA 2QU7A 2EP8A 1V5GA 1TUBB 2O0KA 1Z2NX 3EIXA 5HKLA 1GQFA 1U8YA 5B1HA 4UASA 3JZDA 4I1IA 3LMKA 1G1MA 3WMWA 1M54A 2DECA 1CV2A 1RMYA 1J8QA 1RYDA 2PSHA 3O7WA 3ZV5A 4XJXA 5HKAA 4FDVA 4C7VA 4CKEA 3QEKA 4I1OA 1B74A 2EHJA 1EFHA 2P69A 2K5UA 4X97A 5JFTA 3H1AA 3H9CA 4MKIA 4OXIA 1JI0A 3L7YA 1FFWA 5CFMA 5I7SA 3VDQA 4JBHA 2JLAA 2R6AA 3QEMA 5HUQA 3KPVA 1KI9A 1YK0A 4QOIA 1EINA 1QG2A 2NO9A 3IAFA 2FW6A 2VHWA 3DPUA 1QHYA 2OOSA 4HH0A 2JHAA 3V1KA 3R75A 4E1AA 5CM9C 1G41A 2R0QC 2J4FA 4S05A 3HXQA 1E1KA 3NWBA 4RSGA 4ALIA 2ZIAA 4BU0A 2ZU0C 4KXFB 3PTZA 1M6YA 1YZFA 4A6XA 3LH5A 3KSRA 3KTOA 1K0UA 3LQ1A 4G09A 2X14A 3QWFA 3U61B 1KO1A 3OBIA 4FHEA 1RQ2A 4D9FA 1WXWA 1UXGA 1I1OA 2CVOA 3G68A 3TTVA 1Z4OA 2IQIA 2D2VA 3NAMA 1EP2B 3OZXA 2O5RA 3HDTA 3IVAA 1ULBA 3MRSA 1MAAA 5ABPA 6AT1A 4YIHA 3CLHA 1O6FA 4ZREA 4CF7A 1I0ZA 1USVA 3ZVNA 4PGAA 1OFUX 1XXHA 2XZPA 3WLJA 4EGCB 1AQJA 3HVHA 3BX1A 5DWVA 4YR7A 3IIEA 3EXHB 2H5LA 4IMPA 1ILEA 1L5LA 2WKQA 2Z5FA 4M0MA 3MOGA 5F35A 5T57A 4KIWA 2M98A 3GLIE 1DRJA 1YOVB 2NV6A 3HUTA 2DCUA 3NU1A 5A6SA 4XW2A 4CLOA 3T7RA 4BMNA 1Q84A 5FUXA 2BVNA 3FNEA 1M34A 3W78A 1WMSA 4PBTA 3T3PB 2H16A 2V03A 4Q12A 4FEAA 2A0KA 3SSOA 2AMFA 2HPVA 4C4SA 2DFKB 1BNCA 2FZEA 2R6HA 4FFRA 4GAEA 1WB4A 3CINA 1F8UA 1I4WA 3P8ZA 1VBMA 4OREX 2FWAA 4TKLA 4X54A 1K4KA 2ZJYA 2IYZA 1N5IA 4Y0AA 1IVSA 2DWCA 2HL6A 4AVYA 3KJZA 4LSMA 1AK2A 1TYZA 2UUAB 4K9RA 5KZMB 1IYZA 4JS0A 4Q1CA 5T8KA 4ITUA 3ZK9A 1PGNA 1QWOA 1RI5A 1RQLA 2WJVA 1SD5A 2PY6A 3RUHA 3B6EA 1A9YA 2EIHA 3ZLTA 2B4KA 4JWTA 1G8HA 4AW9A 1T15A 2W70A 2GRUA 4KO1S 1RBMA 4CIXA 4MEAA 1L7DA 3U4QB 2QI9F 4U2KA 5CYOA 3IP8A 4BMOB 1SKQA 5CJ2A 2CVFA 1WM1A 3RANA 3BRWD 1HLFA 2ZYVX 1U0JA 2G1UA 1ZL0A 3F2VA 3FFWA 2QN8A 1QGUB 5G0UA 4EJ6A 4YRGA 1OGYA 3NYRA 4FMDF 2O2EA 1YIDA 3B3FA 2EWWA 1NN0A 3ROMA 2JH9A 5DGHA 1JFTA 3DBOB 3U3OA 5JYEA 2YVLA 1BJKA 3REQA 3UJ3X 1IZ0A 2Q4TA 3D6VA 5MDHA 5AXDA 3I76A 3LKDA 5EWMA 3AV0B 1Q11A 3P2IA 1U3UA 2VJKA 3P9KA 4EY8A 1YRLA 3F6EX 4K9SA 1M5TA 1MQ9A 1VKOA 4N3GA 4LUCA 3PIDA 1H0KA 1VJGA 5ALTA 1KJJA 4LMRA 3SDBA 4GOOD 3SJCA 1ECCA 1ZIPA 3NGLA 1UZNA 1Z5OA 4I4TA 3MS2A 3VKVA 5GJCA 1UFKA 1XCLA 2I6SA 2W6IA 4LXXA 3PJFA 4MV3A 2FU5C 1VRVA 1UWCA 