1ISJA

Crystal structure analysis of bst-1/cd157 complexed with nmn
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bone marrow stromal cell antigen 1
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 87
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1isjA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1isjA02
3E1KA 3PYXA 4UEKA 1E6WA 3TRIA 1OBFO 1OC2A 5TGDA 5I7VA 2H5LA 3ZWWA 3GNSA 1F14A 4XQGA 3SLGA 4QT0A 5EESA 2GF2A 1T24A 5I7SA 1M6HA 5JC1A 4IDEA 3D5QA 2XXJA 5H83A 1I0ZA 1KVTA 5JMPA 1V35A 1J4AA 3SX2A 3GMDA 1C1DA 4P38A 4DC0A 5L53A 3KSDO 4BNYA 1LA2A 2BMAA 3BZUA 4IDFA 1KIFA 4KDEA 4NJMA 4OM8A 1U1IA 3IQDB 5K6AA 4UVEA 4A2CA 1DHRA 3V1UA 1K3TA 1HT0A 3RUHA 1EK6A 1W0CA 4FGSA 1L7EA 4BKQA 4HFMA 1U3WA 4BMSA 4OOFA 2FPIA 1ZEJA 1LDGA 4J2OA 5I9LA 1R0SA 4AG3A 5JY6A 1O9BA 1NASA 4A26A 3EZLA 1MC5A 3TOZA 1ISJA 4D43A 1H6AA 1EUZA 3E6AA 4S3MA 3ZWNA 3ZW8A 3ICPA 3UAGA 3VZQA 4R1UA 1ZUD1 5DOZA 4ZRMA 1UXJA 4DUPA 2Y1OA 4JLWA 2ILTA 1HTBA 2IODA 3FPCA 4NBWA 5T8KC 2RIRA 3WWZA 5HWSA 4YJFA 1DBVO 4NFHA 4ND2A 4R68A 4KUEA 2PLAA 4HWKA 4W7IA 1HKUA 4UREA 2I76A 2JD0A 4YDRA 1IY8A 2EP5A 2F1KA 3W4IA 5F3RA 2R00A 3QA9A 3U49A 3LT4A 4FJ1A 4ND4A 5MDHA 2B36A 4ZHSA 4HFRA 1YL6A 4TWRA 2YUTA 3RKRA 5B4UA 3DZIA 3D64A 1PR9A 3ROPA 3OFSA 1YL5A 4R54A 4LRSB 4WJZA 2NLOA 2CMDA 4CQLB 1HYEA 4J1SA 3FBTA 1NFRA 4XGIA 5A3VA 3B6ZA 1ZK3A 3T4XA 4N18A 1QXSA 2VHWA 1XCBA 2OFPA 4YJGA 5JDCC 1U4OA 3OP4A 3H3FA 4IDBA 4G81A 3GUCA 1FF9A 3ON5A 2O3SA 2HDHA 3VH3A 3TZCA 3ZWXA 4M55A 5C7OO 1PS9A 2IYPA 5I8ZA 3VKUA 1R4NB 5ER6A 1MV8A 4GMFA 4ZQEA 4HKTA 4B8ZA 1PQWA 1PGOA 2XF8A 4IGFA 4BGEA 1GUFA 2PKQP 1SEPA 4JBHA 3I1JA 3R0IA 1K6IA 4WOKA 3OEYA 7MDHA 4K26A 4ND1A 2B4QA 3KZVA 4P22A 1A9ZA 4GVXA 3C7AA 3I6QA 4DLBA 3VTZA 2I67A 2C2XA 2V65A 3MTGA 1TT5A 3TN7A 3KTDA 2VN8A 3VKVA 1I8TA 1UXKA 3FSRA 5FI5A 4BGIA 1NNUA 3MZ0A 4CV2A 3JQFA 4XKJA 2Y0CA 4BNWA 2OHXA 1B16A 1U8XX 3EY4A 2RAFA 3SJ7A 3UOGA 4PVCA 1KERA 3ITKA 4IY1A 5KJFA 1F06A 3IUSA 3M6IA 4X54A 4D0RA 1VKOA 3KUXA 2FZWA 1HE4A 4B3HA 1O89A 5C7LO 1VL6A 2H6EA 2GGSA 4NFSA 4WK6A 1J5PA 5F5LA 5G0TA 3ZV3A 4MVJD 1M66A 3ANNA 3OH8A 5I7EA 4XCVA 1E7QA 1NVMB 2P9EA 4PG8A 4E4YA 2JAPA 1Y8QA 2WE8A 5T57A 3LSYA 1JLLA 4OIMA 1RPNA 2DU8A 1W4ZA 1Z7EA 3LLVA 4R41A 5IN5A 2AG5A 2C0CA 3QWHA 1HRDA 2R6JA 1O94A 1EBFA 1CQJA 1NQOA 3C7CB 3DBHB 4RF4A 2B35A 4AJNA 1LU9A 5B37A 4L74A 1Q0QA 4M1QA 4OSPA 2CNBA 4GX1A 5FEUA 3IL2A 1SOVA 2UV8A 5HS4A 1GFSA 1PWZA 4MVJP 2J3JA 1HZZA 3M1AA 3PP8A 2EV9A 3ZH2A 3KSZO 4CLOB 1EZ4A 4YWJA 4JBIA 2X0JA 3JYPA 1TI7A 1E3WA 3INGA 4O0LA 1DFGA 2AHRA 2J3IA 4OGWA 1CQIA 1U8FO 2EW8A 4IPTA 1R4MB 1PJSA 4DQVA 1UR5A 4QFCA 2J5RA 1O6ZA 1XELA 1JVSA 1PL6A 5EQFA 5JCJD 2D5AA 4M8SA 3D5TA 2BRUA 1S6YA 3PDJA 4E5YA 4UUPA 5TRTA 3GRKA 4CL3A 1HZJA 3ZHZA 4CMJA 4TZKA 5GZ3A 2PR2A 4BNHA 1VJ0A 2NTJA 2AA3A 1WZEA 2EKLA 2YFHA 3Q2IA 5T64A 2HSDA 4QX6A 1HE2A 4IDGA 2VHYA 3K2BA 3U62A 1LEHA 4GX0A 4C4OA 3V2UA 1U9JA 2HLPA 1ISGA 3B1KA 5TJHA 1GPJA 4YRBA 4BNTA 1C1XB 1I3MA 1HLPA 4FC6A 2IYOA 2QYTA 4YYZA 3K2EA 3MWEB 4WUVA 4ZQBA 5HTOA 6ADHA 1DB3A 2VHZA 1WWKA 1HE5A 2W90A 3PJFA 2D1YA 1NR7A 3K96A 1Z75A 4TRMA 4DLAA 5A5EA 3KSUA 1IPFA 4IS2A 4BO2A 2Q4BA 3PHJA 3RC1A 3D4NA 3HFGA 2OMEA 4FFLA 4L8VA 1YKFA 2IE0A 3ZHBA 1KEUA 4MIOA 4YAKA 3ZW9A 3GF4A 3NUGA 3DOJA 2W2KA 3MJCA 2NQ8A 1ULSA 2Y05A 3CINA 2VCYA 4OO3A 4GWGA 1EVIA 1UH5A 4Y98A 1RYDA 4KWHA 3AI2A 2EXXA 4EJ6A 4CLDA 2VWHA 1MB4A 4J1QA 4W7HA 1ZK1A 3AY7A 3ENKA 3I9JA 1NAHA 4R01A 2X0RA 1WMBA 3PHHA 1I3KA 1NQAO 2C29D 4UEOA 4E2ZA 2WYUA 4HNGA 1SPXA 4Q3AA 1QYXA 2VRCA 4GGOA 1FDWA 3F1KA 5A9RA 5KJCA 2B5VA 3WYBA 4CUJA 4KZPA 1AUPA 3ZWAA 1T25A 4I9HA 1ZVMA 1YL7A 2VHVA 4R16A 4F6CA 3NTRA 3JQAA 2VZ0A 5L95A 4Z0TA 1A9YA 1C3VA 4W9NC 4PRKA 3E5RA 1E6EA 1HSOA 3RFTA 3WIDA 4BKOA 2PK3A 5HS6A 2DQ4A 4CODB 3JQCA 1RWBA 4DYDA 4EBFA 4CV1A 5DT9A 2QZZA 1LBEA 3A4VA 4AJOA 5CDUA 1PGQA 4PRLA 2GN8A 1XR3A 4A03A 1PL7A 2OL4A 3GDOA 1YB5A 2PZMA 3H4VA 1B8PA 2PD3A 3WOHA 2Q46A 4B4WA 3WGZA 4EJ0A 1NM5A 4RGBA 3PHIA 1N1GA 2DBVO 2ZB3A 1KC3A 5EINA 3UF0A 4CR6A 3PFFA 1P0FA 3ZWPA 1DIGA 5ILGA 4GSKA 2DUUA 4WCFC 3E5MA 1PJ2A 4L0QA 4UUNA 3WMWA 4BNMA 1DAPA 4IJKA 4ZRNA 2AQ8A 2GZ1A 3TWOA 4YAGA 3K8ZA 4FFMA 3H8VA 3PQEA 5BNFA 4HFJA 1T2CA 4BNFA 3DBRA 3QQPA 4L4SA 2DFDA 1HDOA 4EI2A 3HQ4O 4ALMA 3KHUA 4GQAA 3SVTA 1U5AA 3JCZA 1LLDA 4DPMA 1O5IA 4RVUA 2QQ5A 2BELA 3NGLA 5CFZA 2CDBA 4CLHA 4BNUA 9LDTA 3KRTA 4FFRA 2X7HA 3I9LA 4ZICA 1X14A 3CXRA 4R1TA 2WWRA 1N92A 2TMDA 2DPHA 4YBZA 2FSVA 1UDCA 3T7EA 4MJLA 2D5CA 4XRRA 4QTZA 1E77A 1UZNA 3ANLA 5C5IA 1LQTA 2Y1GA 1Y5RA 4N7RA 4NZ9A 4FR5A 5ILOA 4YACA 3KB6A 1QR6A 3K9QO 1CWUA 5FF9A 4O5OA 3RFXA 3MJVA 5DNAA 3O4RA 3OJLA 5KVSA 1KEWA 2ZK7A 5KOIA 3ZU5A 3LLSA 3PJEA 3DC2A 1D1TA 4P4GA 4RVFA 4CLXA 5CEJA 4BUCA 3NDJA 2B83A 3GPDG 2PGLA 4PLWA 3NT5A 2DM6A 4Y67A 2RCYA 1EEHA 2H9IA 4AJ1A 4CM5A 2PD4A 4GGPA 5DBFA 4YT4A 4KMSA 1MUUA 3WGOA 4BNIA 4BNKA 5BNTA 4D41A 2O3TA 3G1TA 3Q11A 3C1TA 1KVUA 2OGUA 5DBGA 4IJUA 5C37A 2QG4A 5JBIA 4CLRA 3W6UA 4CQMA 4J16A 3I5MA 1GZ3A 4JJGA 1SEVA 4JNKA 1B26A 3HHPA 3HG7A 3H9JA 4RZIA 1ZCJA 3TOXA 1K89A 