1ISJA

Crystal structure analysis of bst-1/cd157 complexed with nmn
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
total genus 87
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1isjA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1isjA02
1LC0A 1Z74A 3RIHA 3HQ4O 2HMTA 1B8VA 4ZQGA 5JNLA 4EBFA 2VHXA 3RC2A 3IKTA 3PDJA 3GHHA 1DXYA 2J5RA 4HNHA 3DBRA 4RLSA 1DIRA 2Y68A 1ZMTA 4MVJA 5COAA 3PGXA 3KYDB 1E1LA 2FN7A 4J7UA 3FNFA 3K73O 1PZHA 1GQYA 5KKCA 1I2CA 1KYQA 3L0DA 5DF1A 4XR9A 1ADGA 2NU9A 4JROA 1AHHA 3LT0A 5L7TA 1R6DA 2ILTA 2BFMA 3GGPA 1QV7A 2VZ9A 5H82A 4Z0PA 3EVNA 2VN8A 4E0BA 1C0KA 3IUPA 2PH5A 1ZW1A 3PYXA 2E37A 5EPOA 1E7YA 5FFFA 3RUDA 3TFQA 1QR6A 2IZ0A 4CLEA 1ZMOA 1YO6A 2YJZA 3COSA 2HCTA 3GDFA 3QWHA 4YJHB 2P5UA 3JYQA 4OOFA 2CD9A 2XF8A 3Q9UA 4P8RA 4GL4A 3RUHA 4ZVVA 2LDBA 4PVDA 4Q3BA 1TB4A 1ZNQO 2CVZA 2O50A 2ZIZA 3QV1A 3DAPA 4BO7A 1RM5A 4OYRA 4H3VA 3WJ7A 1DRVA 4HBGA 4NBVA 4ZICA 3OMLA 4JBGA 2GD1O 4FBGA 4XDZA 3BTUA 5G4LA 3DBVO 2EKLA 2GN8A 4XQ9A 2V65A 3S1LA 1UDBA 4BNFA 3UUWA 1GYQA 1T26A 5I8ZA 2Y05A 4NK5A 5JS6A 4BB5A 3WTCA 3SVTA 5TT1A 3FNEA 4FB5A 3D7LA 3GEGA 1VC2A 3QW2A 2IYPA 5C5IA 3GVHA 1E3WB 2ZQYA 4OSPA 3I5MA 3ZWWA 1EUDA 4RORA 4Z9XA 5K6AA 4U0KA 3ICCA 3K8ZA 1E6UA 1I10A 4YPOA 3DDNA 4UVIA 1KIFA 3PHGA 3K31A 3H9EO 5ES3A 4BNTA 4YR9A 3DEYX 1CRWG 1DEHA 1JN0A 3KYCB 3QY9A 3UCEA 1NHWA 4CMEC 1X1EA 3NGLA 4R68A 4AVYA 1BHSA 1CETA 3IS3A 5IZCC 5EJ2A 1EK5A 3H4VA 1PGPA 4UVGA 5G0WA 3GEMA 3BHIA 1Y9AA 1P1JA 1EQ2A 3MTJA 3L6EA 2C82A 3KB6A 3GDOA 2C20A 3GUYA 5BNIA 5EN4A 1PS8A 9LDTA 1N1GA 2NM0A 3WMXA 1CF2O 4ALLA 2AE2A 1WDLA 1BGVA 5I7EA 2AQ8A 4XYEA 1WAMA 3PP8A 1L1FA 4ZQBA 2YZ7A 1U5AA 2NU8A 2DQ4A 2WD7A 4WASA 3MJSA 4TZTA 1BXZA 1I3LA 5IXYA 3ZU2A 3E18A 1SMKA 2PNFA 2I67A 4OKIA 5F21A 4LN1A 3ZWNA 3UCXA 1NQAO 5THQA 1N5DA 2BGLA 2DUUA 5COQA 2AA3A 2VRCA 2PZMA 1GCOA 1HDYA 2UV8A 4E3ZA 4E31A 3FWNA 2Q1WA 3WB9A 4J1TA 4N18A 1SEVA 1SCUA 2D2IA 4FW8A 1J4AA 4Q3DA 3VVBA 3WLEA 1ARZA 2EW8A 1YWGO 2I5PO 1MA0A 5T8KA 3U4DA 3ZNQA 3WYEA 4NH4A 5IZCA 4TRNA 3WG9A 1BG6A 4B4VA 1X7GA 4BGEA 4MDHA 4GVLA 4PN3A 4YJGA 2RCYA 3UF0A 3G1UA 5A1TA 2VOEA 1A4UA 3OQBA 1I5RA 1H5QA 2FSVA 1MGOA 2BH9A 1VE9A 5EQDA 1DDOA 1EE9A 3RBVA 1DHRA 3RFXA 2VHYA 2ZJ1A 2Q99A 2WYVA 3S8MA 1ZXLA 1LX6A 4R41A 5K0ZA 1XKQA 4GAEA 3AOEA 4JGBA 3RFTA 1WPQA 3OIGA 5T57A 4MVJM 2OXIA 2PZKA 3DBLA 3X2EA 3F9IA 1YVEI 1BW9B 1C14A 4KQWA 2O4CA 1GPDG 1ULUA 2VTEA 3F5SA 4IJWA 4ND1A 1BWSA 1T2CA 4FR5A 3QWBA 3GDGA 1H9AA 2G82A 2RH8A 1MC5A 2Y1CA 4ND2A 3ZHZA 2ZTMA 1CIVA 2RHRA 4J4HA 4JK3A 4M49A 2BI7A 1O8CA 4GGPA 1IYZA 2P2SA 4D44A 1QV6A 1R4NB 2I9PA 3CH6A 4HADA 1XWFA 1K6JA 3NJ8A 1GU7A 3BMQB 5L4SA 5DOZA 4MP3A 2IEBA 4UUOA 5AVOA 5BT9A 2YDYA 3F5QA 1ZK0A 3K2EA 2V6BA 1FJHA 4YAGA 4EUEA 3GFBA 3JQDA 3RJ9A 2GNAA 5F1OA 1XGKA 2G1UA 1U4SA 4BNXA 1NXQA 3GNQA 4R51A 1P45A 2Z95A 1UP4A 1VJTA 3MOGA 1GTMA 3L9WA 4R1TA 3FR8A 4INAA 5L3ZA 1KETA 1V8BA 5KIAA 2NACA 4NK4A 2DTXA 1E7WA 4CM9A 3H8VA 1NWHA 4KOAA 4ZRNA 3JYLA 4BNJA 3OJEA 2EP5A 4R5MA 1R16A 4OXNA 4PRKA 4J4TA 2NVUB 4NJMB 1O0SA 3PWKA 4PLYA 1DIBA 2CFCA 1ENYA 5G4KB 4BQPA 1BDBA 2DVMA 4QO7A 1N92A 4FOSA 3AW9A 4DYDA 2VYVA 2R00C 2JCYA 2Y1DA 1Q0LA 3D64A 3LT4A 3IL2A 2A94A 4OL9A 2CZCA 1SOWA 1IZ9A 3TZKA 3U4CA 1JKFA 4BO0A 1XEAA 3JD3A 4F6LA 4WOJA 3WS7A 4ONEA 4PZEA 2C59A 4I5GA 3TQHA 2D1YA 1IY8A 3T4EA 2W2LA 1V0JA 1XLTA 4CR6A 2CMDA 1JA9A 4IXTA 5H83A 3OH8A 2X0IA 3ZN2A 3W6ZA 4BGIA 3DZBA 1UH5A 3OJ0A 3U09A 1LRLA 5AXBA 3BAZA 4O5OA 4J0FA 5EESA 1PR9A 1ZEJA 3ZCXA 2GZ1A 4QFCA 4DXHA 3H5AA 2FY8A 2BRUA 4A73A 3HWRA 2IXBA 3STHA 2BMAA 3OEYA 3W4KA 2I3AA 4UEJA 4ILKA 2GUGA 3HJAA 3RUEA 4YRAA 3HSKA 4CV1A 3NAQA 3AFMA 5EMHA 3H9GA 2X9NA 1ONOA 3KVOA 4R3NA 3VZPA 3VKVA 4AJEA 4AJKA 1GDHA 3NGXA 1WNTA 1I2BA 4ALIA 4D0SA 1F8GA 3QRWA 3O8QA 4MKXA 4ND3A 3AJRA 5BQFA 3M1AA 4FIZA 1C1DA 3QVSA 1DAPA 1I0ZA 4I5FA 2QX7A 3FNHA 3TL2A 3WX0A 5KKAA 3GFGA 3ETEA 3L07A 2JHFA 4CUJA 1AXGA 1B16A 1Y81A 4E2XA 2JAPA 1T2FA 4R3WA 4DWVA 4IM7A 5KVCA 1R0SA 4YJDA 1G1AA 1O9BA 1EE2A 2O2SA 4OH1A 3V2UA 2GDZA 4MO2A 3RC9A 1C1XA 3ZWPA 5K6AC 1Y9EA 3PGJA 2GGSA 3WGIA 3JSAA 3FBGA 1ZK4A 4R01A 1PEDA 1DPGA 3LZ6A 2NQTA 1LJ8A 4Q39A 3VZSA 3H9UA 1CJCA 2FSSA 4PG5A 2GLXA 4P38A 4NBWA 5IAAA 4GI2A 4Y9DA 1R4MB 4B3IA 5A3JA 1HE3A 3PIIA 5JDCA 4QX6A 1AE1A 1PQUA 2ZATA 1LRJA 2HMUA 4I08A 1YRLA 4UUNA 2E48A 3INGA 1L7EA 2EKPA 2WYUA 1UP7A 2C2XA 1SAYA 4YJFA 1EZ4A 4DRYA 1G0OA 5F5LA 3S2IA 1K6IA 1B0AA 2FR1A 3WTBA 4IJVA 2EW2A 3L4SO 1GZ3A 3NJ4A 2Y66A 5G0SA 2AQKA 3GPIA 4L74A 2YV3A 4OAQA 4XIJA 2G5CA 4FFPA 4RPJA 4E33A 1U8FO 1W0CA 4RPKA 1TXGA 1XA0A 4NMHA 5ENDA 5L7YA 4G5HA 3Q1LA 4RCVA 5IF3A 1WDKA 4JX8A 1YL7A 3M1LA 4J3FA 4D7AA 2QYTA 4JIGA 2NU7A 4BUCA 5KOIA 3LVFO 3TSCA 2J3HA 1MFPA 4GBJA 3WJAA 4IY1A 4TKLA 2Q1SA 4IDAA 5CHEA 5DCUA 1UXJA 