5JVDB 2Q4BA 3MILA 1QK3A 2Z98A 4AKSA 5FL7A 1DS6A 3DNMA 2IUTA 2X5OA 4FYPA 1PYOA 1I9GA 3KZKA 2D2XA 4QWMA 3QELA 3WWCA 2Z2KA 1Z39A 2B5OA 1G5QA 2Q07A 3K8OE 4ZRDA 3R7WA 4AZ3A 9GPBA 1RPAA 2JK1A 3PXGA 4CR6A 2HW8A 5CH8A 2O3QA 1US8A 2CDCA 2J7PD 1VXRA 3GLSA 3HACA 2ADFA 1XAHA 2NIPA 3EW9A 3QKRA 1FRQA 3BL8A 1K89A 5HGJA 1PR6A 2RAFA 4ZA2A 3RJTA 3HK2A 4HYTA 3HEMA 3IUBA 1B8NA 1T8SA 2C95A 2BEJA 5AXBA 4OTZA 1A27A 4P36A 1F6DA 4WOCA 2R6DA 4DF3A 5C7YA 4Q0MA 2QK4A 2XVAA 5FO0A 3RVPA 2F3PA 1DP4A 4RSHA 2NVWA 3BA6A 3MCWA 2Q5JA 2FQXA 3F46A 3QWHA 1FSSA 2J3QA 3HU3A 3KYCB 4GLLA 2DHCA 3R8XA 3WICA 1UAGA 4OQPA 2O0HA 3TDKA 4DBVO 3I5UA 2WSSD 1CJTC 2ZRJA 3EVBA 5EINA 4KACA 3NJ8A 1XEWY 1UJ4A 2IYPA 5JARA 1GQOA 5JAMA 1LCIA 1D2MA 1T13A 2FQ1A 3CRRA 4GGMX 4GOND 5FFFA 3TQRA 4DEVA 3FGOA 3DBIA 3RC1A 1A8SA 1P6UA 1EUDB 1RADA 2GPWA 3ANYB 1S8AA 5CTJA 3O93A 5BUZA 2F3UA 2H1SA 5A3JA 5ICGA 4WUVA 1BGVA 1LBQA 1N2GA 2DZDA 2PUTA 3FZNA 4EKGA 1GGFA 1D0VA 2NXJA 5I4KA 2M6RA 7REQB 4CTJA 3L0IB 2X5XA 2I4MA 1ZGAA 3CA8A 3EYWA 4QNRA 4ZXFA 5CHEA 1V11B 1NMZA 2IZ1A 3NHBA 3MW8A 4L4YA 4ZI7A 1EM8B 3FPKA 3ZV7A 4OHXA 5J2TF 1XLTC 1TQHA 1MTZA 2GLXA 4DQDA 5K0LA 4MV1A 3P4UA 4RJ2A 2ZI6A 4KN8A 1JTEA 3CPSA 3E9EA 4YV2A 3RADC 4QZVA 1X1AA 1DT3A 1UOQA 3X2SA 4PS1A 3CPEA 2C2YA 4BKOA 1U31A 3ELWA 4Y0VA 1MRSA 4H6XA 3AEQA 1UWKA 1C8LA 1EX7A 3GRVA 2Y0CA 4L8VA 2HU7A 4EM6A 3P0IA 5M5BA 2I3AA 2ZZMA 3LS2A 4RKRA 4KQ9A 4LRQA 3GD5A 1C2TA 2F4NA 1VE9A 3BE4A 4AMVA 5DSZA 5BN4B 4EHFA 4MH0R 2PUAA 1RNLA 3DAOA 3DMGA 1X9HA 3EX7C 1P91A 1HE2A 4GWGA 1FC0A 3OO1A 1II8A 1FDRA 2XWSA 2I34A 2PZBA 3IXQA 2OLJA 4D4JA 2O3RA 3WYGA 3OZUA 1HKHA 3RRFA 2Z0MA 3K9BA 4RK5A 3WG9A 1UM9B 2OSVA 1AMOA 3JVEA 1USUA 4IJMA 1TJNA 5DNAA 2ATVA 4RKYA 3JVUA 2Z6UA 1T9HA 4EYKA 1WETA 2Q50A 1XPOA 1BMQA 3LUPA 1GQQA 5IYZB 1RHQA 2R65A 2P9BA 1M1XB 4RZSA 1VPVA 1JEOA 1Z7EA 4MGKR 4GO1A 1PGOA 1Q7TA 4J1NA 5KJ6A 1EDOA 2XJ9A 1EGMB 5C8YA 1QIFA 2OV6A 4OIFA 2H4JA 3HR4A 3L7AA 3RWBA 4Q16A 1NVAA 5EXPA 4KR6A 1G8YA 2VJDA 3ZY3A 4QDJA 4YUZA 3EXIB 3R5FA 1KI7A 1RTTA 1ZNZA 3QF4A 2FZWA 3EGDB 2P67A 4KQHA 4ILKA 1SAYA 3EMDA 2NTVA 3P4YA 1LPNA 1SR8A 4N5HX 2NPIA 2QR3A 1OMOA 1D2HA 3A28A 5C53B 1VLQA 2ZYIA 