3W8DA 4CQMD 8ADHA 1JKIA 4Q3BA 2GYYA 4FCCA 4PLYA 3ZWMA 1U3TA 3BHMA 2GLXA 3P2YA 3WQRA 2ZCVA 4EYEA 1PGPA 3QWAA 4Z3DA 4XJSA 1P9LA 4MP8A 4PZCA 3NDIA 4BNNA 2NACA 4XDZA 3LDHA 3I9KA 1MXFA 4U7WA 1BVUA 3OECA 4AL4A 3C1AA 4D3DA 2IXAA 2QRJA 4GSLA 4CM8A 1DPGA 5IXYA 4FD3A 2FR1A 3EHEA 1WZIA 4U0KA 4NK5A 5TJ9A 4OKNA 3BMOA 4UVGA 5IZCC 4EEZA 4I1IA 4BO5A 1EFKA 4DLLA 4ZQHA 1R0KA 4FJ2A 2ZYGA 4W99A 1LLQA 5A1TA 1VM6A 1ZXBA 3GH3A 3FR7A 3I4CA 1DRVA 4IZHA 3JD0A 5DCWA 4TVBA 4ZVVA 2HU2A 4KTVE 3WJAA 1K5HA 1A71A 2Y1EA 3MOIA 4RORA 1G0NA 1ZK4A 1PSDA 5DDIP 1PWXA 3EZYA 3LT1A 3ZN2A 2B69A 4R9SA 1TVEA 1LLCA 3R3JA 3WFIA 4YJDA 2HMVA 4WCFB 2DBZA 4ND5A 4GL4A 3WGTA 2Y0EA 3NT2A 4WPGA 1JWBB 1YQXA 2G82A 3E48A 4I9UA 4I5GA 1JTVA 1J6UA 1LSJA 4Y6SA 3FTNA 3ZI0A 3AY6A 3O03A 3PK0A 4IZIA 2GN9A 4RPHA 4CR8A 4XYLA 4Y6PA 1P1IA 4MVJM 3U4CA 5THKA 3S55A 1NPTO 2YHIB 1WVGA 4D3FA 1ML3A 4HY3A 3VPFA 3U0BA 1JQBA 1DJNA 1DC5A 1HDXA 4LISA 2X4GA 3GEGA 1NPDA 1ISFA 3AFNA 1F8GA 3GGGA 3IKTA 4CMBA 5EL0A 3OQ1A 1BXGB 3L6OO 1NFQA 3LT0A 1I01A 1KETA 2Y67A 2YW9A 3UCXA 1ORRA 3DHEA 2RBEA 4GI2A 4PLFA 1ARZA 5ENVA 1Y5MA 4J0FA 2A92A 4BO8A 3NV9A 4EITA 5EJ2A 1PQPA 1T2EA 1M2WA 4R3NA 2JD2A 4IDDA 1RM0A 4R1NA 5A9SB 4CMKA 4NQZA 4J4HA 4LW8A 1T4DA 4OJNA 5MGBA 3OA2A 1Z45A 5K6AC 1X1EA 3VPHA 3R6DA 4WLFA 3Q6IA 4CM3A 3P7MA 1TA4A 2G0TA 4FW8A 4WKGA 4PFJA 5A5FA 4YJHA 4B7UA 1BW9B 1N9GA 1PS8A 2GZ3A 3DZBA 1E7SA 1KEVA 3FBGA 2FY8A 5FI3A 1R15A 1E3JA 1YGYA 5GMOA 4YA6A 3IDSA 4B4OA 1UXHA 4RVGA 3RUIA 1P45A 1MFPA 3A1NA 1GUZA 2BFMA 3OJFA 2EIHA 3QVTA 4J6FA 5LCXA 4PGFA 1T1RA 3MJTA 5CDTA 1X0XA 3AJRA 2PKQO 3DZGA 1E7YA 4JJFA 1IYZA 5HA5A 5JPIA 2AQHA 3NTOA 3DHNA 2IXBA 2W98A 4CV3A 3VH1A 1ZBQA 1MGOA 4PCVA 4DIFA 4ILKA 1DXYA 3SLKA 3JV7A 4J1TA 1D1SA 2ZB4A 1Y81A 1EUDA 3V1YA 3N58A 4RF2A 3HWRA 4Y6RA 1F12A 4DQUA 2X8LA 2Y1CA 2P5UA 1B14A 1GEGA 5CP8A 4ZN6A 4LCEA 3K6JA 4I08A 2VNSA 5JE8A 3ZWCA 2OZPA 2EW2A 2PY6A 4PG6A 4YTEA 1QYWA 2B4TO 2J5KA 1NHWA 2PKRA 3BMCA 4URFA 3RC2A 5C3MA 3ONEA 5CEFA 1R6DA 1HL3A 4WLNA 4TMFA 1R16A 4NU6A 5L4LA 1EFLA 1ONPA 3TFQA 2E82A 2POQX 4R51A 1C0IA 3KOUA 3QVSA 1YOVB 4KWIA 3PWKA 2VTDA 4S1VA 1XU7A 3V2HA 4E12A 3ZNPA 1DDOA 2Q45A 2GR9A 2DTXA 1SB8A 3BMNB 4RVSA 1YDWA 2WD7B 4UVIA 2FZEA 2CVOA 2EJVA 2P4QA 3DMYA 5AVOA 4B8WA 2EHDA 1E3LA 3O9ZA 3VPSA 4DGSA 3FI9A 3F6YA 4AJPA 3BTSA 3Q0EA 2EERA 4Z9YA 1FDVA 3TZQA 3RI3A 1WLYA 3DOOA 5A05A 3U5TA 2D8AA 4GKVA 2O7QA 1AN9A 3S2EA 3WQSB 4UVHA 4E2XA 3HUDA 1NPYA 3G0OA 5JNLA 4XYGA 3RUDA 2IZ1A 3OIDA 3W4JA 2X5KO 4U0JA 3WTBA 1GY8A 2VYND 1BMDA 1TB4A 3DQPA 5TNXA 3S8MA 5LDHA 3JQFC 4WGGA 3SEFA 3DBLB 1T26A 4RPJA 1XLTA 1T2AA 4B79A 4B4VA 4HX5A 5T5QA 3RUAA 3PFWO 5AQ1A 2V6GA 3OJ0A 2NADA 4J0EA 4J7CA 4Z6KA 1YB4A 1VSVA 4BOYA 1GU7A 1ZIDA 4QQRA 3ITDA 4IJVA 1VL8A 4DIBA 3WLEA 3DOCA 1LJ8A 4RJTA 4XR4A 3U4IA 4XRGA 2JHFA 2XPCA 3A06A 4A27A 4E5MA 4CMAA 2VYVD 3G3EA 4NDNE 4XQ9A 3VHRA 5COAA 1CDOA 1YQGA 4OXNA 4IS3A 4TROA 1O95A 4Z9FA 4GBJA 3NDRA 3GC6A 1KBZA 2EKPA 2C54A 3DBVO 4FFOA 3KYCB 2O23A 3WIEA 3IJRA 2B0JA 1DEHA 3EW7A 2G76A 2E49A 4NG5A 2RHCA 4H3VA 3ZWYA 4MVJG 5KKCA 1ADGA 1V9LA 2GRAA 4Z3KA 2NU8A 1UP6A 3C8MA 3EMKA 4CQLA 3I9OA 5DF1A 1GYRA 2QZ9A 1MFZA 1DAOA 1LSSA 3AY3A 4GLOA 3EAGA 3PIDA 4HADA 4O6VA 1DIAA 4FSHA 3I52A 4EDFA 1NWHA 3GR6A 2C20A 3WB9A 1KY4A 1HWYA 1WMAA 4PLTA 4UVDA 5DBIA 3LQFA 3NAQA 3PJGA 5B1YA 4ESOA 2C07A 1BGVA 2GZ2A 3H9QA 3NJ8A 3CMMA 2I9PA 1DFHA 3RJ9A 4MIEA 4U8GA 3VAZA 1P3DA 3D3EA 1R4NA 2FMUA 5I9NA 1RM4A 2Q99A 4OAQA 1Z73A 2BH9A 4YAIA 2P4HX 1YO6A 5DP2A 5TS3A 3GFBA 4KUHA 5F1OA 1AXEA 2XOXA 2FSSA 3RD5A 1EDZA 3PQFA 4NBRA 1DO8A 1O8CA 1U5CA 4A10A 4DIOA 2O7SA 3S2FA 5BNIA 3QIVA 3QLJA 2O3RA 1SZJG 1YH3A 1MP0A 3JQ9A 3ZU2A 2O48X 3RKUA 3DB2A 3PHGA 2DUWA 3DL2A 5AXDA 2O4CA 3GFGA 1V3TA 3VPXA 2C7GA 1G0OA 4H7PA 2JCXA 4HP8A 1GTMA 1JU9A 4H16A 2YDXA 4N5NA 4WLVA 2WD8A 5F21A 4E13A 3HN7A 5KCZA 1QLJA 1Y8RB 3Q1LA 2FOIA 3QV1A 2YFQA 1PJBA 3PWZA 3ETEA 4RF5A 4BQPA 2YYYA 1FMCA 1H5QA 3QJ5A 4Z0HO 5ICMA 1ISMA 1BXKA 3FWZA 4TRJA 3DWFA 1J49A 4PLCA 4XZ3A 4R4JA 1YB1A 3QSGA 1SCUA 1SNYA 5JAIA 1P1FA 5THQA 1BTOA 4MVJA 3GAZA 4PLPA 3L4BC 2GERA 3PEFA 4II3A 1AHIA 2AQIA 4FFPA 4MIYA 1IOLA 4N5LA 4OSOA 2O3QA 3KO8A 2WSBA 4XX0A 5L51A 3DMTA 2O50A 1Q7CA 2H1SA 2NSDA 3DBHA 3UICA 1DFIA 2W4QA 1ZMOA 3QWIA 4UUMA 1PJCA 3NT4A 1HYGA 2W2LD 1BDBA 3VTFA 2W8ZA 4K1LA 2WEKA 3JYQA 4IMRA 4DXHA 1LTHR 2UUPA 2PGDA 1TT7A 1WP4A 2NV6A 4MO2A 2PH3A 3L6DA 3BMQB 3G79A 3WMXA 4CLOA 5TLSA 3PYLA 4R5MA 3B1FA 4J49A 4J7XA 2B5WA 4QEDA 5HBRA 5KWEA 1DC6A 3F4LA 4FOOA 3NTQA 3TJRA 1R4MA 1U7TA 3H5RA 4CM9D 4YRDA 3UFXA 4AJKA 4RZHA 4GAEA 5JDIC 2YV2A 5A4DA 2PTGA 4BKUA 3AM3A 3FCOA 3FHLA 1SB9A 3LZ6A 2PA3A 1I3NA 4OYRA 2QW8A 4XEHA 1OMOA 3DTTA 3ONFA 2FWMX 5JCJA 1GADO 1ISHA 4YVFA 5G4LA 5JC8A 5JSFA 5KNLA 4RPLA 5JAMA 4UULA 5L9AA 1PEDA 3AUSA 3VOSA 1FJHA 5HM8A 2GD1O 1B8UA 3JQGB 5DULA 3SBOA 5DP1A 4WE3A 1E7RA 3HSKA 4ZQFA 1A4IA 3JQ7B 3JD2A 4D46A 1YS4A 2IEDA 1L7DA 3LF1A 1NXQA 3UHAA 5GZ6A 2ZCUA 2DTEA 3N7UA 4WLEA 2DBQA 1C1XA 3X2EA 1LDEA 1IB6A 5LC1A 4QSMA 1BRMA 3RUFA 5A03A 1E3EA 3H9GA 3U09A 1DIRA 3L07A 4DWVA 3KEOA 1YBVA 4L75A 