4CODB 2VZ8A 2X1HA 5KNLA 4I9UA 1B2LA 1VJ1A 4H16A 4NHEA 4YAJA 1IL0A 5JBIA 1PJCA 2FZWA 1LNQA 1GV0A 1AHIA 1LQTA 1NVGA 3AY7A 4FJ1A 4KDEA 3W4JA 1PS0A 3EDMA 3EVTA 4TRJA 4F6CA 1WP4A 4HKTA 4YJHA 1GUFA 4QSMA 2GN9A 5KWEA 4E5YA 2ET6A 3GZNA 1E1MA 3I23A 3JCZA 4RF4A 3RQSA 3TF5A 4IIUA 5DP1A 2EJVA 1YBMA 2DBZA 3IIEA 3Q11A 4R9RA 5TLSA 6ADHA 1XDWA 4XA8A 3PWSA 5TX7A 1NNUA 3DMTA 4CM8B 4BGVA 1M67A 4GX2A 1DC6A 1ZK2A 1VM6A 5U4QA 1VJ0A 3TZ6A 2EGHA 4CMCA 3A28A 4A10A 4WCFB 3ANMA 4R1NA 2OOSA 4XRRA 4RV9A 4OHUA 1R0KA 2POQX 4LK3A 2P4QA 4YRBA 1XQ6A 4WLNA 2TMDA 3DZKA 3DZIA 3PQDA 1HDXA 1TT5B 3GVPA 2NLOA 2J3KA 3PQEA 2QRKA 5THKA 3O4RA 3QWAA 4Y98A 3SJUA 2Y0DA 1U28A 4XB1A 1T2EA 2PK3A 3BTOA 2E6UX 4E32A 2C07A 2I99A 4C4OA 4Y6RA 2ZJ0A 2ZKLA 2Y1FA 1DJNA 1LBEA 4Q3AA 3DBHA 1UJMA 5I7VA 2B37A 2DU8A 3PJDA 2HDHA 3VOSA 2I6TA 3GG9A 3M6IA 3QE3A 4YXFA 2FRDA 3NRCA 2NVWA 2PTGA 1MUUA 1LDMA 4J9VA 5HWSA 3CE6A 3LK7A 3TWOA 1A7KA 4KUGA 5C7LO 1QYWA 4WLUA 1Q2XA 4Z3KA 3HG7A 1H93A 1HRDA 2X4GA 1YS4A 4GSLA 3FD8A 4DPKA 1U8XX 1HTBA 4QTZA 3CIFA 4ZRMA 3S2FA 3UVEA 3MJVA 1ADCA 1ISMA 1OC2A 5F3RA 2YHIB 3JQ8B 3CINA 3WNVA 4CMIB 4CQMB 1HDZA 4BO6A 3UAGA 4LCJA 4GX5A 1PGOA 2WYWA 3KLMX 3I9OA 2VHWA 2W90A 3EMKA 4IZHA 2VQ3A 1JWAB 5DCWA 3SLGA 4WKGA 5IDYA 4N54A 1J6UA 5JDIA 2C5EA 2SCUA 2QHXA 1EBUA 1LQUA 4OIMA 1ISHA 3WGQA 3TDKA 1T2DA 5CFZA 1NHGA 1ENPA 5JYDA 3DFUA 1DAOA 1KVQA 4NFHA 1HZJA 4J2OA 3OHSX 2BFPA 2UYYA 1I8TA 3PJEA 3VPSA 1Q0HA 1YDWA 2YHUA 3GAZA 2A35A 4H15A 3DZFA 2X5KO 5L9AA 1V35A 2WDZA 3E5RA 1HWYA 4PLWA 3SXPA 1Z82A 2X22A 4J43A 4IZIA 1RM3A 1UXHA 3JQGA 4Z6KA 2RBEA 3IUSA 4AL4A 4PG8A 3RCBA 2O3TA 3PHLA 3V2HA 1U1IA 5AOVA 1KVSA 1RM4A 3FRJA 3DB2A 2PGJA 4WEOA 4F3YA 3SC6A 3WGGA 1VL8A 2ZK7A 3PK0A 1KVTA 3CSDA 1DO8A 4PIVA 3WGTA 4D3SA 1PWXA 2VUUA 1UAYA 3O8QB 4Q3EA 4XCVA 2WE7A 4HX5A 5JC8A 1NPTO 5DULA 3U4HA 1F17A 2Q3EA 1P77A 1KEPA 1E5QA 1U4OA 4X54A 3ZHXA 5C37A 1GV1A 3ABIA 3JQ7A 3ST7A 2EERA 3ITDA 4A7PA 3MTGA 5A02A 4JP2A 4IQ8A 6LDHA 2A92A 3A4VA 1I3MA 1NX6A 3WGHA 2R2GA 3U0BA 4A5OA 4XD2A 4BNIA 1P1KA 4CM6A 1NP3A 3TFOA 1D3AA 5KVVA 4CR8A 2ZCVA 4MVJE 3ZHYA 2Q4BA 1WWKA 4TROA 2HO5A 3RU9A 3G1TA 1DIHA 4NNJA 1Y1PA 3WR5A 2HMSA 1GYRA 3NV9A 3ORFA 3R3JA 3WLFA 1KS9A 1U7HA 2Y0CA 1PZEA 3FF4A 1GQ2A 4RVFA 3GVCA 4CLRB 4KZPA 1CDOA 4PLGA 3NYWA 7MDHA 2ZTVA 1SB8A 4M8SA 1FF9A 3RD5A 1VI2A 4WLFA 4BNHA 3RAJA 1GY8A 3NT2A 4UREA 4CLXA 4CMEA 3B20A 5DCYA 1T4DA 4ZA2A 4EJMA 4IJKA 1E1NA 2Y1OA 3WFIA 5GZ1A 3OBBA 3AM5A 1OFGA 3LF1A 2HKIA 4BO3A 3ZNPA 3TL3A 2I76A 3DOCA 4J1SA 1RYDA 2OBYA 4IDBA 2ZCUA 5U1PA 3WQQA 4EITA 4RVDA 1P1IA 5CPBA 3ANNA 5DDIP 4DVJA 4FPXA 2YDXA 1C0PA 1T24A 1GCUA 3SBOA 5LCXA 1UXGA 1DB3A 1KEUA 1YBVA 5U9CA 4RO0A 1IPEA 1PS9A 3WSWA 4D41A 5CDYA 3D3EA 1ONNA 1SC6A 3HADA 2GSDA 1X14A 3ENNA 1JQBA 1V9LA 4ALNA 4L9RA 3FN4A 4I9HA 5A4DA 4B8WA 1TA4A 1IULA 3GGOA 4MP8A 3SEFA 4CV2A 2NTNA 4QT0A 3KHUA 1ADBA 2DT5A 3ZWBA 4YB8A 2CVQA 4WUVA 4N5MA 3FNGA 4AJ4A 1KEWA 3JQBA 1UR5A 1ZJYA 3GAFA 3DZGA 4FCCA 2PA3A 3CXRA 3ITKA 5ENVA 4K6FA 2HJRA 3MJ4A 3LDHA 3AU9A 3NDIA 1RJWA 2UVDA 4IQ0A 2UDPA 2V6MA 3Q0EA 4R16A 5CG1A 1N7GA 1W73A 2OFPA 3VKUA 1E3IA 3F6YA 4PLPA 1PSDA 4DC0A 2D3TA 4GMGA 3ZWMA 4IDFA 2Q46A 4PG6A 1LSUA 3DTYA 4DQXA 1FK8A 3AOGA 2P68A 1FXSA 2FPIA 3CEAA 2D5AA 1DC4A 3AUAA 4YAKA 5B12A 3FTNA 4JLWA 4MINA 1I30A 1Z7BA 3JQFC 4QO8A 4TWRA 4YT2A 4D0RA 1VKNA 4FDAA 1QMGA 1B26A 1HDCA 4PCVA 2IE0A 4Y6SA 4EJ0A 1R4MA 2EIHA 2Q2VA 2NQ8A 4DLAA 2VZ0A 1JAYA 2WM3A 3ZV5A 1QKIA 1V3UA 4RF5A 4BO5A 3LU1A 1GYPA 5JSFA 3JTMA 2JD1A 3KRTA 1IPFA 4P4LA 4IIVA 3DBHB 3BMOA 2XOXA 1QLHA 4DQVA 3OFSA 1GD1O 5L4LA 3P19A 3V1YA 3VH1A 4WK6A 4CM5A 2NWQA 4FFRA 1YH3A 3KYCA 2PV7A 1NYTA 3L4BA 3CZRA 3WYCA 1EQUA 1A5ZA 1VPDA 4I5DA 3RASA 4I1IA 3I4CA 3HNPA 4XQGA 1MFZA 3PWZA 7ADHA 4B7XA 4M55A 1T1SA 4YT5A 4Z9YA 3I6QA 5CDSA 3GK3A 1NTOA 4QFDA 1PQWA 3DAGA 1X0XA 1C1DB 4I8XA 1PR3A 3JYPA 2W2KA 4RDIA 5DOVA 4KUHA 5KTKA 4FFNA 5T8KC 1MXFA 2WTBA 3VPGA 4WEQA 3JV7A 3TJRA 3WMWA 2O7QA 2DKNA 1DFIA 1H6BA 3DXFA 4KDFA 4E5PA 3IP3A 5KVQA 1YONA 1C0IA 1QSGA 4XX0A 1IHYA 3UN1A 5JAQA 2DPHA 1C3VA 1D1SA 2P4HX 4BNVA 4BQRA 1H6CA 2BF7A 4RVHA 4JCOA 4WLEA 1SZJG 3UCFA 2O3RA 3BMQA 3LLSA 1ZJZA 3WDSA 3L77A 4TMFA 3W8DA 1ORRA 2NADA 3NT4A 1GEGA 2EWMA 2X0RA 3VAZA 5JE8A 3D4OA 2J5KA 3UKOA 4DMLA 3NDJA 3DWFA 4RLHA 3QQPA 4E2ZA 2CY0A 3NTRA 1OMOA 3GY0A 4D42A 3ETDA 3MJTA 4ZD6A 2AEJA 2VWHA 3UHAA 1Q1NA 5JXWA 3ADOA 3ZU4A 4TRMA 3JQEA 5JPIA 5KCZA 1PL8A 3EW7A 2Q1UA 2YV2A 4TVOA 4Z3DA 1U2GA 4CLHA 4XYBA 2X8LA 3VPHA 5I7SA 1Y8RA 1NVMB 1DHTA 2NUAA 1ENOA 3U62A 1MV8A 3MOIA 2FMUA 1M2WA 1QYVA 5HS6A 3GH3A 4LMPA 1ZCJA 1ZO8A 4J7XA 3DFZA 3R1IA 5CP8A 4YEDA 4WNCA 4BMNA 1YKFA 2HK8A 3I83A 3WOHA 3GNTA 3JYOA 4J9UE 5GZ3A 3D4PA 4CJXA 3OA2A 2XAAA 4YJGB 4HWKA 2DLDA 4K6CA 2RIRA 2BGKA 2B4RO 1KOLA 5IFLA 