3FM9A 2X86A 1QS0B 1M0EA 3I09A 1LSUA 4YNBA 2PA0A 3O8QA 5TGZA 1P81A 1OGIA 4EKNB 1QAMA 5T6MA 3R3VA 4AXBA 3FDJA 3SU8A 1L7XA 4CM9A 2XDWA 2IEYA 3GLUA 4G8CA 2FGKA 3RYHA 3IAAA 4IINA 2VP4A 1L5SA 1S5PA 1SK8A 3H8SA 4A8JB 5INTA 5L4NA 3H6GA 2HK6A 2VZ8A 1EESA 1GZHB 2HK7A 2IPNA 2REQB 3G49A 1U2RA 1H65A 4CHGA 3U40A 3UUFA 4D74A 2G0NA 2H0AA 3TQCA 3AY3A 2BF4A 2JGAA 3JQCA 4TGLA 3RRXA 5AI0A 3EQ8A 4BVAA 3BFVA 4RHXA 1RWNA 1BE6A 3L8HA 4IFBA 2Q3DA 3WLFA 4YK7A 2IUYA 1I4DD 2PNJA 4DKXA 5JPCA 4JEUA 3GRUA 5T41A 4KV7A 3UQZA 2RGBA 1E6UA 5DN6A 3B12A 2PUCA 4MIKA 1MJHA 4QXOA 4RESA 4M9RA 3ZTTA 5KDOA 2BEUA 4R2JA 2QTRA 1QXSA 2B0CA 2JGJA 1X14A 2RGCA 2A78A 3C6ZA 2XKJE 1OLUA 4M4SA 5A0FA 2XB2A 1U4SA 3T7KA 1KRHA 2FXVA 3ELUA 3O2NA 4PV7A 4RV5A 3WYBA 1QBKC 3OA0A 1TZJA 4JN6B 1XP8A 3OFND 4MYSA 5B6PA 1OW3B 4HI0E 1ZD5A 2FMUA 5I8WA 1WIWA 3ELBA 1Z4PX 5AXCA 1U9IC 2NU8B 1M0WA 1GUDA 2UZ1A 1JZQA 4D4LA 2BT4A 4FDUA 1PTKA 4N3CA 4ETMA 4W9RA 3TFQA 2EKLA 3KSBC 1JQBA 1LTKA 2YFHA 1VG9B 2VZEA 4QEZA 4RJIA 5E2AA 1J8FA 1LTQA 5E6RA 4DMLA 4KLNA 1N2XA 4BLOA 4TT8A 4WDQA 3F7MA 3PSHA 3KUDA 1GRVA 1QPGA 2GK3A 4PLFA 4UCWA 2VP9A 5SZHB 1QVAA 3ZV3A 1G3QA 1MXFA 5KTYA 3O3CA 5EOVA 1J0AA 2I67A 3VMMA 2X8JB 3AOGA 2GD6A 2GX6A 1UJCA 5DYIA 2P0EA 3MHPA 1ZRSA 1A88A 1HOTA 1R50A 2GPAA 3AXSA 3FUWA 1ARZA 1LJ8A 3QFCA 4FJ0A 4L72A 3RSOA 2PUJA 3PRHA 3ORHA 1N2JA 3A6ZA 1MEJA 1Q77A 2NPFA 1I9CA 2ZIEA 3SCZA 2CBXA 2XZTA 5BY2A 2UZIR 3USZA 2XMGA 4CQJA 1Y9JA 3IR5A 4KR0A 2YBDA 4BFLA 1U2PA 1Y6QA 4IXTA 1R12A 5EZ5A 4DMMA 2YYZA 4EK9A 5DNCA 1NC1A 1VYTA 4G1EB 4W5OA 2YHIA 3C1OA 1CLEA 1JKJB 1P18A 3GNSA 4JJKA 1CFZA 2HPHA 4G37A 1U8ZA 1UDCA 5IYZF 3IKTA 10MHA 3GL9A 1JG1A 4AROA 2AIRA 2ZYSA 3F5QA 2OQVA 4ZYZA 2XGGA 3L0PA 4UDOA 8MHTA 1R0WA 4Q21A 4C7BA 1JDVA 1NBMD 4WNIA 1USKA 4JXJA 4KODA 5IYZA 2CLCX 5GJWC 5A7GA 1QNFA 4L5IA 4YUAA 4R7TA 5CBPB 1N0UA 3G2JA 1CULC 1E5LA 4XE5A 5T7BA 3TUIC 4XRGA 3V34A 3UYKA 2WTBA 2H54A 3U26A 1U2DC 3PNPA 3SJZA 1UZUA 3P2KA 3USES 4PZAA 3RUDA 4EMTA 3JRWA 3GJTA 3RI3A 1ZI8A 1OLSB 4ZTBA 2FWPA 4XTCS 2Y0PA 3EXHC 5K8VA 2YJNA 4MQUA 3WK7A 3JQAA 2BZGA 1NF8A 1P6XA 4PEVA 1X80A 3UQYS 4CQMB 4DA4A 2C1ZA 2R1UA 2YWJA 2FPPB 2AX3A 1IMOA 2JD0A 2Y1XA 