1K6XA 4B3JA 2RH4A 7ADHA 5EPOA 3H2ZA 4XYBA 2I66A 2LDBA 3INTA 3UXYA 3KV3O 4Q3DA 1P44A 3P19A 1ZSNA 2NM0A 3F47A 1A5ZA 1RM3A 4E6PA 2GO1A 2X0IA 4J91A 4TQGA 1IE3A 5CDSA 4OQZA 4BMNA 2BFAA 4RLSA 1QV7A 4FJ0A 4B7CA 4QO8A 3ROMA 1RKXA 5JYEA 4M54A 2BI8A 5A06A 5DCYA 4LMPA 3T4EA 3QVXA 3TZKA 1PJLA 3CKYA 1Z82A 4OOEA 3RU7A 3JQBC 1SOWA 1LSUA 4KDFA 3V8BA 2DC1A 1P77A 2NU9A 1U3UA 3JYNA 5DN9A 2IEBA 4A73A 1YQDA 2VNAA 1EVJA 5AXCA 3CPSA 1VJ1A 3GNQA 3U9LA 3WLFA 4NK4A 1GD1O 3H9EO 4CMEC 5IAAA 1EVZA 3G17A 3JYLA 1VJTA 4J7UA 1VSUA 3DZKA 4FBGA 1TEHA 3O26A 3W8FA 4QO7A 4WCDA 2AE1A 4W4TA 1QV6A 2GN4A 2X9GA 1X7DA 4XIJA 3AWDA 3GRPA 2VTEA 3GK3A 3IKVA 3HDYA 1LDNA 2AXQA 1NP3A 2BD0A 3I6IA 4XIYA 2HO5A 4BNLA 3CSDA 1UZMA 2GCGA 1EE2A 4BKRA 2PZLA 3OSUA 1ZW1A 5L7YA 4AJHA 5TC4A 3VDQA 1LQUA 4CMHA 4G5HA 4GWKA 3DAPA 4XQEA 3SC6A 2CDAA 2Z95A 1E1KA 1ISIA 1OOEA 2IZ0A 3VH2A 2BFPA 2I99A 3O38A 3HDHA 2HUNA 3AUUA 5AXBA 1LUAA 3X2FA 2NU7A 1P31A 1MG0A 2DTDA 3KYDB 3VH4A 5BSEA 3G49A 1IULA 1K0UA 1N7GA 4MKXA 1ZH8A 3I83A 2X22A 1PZGA 1T2DA 2NVBA 3FD8A 4G65A 3ADOA 5IXSA 3E9QA 4ONEA 4XYEA 4MINA 3JQDA 5CAEA 4EJMA 5G0VA 3OQ6A 1QG6A 4FFNA 4B7XA 2FRDA 1EDOA 3Q9UA 5KJEA 3PXXA 1EVYA 4WNCA 2NWQA 1XHLA 3QW2A 3LT2A 1M76A 1U7HA 1XKQA 2WYVA 4AJLA 5TT1A 1WDKA 1IHYA 3RSHA 2YJZA 4YQZA 4R3WA 3ZHYA 2J3KA 1JDJA 1ENZA 4FC7A 2GN6A 2GSDA 1PTJA 3WG9A 2DBRA 3LU1A 1C0PA 2ZQZA 3LF2A 3AW9A 4I8XA 5DZSA 2E4AA 3DR3A 3WBFA 5ICSA 3ZU4A 1U2GA 2GUGA 3D0OA 1WXDA 3D1LA 3U4DA 2P2SA 2G17A 4DMMA 1GEEA 4CUZA 3L9XA 3GUYA 2BLLA 4J1NA 1R37A 2EG9A 1UUFA 1PR3A 3OIFA 4I5DA 4AICA 2UVDA 4OHUA 5COBA 2Q2WA 3CH6A 2Y93A 3CUKA 3GMSA 2O2SA 2Q4EA 2YQ5A 3GZNB 5EQDA 3ADPA 3GVPA 3RC9A 1LDMA 1E3IA 2PZJA 2YY7A 4NHEA 3G1UA 5T67A 2IRWA 1W6UA 4HNHA 3HNPA 4MVJF 4U6SA 2Q2QA 2QRLA 1EUCA 5ER9A 1ZJYA 3GT0A 2YDYA 4YB8A 3GVIA 4FOSA 4CL8A 4HXYA 3RBVA 1YJ8A 1FXSA 1CF2O 4ZGWA 1P74A 3TL3A 3AI3A 3ZNNA 5L3ZA 3IIEA 3BTUA 3VZPA 2HRBA 3PLNA 5JYDA 1E1MA 5IDXA 3ST7A 3DFZA 3RU9A 4C7JA 2XAAA 4M86A 4GH5A 3LK7A 2ZJ1A 5F1KA 2JHGA 3OETA 1T2FA 4TVOA 4I5EA 3ANMA 2DLDA 2Q2VA 3GAFA 2D3TA 3PYMA 5KVCA 1XQ6A 3I9NA 2Z1NA 4W9NA 1E92A 1JKJA 3PJDA 1E3SA 2X1HA 4BB6A 2OP0A 4PLHA 1DOHA 2PH5A 2X0NA 3KBOA 3ASUA 1LXCA 2OORA 4RVHA 3DO5A 2CDCA 3TL2A 3H3JA 2IZZA 5ITWA 1JN0A 2HMWA 2G5CA 4FB5A 5JO9A 3ZV4A 2ZTLA 2Y66A 4J4BA 5KTKA 1F8FA 1GDHA 4C7KA 1XIVA 2FR8A 5AXAA 4RQUA 3INRA 4HV4A 2Y1FA 4BMVA 3ROQA 2QX7A 3ICCA 1B3RA 1N8KA 2X9VA 4TRRA 4K9DA 4Y8VA 3ZNOA 4M89A 1E7MA 1SAYA 1SBYA 2UDPA 4PZDA 5H82A 1E5QA 3ZDFA 2J5QA 3F4BA 3PQDA 1AXGA 3V2GA 4DL9A 1DRUA 4AJJA 3DAFA 2HMTA 4WCFA 5G0WA 4FPXA 2HMSA 1ZEMA 3GGPA 5IDYA 4OXKA 4F46A 3WTCA 2NVUB 2ZATA 2Y68A 2HKIA 2VWGA 5JY1A 2YHIA 5ENDA 2C5AA 3Q3CA 2Z5LA 3B20A 3D4PA 1HDZA 4E2WA 5JXWA 5JFOA 1ZSYA 4E0BA 5EIOA 4IINA 3BTVA 4BL5A 2YZ7A 3RASA 3BXXA 4J9VA 5TQVA 1YE3A 1K2WA 3WYCA 1VPDA 1PQUA 4CMIB 5F1PA 1R66A 1BXGA 4YCAA 1QRRA 1G1AA 4J3FA 3CTMA 4LVUA 4YAEA 5A04A 1Y9EA 3MOGA 1UZLA 2C5EA 1ENOA 2WJPA 1LC0A 1NR1A 4L4XA 4AFNA 4ALKA 1SC6A 3RJ5A 3W1VA 4RPKA 1H2BA 1HDGO 5A9SA 1DLJA 1JW9B 3PGXA 2J6IA 5KJ1A 4M87A 3RCBA 1OI7A 4HUJA 3AOEA 5B12A 3IJPA 3WYEA 5HRUA 5JAQA 2CD9A 1GCOA 3DHYA 1ADFA 2B37A 4KQWA 4MP3A 4PIVA 4R69A 3L77A 4B4UA 3D3WB 2Y1DA 1IZ0A 2VRBA 1B2LA 4P8RA 4BV8A 1PZHA 1WNTA 4LSWA 1BW9A 3AK4A 3C3XA 2FPPA 3E03A 4J4TA 4PVDA 5A3JA 3GA0A 1FK8A 4W82A 2HJRA 2P91A 3RIHA 2P68A 3JQ8B 2GPTA 2Q49A 1KYQA 4J90A 1HDRA 4XB2A 4AVYA 1D7OA 1M6WA 4B3IA 1NFFA 4FQ8A 5BR7A 3AOGA 3GVCA 4NMHA 1O0SA 1Y1PA 4R1SA 2VZ9A 2ZQYA 1XSEA 1LLUA 4OH1A 2JJYA 3CMCO 3P5SA 1IZ9A 1X7HA 4MVJI 1B7GO 4XR9A 5ES3A 1U2DA 1FDUA 4IIUA 4QFDA 1OC4A 4NH4A 3VDRA 4J9UE 2WTBA 1C0KA 3GHHA 1YDEA 3DTYA 3AM4A 2JD1A 3IUPA 2CF5A 4CM4B 3W8EA 3H65A 3BA1A 2R00C 4EUFA 4DA9A 1WW8A 3VZRA 1JAYA 3FNFA 5CG2A 1H6DA 4Q39A 3M2PA 4XD2A 1D4FA 1LX6A 3CIFA 1PZFA 5CHEA 5U4QA 5GZ1A 3MTJA 3UKOA 2Q50A 4RCVA 2X5JO 3PZRA 4L73A 4L76A 3B70A 3W6ZA 5FWNA 4ZD6A 1P0CA 4D45A 4YPOA 1JAXA 2DAPA 3UCFA 5IZCA 3MWDB 4UAGA 1X13A 1YOVA 4U6QA 4A5OA 2HMUA 3RVDA 4OKIA 3RUEA 4NI5A 4O63O 1YBAA 4ALJA 3U4HA 2D2IA 1JVBA 1DLIA 3BMNA 1PJ4A 2WD7A 3PRJA 4FS3A 4OMUA 3WGGA 3OBBA 1QP8A 3E8XA 3O8QB 4IXWA 2SCUA 3L4SO 2FHSA 4EW6A 2Q1TA 6LDHA 3IS3A 3WSWA 4E5PA 3FPLA 4I5FA 3H2SA 1GL3A 2CVZA 2VT2A 3F46A 1HLDA 5KKAA 5IZ4A 1HDYA 1VI2A 1VL0A 8LDHA 2OXIA 4D42A 4WECA 1D8AA 3PPIA 3JQ9C 1I2CA 1IL0A 1X15A 5G4KB 1VLLA 4WLUA 4MVJE 5KIAA 1FDTA 4L9RA 4PG7A 2X6TA 4A7PA 3KEQA 3GG9A 1WDLA 1E0DA 2VYNA 2HK7A 3DFUA 3DBLA 4MKZA 1EK5A 2ZYAA 3NEPX 4ND3A 2YQ4A 1H93A 3AM5A 3EVNA 2VOJA 1I5RA 1KVQA 2HAEA 3QWFA 3NYWA 5TT0A 1E1LA 4EEXA 2BGMA 1Q0LA 4XA8A 4IM7A 1ONNA 3JSAA 4FDAA 4HBGA 1GQ2A 3GDGA 4E30A 1R0LA 2CY0A 2EJWA 2D4AA 1EBUA 2EWMA 2QHXA 1C1DB 1HDCA 3A28A 4R5HA 2PV7A 3WS7A 3LYLA 3PHLA 3JQEA 2VYVA 2O3JA 2VHXA 4PLZA 4DVJA 4NJMB 1ZSVA 1HF3A 2P5YA 2BKAA 2PNFA 4IQGA 5JO0A 1HYHA 1ZZEA 4DC1A 3DMTC 3KYCA 3Q9NA 4XB1A 5I7FA 1A7KA 1T4BA 2BGKA 5AOVA 1E7WA 3EYWA 4PLGA 1LNQA 5T6BA 4D79A 1LRKA 2CF6A 4Z9XA 4PN3A 1UXGA 3FWNA 3QVOA 2A4KA 2TMGA 4JP3A 3GLQA 1YRLA 2NQTA 4NPCA 4CMCA 3DONA 3UN1A 1Q2XA 1B0AA 4KOAA 