1P9LA 5H81A 4EEXA 5JAMA 3UOGA 3JQFA 2VYNA 5L7WA 1Z7EA 3DBRB 3P2YA 2GRAA 3ZGYA 4Q3CA 4YAIA 3KSUA 4RVSA 3SC4A 1IZ0A 1E3EA 1LDBA 5I9NA 4M89A 2QRLA 2O48X 3RUFA 4L0QA 4DREA 1GZ4A 1M6WA 1JVBA 1QXSA 3MJCA 1F8FA 3RKUA 1I32A 4BV9A 1ML3A 2HLPA 2BHLA 1LUAA 3G79A 4RVUA 1M6HA 1P44A 2EEZA 4E5NA 1NM5A 1X7HA 4UEKA 4ID9A 1T1RA 4CMKA 3ZV6A 4K9DA 4WECA 3UW3A 2X7HA 3FCOA 4UULA 3D0OA 3ROQA 4L4XA 1RKXA 3ON5A 4ZJUA 3JQ9A 1ADFA 1DC3A 1U3VA 1YOVB 3V1TC 4TZKA 3FSRA 1ENZA 3BMCA 4J7CA 4RF2A 4Z0HO 2YHIA 3JQ8A 1GQQA 1PX0A 1PJTA 3SJ7A 5JCXA 4C7KA 2DAPA 5BSGA 1UP6A 3JD4A 3DBLB 3GOHA 3RC1A 1B15A 2PH3A 3PJGA 1U7TA 3INRA 2H5LA 3L9XA 4OMUA 3PIDA 4UAGA 4DMMA 1EUCA 1BXGA 3ENKA 1M75A 3I52A 4HFRA 4BO4A 4U5QA 1MG0A 3H3JA 1EFLA 2H9IA 1HL3A 4JN6B 3BXXA 1XQ1A 1NWCA 2Z5LA 5FWNA 4WCFA 2UUPA 3Q3CA 4YDRA 1LI4A 1GADO 4IQGA 4BNMA 2W2KB 4R1SA 5G0UA 3R6DA 4DIOA 2O3QA 4JJIA 5A03A 2DBRA 1XU9A 2B36A 1LA2A 3JQGB 3GZNB 1NQOA 1M66A 3EY4A 4WOKA 3BYZA 1FMCA 3OICA 3DO5A 3F47A 3H9JA 3HE3A 3MEQA 4FS3A 5DBGA 1WZEA 5HRUA 2EG9A 1T2AA 1OAAA 2VNSA 1Y8QB 4MVJD 4PLTA 4D46A 4DPMA 1LXCA 2RHCA 3QVXA 1Q0QA 4QQRA 3IOYA 4PLFA 5IN5A 5T64A 2OZPA 2A4KA 2PR2A 1XU7A 3ANLA 1QLJA 3BZUA 3RVDA 3S2GA 4DC1A 1Q7CA 1YXMA 3PDUA 2X5OA 2GERA 4QECA 3DMTC 1CWUA 4U7WA 1QRRA 2Q50A 1V6AA 5IN4A 4W99A 3FR7A 3ZWAA 4EZBA 4U8GA 2VWQA 2GASA 2YUTA 3GF4A 4OO3A 2GN6A 1ZFNA 2VT3A 2Q2QA 4UVEA 1H94A 1QYDA 4P22A 5A5EA 3KV3O 3LC1O 1A7AA 4TVBA 1ISGA 5KJFA 4YT4A 1HSZA 2YQ5A 2D8AA 4OQYA 1D7OA 1PGQA 3B1FA 3PZBA 5L45A 5JMPA 1N7HA 1A72A 3E82A 4BHTA 4W7IA 2NVBA 3GLQA 1N2SA 1Z75A 3GPDG 5B4TA 1KEVA 4OXKA 4BKQA 1GAEO 4CQLB 4EYEA 1NFRA 4YYZA 3MWEB 2HMWA 3LF2A 1FDVA 5TJ9A 4R69A 1GL3A 3E1KA 3NEPX 2C5AA 2JL1A 4UEOA 3CUKA 3VHRA 1FDTA 1WZIA 4BIIA 1S7CA 3D4NA 3C1TA 4CMHA 3V5NA 4NFSA 1BTOA 2YFQA 1HKUA 4GX0A 3ZDFA 1NASA 4BOYA 5IDWA 4W9NA 2QYSA 2P9EA 2O23A 1JU9A 2YV1A 4L76A 3NTQA 4UUPA 1J5PA 2PWZA 4OXYA 1VSUA 4WCDA 4XR4A 4DGSA 3RUAA 4MIOA 1X15A 1U3TA 5IJZA 1LRKA 1N1EA 3HHPA 2AEMA 2DBQA 1VL0A 5AXCA 4AJJA 5LC1A 3DC2A 5TS3A 1JLLA 4ALJA 4PZDA 4B4OA 5HS4A 2WD7B 3G49A 3TZHA 1ZEMA 1H2HA 4NIMA 1ULSA 1MXHA 1XHLA 1YE3A 3L6OO 4BMVA 5FF9A 5CDUA 3VH3A 5ER9A 5A3VA 4NU5A 2LDXA 2DTEA 1CYDA 3ZW8A 4OGWA 4U6QA 1NR7A 3UGKA 1OC4A 1BXKA 2HU2A 4BNUA 5BR7A 2Z1MA 3W8FA 5FI5A 4N5LA 1F12A 1U3UA 3KSDO 3QVWA 5JCJD 5LDHA 1YDEA 4FN4A 4B3HA 2PKQP 5HA5A 4OQZA 2HAEA 3EYWA 4IPTA 1ZXBA 4GKBA 3WYBA 3EHEA 1JW9B 3GA0A 2PKQO 2PFGA 2UAGA 4E21A 5CDGA 1PGJA 2X58A 3JD0A 4DYVA 4MKRA 4JP3A 1PJSA 5JW6A 1EDOA 4WLVA 1TVEA 2QZ9A 3QWFA 1V3VA 3BMNB 3GEDA 3K6JA 4JJFA 4DIBA 4AG3A 3ZV4A 1B7GO 1MP0A 3PZRA 1LU9A 1EVIA 2O3JA 3ZWXA 5AQ1A 2QIOA 4AJNA 2PLAA 3EK2A 3H2SA 2VUSA 5IG2A 1EEHA 4BNYA 4J90A 5JFOA 4FC6A 4L8VA 3VTFA 5FI3A 5A06A 5ICMA 1NAHA 2QRJA 4OSOA 4OOEA 1P74A 3DR3A 2GO1A 3PYMA 1HYEA 4BNKA 4DTIA 3HDQA 2HMVA 2VNAA 3BMOB 5F5NA 1Y5RA 3ZU3A 5JAIA 4URFA 2ZQZA 3LC7O 3K30A 2PD3A 3WXBA 4LGVA 1HE5A 3A9WA 4XGKA 5KJ6A 3F4LA 4B4WA 3B1JA 4CM3A 3D1LA 4BL5A 4HUJA 2IRWA 4BVAA 1TEHA 2NV6A 3JQAD 2DTDA 2VRBA 3HFGA 3HFSA 4XGIA 3HN7A 5JDCC 1LLCA 4E5KA 3PPIA 4E2WA 1JTVA 3GN2A 4CMBA 2ZB8A 3GRKA 5T67A 3FWZA 5BSFA 1P0CA 4FD3A 3T7EA 4FOOA 3V8BA 3L4BC 1YQGA 4JQCA 4J1NA 5TSDA 3DHNA 4BNWA 3GRPA 1K89A 1DJQA 3ZWYA 2ZB3A 2F00A 1YGYA 4D79A 5BSHA 1G6KA 4ITUA 1YB4A 3D3WA 4W7HA 4J4BA 4RJTA 3GZ4A 3IQDB 2XXJA 1DBVO 1HDGO 4HNGA 1R0LA 3VPFA 2ZB7A 2PGDA 1KVUA 1O6ZA 1NQTA 1V3TA 5EIOA 3SX2A 3QWIA 3JD2A 4W82A 4TRRA 3ONDA 4H7PA 4GKVA 4B4UA 1P0FA 1HLDA 3ONEA 3QP9A 5L53A 1B8UA 5CDTA 4MVJG 3G17A 1BW9A 1I3NA 3K9QO 4IMRA 4CM1A 1C1XB 3IJRA 3O26A 1K5HA 2TMGA 4KWIA 1GUZA 5MGBA 2Y67A 5AYVA 2GPTA 3N7UA 3F46A 3VDQA 1PJLA 2Q4EA 3H6KA 4ZGWA 3QHAA 1F06A 2B69A 4D3DA 4LRSB 5COBA 3C7DB 4GH5A 4P4GA 3LT1A 3PFFA 1HDOA 5EL0A 1KERA 3RU7A 3OIDA 3H5RA 2OO5A 1O94A 2HSDA 2YQ4A 3BMCB 1Z45A 3DL2A 3O9ZA 1PU2A 1SO8A 4BKRA 2DUWA 3HZZA 1OI7A 4MKZA 1RPNA 2GZ2A 1E77A 4BNLA 2VHZA 5A04A 2O2YA 4CM4B 1P1RA 5A05A 3GN1A 1WVGA 4EJ6A 1KY5A 2AQIA 2JFGA 2HUNA 4R4JA 3QVOA 5GZ6A 5CAEA 1DLIA 1J49A 3JQ6A 2I66A 1Y6JA 3B1KA 4NG5A 3RSHA 1VLLA 4OM8A 2CF6A 2GYYA 2Y0EA 1EFKA 1HE2A 9LDBA 4IXWA 4LMRA 4I5EA 2C7GA 4FC7A 4ROSA 5L40A 4PGFA 3NX4A 1BRMA 5JC1A 1K0UA 1T4BA 3I9NA 4EDFA 5A5FA 5JO0A 2X23A 2XPCA 1P33A 5L95A 5BNFA 3QLJA 5IZ4A 5CPFA 2AXQA 2W8ZA 1R66A 2WEKA 2JCXA 3L6DA 4BKOA 1E7RA 1E3SA 1LDYA 2OHXA 4Q3NA 2JFHA 4XKJA 3NTOA 5B37A 1FDUA 4PLZA 3KYBA 2X6TA 1RM0A 3PVZA 3AI2A 4EW6A 4JJGA 3OEWA 2BFAA 1M76A 4IS3A 3AWDA 4RF3A 3S2EA 4QXMA 4FFMA 3KXDA 2CDCA 4EEZA 5LDGA 1Q7BA 3WWYA 2A9FA 4NBUA 3EUWA 4P4NA 1ZH8A 3KTDA 3B6ZA 3DHYA 1KC1A 1NAIA 4R5HA 3VDRA 3PRJA 2G17A 4BKUA 2W98A 2JJYA 2IDZA 4J91A 1UXIA 1WW8A 3AU8A 3GGGA 3WQSB 1CQIA 3IDSA 1LSSA 2EXXA 5G4KA 3WNQA 1P1FA 1MG5A 3K96A 2AG5A 3WBFA 4A0SA 1TI7A 