3JVIA 4HEA6 2J3EA 4UM9D 4F38A 4BNHA 5A03A 1XDSA 3NVKI 1LD3A 2CUKA 2P3QA 2HMAA 3D8HA 4CTNA 2NAFA 3KYDB 2FDRA 2WKWA 5DWQA 3EBOA 2ZSEA 4MV9A 5CW1A 3GRFA 4ZI5A 1T5HX 3ZWPA 3AMVA 2SCUA 3H1EA 1XOIA 4N0PA 3CS3A 1NUTA 3U7QB 2D8MA 2M9MA 4W5JA 4WXPA 4YGYA 3LU1A 3QKRB 5HZKA 1N9GA 3CUSA 3JQBA 3PZRA 4I81A 5HNKA 2P75A 2G36A 5DK6A 5G40A 2CVPA 1P7ZA 2EGHA 3E2MA 4M98A 4YIKA 5EKXA 5AVOA 3T5GA 3TLAA 3VJMA 2ZIFA 1SUIA 4ZCSA 4CHTA 1RP7A 3JQRA 2O1EA 1V3UA 4QFMA 1U2GC 2AFVA 2ZR8A 4RDIA 4XWYA 1QYDA 4YO8A 5ALIA 4BPRA 2MU1A 1RWXA 1JH8A 1E7MA 3LPLA 4QQFA 1K9SA 3S2EA 5JZSA 2GXAA 1P2TA 2J9ZB 2JAHA 3GGPA 3ML1A 4YT2A 2ZZKA 5KVVA 5CLQA 1X2BA 4RSRA 5F4BA 3V4OA 1U2EA 3H4IA 3W5VA 3X1KA 4C04A 1U5AA 3PLAE 2QQEA 3JALB 1SMKA 3MOSA 1NTOA 4FHGA 4GI3A 1R9GA 2JAOA 3U7EB 2QAIA 5CVUA 2WDZA 2WKRA 4YRKA 1MJNA 1CTQA 3KPUA 5K01A 2HTFA 2FWNA 2D2EA 1SXJE 5EAIA 3SICE 2V7UA 2GJAA 4OMUA 5AJZA 2QTGA 3S55A 2XVXA 5K09A 1DRKA 4M1OA 4Y2YA 3QLJA 4WOJA 4YHHB 4EFKA 3D6AA 4IDPA 3E6AA 5FTNA 4JCCA 2RGYA 4RA9B 5KAPA 1MU0A 2QUJA 2UVDA 4BZQA 4RK7A 1VLJA 2ATXA 4IILA 3SHTA 3LUJA 1H4TA 4REQA 1NUUA 2ZEJA 1UDBA 2RB5A 3UHFA 1JIXA 2VPZA 3H2GA 4QUAA 1KH2A 2GN0A 5JDCC 3FGNA 1M2EA 2VTKA 3Q6IA 4EF6A 1O54A 4ZVPA 2C9DA 2XECA 1SHJA 3IQEA 1NG9A 2QQGA 3F6SA 4HZUB 4NCIA 4A10A 4FCCA 1AKTA 3NUGA 4YV0A 4G5OA 2UUOA 3C6MA 4D4GA 4BVHA 2G5TA 4G23A 4M8SA 2V54A 4PSAA 2C7GA 2I4OA 3TOSA 4QHYA 2UAGA 2PA3A 3K4PA 2IY7A 5C52B 1H2HA 2CMHA 1JEAA 3I01M 4KJXA 1KAHA 2IXAA 5TX7A 2CVQA 4ESHA 5IWCA 3VR1A 2Z8XA 3IXMA 4HXEB 4DCMA 3DDCA 1N6RA 4BN5A 1C7ZA 4FHZA 5E7MA 4NIMA 1OPRA 2P2YA 2CSXA 1J09A 1M34B 1Y82A 4PGFA 3NYQA 5B7GA 3ZQJA 4LBWA 4F3NA 3VZDA 9ATCA 2N0SA 2Q2OA 3ZU2A 3NKLA 1P62B 1ZGHA 3IQWA 1NIJA 1YR8A 2QVXX 4X45A 4BNUA 3VHXB 3W3AD 1KJZA 5CCEA 5SYAA 3K6RA 4NV0A 2ORYA 2C97A 2W4QA 3DLTA 4N0MA 4W1QA 1YC5A 2L18A 3TQOA 3SQMA 4B82A 2CT8A 3B6MA 1J0DA 2MSKA 3IDZA 3WY9A 1R4NB 1GV0A 2BWJA 1NF2A 3RJ9A 3DHWC 1OXBB 3N8IA 1EJ2A 2VUHB 4L28A 3ZU3A 4HVCA 1C9EA 5TLSA 4NXNB 1RC0A 1K0FA 1A9XB 2DPHA 3WQQA 2CLOB 3OOYA 2HM7A 4MUKA 2IU6A 4URVR 2JBWA 4YPFA 1IIBA 4FMPA 4NS1A 5LYJF 2PDAA 1JYEA 1ZNWA 2HCRA 3KR1A 3QHQA 4Q6WA 1Z0AA 4R3NA 3VPXA 1AZWA 1G8JA 2CKMA 