5J23A 3LVFO 2ZTMA 1X0VA 3TZ6A 1H9AA 2CSUA 2EGHA 4GVLA 5H81A 4BNVA 4JBGA 2QYSA 3D4OA 3EDMA 4CLEA 1YBMA 4K28A 1ONOA 2F00A 5JMWA 1NHGA 4ZU3A 3AUTA 1EMDA 2PFGA 5L7WA 2BGLA 1G6KA 2AE2A 1Z7BA 2NUAA 4YJFB 4E31A 3UW3A 1MXHA 1DJQA 3QY9A 2O4UX 4BNJA 1V6AA 4ALIA 3M1LA 4INAA 2X86A 3PI7A 2EGGA 2CZCA 5G0UA 4PG5A 4AJEA 4KTTE 5EN4A 1Q0HA 3IAHA 5B4TA 2FN7A 3R3SA 2P9GA 3BHIA 1JA9A 1UAYA 2JCYA 1PZEA 3ETDA 1ENYA 3GG2A 3TFOA 3KVOA 4GX2A 4IGEA 4ALLA 2I65A 3ETGA 1ULUA 5GY7A 4UEJA 3WXBA 5JAZA 4LGVA 1ZXLA 4NU5A 1UP4A 1Y8RA 3F5QA 1W73A 3EC7A 4BGVA 3B1JA 5K0ZA 4IIVA 4JROA 4E32A 3F9IA 1QORA 4YJGB 4BQRA 5LDGA 1I36A 3TPCA 3UH1A 3WGIA 3AU9A 5IDQA 3H6KA 3OMLA 4LN1A 5IFLA 4LSMA 3W4KA 4YEDA 2HK8A 1I10A 1UP7A 4CV0A 2GDZA 2NVWA 4IQ0A 4QXMA 2Z1MA 4WASA 1LDBA 4P4LA 3H9UA 3K92A 2V6MA 3RWBA 4II2A 4GX5A 3E82A 1QYCA 3PTZA 1TT5B 1BXZA 3M2TA 2FPGA 3QRWA 5L45A 1F0YA 3GVXA 3FTPA 2W2LA 1EE9A 3R1IA 5G2OA 5L4SA 3OF2A 4TRNA 1Q1NA 3BMQA 3MCVA 3PLRA 2OP1A 1BHSA 3AU8A 3GPIA 2GNAA 1GYQA 3AFMA 3I3OA 4CUKA 1F17A 4JQCA 5I8WA 2EKQA 5EMHA 3KLPX 3E9MA 1B15A 3EK2A 3GNTA 3MJEA 3QP9A 3RFVA 3OHSX 5T8KA 1Q7GA 4WEOA 2ZB8A 4E5KA 3ZHXA 2R2GA 1B8VA 1LI4A 3HJAA 3NJ4A 3NGXA 4CM9A 5U9CA 1ID1A 1RJWA 1WDMA 1YONA 2PZKA 4Q3EA 4E33A 4IJWA 5BSHA 3COSA 1SMKA 1H94A 4DYVA 4A0SA 4NBVA 1MA0A 4ZQGA 4CM1A 1I3LA 4O1MA 1Y8QB 4TZTA 1JKFA 3ZGYA 2X23A 3DXFA 3K30A 4DBZA 1BWSA 1B3BA 3JQGA 3KLMX 2A35A 4DRYA 1U3VA 3PGJA 4W6ZA 1DHTA 5L40A 4NJOA 3F1LA 2X9NA 5CPFA 1Y7TA 3TF5A 3I9MA 1OFGA 3CZRA 3JQ7A 1I32A 1I33A 2EP7A 3KM0A 1PGNA 1UJMA 1UAGA 1CEQA 1ZK2A 5JDCA 3H5NA 2AMFA 3DZFA 3HFSA 1NX6A 4KP7A 1BVRA 3WGYA 2O2YA 5FYDA 4BIIA 4EGFA 1M67A 3SC4A 1PGJA 3RQSA 1GPDG 1E3WB 3ZV6A 1N5DA 5K9ZA 2PD6A 4ID9A 1ENPA 2RH8A 3VVBA 1PJ3A 3WGQA 4YXFA 5TF4A 3RROA 4BV9A 4IUYA 4KQXA 3T7CA 3BTOA 1VRWA 3EVTA 3JTMA 3FNGA 3WFJA 1YWGO 5L7TA 3OJEA 1A4UA 4GKBA 4IBOA 2AEMA 4RDIA 4BO0A 2HRZA 4F45A 5CG1A 2DPGA 3LC1O 4AJ2A 2E48A 3MEQA 1MLDA 4WLOA 2FR0A 2CFCA 1VKNA 1JWAB 2D0IA 2C2YA 4UUOA 3V5NA 1DRWA 4JIGA 2V6BA 2NU6A 1I2ZA 2ZYDA 4Y9DA 4XGNA 1Y9AA 3ULKA 4YRAA 2H63A 5DOVA 1QYVA 3WR5A 2AEFA 1R12A 4IQ8A 4YQYA 3U3XA 4CM6A 2J8ZA 2OBNA 3HB5X 2X5OA 2ET6A 4J2HA 1C14A 1Z74A 1LSOA 1KVRA 4CPDA 3L4BA 4E21A 1QYDA 3L9WA 4MP6A 2VZ8A 4BO3A 5CDYA 5BQFA 4OQYA 3JD3A 4GPD1 3VZSA 3GY0A 5IDWA 3ZWBA 3WJ7A 2Q3EA 2OO5A 4ITUA 1D3AA 2A9FA 3EUWA 3HDJA 4MVJH 2QRKA 1LC3A 3FNEA 1NQTA 3AUAA 9LDBA 2W2KB 2OBYA 3L6EA 1PJQA 4BGUA 4CJXA 3HADA 5A9TA 2I5PO 1OAAA 2BI7A 2JCVA 2WE7A 3FF4A 3DZJA 3OIGA 3S2GA 1HEUA 3ZU3A 4N54A 1T1SA 3WSVA 2HQ1A 4O59O 4JK3A 3MJSA 1C0LA 3OEWA 4K6CA 4NR0A 1Q7BA 1EQ2A 3EGOA 1H9BA 3WGHA 1NBOA 1OZAA 3KYDA 1L1FA 2VRCD 2WYWA 5DCUA 1EQUA 1P1HA 4M49A 4KUGA 2JFGA 3QWBA 4AJIA 4BNXA 3RBZA 4RPGA 3LC2O 2P9CA 3QVWA 1NVGA 4WOJA 5JDIA 3ZWOA 2AQKA 2EEZA 1GQQA 4EUEA 1BDMA 2J3HA 3I4FA 3JQAD 1NYTA 2Q1WA 4RF3A 3JQAB 1E6UA 1H2HA 3F5SA 3JD1A 1WPQA 1TXGA 3GQVA 3FRJA 1QLHA 3K73O 2OOSA 2VUSA 3KYBA 3WQQA 2AEJA 2A94A 3ZCXA 5ADHA 3PVZA 1CERA 2LDXA 2BHLA 3E9NA 4BO7A 1XA0A 4D7AA 3ZV5A 1AGNA 4ZJUA 3ABIA 4DBVO 2JFHA 3CZMA 5JCXA 2ZTUA 3A14A 2ZIZA 4LCJA 2AG8A 3ROKA 1VC2A 4JCOA 3GOHA 2D59A 2Y0DA 4E3ZA 3KETA 3GZ4A 2Y99A 1P1JA 4NNJA 2UYYA 3SJUA 2IDZA 1AHHA 3V1TC 2VQ3A 4TSKA 3WBBA 4BO6A 4H15A 4XGKA 1ZKMA 4PG4A 3GGOA 3F3SA 3K5PA 4BO1A 3TZHA 4FGWA 1ZO8A 5L4NA 3IMFA 4IDCA 5AYVA 2FP4A 2VT3A 1GCUA 3QHAA 5KJ6A 1DC4A 1GZ4A 3LC7O 1K6JA 4Q9NA 4TKLA 5IG2A 3PIIA 2C82A 4NFYA 3A9WA 4XQCA 3RBXA 1H6CA 1MC4A 5G0SA 1ZMTA 3GZNA 1N7HA 3DBRB 1MG5A 5CDGA 1RYEA 2NTNA 3FR8A 1ZJZA 3BIOA 3VC7A 1DIBA 5TIIA 4HFNA 1DC3A 3GN1A 1J0XO 1KEPA 3WICA 3BYZA 5JW6A 4YAJA 1PJTA 5I9MA 3HN2A 2NNLD 2EF1A 2C7VA 1KC1A 1M75A 4E2YA 1UDBA 1QKIA 4I9NA 3OICA 3P2OA 5TSDA 4YT2A 2DT5A 1GYPA 1PL8A 3JQBA 3D7LA 3AOEC 3FNHA 2VWPA 1N2SA 1GV0A 5A02A 4GLLA 4XYMA 3STHA 1YVEI 1ZNQO 1KS9A 4CMEA 1H6BA 3I23A 3PZBA 1XWFA 1I30A 3KXDA 4D0SA 4U5QA 4JX8A 4OL9A 3IOYA 3HE3A 1LDYA 5IN4A 4JN6B 3WWYA 1ZFNA 4Z0PA 4LRTB 3S2IA 4WEQA 3ZWVA 2VUTA 3WDSA 2ZTVA 2OUIA 1GZ6A 2I6TA 4IXTA 4DMLA 2PGJA 4JP2A 4D44A 3UVEA 4WNIA 1A27A 5CEEA 4MKRA 2VOEA 4RVDA 4XDYA 1IUKA 1ADCA 3NX4A 3OM9A 4CR7A 3HB4X 1HE3A 4NIMA 1N1EA 3CEAA 1CRWG 3DDNA 4BB5A 4BKPA 4CLRB 4GMGA 1QSGA 4CQMB 2UUOA 4P4NA 4BNGA 2DFVA 4XWYA 3C85A 1PIWA 3RUCA 3C1OA 4JXKA 1XEAA 1V0JA 3SXPA 2CVQA 4IDAA 1P1RA 1A72A 2DVMA 2NVUA 3OA0A 4RV9A 3TQHA 1U28A 1V8BA 4LVCA 4TKMA 1HETA 2HK9A 3WX0A 3OQBA 4D3SA 4R9RA 2E6UX 4MPDA 2X58A 2O3UA 1PS0A 4JGBA 3ENNA 1RM5A 4PLVA 4ALNA 1E1NA 2CUKA 4MOWA 2V7PA 2I3AA 2HJSA 5KVQA 5BT9A 3GHYA 2WDZA 4CMIA 3GEMA 4CM8B 5IF3A 1UDAA 1MX3A 3UCEA 4PZEA 4DREA 2Q1UA 4QECA 3BMOB 5U1PA 2JKVA 3JD4A 1NAIA 4DTIA 1XG5A 3C24A 1XGKA 1Z6ZA 3NRCA 1P33A 4DQXA 2ZB7A 5TX7A 1SO8A 3NKLA 1KOLA 2WM3A 3RC7A 1UXIA 2ZKLA 1GR0A 1AE1A 1XU9A 4IMPA 4L4RA 4BVAA 1CYDA 1V3UA 2RHRA 2YV3A 1WAMA 3VPGA 1I2BA 5ITVA 3GEDA 5JS6A 3ASVA 3D3WA 4AJ4A 1X7GA 4BO9A 4RDHA 1NTOA 3DZHA 4Q3CA 3DAGA 4RL6A 2AW5A 2YHUA 1CETA 4OXYA 1YJQA 3TNLA 5C7IO 5COQA 2V6FA 3HZZA 1NWCA 3JQ8A 3ZZNA 3WNVA 1XQ1A 2XXBA 1I24A 2DKNA 1X1TA 3RAJA 2WMDA 1HXHA 5BSFA 2JL1A 