5KJ1A 3HDHA 4IJUA 3PHIA 4LCEA 4EUHA 2W4QA 3A14A 3PHHA 5HBRA 2EJWA 3JQCA 4BO1A 2H63A 1NPYA 1XSEA 4GWGA 4HFMA 3QJ5A 4IDCA 2P9CA 2PKRA 4TSKA 3H2ZA 3E03A 1U3WA 2Q1TA 3NKLA 3RBZA 3WQRA 4XEHA 4TKMA 4FGSA 1NVTA 1O5IA 2X86A 3EAGA 5DP2A 4L75A 4FGWA 5L4NA 2IODA 4YACA 3ROKA 4XRGA 2FR0A 2JHGA 1ZK3A 2HJSA 1BMDA 1B3BA 2OUIA 1ZVMA 2AEFA 5B4UA 3KUXA 5I9LA 4Y8VA 4J2HA 1SBYA 4GPD1 4O1MA 2V6GA 4NJOA 4E2YA 1T25A 4RVGA 4RQTA 4A03A 1HLPA 3DHEA 1Y8QA 4J16A 2G0TA 3T4XA 4DPLA 4RZIA 5J23A 4WGGA 1JKJA 1HXHA 2C54A 4IBOA 4CQMD 4YJFB 4WPGA 4R9SA 4CUZA 1HYHA 1SNYA 1VL6A 4EI2A 2O3SA 2CUKA 5C3MA 2D4AA 4NBTA 3E5MA 4NFYA 3IC5A 4RPHA 4KUEA 2AMFA 3LT2A 2JD2A 2C7VA 1SEPA 2CSUA 4BO8A 2PY6A 3U49A 1P31A 5JAZA 1YOVA 2BELA 1JKIA 4IDDA 4B8ZA 2PD6A 4WNIA 1B14A 1I3KA 1MLDA 2CVOA 3RROA 4CM4A 4MVJI 4CMAA 2EKQA 3ETGA 4HP8A 4ZU3A 4D3FA 3DTTA 1A27A 3KYDA 2NSDA 2R6JA 3P7MA 5K9ZA 4O6VA 2VOJA 4BMSA 5G0VA 1EVZA 3ASVA 5GMOA 1I01A 2ZYAA 3H3FA 3PEFA 3Q9NA 4R1UA 3HDJA 2GF2A 3F1KA 5DNAA 4E30A 4AJ1A 1QYCA 4RQUA 1NBOA 4NBRA 3ZWCA 1EVJA 1UZLA 2FPPA 1ISIA 3ZWVA 4O0LA 3TNLA 3I6IA 2NVUA 3AUTA 1U9JA 2FPGA 2BLLA 4CM8A 4MJLA 3H65A 4G2NA 3RI3A 2FOIA 5HM8A 1WMBA 1PJ2A 3OECA 1ISJA 2IEDA 3VH2A 3VTZA 2B4TO 3PXXA 2AE1A 3I9KA 2PGLA 2D5CA 3JQAA 1KY4A 2GN4A 3HB4X 3KLPX 4GGOA 2DPGA 4I9NA 2X9VA 1SOVA 4ND4A 1DSSG 3CPSA 2WWRA 2PZLA 1PIWA 1XIVA 2ZTUA 4IDGA 5A9SA 1ZKMA 2EHDA 4EUFA 4CQLA 2AW5A 3JQAB 2V6FA 5JLAA 3FPLA 4K28A 3I1JA 1LLUA 1CQJA 1XYGA 4TQGA 1SPXA 1BVUA 1JWBB 3AI1A 4KQXA 4YAEA 3ZHBA 3P5SA 4AJOA 3AOEC 4B7UA 1ZBQA 3RC7A 1LLQA 4LVUA 2HK7A 1R4NA 1BVRA 3ZWOA 3IP1A 4MOWA 1OOEA 3E48A 2JCVA 1HSOA 3K92A 1TT5A 3A1NA 2R00A 1E7QA 2OMEA 3AY3A 3JQ7B 1LC3A 2IXAA 1KBZA 3CKYA 5KVSA 3K5PA 1J0XO 4CV3A 2ZYGA 3I3OA 2DM6A 3P2OA 4IGEA 3BHMA 5DZSA 4BNNA 2O4UX 1YQDA 2NNLD 1W4ZA 3ROPA 1LSOA 4KP7A 3O03A 3LLVA 4IS2A 1H9BA 3Q2IA 3D5QA 4U0JA 5JY1A 5B4VA 1AUPA 3MCVA 4FFOA 3BHJA 4UUMA 5BNTA 4AICA 4LVCA 4J6FA 2C0CA 1E7MA 1NFQA 1AGNA 3QA9A 1B8PA 2RAFA 4YA6A 5CEEA 5IXSA 1GZ6A 3KBOA 4R54A 3KETA 3RBXA 4ZHSA 3ASUA 4LSMA 2B83A 2FWMX 2ZB4A 4Z9FA 1U2DA 1ZK1A 4E5MA 2WMDA 5TQVA 4JNKA 1WXDA 2P9GA 2AQHA 1LDEA 3C7AA 1XG5A 3I9MA 2CDBA 3WFJA 4LRTB 4OKNA 5ADHA 1ZSYA 3R3SA 5DN9A 2D0IA 1JVSA 2J5QA 3AK4A 4O63O 8ADHA 2BFOA 3ULKA 4XQCA 1E3LA 1MC4A 1NR1A 4KTTE 5I9MA 4CM9D 4CPDA 5TNXA 3BMNA 4KTVE 1JDJA 1XCBA 4NI5A 4NU6A 4CLOA 1SB9A 3ZH2A 5JYEA 4ALMA 2GCGA 1GUYA 4XGNA 2NTJA 1H2BA 1DLJA 3VVCA 5AXAA 4FFLA 3PHJA 4E13A 4A27A 4CMIA 1QG6A 1NFFA 3DZJA 2H1SA 3QVTA 3EZLA 5DBFA 3AM3A 2J6IA 4JBHA 2B5WA 5C7OO 2EF1A 1O89A 2B4QA 2X0NA 4CL8A 1GEEA 2VYVD 1W8DA 3DQPA 3EC7A 1R15A 4XDYA 4GMFA 4BO2A 1EBFA 2J8ZA 4RL6A 1DOHA 2DBVO 3TZQA 2DFVA 2G76A 4HY3A 4L4SA 3RJ5A 5IDQA 4GQAA 1TLTA 1YJ8A 1X1TA 4FJ2A 4M87A 4EGFA 2V7PA 1PL6A 1VSVA 2X9GA 4Q9NA 4PG4A 2BI8A 1PJ3A 3HN2A 3V2GA 1PWZA 4YWJA 4CR7A 5B1YA 3PQFA 1QP8A 4ZQHA 3CMCO 5TT0A 2JFFA 2Y1EA 1Z6ZA 4DA9A 5CG2A 4CM7A 1YB1A 1CEQA 4N5NA 1A9YA 2BKAA 2Y93A 4ZQFA 3GMSA 1X7DA 2OL4A 4D45A 3OJLA 5ER6A 4Y67A 2I65A 4HFNA 2IZ1A 1IUKA 2B0JA 1C0LA 1MX3A 2OGUA 3HDYA 3AY6A 1B3RA 1UZNA 4WLOA 5BSEA 1E3WA 4ZQEA 3JYNA 4XYMA 1K2WA 3R0IA 5KJEA 1LDGA 4KWHA 5AXDA 5GY7A 3NT5A 1OZAA 5ITWA 3WIDA 2NTVA 3IJPA 2E49A 2WE8A 4PLVA 1E1KA 2H6EA 1HEUA 1Y8RB 4II2A 4YRDA 4CUKA 1BDMA 4DQUA 2NU6A 3U5TA 1P1HA 2GZ3A 1VRWA 1DIGA 4W6ZA 5TF4A 4BKPA 4E12A 3AUUA 3D3WB 4PRLA 4DIFA 4CLRA 5ITVA 2VHVA 3W6UA 1P3DA 1PZGA 3PI7A 5DBIA 3N74A 2I3GA 1HT0A 1AN9A 2P5YA 3MWDB 1GR0A 2OP0A 1E0DA 2QQ5A 3C3XA 2YY7A 4S1VA 4O59O 2VWGA 3RKRA 5JDIC 4OJNA 3PLNA 3CTMA 3PJFA 4NDNE 2EGGA 4WJZA 5T5QA 3RUCA 2O3UA 4CLOB 5IDXA 3PYLA 4GWKA 2Q2WA 1ID1A 3TOXA 4YBZA 3W1VA 4NZ9A 4CLDA 8LDHA 4QUKA 1RWBA 5EERA 1LSJA 2BGMA 3DOJA 3DZHA 3GQVA 4RGBA 4XIYA 3ZV3A 1A4IA 1DC5A 4W4TA 3AUSA 4NR0A 1NQ5A 5JMWA 1IHXA 3JD1A 4BO9A 1UDCA 4PLHA 4ESOA 2WSBA 2QW8A 3KM0A 3OJFA 1PGNA 4LISA 4AJLA 4L4RA 3TRIA 5T6BA 3VZQA 5EQFA 3E8XA 2AHRA 3FBTA 3PFWO 3QIVA 1Z73A 4DLBA 1H0KA 3WBBA 1UXKA 1PQPA 4L73A 3H5NA 3C7CB 3W8EA 5I7FA 3KSZO 1EK6A 3W4IA 4N7RA 1G0NA 2CF5A 4M86A 1IE3A 3MZ0A 5EINA 5G2OA 3WSVA 4AFNA 3I4FA 3OQ1A 2BD0A 3KO8A 5KJCA 3RUIA 2W2LD 3G3EA 4XQEA 3OETA 5FEUA 1PJ4A 1YQXA 4D43A 1UUFA 1VKOA 4C7JA 3GUCA 1LLDA 4J0EA 2WJPA 1YJQA 4UVDA 4K1LA 3U3XA 2Q45A 1RYEA 3FTPA 3PLRA 3KEOA 3N58A 4W9NC 3WGZA 1DFGA 4AJ2A 4F46A 2OBNA 1U5CA 2RH4A 1F14A 3INTA 1HE4A 1XR3A 3FI9A 1HZZA 4BNZA 4Y6PA 3BTVA 3ZZNA 5A9SB 3FHLA 2UUOA 1KC3A 1UAGA 1ZIDA 3NDRA 3OSUA 5DT9A 1WLYA 1GFSA 3K2BA 3LSYA 3VH4A 1BXGB 4MIEA 1EVYA 1Y5MA 3C1AA 3OA0A 2X5JO 3OP4A 3OF2A 4II3A 3F3SA 4BNGA 3KZVA 5A9RA 3UICA 2F1KA 2OP1A 3DMYA 4XWYA 1EDZA 1K6XA 3CMMA 5JY6A 4FJ0A 4PG7A 3IAHA 1I24A 2IYOA 4MVJH 3G0OA 1O95A 3C1OA 4RPLA 1ZZEA 3D5TA 4GLOA 2FHSA 3Q2KA 4DBVO 3JQBC 1X13A 4MVJF 5HTOA 1K3TA 