2O2HA 4HDQB 2Q1YA 3WYNA 5GTDA 4JGGA 1YS2X 2AG6A 2HAEA 2IA5A 3NONA 1XWWA 4LHVA 4P4LA 3T7EA 1L6IA 5EE1A 1JN0A 3PJRA 2E48A 4OBBA 4HB4A 4AZSA 1JQ3A 5T8KC 1L8XA 1NE7A 1GXSA 1R4NA 5JCOA 1YOBA 3DTTA 5CD1A 3S7ZA 2H4FA 4HAVA 4ZOLF 3DCIA 3IULA 4X20B 1QKJA 1KZ4A 4YRBA 4TYWA 1QRDA 4D9KA 4NJEB 1KJIA 4IDAA 4ZOLB 1UR5A 1XXLA 3FUVA 3OEYA 4EQ6A 2O3UA 3IV9A 4AJKA 1CWUA 1AA9A 4RVCA 2BUAA 6REQA 121PA 3JV7A 3ZXUB 2NQ8A 1DMSA 1F2VA 1YS4A 1ZDMA 1UQUA 2HWYA 1H2BA 1JBQA 1H9AA 5AR1A 2WWVD 3REFA 3CU5A 4UTRA 2A5YB 2AD1A 5CYPA 2WF9A 1Y4AE 5TT1A 3SHOA 4BNWA 4CFYA 1EBUA 2JIZD 1XZPA 2ETVA 2JJMA 1RWVA 4AC9A 3ICVA 4TV9A 2DERA 1H1DA 1HZZA 1VLLA 2J33A 1GG2A 3KPJA 4B17A 4QGBA 2VXYA 1DC8A 5KREA 3N0VA 4A36A 3VHXA 3EVAA 1FNDA 1V25A 4JR1A 1OB2A 1WMEA 1WDTA 1THTA 2P65A 3D6FA 5IDQA 5CW2A 2NTYC 3QITA 1LNQA 2JCVA 2AUNA 4KBYA 4RS3A 1FEZA 2R47A 4G0UA 3WV4A 3E5HA 1DAFA 1KNXA 2VC2B 3IPYA 4P3NA 1CIPA 1JJBA 2EEPA 3EVDA 3IX7A 4FS3A 3A14A 1A2BA 5FP0A 3O03A 3U5TA 1HNZB 3PNMA 2MDTA 1LEHA 3T7TA 4HAYA 4KPFC 5DULA 4ZZ2A 1ORHA 1FYDA 3ICCA 3HBJA 3A2LA 1W49A 3GEIA 3HR7A 5IDYA 1M6NA 3IB3A 3KKMA 3SXUB 1DGQA 2FUNB 3K5IA 3CH6A 3U81A 2R8BA 2GGSA 2O2CA 1JDPA 2H1HA 5TRTA 1XYGA 2B1GA 1H3FA 3G9XA 3B53X 3WGGA 1B0UA 1H5QA 4RIIA 2V0CA 1AS0A 3I9FA 2DG2A 3SS7X 2CHUA 2KE5A 3NTXA 4U7WA 5LUBA 1WUKS 4D43A 1TO6A 1S2IA 2AZTA 1VPWA 4BO1A 2IELA 2VYQA 1CZNA 4TLMB 3QBTA 1OI3A 2P41A 3EDQA 4G5FA 4BUCA 2IYUA 3NFRA 1TZMA 1SZPA 3IDOA 1ZN2A 3V8MA 4GLOA 5DNUA 4G1CA 2B9EA 3GJXC 3HM2A 1ZSVA 5FWYB 2ZFUA 3HXPA 3IAXA 3M33A 4PQGA 3TRHA 3RYIB 2C94A 4D9IA 1T10A 2E5FA 1QP7A 1AKMA 1G42A 2DKFA 2V7BA 5EQJB 4ZVOA 5LDHA 3TNFA 4F9FA 1T9CA 2WUFA 1XTIA 5FWXA 2W2LA 4GOXA 3QPBA 4B4VA 1RQ7A 4FHFA 4IXNA 3ZS9A 3B48A 4IWXA 4LDJA 3I0NA 4R1UA 2C82A 3C7AA 5COAA 5BSTA 1P5RA 5FBQB 5JNSA 1N9GB 2QAJA 1YDFA 3ZK8A 4W5QA 1J2JA 3DJYA 3Q9LA 1JGTA 3BFKA 4LHXA 1AV7A 3AF4A 2O1SA 4MVCA 2C5SA 3ZZTA 5EXXA 4XPIA 3ENQA 1W59A 3FVWA 3KP1A 4E2YA 1VMIA 1VL1A 4EG0A 5KINB 2D1QA 2PKQP 2F3RA 5FUVA 421PA 1KI3A 5KYUB 2C5BA 4AP5A 2R00A 4DWWA 3ELYA 2OXCA 3WXMA 1BVRA 3LCUA 1DHTA 5JBQA 2YWGA 2ZJ1A 1KETA 3QE0A 1BSVA 2QTBA 2PX5A 3PQ4A 1T5TA 1KE2A 3CRQA 3JYOA 3ZXIA 2NU6A 4KXMA 