3GN2A 4BHTA 3K31A 1BG6A 1U4SA 1BSVA 2HCTA 1IHXA 5B4VA 4MDHA 5EERA 5FFFA 4QUKA 3ZNQA 1YXMA 2Q1SA 3IC5A 4G2NA 1ZK0A 4RO0A 1GQYA 3BHJA 1V3VA 2YV1A 2GASA 1H0KA 5F5NA 2JAHA 2C59A 4F3YA 1GV1A 4NBUA 3AI1A 4CM4A 1Y6JA 4YR9A 5BSGA 4ZA2A 2PWZA 3UGKA 2I3GA 3ONDA 1LRLA 2E37A 2ZJ0A 1A7AA 2BFOA 3FN4A 3MJ4A 3OJOA 1XDWA 4EUHA 2JFFA 1NVTA 2B4RO 4BNZA 4FN4A 1GAEO 3UUWA 4YJHB 4BO4A 1DSSG 4N5MA 1GUYA 3L0DA 1N9GB 3QE3A 4YT8A 1QMGA 1S7CA 1CJCA 3N74A 4DPLA 1DIHA 1VE9A 3DEYX 1W8DA 1CIVA 4J43A 3Q2KA 3S1LA 3JQ6A 5IJZA 5KVVA 1FDSA 2G1UA 1IPEA 3HDQA 3O8QA 4K6FA 2NTVA 4FIZA 4RQTA 2VWQA 3IP1A 4Q3NA 4JJIA 3BAZA 4LK3A 4CMGA 2BF7A 3PWSA 5JLAA 2VUUA 4DPKA 3JYOA 3ORFA 3CE6A 1TLTA 3GVHA 1E5LA 1PU2A 1KVSA 4LMRA 4ROSA 3VVCA 4XJTA 2UAGA 3WNQA 3GDFA 1ADBA 3TSCA 3H5AA 3H7AA 1KY5A 5CPBA 4NBTA 4YT5A 3E18A 4CM7A 4F6LA 4EZBA 1NQ5A 5G4KA 2QIOA 1PX0A 4E5NA 4RLHA 1P1KA 1HSZA 3BMCB 1XYGA 3IP3A 3PDUA 4BS9A 1LRJA 3TDKA 3C7DB
chains in the Genus database with same CATH superfamily
1HA3A 3W77A 1T3SA 2I8CA 3EZ9A 4TT8A 1OC2A 3VBEA 2V3CC 5I7VA 4FYWA 3WLIA 2IDJA 3IT1A 4OQLA 2FPXA 3PNQA 1E9AA 2L18A 3RVOA 2JI6A 4HQKA 3HBFA 4OKIA 5EESA 5LQKA 3IO3A 3UK7A 1T24A 1IHPA 5EAIA 2EOAA 1AUXA 2ONZA 4GPIB 3MJFA 3SSAA 4EGSA 2B4KA 5JC1A 1I0ZA 1JE1A 3SX2A 3PXGA 1KZGB 1ZCFA 4OP3A 4YUZA 2XMGA 3GMDA 4EW1A 5BUCA 4GMHA 1YDFA 4OGFA 4ARZA 1M6YA 5DHSA 4BNYA 3L6RA 3BZUA 3B82A 2VRWA 2Q6OA 4M98A 5ALFA 3HXKA 2Q9AA 4OYYA 2VH2A 4EG1A 5IZCA 3RLFA 3AZPA 3DAHA 4XEUA 3V1NA 3V8QA 1SBHA 2XECA 3ZI7A 4DQ0A 3LDGA 4U2FA 3ICVA 1T0PA 2QXUA 1WRBA 3CPEA 4HVCA 2ZUFA 4N41A 2C2WA 1N2BA 4KMOA 1O4WA 3AMVA 1EK6A 4MSUA 5LZ8A 3GLGE 3LQ4A 1UPCA 1ACLA 3GA7A 5BW6B 4DDMA 3MBOA 1KDYA 5AHXA 5EXXA 2XH8A 4G85A 4CU5A 5EWJA 1Y1SA 1TEZA 3LKBA 1P0IA 4J2OA 1PYGA 5I9LA 1R0SA 4KOEC 2BJHA 4C3OB 3DNMA 1Z34A 3LSTA 5JCOC 3SE7A 5L3RA 4MLDA 3TOZA 1ISJA 2B61A 2HBYA 4D43A 2QU7A 1MR3F 1L1EA 3ZWNA 5ADUS 2QMYA 4MV0A 3WO0A 3CNQS 3VZQA 4R1UA 1XF1A 1QFXA 4BIMA 1FUYB 2Y1OA 2H65A 2X2OA 2BHNA 3C3KA 3CLTD 4R31A 2DHRA 4D74A 5T8KC 2YFKA 5IRCD 1SHUX 1DBVO 4R68A 4M8NE 1P2GA 1XWWA 1Y8AA 3SVZA 2PLAA 2KPOA 4TYPA 1KZ9A 1ZWLA 1LBTA 3I58A 5FJIA 1D4ZA 1UIMA 2PGXA 3QA9A 4AY4A 3LT4A 3C14C 2FJPA 4OLBA 1A7UA 1TVMA 4GRDA 4ML3A 4A2PA 4AMVA 5MDHA 2B36A 2ZOSA 2VKQA 1TCVA 4HFRA 2FZVA 3TSWA 1YL6A 5EKTA 3UG6A 3K1TA 4TWRA 2YUTA 1M2NA 5DHPA 1WZNA 1JP7A 2EJTA 1KU6A 3A26A 3HBJA 3I1IA 4OUKX 1L5YA 4QRIA 2J87A 3D64A 3NOOA 1F6DA 1MH9A 4L5BA 3OT1A 5F3DA 3C4QA 3EVDA 4J0DA 3U7RA 4L08A 1QE5A 3OFSA 3D6VA 1IY2A 1JQEA 1DO0A 2OESA 4LRSB 1V9SA 4WJZA 2CMDA 1YRYE 2BGUA 1RP7A 3ZZTA 1CB0A 1E2JA 3PHBE 3HNOA 3DGEC 3GJTA 2ZRHA 2XUZA 3N8HA 3B6ZA 1Y3AA 3CLUD 3NATA 5A3VA 4QWMA 4B3BA 1QXSA 1ZHFA 3K0HA 1MD9A 2OFPA 5CVDA 3OP4A 4KO3S 3NRBA 4YAOA 3H3FA 1AVTA 2IDKA 1J8FA 2EFDB 2X0KA 2X14A 2YC2C 3GUCA 4Q1FA 4ZI7F 2HDHA 3VTAA 3DLHA 2FGJA 2R6ZA 1PS9A 1THZA 1CR1A 1JQDA 1CQZA 3NASA 3G2NA 1RXCA 4MS3A 5TMDA 3LUKA 1R4NB 1BWQA 5I4BA 4HKTA 4X41A 1D0SA 1LVUA 1A98A 3IEKA 1YHZA 4D0GA 3QU5A 2XF8A 3I42A 1GUFA 5HQ3A 4M21A 1HDEA 2IVZA 3R0IA 4D56A 3H87A 2VYFA 4MQUA 4WK4B 2O07A 3WRVA 5F51A 1GU1A 1OLXB 3OTGA 4WNAB 4MUKA 5AVXA 2VJMB 1KYIA 3VTZA 5H9VA 5BWMA 2I4OA 5TY0A 3TAXA 5FOUA 1SUAA 1F4PA 1V25A 3QF7A 4I1RA 4UMFA 3TLGB 3HB0A 4MUNA 3VKVA 3W9BA 2H85A 3ZJ5A 4Y2UA 1YTLA 2EQBA 3BH0A 3IDOA 1UXKA 2VF2A 2IELA 3AKCA 3K0BA 1N75A 1OBOA 3MZ0A 1YQWA 4O33A 5HIJA 1ZD2P 5JS2A 2Y2UA 2Y0CA 4BNWA 3B3JA 4YLEA 3HA5A 5DJ5A 1WULS 5G53C 421PA 4DV1B 4UM5A 2RK3A 1X80B 3LQQA 1F0NA 1KHHA 2A86A 3BEDA 3ITKA 5KJFA 2ZYSA 3UHJA 2XWBF 3IUSA 4C4TA 4JC5A 4X54A 4C5AA 1V16B 1WNFA 2B1IA 2BKEA 5T6MA 4B3HA 2Z2XA 3KQWA 5HE9A 2L82A 4XARA 1RKBA 1N2ZA 3IB6A 4DV0B 1L4EA 1OUMA 3QXHA 5F5LA 2WT4A 2ZJBA 2JFBA 1M66A 4QU5A 3W2HA 3ZV3A 5JRJA 2QBYA 5M3BA 4PFQA 1RVDA 2UYCA 2AOTB 4P36A 4Q9IA 4Y7DA 4YIHA 2I71A 5JS8A 3A6EA 3OZGA 2OCLA 3ANSA 1Q1ZA 1Y8QA 3PGKA 3A1SA 4MYTA 3T5GA 3USCS 2OD9A 4OIMA 4DJ5X 4N0QA 1SN7A 3R41A 5I9IA 1W4ZA 2H51A 3LLVA 3EZNA 3I2YX 3ZVKA 2AG5A 3N8GA 3V7FA 1HRDA 4ZT5A 3I9V1 1KEEB 4NAUA 4RENA 2B35A 1VGRA 1LU9A 5CW2A 1ZICA 2ZTSA 4K6GA 4MB2A 1Z63A 2YZ2A 1Q0QA 3CR8A 3JWHA 2HBZA 4MRMA 1KQNA 4J03A 1RRKA 3HCCA 1SOVA 2P9YA 2P75A 2IOHA 3N8NA 1QC5A 2NYUA 4KMRA 4WFQA 4CF5A 4QLBA 3X1KA 3QOXA 5IBQA 4RL4A 2J3JA 5K0CA 4UXIA 3GEPA 4ETWA 2VJOA 4K9MA 4HDSB 1LW6E 3IQZA 3I2GA 5E4YA 4NAHA 2J9ZB 4F91B 1KYZA 1EZ4A 4YWJA 4JBIA 4PBSA 2X0JA 3BFJA 3JYPA 3KJXA 2FPLA 1AA6A 4L2IB 1DL5A 4H35A 1L9KA 3JRNA 4CIXA 2WFMA 5GQSA 4OGWA 2EW8A 2BFCA 4IPTA 4JAVC 3R7FA 2QJWA 1PJSA 1LF0A 1NBAA 5JAOA 4BMPB 2J5RA 5JSUA 1NKTA 1XZQA 3KE9A 4ADSG 5LUAA 1CD5A 5ALJA 3DE2X 3BC1A 1J97A 1JHYA 4DMCA 3B2EA 4M8SA 3T0GA 3IT0A 2BRUA 2VNIA 3OX2A 4E5YA 1OHHA 4HNQA 1QFSA 3GRKA 2LNDA 3P2EA 4ILEA 1GO2A 4CL3A 5BNZA 2A5LA 5EYPB 4CMJA 3MGAA 4LJKA 2VR1A 4TZKA 2AR9A 4D80A 3FOZA 2OZVA 4BNHA 4F3KA 3VPAA 4C0JA 3ZLJA 3T1NA 3M6AA 1S8OA 3S0JA 4KGVA 5T64A 4QX6A 5HSGA 4KRFA 5FNVA 2ID8A 2H5JA 4UCQA 5L8VA 4MAMA 3B1VA 3ONVA 3IAEA 5BYBA 3O8DA 4QL3A 1L5LA 4IIGA 4QUEA 1LEHA 1NNSA 3BULA 1W581 2VSFA 4UD2A 3S2YA 1U9JA 3MQFA 4EQ6B 