3F4BA 3TPCA 1PTJA 5I8WA 3M2PA 2QZZA 1JAXA 3T7CA 3C24A 3ZNOA 4ZN6A 1DRUA 2FP4A 5JO9A 4CL3A 2EV9A 3E9NA 3X2FA 4DLLA 3U9LA 2VT2A 1XELA 4A2CA 2AG8A 3GG2A 4MP6A 1N9GB 1ONPA 3AM4A 3GVIA 2XXBA 2YYYA 1AXEA 1UZMA 3GT0A 1YL5A 3IMFA 2OORA 4HXYA 4J1QA 4LW8A 3TOZA 3AI3A 2Y99A 3GR6A 4DL9A 1EUZA 1MB4A 2WD8A 4BGUA 1LDNA 4KMSA 1Y7TA 3SLKA 1L7DA 4RDHA 1QORA 4XB2A 3ZNNA 4GVXA 1A71A 5ICSA 3E9MA 4IINA 4XJSA 4XZ3A 1D8AA 2HRBA 1PZFA 3OM9A 1IOLA 5MDHA 1D4FA 4M1QA 3WGOA 1HF3A 3DONA 4PFJA 1DRWA 1CERA 3UXYA 3ZW9A 4CMJA 2JAHA 4XYLA 1KVRA 3WIEA 1NPDA 4XYGA 4G65A 1ZSNA 4U6SA 3ZI0A 4YTEA 4RPGA 1I2ZA 4MIYA 1X0VA 1PJQA 3DOOA 4LSWA 4YT8A 3HB5X 2J3IA 2VCYA 1WMAA 3E6AA 3U4IA 1DFHA 4ND5A 1OBFO 3C8MA 3ZU5A 4B3JA 4DUPA 5A9TA 3LYLA 5ILGA 3BIOA 4PVCA 1PJBA 5CEFA 4NQZA 3VPXA 2PD4A 3I9LA 4JBIA 4S3MA 2VRCD 2J3JA 3GMDA 4BB6A 1I36A 1W6UA 3RFVA 4NPCA 1PL7A 4AJPA 4BS9A 3TZCA 2YFHA 2X0JA 1WDMA 3OJOA 2HRZA 4NJMA 2PZJA 1E6EA 4Z0TA 4GLLA 3FPCA 4F45A 2CDAA 3B70A 3M2TA 2P91A 5F1PA 4J49A 3O38A 2DFDA 5TGDA 2E4AA 3Q6IA 2D59A 3EZYA 3VC7A 3DAFA 2VTDA 2HQ1A 2QG4A 2VWPA 3E9QA 4FQ8A 1I33A 3GVXA 5TJHA 3UH1A 4UVHA 4E4YA 2C2YA 1YL6A 2Q49A 5TRTA 2C29D 3H9QA 4A26A 1N9GA 3F1LA 2HK9A 5TC4A 5L51A 2JD0A 5JCJA 1FDWA 4HV4A 3GHYA 4M54A 1YB5A 3VZRA 4IDEA 4PZCA 1E6WA 4E6PA 2VYND 2CNBA 2YW9A 3TN7A 1BSVA 2GR9A 1FDSA 2IZZA 3LC2O 4ALKA 4AJHA 1Q7GA 4AJIA 2VUTA 4MPDA 1E7SA 1R12A 4JXKA 3QSGA 4GX1A 2E82A 1S6YA 1TT7A 1DIAA 4YCAA 1GPJA 4G81A 3BTSA 2FR8A 3UFXA 1H6AA 3KOUA 3WICA 4CQMA 1UDAA 3S55A 3V1UA 3H7AA 3ADPA 2B35A 4IUYA 4CMGA 1F0YA 3WGYA 4B7CA 5C7IO 1QYXA 4PLCA 1ISFA 1E5LA 1HYGA 3HUDA 3MJEA 3OIFA 3WWZA 1E3JA 3AFNA 2ZTLA 3KEQA 3LQFA 4WCFC 5TIIA 1A9ZA 1N8KA 1HETA 4FSHA 4IMPA 5CEJA 4YVFA 5ILOA 4DBZA 3C85A 3RWBA 5F1KA 3OQ6A 2DC1A 4WE3A 1E92A 4B79A 4QEDA 1HDRA 3ONFA 1ZSVA 3IKVA 4XJTA 3JQ9C 1R37A 2ZYDA 4IGFA 2O7SA 1LTHR 2B5VA 3GNSA 1IB6A 3CZMA 3ROMA 4HFJA 4K26A 4RZHA 4GSKA 3EGOA 3ICPA 3A06A 1LEHA 5G0TA 5FYDA 4YQYA 1H6DA 4BV8A 2EP7A 4MVJP 2JKVA 3NUGA 3PTZA 3I9JA 1ZUD1 4CV0A 1D1TA 2FZEA 3GC6A 3BA1A 4YQZA 1YBAA 1EMDA 2Y1GA 2Z1NA
chains in the Genus database with same CATH superfamily
1IZZA 4LYYA 1Z74A 5AVRA 1OPXA 3N0RA 1C4XA 4ZQGA 4FK8A 3WFZA 2G04A 4LZLA 5KOJB 2VHXA 3FMPB 5IHPA 2ADFA 1H8EA 5F98A 5MN6A 3TGLA 3PDJA 3GHHA 1DXYA 1L5VA 4HNHA 1R1DA 3DBRA 1H2XA 3DE7X 2BVNA 3LXXA 3N53A 1VG8A 1J00A 3LDAA 5LBUA 3MCZA 4PS1A 3KYDB 3PGKA 2D5LA 1O54A 2PHZA 3DDZX 4ZK2A 1M5RA 3E8MA 3K73O 5BN3A 3M4JA 3D7MA 3O2SB 1PZHA 1FSPA 4Z0NA 1TTTA 1Y1SA 2YWCA 3DJYA 1FTQA 3GFVA 4HHEA 4MZXA 4B9EA 5KKCA 4DCGA 1H05A 5DF1A 4GUDA 1ADGA 4BFCA 2YCLA 3WP0A 5FPQA 3C98A 5JYBA 1HNXB 4TXLA 1KFEB 4OLBA 1AHHA 3LT0A 5KWSA 4URHA 1PVVA 4Q19A 5H82A 3U3RA 2ORVA 2VZ9A 1J21A 2I55A 4Z0PA 4C88A 3SZUA 3L7DA 3P4YA 4H6VA 2PH5A 4ZODA 5EPOA 1CUVA 4RY8A 2IZ0A 2JIQA 3STUA 1SUFA 1ZMOA 5KU7A 1TAQA 2P9BA 4K05A 1G2OA 4R8LA 1ZIXA 3VKGA 3COSA 3S44A 3KR2A 1IIBA 1TM5E 2GA8A 3P9NA 3GGSA 2PUTA 5JECA 3FYDA 2YRWA 1I4EB 1N8SA 5CT5A 2FK8A 4UAJA 2J67A 1ZOIA 2XF8A 3L7YA 3Q9UA 4LHEA 4UBJA 4B73A 1LGYA 3PS9A 4ZKDA 3C7KA 4PVDA 1ULHA 4NU0A 3I2IA 2Y4OA 2D1RA 5EIHA 2XZPA 4GBED 1MH1A 4LZAA 1FE8A 2ZQ5A 5JCPA 5T7BA 1CRPA 2H0RA 1XF9A 5EXTA 4B81A 4BO7A 1EFHA 1ID8A 1L4MA 4U5XA 4ZHQA 4RENA 4OYRA 1ZNXA 4FI3C 4HBGA 2ZAYA 4NBVA 3VO9A 4ZEXA 5JFGA 3AI7A 5ETJA 2MMGA 3SIPA 1FPMA 1ZVKA 1CQXA 1GPLA 5ALNA 2GN8A 4M1TA 2YNMA 1U0JA 4IV0A 2V65A 3HVJA 4Y9SA 3W2FA 1NBWB 1PR2A 3T35A 3STVA 3EODA 5HFJA 4BNFA 1HE1C 4KYUA 4JJ6A 3UUWA 3VR3D 2EJUA 1WETA 1DOAA 3UHOA 2QE7A 5JS6A 3R6GA 3TM4A 4ATNA 2YC2C 1XVUA 3M6AA 1I1OA 3MPOA 2C0PA 2QRVB 4LOJA 2FJ0A 3DDOA 4N4AA 1VC2A 1T3GA 1SU4A 1ZJJA 2Q5CA 3JX9A 4GP6A 5J59A 2A33A 4J16C 3HK2A 4ZOLA 3SQOA 1CY1A 1T91A 4A6XA 5BWOA 5C5IA 2IW3A 3FJOA 3R3WA 1A9XA 4RORA 2FMHA 5K6AA 1XAIA 3D8TA 4UJ3A 4M8NE 2J5BA 3PHGA 4MR9B 3D6MA 1KDZA 4B6QA 2PUFA 4BNTA 3OD5A 3DLBA 1S1CA 4TT8A 4ABYA 1JN0A 3KYCB 4YO7A 1O6GA 1NYLA 3PUHA 5EJFA 2GJAA 4XEUA 1F3OA 1NY5A 4PSAA 5CYPA 3B60A 1GCIA 2VH2A 1BS9A 4FYHA 4Q15A 1FX1A 2FEPA 3U40A 4B1FA 2SKEA 4AXBA 3UJ7A 1CETA 3WVNA 3SDSA 1RLOA 2MYNA 4REOA 3UG7A 1L8XA 4GC9A 4RK1A 4QG3A 3COVA 1ZH0A 2OM2A 1EG7A 2WDPA 1IMJA 3V4RA 1Q22A 1BFUA 4UVGA 1KHTA 3BFJA 3ZZUA 3FW1A 1WBBA 1UPCA 3GJSA 4H2DA 1JHXA 5ADWA 2W6IA 5EN4A 2VJAA 4EECA 3TOCA 4DDMA 1ZICA 2CXOA 9LDTA 1CFJA 4CE6A 1U8UA 4EGAA 5K0TA 2ADOA 2HQOA 3GRCA 1KGSA 4MSUA 3LUCA 1ESCA 1XMJA 1U2GC 3E3NA 1J0EA 4DW8A 4JLAA 1ABBA 3P0JA 2QJOA 3PP8A 1L1FA 4ZQBA 3TD9A 5JATA 5CJJA 3AV3A 3EVDA 3LDGA 3P0RA 4LBWA 3MJSA 1HDIA 3YASA 2DFLA 1OREA 1QHXA 1Y3DE 2FW0A 2I67A 2O2DA 3EQ7A 4US1R 5JASA 1G42A 1I6LA 3I2JA 4DG8A 4DLZA 1T4CA 3ZWNA 2HEGA 1HLGA 2FQXA 1NQAO 4JBLA 4MYHA 4TN5A 2BGLA 4CYMA 2DUUA 4KGXA 5AUPB 4TYWA 2IELA 1JSXA 2UV8A 1HDYA 4FGLA 4J76A 