1EFLA 4D96A 4KXUA 3CNOA 3EWIA 1WHSB 3QMPA 2C77A 3A4MA 5J4KA 2B36A 4AJLA 1RSZA 3NI2A 4C21A 1Y5MA 2FUG1 1I80A 4CCYA 3JRXA 1HFEL 4JZKA 1T4CB 2GNOA 4ARAA 1MKYA 1SUEA 1VJ0A 2JVJA 4PXAA 4BRZA 2O5CA 1JG6A 3SZGA 1UADA 3TKYA 2BR3A 1QYVA 1DOZA 1G5RA 3GZNB 2FSUA 2RH9B 1ZM4A 2V74B 2E4AA 4MW4A 4N8DA 1ZBDA 5DI3A 5G4KA 5GJVC 5CDHA 3AP2A 5LR6A 3Q8LA 3AEYA 3BICA 1E3TA 3TLZA 4JUAA 1RYHA 2Z43A 4QXMA 4V2IA 4BLPA 2WU1A 4HHEA 3NHRA 4MWEA 4YMIA 4N3NA 3X2FA 4ROSA 3BG5A 2ZUBA 1I13A 4ZQGA 4IDEA 3W8FA 1JEYB 1R6BX 3I9V6 4W5HA 4RV9A 4LGMA 2NZWA 3LC2O 2J9YB 3E2IA 3UFBA 3DFMA 4BLWA 3H5AA 3U9LA 4ZKDA 4LKRA 2ZB4A 1NYTA 7ADHA 2RHLA 1R1DA 4GH5A 1Z6TA 5A2GA 4EA6A 4YA6A 2QF7A 4KSBA 4L95C 4PO8A 1YGPA 3IHTA 5I8PA 4L8YA 5ENZA 1ICIA 1K6IA 1UMBA 1RHKA 1YKGA 1S8FA 2TECE 1TVCA 2BHNA 1YR9A 5JJCA 2V7EA 3DZHA 2DH6A 2NYAA 4PGMA 4PVDA 3MRTA 4XB1A 5D8DA 2VQEB 2G1PA 3U3DA 4GC5A 2HU5A 4GF5A 1EGQA 1ITZA 1E79A 1M2OB 2C3UA 3D7NA 3TCNA 1DHRA 3KJFA 3TBFA 3O47A 1XELA 4BLSA 2RAPA 2O19A 1EVKA 2PAAA 2RHBA 2PSJA 3UXEA 4DM7A 2NZVG 2ZT8A 4POOA 1B8UA 4DAEA 5L40A 1RHRA 3L4BA 3LPCA 4N12A 2NT3A 2NV0A 3CX8A 3KXPA 5J43A 1D03A 4F4UA 4PC3A 1UMDB 3D6UA 4FP9A 1G3RA 1P39A 4RIHA 5ESDA 3SNHA 3RLIA 3RDPA 1CR6A 1PT5A 1XQ9A 3N0RA 2ST1A 1AGYA 4UPDA 3FWZA 1LV8A 1PLJA 2ID7A 1EPUA 3ANSA 4PCAA 1AY0A 2PD3A 2IYOA 2FY8A 2EAUA 4P38A 4Q9IA 1QR6A 3A36A 1DQPA 3LL7A 4KNWA 3PWZA 4O63O 1PR2A 3I2HA 1DMRA 3TZQA 4IH9A 5MF6A 1T43A 1M33A 2OB1A 1XV5A 4HEQA 1QOPB 2JD1A 4L8LA 4BWYA 1B16A 2QY6A 1UL1X 1GZ7A 3K2QA 3DB2A 1L1QA 1LU9A 1G21B 3I1JA 3FXAA 3R6DA 4BQRA 1U8EA 1XFDA 2Z30A 4YAGA 4R2IA 5B2FA 1IL0A 1P4JA 5CVEA 4KO2S 4OU4A 3QVGB 1I2MA 2PH5A 4Z9XA 2DHRA 4F3RA 1S3GA 1WEHA 2OMKA 2HPZA 2R6ZA 2VHJA 4KKXB 4BN0A 4JUBA 3ZIAD 2I2AA 5B37A 3GH3A 5KEIA 3O8CA 4M38A 2D2FA 13PKA 4XIFA 3FBGA 2O2DA 3A9VA 3OTGA 1R64A 2JW5A 2JEOA 3Q7SA 2C1EA 2ZS8A 4QUJA 1UZLA 1T5BA 2C7RA 1U0GA 4UVEA 4PSVA 1ORRA 4GLJA 4NU8X 4MINA 2HCJB 4RORA 2ZU6A 1JQJC 4TKUA 3U7QA 3JR7A 3EIEA 3H2YA 2XUZA 1FP7A 4LRXA 5TQ2A 3C4VA 2H7YA 4TYNA 2QIPA 4GQAA 1GVHA 2XDYA 2AK3A 3J7TA 2DULA 2N42A 1M2WA 2AWOA 3GJ7A 4KWEA 5KJEA 1YB2A 1L3IA 5GM1A 1TDJA 2INGX 4DTIA 2CHEA 2X8BA 1ZAYA 2B8NA 1C3XA 