1KZYC 3KQVA 1GPJA 3MT7A 3RYHA 1KKMA 1QH1A 1Q1GA 2P4EA 3UJ8A 2ZEJA 1C1XB 1HLPA 3L8CA 2YIMA 4FC6A 3O3MB 3A9CA 3IQIX 1CJKC 1Q15A 1QVRA 4Q01A 4MVYA 1P5JA 4WUVA 5HTOA 2NT4A 2I91A 3G0HA 3PJFA 2ZR8A 2D1YA 4LVNA 2MSNA 3U31A 5A5EA 4P82A 3OD5A 3KSUA 3B3FA 3ZOKA 5L3VA 1OB5A 2G7MC 4HQFA 3THRA 2GCNA 5I9SA 2FX2A 3G0CA 4AWAA 1DKLA 2AFRA 2IE0A 3L82B 4EENA 3EAQA 1KK1A 5E6UA 2GYWA 4MIOA 4ZCSA 4EA6A 3OZTA 2WD9A 1W85B 3GF4A 3I01M 4KPUA 5DHAA 5LP6C 1T6NA 3I09A 1BMTA 3PE4A 2W2KA 3ND8A 4M76B 1IJEA 2NQ8A 2Y05A 4B34A 1UKAA 2ST1A 2VCYA 1UFRA 1EVIA 4GWGA 1FXWA 1UH5A 3FY4A 3UAYA 2X6RA 1XMVA 1RYDA 3GYBA 3WYDA 3FXAA 5GJWC 3F96A 3LWDA 5FTWA 5CYGA 2A5YB 3C45A 4EJ6A 3MBKA 5IBCA 5DYIA 1MB4A 4BNDB 2CV1A 1ZK1A 4YALA 1KRHA 3SZ3A 3AY7A 4K87A 1BH2A 3VV2A 3I9JA 1DBRA 1P8AA 4ZWNA 4HX2A 3EFOA 1R6BX 3GCDA 3N75A 1QHYA 4JVSB 1TRKA 4RV5A 3I61A 3N2GB 4MUAA 3ZDBA 1WKBA 3I64A 1QYXA 2ZI4A 5CVUA 4L28A 1RPTA 2OSBA 3O9MA 1FDWA 1G19A 4HQNA 5CA0F 4QREA 2R3SA 3DMGA 1SKQA 4LF7B 3ZZUA 4I9HA 4E6EA 3WLKX 4LRXA 4EG8A 2YICA 1P7PA 1IQUA 1PNQA 4MV7A 3AIKA 4JC4A 4YDQA 1NJ5A 4LE2A 4Z0TA 3DO8A 3ZCSA 3EPJA 3THXA 2OA0A 1QANA 5EIFA 2DQSA 1WX1A 1YRBA 2FQQA 3KPYA 4LRQA 4QE3A 2FMIA 4UHJA 1YVRA 3RFTA 2ZKIA 4D8XA 2GA9A 2PSFA 4ISCA 4TWAA 4UHDA 4YV0A 1CUWA 1ECCA 1A1SA 4CV1A 4DYDA 3KQKA 4B3RB 5AVRA 1EE1A 2VHUA 2X4DA 1R6UA 4Q7QA 4O4JF 3SQXA 2GCOB 2GN8A 3DPSA 2PJRA 4MVXA 1TM5E 3AJ8A 4J75A 4ZV7A 2CBXA 2JGFA 1VCMA 1WXXA 4U7HA 4RTPA 2ABWA 2E0IA 5KYUA 1TF2A 3RK1A 5L6MB 3LL7A 2PZMA 1WUKS 1K3UB 2ZUTA 4JVNA 3EEFA 4XVHA 3CWQA 3M4JA 5G41A 1ODLA 4NULA 3WOHA 3JAMA 1S89A 4DJFC 1QCZA 1QHFA 1WMFA 4I99A 3NORA 3GMIA 4L9WA 3EZXA 4GOND 3HBMA 3UF0A 1U9YA 3UWPA 4X97A 1WXHA 1ZS9A 1EP1B 4KXXA 5FI1B 3QELA 4ME6A 3U17A 2AKYA 3IBTA 2GFIA 2Z6QA 4HQRA 1NUHA 4L0QA 2BDTA 4YYEA 4EJSB 1N36B 2QN6A 2JFPA 2QTHA 3O3OB 3TQIA 4EZIA 1UBEA 1JLHA 3QTTA 4K0RA 3RHTA 3TWOA 4YAGA 2AKAB 1GFZA 4FFMA 1RFGE 4FU0A 1QX3A 5CNJA 4HFJA 1T2CA 3GJ5A 4JR2A 2AZTA 3QQPA 4L4SA 4ITRC 3BWYA 1DKMA 4WXYB 3N6VA 5CAEB 1HDOA 5JVDF 4BQQA 1QO7A 1IUOA 5FWXA 5DNDA 5BMVA 4LQLA 2F59A 3KHUA 2IH4A 2QM3A 1U5AA 1L5ZA 1H1TA 1JRLA 3M6VA 3AL3A 3ZY2A 4CKCB 1O5IA 5CIYA 4EHKA 2BELA 4L95C 5CFZA 4M7WA 2CDBA 3BB1A 3KRTA 3M3HA 1SKUA 2PS1A 1MKYA 4AX4A 3IR5A 5JWOA 2WWRA 1SCQA 2TMDA 2XMCA 2XWJI 4X95A 2FSVA 4YBZA 3VR4D 3C6YA 1EWRA 2AYZA 4NH0A 4RSRA 4F7WA 3TG2A 2HM7A 2QOEA 4GS5A 1JQ5A 4KO2S 1YR3A 4BBAA 1SQ6A 5KWVA 1WKVA 2J4FA 4B4DA 3R5SA 2JGEA 5IVPA 1LQTA 2Y1GA 4NLLA 3ILXA 1FLNA 4JKOA 5E9AA 4Q9HA 1RW4A 3KB6A 1CWUA 1ZGZA 2D1FA 3OJLA 5DU2A 5J3JA 2XMPA 5KOIA 1YR2A 2FU5C 2ADFA 1U3GA 2JAWA 3LLSA 3DC2A 2Z0MA 4RVFA 3WRYC 4CLXA 4M83A 4CF4A 1V71A 3UOWA 4BUCA 3GPDG 3PCXA 2PGLA 4QXQA 1FFHA 5AI6A 4MQEB 2FGKA 4CYMA 1EEHA 4CM5A 1VA5A 1UPTA 4LNHA 1AIPA 2ZE8A 5DBFA 2Q2NA 1MUUA 1VG9B 1WOYA 2VJAA 5BNTA 1KIAA 4PGHA 2XTNA 3ZYCA 1URPA 1JXAA 2QTWB 2R6R1 1GPYA 1RBMA 2A1UB 3D8RA 2R1UA 1VJRA 3G1TA 5M7EA 1GZDA 5FHQA 4D0LB 1N5KA 2O1EA 2W7TA 1K98A 1VE7A 3SYLA 1AHPA 1JIUA 3OZVA 2BFBB 5JBIA 1Q1BA 3IGFA 2G5TA 3SQOA 3W5HA 1HR0B 3I12A 4EATA 4GPZA 5BQOA 2ATXA 4AMBA 4W5RA 2XNCA 3C3AA 3ZU6A 1SEVA 2HT6A 5EEGA 3T5CA 4RC9A 5E95A 4AT1A 1JEEA 4KIFA 3PE6A 1S01A 4HWPA 4DT1A 3W8DA 1KK3A 2AK3A 3L43A 3RDPA 1GAJA 4Q3BA 3X3HA 1E2LA 4ZJYA 4W1SA 3OPQA 2GYYA 4FCCA 2ZLBA 4EB6B 5BY2A 1Y5IA 3ZWMA 3BHMA 2VNHA 3A9VA 3C3YA 4HDNB 4K7JA 4ZAVA 4BLUA 5DW0A 5AI8A 2VQEB 3O92A 3KHTA 3RGGA 2POCA 2AFVA 5EHQA 4PRZA 5K8IA 1G8MA 4MP8A 3K0SA 1C3LA 3NDIA 1OGJA 4WH0A 3G02A 4HWGA 1T5HX 3P2MA 4N0PA 4XDZA 2G67A 4U7WA 1H0SA 4NJEB 3FNRA 3T5DA 2PXAA 3ZWDA 3V55A 3SJBA 5IVKA 3IAUA 4JWTA 4CM8A 1P4SA 5JD4A 1YULA 3K4HA 3IRUA 5IXYA 2YMMA 2J5BA 4U0KA 4MUBA 4I6JA 3WNDA 2HA2A 1USVA 4R0NA 5FYQA 4C14A 5CXSA 4MW7A 1P6XA 3NNDA 3EZ6A 4FJ2A 4OTZA 2WIDA 2Q4DA 4YCDA 1WW3A 2IPNA 1LBHA 3NBYC 1JT2A 1XRRA 3AIMA 3FMVA 1LLQA 4W99A 2QQ0A 1ZXBA 3I4CA 3OUUA 7YASA 3NH9A 4GYJA 1G8HA 3CNOA 4IZHA 4N6NA 4YP7A 5A5DA 2HU2A 1WTCA 3MOIA 2KSQA 2H52A 5K0NA 4HDRB 3RS8A 4RORA 1JG1A 3PL1A 3PKZA 1SVOA 3AHCA 3HA2A 4G63A 4KPGA 3DE6X 1ZK4A 1PSDA 2NTYC 3NOVA 3HH8A 3OAAD 3ZIDA 1Z37A 4GOKA 4W5QA 2C61A 3WFIA 2ZDQA 3QUTA 1Z4JA 1EFVA 2C2ZA 3WGTA 4GL4A 4OD0A 2Y0EA 3DSRA 2HO4A 1JWBB 5CA1A 4ESHA 2W42A 1T0BA 1JTVA 1J6UA 1PZNA 1XZNA 3W5IA 2Y8EA 3ZI0A 1U3CA 3PK0A 4XYLA 2YWDA 2A30A 4L22A 4FYKA 2AZ4A 2C78A 1PQYA 3K0FA 3VMMA 4AY3A 3CF2A 3U4CA 1IATA 2EVWX 1NPTO 4DR2B 3SVLA 1OROA 5BP7A 3A1TA 4P4UA 1UPUA 1JQBA 1DJNA 1DC5A 4I2NA 4HNUA 1HDXA 3U16A 2AOWA 1OFUA 2AMLA 4Z51A 3GEGA 1NPDA 4I4CA 1ISFA 3GGGA 1F8GA 4QBHA 3G82C 2HIGA 4G4IA 5C8YB 3M9LA 2EBHX 1PNVA 2XT0A 3IUQA 5EL0A 3W5JA 4RJIA 1BWRA 1BXGB 2R1VA 2YBDA 3L6OO 4CF3A 5KX5A 2Y67A 1OTXA 3S29A 1JEQA 1XD8A 2RBEA 4HLUA 4MYHA 1JX6A 4GI2A 1Y5MA 4BWVA 2A92A 1K66A 1XVVA 9ABPA 5EJ2A 4CKWB 2BE9A 3OWOA 3R6GA 5DISB 3ONNA 3T3HA 3M70A 4LWZA 1MPXA 4R1NA 2YS7A 3DE3X 1PFQA 1T5DX 3VR6D 4CMKA 1I1OA 5KTNA 4E1VA 1FTWA 1UBRS 5ILQA 2F8LA 3I2IA 4P6VF 1CLUA 2IV2X 5CNKA 4AY5A 1X7ZB 1PDOA 4KEAA 3TCNA 4Q93A 2PRIA 4QXOA 1G291 3BGDA 4OEHA 3IE1A 1MU0A 4JLUA 4YRIA 1D2HA 1P5FA 3CB2A 1TA4A 