2NU8B 2FUKA 3UAYA 2NX2A 1CQZA 1HA3A 1GQRA 1NLUA 2TS1A 4J1TA 4N18A 5ALIA 3FYHA 1V5GA 1SCUA 2HRCA 2VDJA 2D2IA 2MDTA 1US8A 3BREA 4FW8A 5EGSA 2ZU6A 5LXTF 3WLEA 3OE1A 1IVSA 2MR6A 2I5PO 3U4DA 1FRZA 2I6XA 3LVRE 3WYEA 1C80A 1OXUA 4Z51A 5EKSA 4HJXA 3WG9A 3SI7A 1A69A 1PJRA 5AVWA 3DOUA 1YZUA 4Q34A 3HS3A 4PN3A 8OHMA 5EWMB 3K70C 2V5AA 1KQGA 3G1UA 3SC2B 1V48A 4HI0E 1I5RA 2NYUA 1JEEA 5H16A 3KEGA 5EQDA 2BJHA 5AK3A 4DILA 2YN2A 4LOIA 4H31A 4OQLA 2QENA 4W5WA 4AY4A 1EVKA 1L6IA 5M29A 2QRGA 3W9BA 2ZJ1A 4QHYA 1ODIA 3DVQX 2X2EA 3HDGA 4XIGS 1KZYC 5AVKA 2EJTA 3AOEA 1JDTA 2C5GA 2FW6A 4ENQA 2IYQA 2GVNA 2QZJA 1DEXA 2ON6A 1U8CB 1W5AA 2WTEA 1IHPA 4JZKA 2PZKA 1C81A 2PYDA 4ZDIA 3A0UA 1HNZB 5TQ2B 4X41A 2BBTA 1ULUA 2G1JA 2VTEA 3CLUD 3OPVA 5HIIA 3RF6A 4XH9B 4AMZA 3H9BA 3T1QA 1EVLA 2FWPA 3GI1A 4L6IA 4OX9Y 4I50F 1QPBA 2G83A 3AEKA 1C9NA 2ZTMA 1RFLA 5E4TA 1EM8A 5LFAA 1VBKA 5JPDA 1BWQA 1EWYA 5ENZA 3QYJA 1RE1A 1MBZA 2OB2A 4O4IA 4N3NA 3VMMA 2ADMA 1PNQA 5GM1A 1F2UA 1KEEA 4XM1A 1QV6A 3CH6A 3C8HA 1XD2B 1SBZA 2F9FA 1K6JA 5A2GA 4OXIA 3NJ8A 4LXUA 3T3MB 3TKLA 5DOZA 1E9CA 4N47A 1OGIA 4E1AA 4LXTA 1FSGA 5CU7A 5AVOA 1YHNA 2ACKA 2YDYA 1DKOA 1PYOA 3F5QA 2YUIA 3G8CA 3K2EA 3LPMA 4CCYA 2V6BA 4F5YA 1UMDA 1WMDA 1RYHA 3HSYA 5D85A 3D6TB 4MWTA 1UIRA 3CPEA 5FOUA 2VPPA 1HC7A 3JQDA 2CLLB 3PVSA 4QVGA 2GNAA 2FVYA 2WZCA 5GPBA 1UJ5A 2N9UA 4DNPA 3M82A 4M1KA 1EGQA 4R51A 3HH8A 2GM9A 4I1UA 3IIIA 5LQJA 2HH9A 1RBQA 1KETA 2H57A 2WU8A 5L3ZA 4NK4A 4DEVA 2NVOA 4LV6A 3AF5A 2X0KA 4I4LA 1NWHA 4KOAA 4MRAA 2EX0A 2EP5A 4PRZA 1O3YA 1PT6A 3WADA 5LKRA 4PHCA 2NVUB 4Z1MD 3J7AC 2IPMA 3GJ7A 3SHOA 3K1AB 1BYIA 3JASA 1BDBA 1MN6A 3MTAA 4QO7A 1RP7A 4FOSA 5KSPA 4Q9AA 2IYYA 3RDPA 5JJ5A 1UEXC 2JCYA 3KDSE 3QM1A 4CVNA 3IL2A 1ZG3A 2A94A 1W0KD 3EPHA 5TPZA 2VP3A 3HDVA 2CZCA 4QTUB 1IZ9A 1LS6A 4XGQA 5MGNA 5EP3A 2DUNA 3WLQA 1D7AA 4GHWA 2FOLA 4F6LA 4QEKA 3H0EA 1K66A 4HPWA 4IIJB 4ONEA 1GOTA 2C59A 4KFUA 1FFXA 2EYUA 2H2DA 5BP7A 1CQPA 3VPCA 1IY8A 2E4XA 2F3SA 3EUEA 3HP7A 5AH0A 4JI4B 2W2MA 1XLTA 1BVHA 4REQB 2G06A 1JA9A 3SEZA 5HZMA 5H83A 2FCAA 2Y77A 2OAP1 1T3LA 3E7PA 1MC8A 4KCGA 1UH5A 5AJYA 4EF6A 3OJ0A 1N2HA 4TT3D 1LRLA 5AXBA 3T7KA 1WB4A 4GFDA 1KXJA 1U1DA 1ZEJA 1PP4A 2VF7A 1VCIA 3EUAA 2IYFA 3GV0A 4IILA 5E0KB 3AL2A 1Z3IX 4KR7A 6AT1A 1CIPA 4QYMA 4ZRDA 4XPIB 2K4MA 3THXA 1WD5A 4MULA 1RC8A 1JL3A 3GRAA 2NV0A 4D82A 3I2HA 3HJAA 3RUEA 1X9HA 2Q4TA 4PCAA 3R7BA 1WF3A 3WZ2A 1PN3A 4PYJA 2SNIE 2HM7A 1OXVA 3NAQA 3FPFA 3DMNA 4NZNA 2V8OA 3KVOA 5C8XA 3NTVA 1P0IA 3TAXA 4MW1A 1WNTA 3BB4A 3GJ6A 4AO6A 1IMOA 4KYIB 1KFCB 3O8QA 4RAQA 2FG5A 2M6RA 3AJRA 2WLTA 1YFKA 1E1CB 1YUNA 2CE2X 3M1AA 4FIZA 4IFEA 4JFAA 4XGRA 4PZYA 5FNVB 1DAPA 5CH5A 5I9IA 4BFYA 4DA4A 1TKRA 2BGGA 3TL2A 2GHRA 3GNLA 3WX0A 2XCIA 3DW1X 3SYMA 3LX8A 3KWFA 2Z9BA 4HB0A 4B35A 4BJHB 2E87A 4CUJA 1QFSA 3PNSA 1AXGA 1B76A 1J42A 1EJ2A 3FDJA 2WWWA 3JTEA 4QAJA 2O19A 1RTKA 3BEDA 4U63A 3RS5A 3OEEA 4YJDA 2NZWA 2O2SA 1XWIA 1TTHA 1IN8A 1AVTA 4TUYF 1MMFB 3RW9A 2WY2D 2P35A 1YZKA 4G1MB 2X9QA 3ZWPA 5EIBC 2Z6QA 2B3DA 5ALDA 2DCUA 4EX7A 3WGIA 3IPRA 3FMGA 1DPGA 1S0UA 3IQEA 3VZSA 4Q39A 4MUIA 5DYYA 1IONA 1WXEA 3H9UA 4LWZA 1M5TA 4A26A 5JBNA 2WWYA 2GLXA 1LFDB 2PPVA 2SHKA 4P38A 4YPVA 2BFWA 2JGRA 4WRRA 1HE3A 2GT1A 5DHSA 5JTUA 4QX6A 1AE1A 4E09A 1RQNA 5EZQA 2ZATA 1FSSA 2QX6A 3UJ8A 2V7QA 5KQSA 2H2FA 5DEOA 3HU2A 3O84A 1YQTA 4YRJA 4L8FA 1X7XB 1RJ9B 1SVOA 2J48A 2WYUA 3S29A 3P4UA 2C2XA 1UXOA 2F67A 3KDAA 3LECA 1X1QA 5E95A 1NXOA 1SAYA 3NVKI 3QJGA 3A9UA 4DRYA 4ACAA 3S2IA 2ETVA 2FR1A 3WTBA 4EW3A 1OFUX 1GZ3A 2WJWA 5G0SA 2BFNA 4IZ6A 4GO1A 3GEEA 2OTCA 2KMLA 1MDFA 2OPHA 5IH7A 4L74A 4OAQA 4ZOAA 4A92A 2G5CA 2QMHA 2XF2A 4RPJA 1OASA 1G5PA 3T3DA 1R9NA 1TXGA 4NMHA 3UHJA 5L7YA 4E33A 2IE8A 1RMQA 5IF3A 4RCVA 4WFQA 4L9AA 1RAEA 3A2LA 2ID7A 3LUJA 1MC1A 4L2IB 4PPNA 2QYTA 4NZOA 3F6EX 3V8QA 1R50A 3G1WA 4WZAE 3AVYA 3PEEA 3TSCA 3OT4A 2RCNA 3WLKX 1HKHA 5BWBA 3KL2A 1CNEA 1MFPA 1XZHA 2B4YA 1OJLA 4GBJA 3WBJA 2JBAA 3WJAA 4ARAA 2R751 4FI3F 4DWOA 1M34B 1PK8A 2V0NA 3PDHA 1OU4A 5FB3A 1UXJA 3BL8A 5DNUA 5EC8A 3G2LA 2VZ8A 2X1HA 3T0GA 3EXHC 2QYHA 5KNLA 2ODBA 2FG6C 2V45A 4GR9A 2DEUA 4ZGBA 4WDQA 1B2LA 3TLJA 5AOCA 4N03A 1E32A 1XZKA 4LXXA 4H16A 4NHEA 3L0PA 3V4LA 4E3WA 5JBIA 1RQGA 1RBZA 1TM3E 1GV0A 1AHIA 2R4TA 2NG1A 4OAOA 4FJ1A 5HKAA 3LBYA 1R8SA 3EVTA 1ZLYA 3DOIA 1J2UA 3UWOA 4DJEC 3N0VA 4JOSA 1E1MA 4RF4A 1LK7A 1W49A 3ECCA 4IVQA 4O4IB 1V11B 2VP5A 4IIUA 4YO8A 1AMOA 2EJVA 2VDLB 1YBMA 1RXVA 3IIEA 5DRYA 1GUDA 5GJVC 3ZDXB 5JEEA 4BGVA 3QXHA 2QROA 2W71A 5AJZA 3AW8A 1OBOA 3G5TA 4GX2A 3UZUA 4AKIA 3OZAA 1VJ0A 1L7MA 2Z58A 3TZ6A 1RWMA 3PXDA 4A10A 5LUBA 4PR3A 4Z7QB 5DN6D 4JR1A 4OG2A 4RVCA 2WIGA 3ZCQA 4RA6B 2G80A 1XQ6A 3H1TA 3K4QA 5DHUA 4NZZA 3DZKA 2QP4A 5B3KA 1T2UA 3PQDA 3Q7RA 1NJSA 