2XADA 4HAZA 3CNNA 3IQXA 2PSEA 2JFWA 4PAWA 3CUUA 1EFRA 3D2LA 4FGWA 2AVDA 3UMJA 3IERA 4O3FA 4CG0A 2EJWA 3IQDB 5DCUA 1ONSA 2PBFA 5K3BA 2J0UA 3F6PA 3FFAA 2PZMA 4E70A 2I2DA 2R4UA 4XLLA 2HUNA 3SZUA 2PL5A 2IYNA 4GBJA 1XPUA 3IA7A 1KU0A 1PTJC 3FVQA 5KI6A 1CZHA 2Z04A 5FTJA 3WBBA 2Q4OA 2KLHA 4YP7A 3E7XA 4JVNA 3BIJA 2REXB 2QLNA 4H1VA 3L8ZA 4PYOA 1F2DA 1E9FA 4R40A 1EX1A 5FOVA 4F4HA 1B6TA 3M5DA 3TSZA 3U3ZA 1N6KA 1SC6A 2P2SA 3NTOA 4H35A 1RAHA 2HIGA 1YQUA 2Z2ZA 5FBRB 2QS9A 4KO8A 2IYLD 5DBHX 5GZ3A 2D6FA 3E15A 3AP3A 5C34B 4FYIA 4AY4A 1D4OA 4BQQA 4G3XA 3OZFA 2IHZA 1B1CA 4PPQA 4JLKA 3S40A 1V9CA 1D9ZA 5E8RA 2JFGA 5CFRA 2ZSUA 4LBYA 5ENDA 2F55A 4N9QA 1MEEA 2PFGA 3DW3X 4YS6A 1H4SA 3NEYA 2AD5A 5GV8A 4IIDA 2VTVA 3HB5X 4G1VA 3VDRA 2DTDA 1JIKA 2RSLA 1HE8B 3WKBA 3ZNPA 4JT9A 4TROA 1KNQA 1XZHA 2X0NA 3B8EA 1EVQA 2REBA 1FQJA 1V47A 3MT8A 1EQUA 3T9CA 3O4RA 5ALJA 4EAAA 3QYJA 5CB4B 2DHQA 4X7RA 3OP1A 4FS8A 1C3OB 1SZDA 2ZRDA 4HAWA 4IHJA 4PX2A 2OY0A 2IXBA 3OD1A 5K3OA 3HCRA 1CRZA 1O94A 1NBIA 3R6LA 1QKKA 2LDBA 3JQ7A 4ZQEA 2H57A 4WMLA 1H0HA 3SBOA 5FWAA 5E4YA 1Z6PA 1JS1X 3BFJA 5EJ9A 2GA8A 4XLTA 2EZ4A 3SLGA 1U99A 1K08A 1R18A 4IBOA 4KTVE 4MYUA 4D57A 1E3SA 1XZ8A 2B7BA 3H83A 4Y6OA 1PV2A 4U6QA 1P0QA 1RP1A 1TTTA 1GCOA 1LY1A 2QMEA 1AQUA 2G8LA 1YZ3A 4MMZB 4TTQA 3HCCA 2C5GA 2CWWA 2J9XB 4G5YA 3KCQA 4TM8A 2GJ8A 1CD5A 5IC4A 2DLCX 4HY3A 4LDRA 4ZT6A 1JU4A 2XMZA 2WZCA 4DR6B 4IJWA 4MVYA 5AP9A 1EDEA 3DLIA 1A4XA 3EQZA 3PHHA 3X1WA 3HBFA 5FDFA 4LDPA 4GPD1 3HDGA 1Z2PX 3SBXA 2GSWA 3CXRA 3TOXA 1EM8A 1M73E 4OAPA 1M34E 2PL1A 4MO2A 1RIFA 4GDFA 4BNVA 4DLTA 2WC1A 4IOLA 6Q21A 1KWGA 1CC1S 2I2WA 4Y7DA 1I5RA 1VZ3A 3I9KA 1YBHA 3Q11A 4N4AA 1O1YA 2Z5VA 4Q93A 1NKVA 4IGAA 4K6FA 3W4JA 2ZKIA 4P08A 4YASA 1Y8QA 2BISA 4IEIA 5KWJA 4E5SA 2JGFA 2RBEA 3ESAA 4LFAB 2JK0A 5EXSA 5C1OA 3Q8MA 2VJLA 3OM9A 4D3SA 4O2AF 4I5EA 3AG5A 1SCAA 2WOJA 1L1FA 1XWFA 3EXG1 4OF4A 4IIBA 3E0QA 3MWDA 1JIVA 2ZYDA 3PTLA 2CL5A 3VTFA 5KX5F 1HEYA 1OLUB 5AIAA 2GLUA 3OJOA 2F67A 5HFJA 1YBVA 2R66A 4B7AA 4TM7A 4C43A 1CUYA 2B3TA 3BGWA 1GGMA 3PVZA 4TLDA 4GX0A 5CT4A 4MRSA 1AUQA 1F06A 1YR7A 4I4TB 1FDVA 1XK7A 2FWIA 3SAJA 2R25B 4EHJA 2KSQA 3B85A 1Q1EA 3BKXA 