5FBWB 2XMZA 1FFXB 1E1RA 2SBTA 1OWPA 3L04A 4B7UA 2F90A 4JT8A 2P77A 3SHOA 1PS8A 2GZ3A 3ILSA 3DLIA 5NLLA 3HXQA 3FJ1A 1RIIA 1QWOA 2QPTA 2RHDA 2B0CA 1Y1QA 1N5JA 3OM0A 1R15A 1T2UA 2AH5A 2J07A 3KFXA 3EGEA 1WCV1 4YA6A 1NNI1 3EZFA 1GZSA 3EGWA 4GOXA 1SC1A 2L69A 4RVGA 1GAQA 3GBVA 5AJZA 3UHFA 4LSZA 1YAJA 3DPIA 1FDOA 1GUZA 3P0IA 4ZVSA 4EBFA 4OK5A 1GCGA 4NOMA 1PRYA 4HUTA 2F3RA 4PGFA 1B1AA 1E64A 1T1RA 2PPVA 2QTVA 2WVAA 2Q8PA 2WKWA 4LIPD 3ZXYA 2DYKA 3DZGA 4W1RA 1IYZA 3ZHVA 3EQZA 3K0CC 2W2OA 3NTOA 1A9SA 2W98A 1Y4ZA 5CW1A 3TNYA 1UBJS 4DM7A 5J4YA 1MGOA 4Z4HA 3L0CA 2YNMD 1KAEA 4J1TA 3A25A 1JSZA 2ZB4A 3KR0A 5DHQA 3W6PA 4FE4A 4HMOA 2GHQA 3ZBPA 1N3YA 3N58A 4F2DA 1Y8ZA 1TUIA 1BWPA 2RFLA 4RF2A 4EARA 3K0KA 3NBAA 3MYYA 4DQUA 1OKKD 4MGEA 3SMVA 2M6LA 1IWPB 3I62A 2HSWA 4J3JA 1U7WA 3DYIA 1G6HA 4W1QA 3HB9A 1UMBA 3HR4A 3K1YA 3ETHA 1YUNA 1FDRA 2VNSA 2G80A 5HZHA 4URFA 1NHWA 3KZMA 1ONBA 1YF3A 1O3YA 3ABSB 5CEFA 2V7XA 3E2IA 3E3AA 4W8HA 4X1KB 1R16A 1GTZA 1LH0A 4RKQA 5AVJA 4JJZA 3QVVA 5TGTA 1A9XA 5K7SA 2F8MA 4YDHB 1M3SA 3QVSA 1Z0IA 2BFNA 2GESA 2YWBA 1N1DA 1CK4A 4HWRA 3UMFA 3TTTA 4E12A 5CM2Z 1OBVA 1X8JA 5DXAA 1PR6A 2DTXA 4WZBE 3FOBA 3BJEA 3ZIUA 4RVSA 1YDWA 4M0LA 4DR7B 3LHKA 4M53A 3VSCA 2X8BA 5MN5A 3DMYA 3F6PA 4R71A 1JHDA 2N9UA 1P3JA 4LJ7A 4TV9F 3HS3A 1Q3KA 1EESA 1M73E 3GJQA 2CB0A 3O4VA 2R60A 3PQ3A 3D6HA 3F6YA 3A6JA 1T8UA 4PXSA 4RTJA 3BTSA 2EERA 3AHJA 3H6GA 2OMKA 4DKXA 3FJYA 4KNYA 1FFBA 4OFZA 3D8HA 2BTQB 2FWJA 4E2XA 4U7JA 3G0OA 3THYB 5JNLA 1Y1LA 3JTEA 4XYGA 4DIDA 4Q9DA 3W4JA 4UBOA 4I9GA 2OCBA 4Z4EA 5TNXA 2QG9A 1TB4A 2B8EA 1H3FA 3DQPA 5AKZA 8ABPA 3C70A 3H4IA 2VQSA 4QG7A 4UCXA 3EW9A 1C0EA 3N59A 1AMUA 1TYBE 1U1GA 4WY8A 3JY6A 1T26A 1I1HA 2QPAA 1ZVKA 3FPBA 4A0GA 4GNKA 3MUFA 2GHRA 1T2AA 1M2EA 4KH0A 4QVKA 5ED0A 4B4VA 4NICA 3T9CA 1I9GA 3D31A 4HMQA 3PFWO 1RE1A 4M0FA 3P0JA 2V6GA 4KYVA 4J0EA 4YO7A 3FLEA 4BOYA 1GPKA 1NP6A 1RVV1 5DM0A 1ZIDA 1SD5A 5CLGA 3ITDA 2I87A 2TMYA 4M6WA 3WAKA 5HFAA 3OCYA 1YV9A 2QN8A 3WLEA 2FX5A 3DNPA 1U0OC 3ABRB 1RQRA 4R2LA 1KPIA 5K0TA 3G9TA 5FUVA 4A27A 5LQCA 4UCFA 3Q87B 4HNRA 3VX3A 2ZM5A 3LW7A 1XMOB 2C1XA 3WKAA 1P81A 4KREA 3CG0A 4XWGA 3FOFC 3QI2A 1UINA 3R5FA 4TTJA 4GBJA 3NDRA 3RREA 4R05A 1SCKA 2EKPA 3I3SR 2O5CA 3PUZA 2JI7A 1YRWA 3DBVO 2O19A 3CH4B 4FGKA 4Q48A 1A3CA 4TMXA 1XQWA 5BV8A 3GRAA 3EBLA 3G2OA 2GETA 4UHCA 2VK1A 5KKCA 4X8MA 1O77A 4Z3KA 1THGA 4H59A 4UU8A 2NU8A 3C8MA 1SKYB 1QGOA 3BSYA 5DF1A 3VOBA 2NO0A 1E8NA 3AY3A 1DAOA 1LSSA 1ZUNA 1TF7A 3PDWA 4GLOA 4HADA 3VDMA 1GWNA 4BEWA 3A7EA 4YRRA 4C4RA 1XTPA 3GR6A 2QJOA 4HRXA 3WB9A 1KY4A 2I1VB 1I7DA 1L7QA 3UWKA 5BWNA 5B1YA 4GLJA 1BGVA 1NUUA 4JUBA 3CMMA 3RJ9A 1DFHA 3VAZA 3QJYA 5EWMB 2ZYVX 3T6KA 1P3DA 2R47A 3THSA 1NBIA 3IAXA 1XMPA 2FMUA 3OE1A 4O4IA 3TLJA 1Z73A 4YAIA 2GSWA 5I9NA 1KK2A 3O8NA 1L1QA 2NUAB 5B2EA 2CV2A 1GPH1 4LGYA 1AXEA 2VPWA 1MHTA 1L5SA 3EOBI 2XOXA 4BAZA 3QOWA 4BFSA 3R44A 2FSSA 4MULA 1U0HC 5E4FA 1OXSC 2WMOB 1O8CA 5D51S 4CIVA 1D6SA 3IEUA 4A10A 3REQA 2O7SA 4Y2PA 2R8XA 4TL9A 3V7NA 4Y9RA 5BNIA 3QLJA 5DMHA 2WKPA 2R7KA 5ERGB 4OLJA 2XYRA 1I7NA 1YH3A 2WAAA 1UOOA 5D87A 1P9RA 1YMVA 5L3SA 2PS9A 2WUVA 3DL2A 1WABA 1TW3A 4RFSA 4NFLA 1WY7A 4E4TA 1ST3A 3BKWA 3G5UA 1PUJA 2AD5A 2R5NA 4RGVA 2PUHA 1F2TB 4IHAA 4H16A 3R40A 4N5NA 2VDWB 5F21A 1L9XA 3SEQA 3HN7A 4E13A 1NN0A 2BFFA 1QLJA 1H0RA 2JGNA 4LE0A 2BZSA 3QV1A 5K51A 2YFQA 1PJBA 3NHBA 3ETEA 4UTXA 3ABZA 4WOCA 3BGIA 3UMJA 4JC8A 2AFHE 5ICMA 4OBXA 4LE1A 1ISMA 4N0MA 1OIWA 3FWZA 4TRJA 3EZGA 1U2PA 2CEAA 2PLNA 1FSZA 3DWFA 3ITNA 4A0RA 1QH8A 3ZDRA 2OV4A 3ZK8A 1H3EA 4R4JA 4TSFA 1R0ZA 3HWWA 1SCUA 2GK6A 1SNYA 4L5YA 1XB2A 2WDPA 1T9DA 4M7PA 4TUYA 3U0VA 4A3SA 4DY6A 1U8CB 5C1BA 4N3GA 3HR8A 4D4GA 3NEJA 3PIRA 5A0TA 2Z58A 5JXJA 1KO7A 4WXMA 1USWA 3GAZA 2FFAA 4PLPA 1T5IA 3VNRA 2QZPA 3SR0A 4MGZR 4MIYA 4ZYVA 3TRJA 4EG0A 2DLNA 4OSOA 2OQ2A 5LP1A 2WSBA 4YDSA 1QS0B 2JIRA 5CB4F 4CCYB 1N6IA 3UA4A 4DV6B 3VU0A 2O50A 1Q7CA 3OE4A 4MJXA 2G0AA 5DE3A 1RYMA 1N5MA 2NZ2A 4EYKA 4Q6WA 3EIQA 3GJRA 3FZGA 3OUTA 3PE3A 4A8PA 4BVHA 1J5EB 1US8A 3IALA 2JLYA 1JLRA 2F3SA 1DKQA 3PFCA 3C41J 1W0KD 2BGGA 3I2HA 3TGLA 5LL6P 2O5RA 3LPAA 4DXHA 3MHTA 5LOVB 3IULA 2NV6A 1FW6A 3CNHA 2YVUA 1KF0A 1VKZA 3SCZA 4CLOA 3AHHA 4MWDA 5EHIA 4OHFA 1YMQA 1W0JA 1DC6A 5HBGA 3TJRA 3LPNA 3X1ZA 3NTUA 1H0HA 3X2SA 3UFXA 4AJKA 2C4UA 2BMJA 4L6AA 4GAEA 3CLRC 3V48A 1KAOA 1GKKA 1G7SA 2DHDA 2PTGA 4MR9A 4WNYA 3FCOA 2XOEA 4KX3A 5BSRA 1I3NA 2RH5A 1VIDA 1Z07A 2CZQA 3VU9B 3DC7A 2QMUA 3GRFA 3ONFA 3ZOZA 3BK7A 3RS0A 3ENVA 2WU0A 3IDFA 4M9CA 3FFWA 5HEKA 4RPLA 1CY1A 1ATIA 4UULA 5L9AA 2X1MA 1PEDA 4KCGA 2QLJA 3EGXB 2IOYA 4GICA 3ODGA 2GD1O 1Z18A 5DULA 1NOIA 3HTXA 5GJBA 3T8YA 4XE5A 5DP1A 5AOAA 4ZREA 3RT1A 1SA0B 2D54A 1XP8A 4KGZA 4OBEA 4TMTA 4KMMA 1A4IA 2Z83A 4WKBA 1YS4A 2WHPA 5BN5A 2IPLA 2V7EA 3LF1A 3UHAA 4BLSA 3N7UA 1F38A 1QNLA 1Q6ZA 3RUFA 4D4KA 3T0IA 1TCBA 2FZLA 1LTKA 2H2FA 3GJ7A 3MWEA 1NRIA 4X00A 5CYFA 1G4AE 3KEOA 4OK3A 1I7LA 3STWA 2Q3LA 2VNJA 4TKUA 3NHRA 4FDUA 4CG0A 1K6XA 1Y3IA 2GD2A 1KNXA 4NNOA 4B3JA 4YR7A 7ADHA 1BROA 2RH9B 5EPOA 2WF8A 2JGJA 1HX7A 