2G7ZA 3QQ5A 5HIJA 3DMGA 4V0QA 3U3ZA 1BQ4A 1THTA 2BDUA 2XUZA 2Y0DA 4XB1A 1Z06A 1EDDA 1T2EA 4V38A 2DWOA 4LDRA 4E32A 1G7TA 1AGYA 1SCIA 2C07A 1YZTA 2XB8A 3EIUA 4B40A 2WNSA 4HWPA 4BMZA 5EHZA 2ZJ0A 5BUSA 1Y5NA 1QCYA 1W2WB 3CZ4A 4Q3AA 4EENA 1G41A 2B37A 4BB0A 2WSSA 4ZT2A 3ZHRA 3HYTA 1G5QA 3JS5A 1EUQA 2FRDA 2ZAOA 5EXDA 2EWWA 3R41A 4GD3Q 3TWOA 2C4VA 2Y92A 3LK7A 4R0VA 4D0LB 3R77A 2YS6A 1N6NA 1L7RA 3C3JA 4KUGA 1PW5A 4Q7JB 3TB6A 4DEYA 1XTSA 2E85A 3I04M 2VDWB 3QBDA 5H7XA 5JSYA 3E5HA 4BLRA 3IBYA 1YMVA 1TZ2A 4WOBA 2OY0A 4TXNA 2ZPTX 5C80A 4UCWA 4GSLA 2VF5X 4NL4H 4DPKA 2PSHA 3NS7A 4LYAA 5FO0A 4HXFB 3HUUA 2E7ZA 1E1RA 3OOSA 3UVEA 4ZRMA 5AK6A 4D9BA 3KFXA 2FKAA 4QYTA 1T8SA 3MG9A 5ARBA 1LBTA 1JKJB 1EFVA 1SBQA 1DBQA 2XNJA 2HF2A 3W3AH 5FL7D 4H0FA 3ZKAA 2W6NA 2MSDB 5EJ6A 2LUOA 4LCJA 2HJHA 4GX5A 4ZARA 4EVSA 4RKRA 3ZDQA 2WYWA 3HO6A 4Q7QA 2JI6A 2EGUA 2VQ3A 5DCWA 3SLGA 2OO7A 2QTLA 3CJRA 5CR9A 5C5DA 5SY9A 3EWNA 1J8FA 3A4YA 4YYEA 3EIXA 1IPHA 1LQUA 1ISHA 5DYWA 3B5IA 2O6LA 1CUDA 3CX6A 5A4JA 3BH6A 3S68A 3TMYA 1NHGA 3WLLA 5JYDA 3TW8A 3R0XA 4LOLA 4V0KA 1Z39A 4D4IA 4FE7A 4DCPA 3OHSX 3LPLA 4QGBA 1OIXA 4Z4EA 2J85A 1YOBA 2KWIA 1U2QA 2N42A 2OZKA 3TPFA 3PJEA 1FP7A 1Q74A 5DWQA 4EF5A 4PPQA 3HEBA 4IHJB 1N2IA 5CB6A 2WAOA 3N3BC 5L9AA 3ILXA 2YINC 3CLRD 4PHTA 4PLWA 4DUZB 3SXPA 4EPYA 1Z82A 2X22A 1C9DB 2VJQA 4YMIA 1E62A 2X8JB 3RJTA 1E64A 4IZIA 5ALVA 4FWTA 1IY0A 1MB3A 3ZKWA 3F73A 3S2SA 4K3UA 2RBEA 5FR2A 4Z6KA 5J1SB 1SKMA 4H6WA 5LJLA 3PHLA 3TG2A 1DWPA 4EHNA 5K8JB 4J3NA 4L16A 1KVSA 4PAGA 4PEVA 5IW8A 1N6RA 4UM9B 5FLEX 2PGJA 4F3YA 5CLHA 3SC6A 2E4VA 1NONA 4MWEA 1KVTA 4L8WB 1DO8A 1CUJA 1NUTA 2QRVA 3X1WA 4Q3EA 4DDKA 2WE7A 1P5HA 2JKZA 4IH4A 2B4AA 1F17A 3D3QA 2VCHA 4I66A 1N5MA 2ZJ5A 4X54A 3ZHXA 4HQOA 5C37A 3II6X 4J2TA 3T7TA 2I8AA 3JQ7A 4Q1DA 3TLGA 4TLAA 3KKNA 3LP5A 2R8XA 1P5RA 3M49A 1GWNA 3BF7A 3UXHA 10MHA 1L4YA 1JFLA 3K5WA 2WKWA 4W5NA 5H1YA 4TMVA 4UOQA 4OXXA 4B2YA 4CKBB 4QSHA 1IK6A 3KC2A 2A92A 1XD2A 3A4VA 5AVQA 1R4AA 3MRVA 5CNKA 2Q8PA 2ESRA 3WGHA 2R2GA 1PT5A 2FUG1 3CIOA 5HRCA 1M9NA 3FJYA 4OB6A 3UFBA 5JJBA 2RJ3A 4KQ1A 1KO4A 1TIPA 1V3QE 1CEXA 4MV4A 3LBNA 3IKLA 2VF2A 4R1OA 1PWHA 4MVJE 2JW5A 2FN9A 2Q4BA 3KSRA 3MBOA 5A5GA 1XDGA 3HCCA 4I1PA 4NNJA 1JS1X 3G59A 3OOHA 5A5DA 4DTCA 1W4CA 2G07A 4JYAB 2HMSA 1PFWA 2OYSA 2W48A 1GYRA 3AJ9A 2PX8A 1J23A 1J20A 1Y34E 1SKYE 3GELA 3INNA 4GI7A 4RVFA 3TNFA 3WP1B 4CLRB 4KZPA 1CDOA 2A5FA 2ZUDA 4PLGA 1RRGA 4TV8B 1T9BA 1SB8A 5B2EA 1FF9A 3H99A 2ZJAA 3NT2A 2X5XA 1VSTA 1XTUA 1P29A 1IG0A 2O2XA 1H1TA 1RXIA 2YZGA 4N7BA 4RESA 3VR6D 3IBTA 1PUXA 3SIRA 1MJNA 2PZFA 4LXGA 4LZPA 4EJMA 4EHAA 3RHSA 5FWYA 1XEWX 1NNSA 1CJMA 3WFIA 2JK0A 2REOA 3OBBA 1EDBA 3N9IA 1OFGA 3A1UA 2IHJA 1XMVA 3TINA 2Y1KA 3WJ2A 1YFLA 2FZCA 5ILQA 2HIAA 2HKIA 4U2KA 4BO3A 4F2DA 4DDUA 1M6VB 4K5QA 1Z63A 4MAMA 3LPCA 1FFBA 2CJXA 2C42A 4G26A 3TL3A 1CDDA 1H42A 1RYDA 3WQQA 2ZYTX 4Z54A 4RY9A 2EX4A 2IUUA 2EATA 5A3QA 4HAVA 5BWMA 3SDZA 3A6EA 3SBOA 3QI2A 1UXGA 1DB3A 3TTTA 1BAPA 3WSWA 5CDYA 2ZBGA 3ZVRA 4B7AA 3D3EA 1L3IA 1SC6A 4LRWA 5DWVA 2IU0A 2ZGVA 1KTVA 1V9LA 2JLCA 4N9QA 4L9RA 3RSLA 3VU3A 4EGSA 2XNKA 1RIFA 2GN2A 3FSEA 2ZRLA 1TA4A 3HI6A 3NRJA 4JGIA 4MP8A 3GGOA 4M0MA 1ZKDA 1V6CA 3SEFA 4CV2A 4ZYXA 1D4ZA 1JG2A 2V3CC 1R18A 3KTAA 4JXZA 1WD7A 2VNJA 3N2IA 3PFIA 4FZJA 3PRHA 5KC8A 1YRYE 4X97A 4WUVA 1WTCA 5J3JA 2XIJA 3BQ9A 3V8EA 1P4GA 3D0KA 5F9HA 1IEQA 4Q03A 1HOXA 2A8YA 3GAFA 1KMMA 2C5LA 1WX1A 1N6OA 4FCCA 1TVKA 4D92A 1YGPA 3DDUA 3ITKA 4Q6BA 1RE0A 3U17A 2Q3HA 1I94B 3EQ9A 4DRXA 2UXDB 1N3IA 4IQ0A 3HLKA 3A1FA 4DZRA 1N7GA 4G0OA 3VKUA 4AKEA 1RC0A 4O2RA 3F6YA 2DUJA 4Y7CA 2BP7A 3G0GA 4LBVA 2D3TA 2PZBA 3FMIA 3KZ1E 4HMPA 1LSUA 3DTYA 4PG6A 4DQXA 1F2DA 4ENTA 4ME6A 3AOGA 1FXSA 4RIEA 2FPIA 2D5AA 4Q3KA 4KXUA 5B12A 4B3CA 1M73E 2F8LA 2ODTX 3HB1A 3FTNA 1NXSA 1XXHA 2IY8A 2YICA 4O8ZA 4W63A 5EE1A 5FQOA 1H2WA 1EWRA 1W0KA 2HMAA 1OBVA 2D2VA 4FDAA 3HC7A 2C9CA 1HDCA 1XMXA 2ZJZA 3EG9B 4FMCF 4GM0A 1PG2A 1TL7C 4MW5A 4LS3A 4PCVA 1YZYA 4Y6SA 5JXHA 3DCYA 2FUG6 5EP1A 4NENB 1JAYA 1SIWA 2R3SA 2OD9A 3ZV5A 2YFKA 1D8TA 1QKIA 3MUFA 4BO5A 3ZXSA 1D6MA 2JLWA 1GYPA 4OK3A 1D2EA 3JTMA 4J29A 3X1ZA 1PI3A 4KX3A 3DBHB 2XOXA 1QLHA 5EVJA 1GD1O 3UENA 5E2IA 2PVPA 4RSRA 2XB6A 3HGMA 4WK6A 1Z2NX 4FQ5A 3WB1A 7MHTA 4D9EA 1F4PA 2VLIA 3NHSA 2JGFA 2OK8A 3L4BA 5CJ2A 3O4GA 1MT0A 1R3UA 5ECYA 4ZXPA 1FP6A 2QEQA 1UBLS 3O92A 3ABOB 2ZIEA 1GHTA 1OWNA 7ADHA 3AKEA 4YAFA 4Z9YA 3I6QA 5K7SA 1YC2A 8ABPA 1JI3A 4BYGA 3UUGA 4JFRA 4F11A 1FJXA 4K0RA 1Z13A 4I8XA 5DOVA 4MS1A 3PHCA 3CEHA 4HDQB 5EMNA 3RHZA 4UTXA 4KUHA 4AP5A 4AROA 3O47A 1XRQA 1LTKA 1V96A 1W1IA 2V6IA 2ZBEA 4WEQA 3T38A 3VPGA 1DKNA 3ND9A 2LKDA 4CF4A 1TEZA 4KDFA 1RXYA 3DXFA 4N0DA 1KMHB 4XD7D 2IC5A 4EG6A 4OATA 3HBAA 4PF1A 4XX0A 4I1VA 3SD7A 1XTRA 