2W6JA 3L77A 3OZGA 1T8WA 1S3SA 1P73A 1P80A 3EGDA 4C7MA 1F0KA 1T2FA 2B2XA 4JYPA 2G7ZA 4Q9NA 1LK0A 1SVNA 3OETA 5AW8A 3F6CA 1HDYA 4DXHA 1GNRA 1HDGO 2N1BA 5HIAA 3IRUA 3TZKA 4DSAA 3DWFA 4YJHA 2Q29A 2SCUB 1KEKA 1SWWA 3MJ4A 3I1YA 4P5DA 3LC7O 3VNVA 3JD2A 3ZQ6A 3CIOA 3LDAA 4K1LA 1RU3A 3DMHA 3E0XA 3LRTA 1PBTA 1HTWA 1E5DA 5G4KB 1EDDA 3C3XA 4RY2A 4U7FA 5IAAA 2HK8A 2HN9A 4MQLA 3R74A 3SOPA 2GN8A 5FWYA 3WOHA 2P9CA 2ZETA 2AQKA 4JXKA 4Z1OA 1Y8RB 2OOKA 4F8YA 3FSRA 3OQVA 3LPAA 2AI3A 2IWRA 1USGA 3AG6A 4ZEXA 2WW8A 3TR0A 3C39A 3WLLA 5JXIA 2A2ZA 5AI9A 1PYGA 1B8PA 5BORA 3A58B 3P96A 1VCHA 3SJBA 4D2IA 1JEQA 3D31A 5HSGA 1CZUA 3IBGA 1VKRA 1Z34A 2CNOA 1FLDA 2ZBUA 4JJAA 1L4FA 5JZBA 1SIOA 1Z82A 1GHTA 5A9RA 5HWSA 5SY6A 1CJCA 1ZC3A 4MR7B 2N9UA 5DNDA 3T7SA 3GN1A 1HG0A 1M6EX 1JUDA 3NIWA 3DF7A 2WFMA 4M1ZA 3MT7A 5HRUA 4ZYUA 5GGXA 2JAXA 1N2CE 3P9PA 2OHJA 3DDSA 3FYDA 3M7IA 4UVHA 2R751 1E0SA 1W4BA 4Z1MD 3PHJA 1MA3A 3LX5A 4RL6A 2JB9A 3RAJA 1SBCA 1IG3A 1ML3A 2QXTA 1OASA 3JQ7B 3MBOA 1I4LD 2QKYA 4MQMA 5EUBA 4A15A 1H2AS 2YYAA 3C87A 1VKZA 4A3SA 1ZIOA 1XQXA 2PYDA 2B30A 4M1SA 4BCCA 3RAFC 2V3WA 1HSOA 4I4IA 2FZCA 3MS7A 3WMFA 3F5SA 5CB4A 5EPUA 3AJDA 1A96A 2R4QA 1Y9EA 2WIKA 3GW8A 1TLLA 2QD5A 1Y63A 3I34X 1QE0A 1SVLA 3WS7A 2H9AA 3QI2A 5U4XA 4U7HA 1HA3A 1NAIA 3AEKA 2WMYA 2YXDA 1IDOA 3HB7A 2FMFA 3RGWS 5HQTA 1TQ8A 2EJBA 3RROA 5K9ZA 5DBGA 3UWSA 3AIOA 1VECA 4C4PA 4RD0A 4DYVA 2NUBA 3KJEA 2ES4A 4Z9YA 3S3TA 3WDSA 1JLLA 1OY1A 2VBCA 4ZI2A 1HORA 3EE6A 3T41A 2ZYRA 3HMQA 3O1LA 1VE3A 4CKZA 3IMCA 2ZUFA 3PF8A 2A30A 4CE6A 1RLMA 3EUAA 1PR5A 1X1EA 3PCRB 3U56A 2FAXA 2PR7A 4GECA 3TI9A 5HGXA 2WT8A 1Z26A 1H2XA 4D82A 2PLRA 4LQLA 3ER6A 4RH0A 3PNBA 3AJEA 4DMHA 2G5PA 2AA3A 2D06A 3WHPA 5FTWA 1SD1A 1FDOA 2P2ZA 3RUEA 5TC4A 1EXDA 3NBZC 5IVIA 3TEMA 4K9MA 5AICA 4JLOA 3WRYC 2IP2A 1NWCA 3D3WA 4OEHA 4RK4A 2VQ3A 4L75A 5CIWA 1D2RA 1DQYA 3DD5A 3HYRA 4J8PA 3F2IA 1IM2A 4YAJA 5L45A 4K26A 2VYND 4UTVA 3IJPA 1N6PA 4AMGA 3SX0A 2W9XA 5C3UA 2CFOA 1QFZA 5E0OA 1T4DA 2PU7A 3FRJA 2O3TA 1ZOPA 3T4EA 2VYVD 2GHTA 3QVKA 3FWHA 1L7EA 2P77A 3RHTA 4WN9A 4ECEA 1ODFA 1SPBS 1NUPA 4H6PA 2BJWA 4Q9AA 2HREA 4H59A 3SC3A 3D7LA 1Z8HA 4RANA 4RNDB 4I6GA