4D9IA 3UXYA 1U0LA 4Q3DA 1JEAA 1K7XB 5ICEA 3KQLA 1N78A 5T7BA 4DDUA 3RO7A 1E6MA 1RM3A 2H1RA 3F9CA 4E6PA 3NP9A 4OCZA 4J91A 5J43A 1TUBA 2Z1DA 5CB6A 1SM4A 1PW5A 2JVIA 3R5HA 2H54A 4FINA 4Y2JA 1D6MA 2BM1A 2QT0A 2VATA 1QV7A 2N3ZA 4KYUA 4QO8A 3M9XA 4KQCA 5JYEA 5KSYA 5NULA 3QE4A 4HWOA 1YB7A 4U3JA 5M34A 3QZUA 4HB2A 3RQIA 3RRZA 5FNZA 2K87A 2WQZA 3V8MA 3G8BA 2WYOA 3SD7A 2IIVA 3E7DA 1YI0A 2JIOA 6CHYA 2NU6B 3IPRA 1PJLA 3FUWA 1KYTA 2FEPA 2FPOA 3N2KA 3KDAA 4U9UA 4DG5A 1THTA 3LH5A 2IGTA 4DUYB 1OREA 2GHIA 1POXA 1YRQA 2DC1A 1P77A 3JYNA 2IEBA 3GDWA 4C4YA 1YQDA 1UMDB 3D8NA 3RC3A 5AVKA 1OAOA 3G2JA 4LXXA 1GD1O 1JSLA 3NHKA 2D0PB 3DE5X 7REQB 2QGZA 1P19A 3DHVA 5REQB 3AJ9A 5K3DA 5ELXA 1X9GA 2XD9A 2W2PA 3PQCA 2Z57A 1VSUA 4FBGA 3O26A 1EYZA 2AF3C 2HL6A 3QI7A 4IH9A 5EGSA 3TRKA 3W8FA 4EDHA 1SHZA 4W4TA 4C0SA 3H1PA 1OILA 1SZCA 2JAOA 2CHUA 1MMFB 4XIJA 2IV7A 2J0QA 3QUBA 3Q9LA 5AKEA 5DXFA 5I4CA 3F2VA 3ZHUA 4KVAA 4KRGA 5LWHA 4QWWA 4CCAA 1IY0A 4GR4A 5ICGA 5FO1A 2DULA 1BC5A 2ODEA 3DT6A 3QLVC 4IFBA 3F98A 5LM3A 3MCWA 2QV7A 4BKRA 3DVAA 4QOHA 3A3YA 4K3UA 1W88B 5TC4A 1KAQA 1CS4C 1XZKA 4UHFA 5DTEA 4Q03A 3B8HA 4CMHA 3NEAA 3HV0A 3W5SA 2GX6A 2CDAA 3IEMA 5FPHA 1UBKS 1M34B 1NATA 4RWEA 1ISIA 3QE0A 3JALA 3VH2A 2I99A 1YHNA 4G56A 4YP1A 3F97A 3B1WA 2NU7A 1P31A 1MG0A 3KYDB 3UWDA 4C0WA 3FMOB 1IULA 1IHOA 3OMXA 3DLPX 3MN1A 1PR4A 4NTZA 2ETVA 5F7ZA 3WIOA 3WWPA 1ORIA 2IYTA 5AP9A 2I4NA 4D98A 2FMTA 3VPDA 2BN4A 3U7FB 2J1LA 4RIHA 3JVUA 1MN6A 4Q15A 5JXIA 2KBFA 2VDOB 2FN8A 1IG3A 3QYJA 1PZGA 3ZWCA 1Z6GA 2EX4A 1T0JB 3CZPA 1KP2A 3IDZA 1U1DA 1VG8A 5F2EA 5AO9A 4RK4A 5FUYA 3HO6A 5JBNA 3JQDA 1SKBA 1VLVA 1JG4A 1E2HA 3OQ6A 1S96A 3ZC3A 4M0KA 4FDVA 1FY2A 3OQHA 2FRDA 3KVYA 1Z8DA 1IU9A 5CUQA 4W5TA 3H1GA 4Z9AA 2G1PA 3FYUC 2MT9A 4NECA 3T15A 4HTFA 5IC5A 4QT4A 4K40A 1E61A 2ORWA 1R6VA 2RHWA 2PT5A 3LT2A 4AG6A 1A9OA 2QD4A 4MUXA 1M6VA 1U7HA 2OXFA 3NNNA 4M9UA 5K3AA 1TNDA 4AJLA 1QU3A 1WDKA 4OGLA 5EY5B 3K2IA 1Q7EA 4N3BA 4YQZA 5EJ9A 2CFSA 2WUWE 3AYXB 4JMLA 4LHXA 1JG7A 4NX2A 5DM4A 4R81A 4FC7A 5TQ2B 3I1YA 3TNDA 4NEQA 1ISPA 4QDTA 5ALSA 5HUJA 4NZMA 3F74A 3PFNA 1C0PA 1U11A 1WJGA 1M2GA 1A9TA 2FOLA 2WT8A 3AW9A 1GG2A 2GXAA 3SYTA 4MWSA 1L3CA 5DZSA 4C29A 3DR3A 2XTJA 1Q83A 3PDIA 3OY2A 3ZCUA 2HJVA 4RS3A 3ZD8A 5B3KA 4BBPA 5K6RA 1T9CA 1GEEA 3HBNA 3C16C 1Q1AA 3CZ5A 2HPVA 2R68A 3PWTA 1MC8A 3ND7A 1NVDA 2E4WA 1X74A 5KOJB 1E3MA 1U7DA 2BLLA 2GJ8A 4EPXA 2EG9A 4KX5A 1PR3A 4LY6A 1U9ZA 3TQFA 4JL6A 2ZSDA 5T4FA 1S8NA 5KZMB 2WKRA 1LS6A 2O2SA 2Q4EA 5EQDA 3ADPA 3GUVA 4FHCA 3RC9A 1LDMA 2FFJA 2PZJA 2YY7A 5EIWA 2JFWA 3DP9A 3HNPA 3IURA 5FLKA 4C3VA 3FLBA 1IC6A 1NDUA 4YH1A 3A6HA 2QRLA 3LXUX 1UQUA 2AJCA 5SY4A 5DEIA 5JRDS 1YNOA 4RMJA 4ZPJA 5EXTA 1NUTA 4ZMRA 4FOSA 4N6GA 4HXYA 4DDVA 3SQNA 1CF2O 1W87A 1XLVA 2QM8A 1VHQA 1EG2A 2HCBA 1PZXA 4K6KA 2BGNA 1XPRA 1R7RA 4LI3X 5EQTA 2R2AA 1N25A 1T1GA 5CCXA 1YIDA 4ASUD 5A7HA 5K20A 2O8BB 1KZ6A 4TT3A 4XM0A 3Q1KA 1YZHA 1C3OB 4L3OA 2K7FA 3QEAZ 2P11A 3CNNA 4XDGA 3CW9A 4ARVA 1O96A 5CX1B 4FYHA 4GPTA 4QU8A 3SZMA 4FWTA 4DADA 1JA0A 3TI7A 4W9NA 4C7XA 1JKJA 1E3SA 2X1HA 2MDTA 2P5SA 2OP0A 4BB6A 5K8LA 3WLSA 3FE2A 4KAJA 1QIKA 1ZM2A 1FFAA 3CB4A 2VJCA 2OORA 1A77A 2QZSA 1GTL1 1VG1A 2EW1A 3C5VA 5KTTA 5MN4A 3IEIA 1NW5A 4CF7A 5JO9A 4F6RB 3AUJB 2BFEB 1GITA 2HDWA 5F4BA 5KTKA 1F8FA 2WSSD 3IQXA 3I6YA 3RFFA 5HCIA 1NV8A 1CUAA 3U61B 1XQVA 5BPHA 3KQHA 5LZ7A 3AG6A 2GMWA 4FEYA 3AESA 3LP8A 5LMNB 4MI3A 2Y1FA 3O91A 1UBOS 1D7AA 5CM9C 4F4HA 3ICCA 1JGTA 1B3RA 2X9VA 4TRRA 3C8UA 3N0VA 2JF0A 1C7RA 1RMTA 4FR2A 3E05A 1EINA 2ZW9A 2VBGA 3D0KA 3DAOA 4WDRA 5AK0A 3RUPA 2ACKA 3S3TA 4GYKA 3V2GA 2G9ZA 1AK2A 1DRUA 3QNUA 4H6PA 4H0NA 5GV7A 5AD1A 3PPVA 4L6CA 3VVLA 3ZKWA 5SYNA 1I1QB 1FTQA 4FPXA 1KI6B 2HMSA 4PY2A 5HQJA 1ZEMA 2CLFB 3JWJA 2WOOA 4D2IA 2M6RA 1ZD5A 4OXKA 4F46A 5LQUA 4B9EA 1PSWA 2DFPA 2NVUB 1YR7A 3AVWA 3F67A 4IGAA 1V1RA 1Z88A 2OHOA 2VWGA 3Q7EA 1R8JA 3BIWA 1RZVA 2WK1A 2BUCA 2YHIA 3DD1A 2J9RA 4OJKA 4U9IS 4CGZA 3D4PA 3I37X 5ALWA 4TTRA 5K0EA 3GUHA 2N75A 2CL7X 5CLIA 5DV9A 3M6LA 1AZLA 2FQYA 2HHCA 2ZWMA 3LIIA 1EDBA 1VLZA 1XNJA 4AZTA 5TQVA 3FYUB 5DK4A 1YE3A 1EXWA 4MUIA 1JHRA 2PUTA 4F56A 2VHJA 1BYIA 4M46A 3VPBA 4C08A 4BTLA 2ZCJA 5A04A 2XB8A 5AUQA 4Q9AA 1XLWA 4JOBA 4L4XA 1XZMA 4Q1CA 5JADA 3MAGA 5CXXA 1VGVA 4NMXB 3RJ5A 1JPNA 3LBAA 1C8LA 2FHPA 5EZ5A 1IB0A 3Q72A 4OU5A 1IQRA 1JW9B 3WHIA 2M32A 1RMQA 2J6IA 3DDSA 2VAXA 1YZLA 4R1PA 3LLMA 3GJ3A 3WRXA 4EY6A 5FBHA 4ZV4A 4LYHA 1XD2A 4FMBB 1XNGA 2DZDA 1FUEA 1YE5A 1X70A 3Q3VA 4N40A 4P7BA 4AWXA 1ADFA 1E0SA 4QODA 4B4UA 3EARA 2GN1A 3L77A 4YJKA 3DFIA 3N0WA 4DANA 2W71A 2IS4A 3GCGA 1W5BA 1B2LA 4P8RA 4Y6GB 1BH6A 2XV1A 1YACA 1SOAA 4JMPA 3LOUA 1FTGA 4JB2A 1BW9A 4QOFA 3E03A 3H5TA 4Z86A 1OI2A 2I62A 2YVKA 3KX2A 3L1JA 5BO5A 3NVDA 4XGRA 3SSNA 5ALGA 4W82A 2HJRA 3HBAA 2DRIA 4HAZA 2VC2B 2YYZA 2Q49A 2J0EA 2QP4A 1KGDA 3UQZA 3F2IA 1WV1A 1WEKA 1DMRA 5FOWA 4K0KB 2ZS9A 1J7KA 3QYPA 3GARA 4Y7CA 4ZVTA 5KO2A 1O0SA 2WNIA 5HIMA 4KI0A 2GJ4A 4L8YA 3BIXA 4K05A 4WV3A 2WNSA 1DBIA 2GPBA 2XF2A 3CLTC 4QDUA 3QU2A 5D7BA 2NO7A 2ZQYA 3HL0A 1DUIA 4YRSA