2DPHA 1D9XA 1C3VA 2P4HX 2BF7A 1QIGA 1KY2A 1T0HB 3TSAA 1YI8A 4KAJA 3S28A 1SZJG 3V34A 1UOPA 4NCKA 2MCFA 2XRZA 1ZJZA 4Q21A 3DWIA 1NL3A 1AHPA 4HNRA 4QD3A 4TMKA 3LKDA 3CSSA 5BW5A 1XI2A 2I4OA 3ETJA 1N34B 4LE1A 3VPBA 2GPNA 3KAQA 4JH0A 4NEQA 2DFNA 2H1FA 2J5KA 2RHMA 3K35A 3LYHA 4GIBA 4UD6A 3I61A 3UKOA 3KKQA 3DWFA 3QQPA 3OCZA 1PLLA 4LDZA 2ZETA 1RYFA 1OMOA 3QUSA 1KDPA 1U2TA 3Q85A 5AO9A 3A0RB 3ML1A 3IRUA 3O21A 3E2PA 3HA7A 2I1LA 2AEJA 2VWHA 2WI8A 1FLNA 4UUQA 1RRKA 3JQEA 2G7MC 1L3BA 2NGRA 1EVQA 2FETA 5JPIA 4YLGA 2VAMA 1MVLA 3EXG2 4AWXA 4JITA 2J31A 3NHWA 5IABA 1A5BB 3R5HA 4KPEC 2GEBA 2J5XA 4IUBS 4C7BA 5IJWA 4ZCMA 1SU8A 1I6MA 1P9OA 1U2GA 3PXAA 4WN3A 2P77A 4DR4B 5I7SA 1Q6YA 2PLNA 3BXGA 3VPHA 2QA5A 4L0DA 1EHYA 2TMKA 2X1MA 1D2RA 2HA4A 3GFRA 1IRIA 2CLEB 4RK4A 3LVBA 2CXTA 1M2VA 2L0XA 2OHOA 1L5NA 1M2WA 4O4LB 5BWCA 2HWKA 5HS6A 3GH3A 1CCWA 4PZUA 2WPNA 1ZCJA 1JJIA 2WBLC 2DFPA 3HYCA 1IEVA 4J7XA 5CP8A 3SE0A 2P6PA 4AZWA 4BMNA 4WK2B 1WLSA 3JYOA 4K87A 5HVNA 4CFZA 4DYHA 2WLSA 1A4RA 2CLFB 2GPBA 2JZOA 2ONCA 1YMUA 2OCAA 1XZLA 4PBSA 2QPOA 1Z6XA 1U02A 1NW7A 4MQ4A 4WESB 5ERXA 3ZGYA 1FA9A 1MB2A 4JOCA 4YAIA 5KU1A 5L6MB 5I9NA 3KWLA 3M34A 4Y0NA 4MCIA 1GNRA 2O48X 4UXIA 4LIPD 4L0QA 2W5UA 5A7GA 3AB8A 4DREA 4ZREA 5BNZA 4QXPA 2WIJA 1G4HA 1NMYA 2O1SA 3KVYA 3RKUA 1G9XA 3ND7A 4G0WA 5K4AA 2BGWA 1Y3CE 1MRZA 4K3VA 4M22A 1EFRA 5H0IA 3SF0A 4N76A 3EDRA 1P44A 3G9ZA 1NJFA 1OFIA 2JHPA 3G0IA 2KQUA 4E5NA 4HGQA 2QQEA 5FH9A 1OB2A 3EVAA 1RZ3A 4K9DA 4MPJA 1VECA 1W8IA 1KI7A 4YRIA 1CUUA 3FCOA 2I1VB 5KOYA 3EMBA 1JAZA 1YS9A 3FDZB 1RKXA 1JECA 2ID9A 5HUHA 2VJBA 1WCIB 2XQJA 1U3VA 3G02A 3SXJA 5DM1A 4TZKA 5AW7A 1U2PA 1ENZA 1I6WA 2JEYA 3O91A 4NYIQ 5AKEA 4J94A 3LUPA 3MOSA 4QULA 3SJ7A 1VKRA 3U4QB 3LH5A 2GZMA 2DAPA 1FLVA 3NV7A 3A3PA 4KQ6A 1UP6A 3NNSA 2O2ZA 4P6VF 5FHRA 1BHO1 3ZWDA 5A62A 3GOHA 4OMDA 4GNRA 2PRJA 3PJGA 5BMOA 1R9JA 2H5LA 3INRA 4QOGA 1VGVA 3TXXA 3BRCA 3LLMA 3GFTA 5K0JA 4XSHA 5G1PA 1ZL0A 1SUIA 1N5JA 1Z22A 2B1IA 3A58B 4KYTA 2I7TA 3I52A 2OD7A 3RYIB 3U7QA 3ZHVA 1UMKA 1G4AE 4U5QA 3WLSA 1EFLA 1ZIPA 4EG0A 4XLLA 2ECOA 2GRJA 3BXXA 3WRVA 1YBFA 2JBWA 4C4AA 5FWNA 3JWIA 1SKQA 2UUPA 1J24A 2VSYA 4QDKA 3GWGA 2WVJA 2CUZA 3Q3HA 5EUCA 1IOVA 4MIKA 1MW9X 1V8ZA 1V1RA 4ZO4A 3RO7A 4QM6A 1QF6A 1XDDA 4PWZA 5G0UA 3Q0TA 3DVAB 2E4UA 3DB1A 4DIOA 1VYTA 4PGAA 5H4HA 4IIHA 4AS3A 5KMGB 2C1XA 2DJIA 3KD2A 1KDTA 1KBOA 4K9OA 1FNNA 4NV3A 2DBRA 4LK2A 1XU9A 4KRFA 1DAFA 1PYDA 2REQA 4EKGA 4WOKA 5KMGA 4KRXA 1FMCA 2TMYA 5EY5B 3DO5A 4Y1FA 1XVLA 2C2GA 1C9JA 5B3LA 3OX1A 3TK1A 4IHQA 1WZEA 3DDHA 1V1RB 1C30B 2H11A 5IS2A 2EG9A 3D1JA 4OLFA 4MVJD 4PLTA 3A6PC 5KYTA 4HEJA 5E2BA 1KP9A 1VI6A 1HFKA 1RJGA 1WO8A 2IU3A 2XYRA 1Q0QA 3IOYA 3BXZA 1CUHA 2ZJ2A 5IN5A 5FUQA 1M83A 4O4LF 3BAFA 1RRMA 3FJ1A 1UPTA 3K4PA 3EWAA 5DM4A 2OZPA 3V7WA 1YE5A 2VTVA 8AT1A 1Z25A 2PR2A 3ESXA 4I36A 1YRAA 3ANLA 3SYRA 3U7QB 4E6EA 5IT0A 1KI6A 1KSFX 2AR9A 2FQ1A 3BZUA 3RVDA 4M88A 3S2GA 4AWBA 5FBVB 5EE9A 2QGNA 1GKYA 4P84A 3PE4A 1QTQA 2R7LA 2NPFA 2A9JA 1Z4IA 2QVXX 1FP4A 2H2AA 2PU7A 2P2LA 2VG8A 2X5OA 3RVLA 2A9KA 2HRRA 1QRRA 3LWNA 3K6KA 1FFCA 3DLAA 4DWJA 5GIOE 4GI1A 5IN4A 2B6NA 1WY5A 1KO7A 1RAHA 4FNGA 5GV8A 1WHSB 1HQKA 1W4BA 4IV5A 2Q62A 3D2AA 3RVNA 2GASA 2FA9A 4WW0A 1S2NA 4RAOA 1AQUA 2EC5A 3AQIA 1H94A 3A4NA 2B82A 1MB0A 3OY7A 1JR3E 4J7AA 2HCJB 2XYGA 2NW6A 3ZIUA 1L8AA 2PWYA 5CB8A 2PRZA 4ECEA 1A7AA 5IASA 1C9YA 1HSZA 2PL5A 1ICEA 4I19A 2HJGA 1G20E 2G9QA 1WSWA 4M46A 1ZDMA 1N7HA 2ZYVX 2D13A 3E82A 4C0WA 4W7IA 1OA1A 1XTZA 5HQTA 2FPOA 1S8NA 1P80A 2NO1A 1PR1A 2X8JA 4JL8A 4JOBA 4V24A 5B4TA 1VMKA 1KEVA 3TEMA 4EYEA 1NFRA 2QE6A 1AMUA 1P73A 1OILA 3MM4A 1EDEA 4ZO7A 1Z5OA 1ZVJA 1AQYA 2HMYB 3NEPX 1PJAA 1MO4A 2C88A 4UEOA 5CA1A 3VHRA 4CCSA 1FDTA 5BQ5A 5D5QA 4OHVA 3QGMA 4OMFG 3D4NA 4A6DA 1B00A 2ACWA 2IXGA 3HJHA 2WTNA 3V5NA 3DLCA 3E84A 2GFQA 4NFSA 3QV2A 1G98A 4MKFA 1HKUA 4MYRA 1HGXA 1E66A 1NASA 5EWLB 3BJRA 5ADUS 2FX5A 4JJEA 1EUYA 1V4VA 2P9EA 4KU4A 4KE8A 1JZSA 2YV1A 1RWXA 3HACA 5LBTA 3P0HA 5JAPA 2DR3A 4LF5B 5B7GA 4EUNA 4UBLA 2ZS7A 4ZHQB 1YJCA 4XR4A 1PZMA 4LA4A 4W6QA 5MFZA 3WJ1A 2WSYB 4MIOA 1A9QA 3VPDA 4I2VA 1X15A 1U3TA 5IJZA 1TD9A 1LRKA 1NMSA 2GO7A 4M53A 2YV4A 1EIZA 4PSKA 4IG4A 2AEMA 4TKZA 1K2VN 4NKRA 5JD3A 3H2BA 4ODIA 3T3EA 3G13A 4B6PA 3BMXA 9ABPA 4KWTA 2BFFA 3TAHA 2ZAIA 3TQTA 4ALJA 3TQQA 4B4OA 3BX1A 3ZOKA 3O8CA 1GA4A 4JS0A 1ZEMA 2XITA 4YRTA 1H2HA 1ULSA 1MXHA 1WVIA 3SQXA 2FN4A 1BA3A 3DOHA 3ESCA 3SE7A 1FNDA 2I6GA 2I71A 1ZESA 2NT4A 2NZJA 1TC2A 2QRNA 4LC9A 3EQZA 1G20A 1OWLA 1RXSA 5E7QA 5ER9A 1LX7A 1A2KC 5DGCA 5F7ZA 3BWCA 3L92A 3MUOA 1G6HA 1QIIA 4ZZ0A 2QKYA 3ZW8A 3UJ3X 2J46A 4U6QA 2RHOA 1NR7A 1KI1A 2HU2A 3EQ8A 4TTTS 3RU2A 5BR7A 4L50A 2FQYA 4C0JA 4U39A 2HA6A 2G70A 3R23A 5FI5A 5DSXA 3QVWA 5BVHB 4ZZIA 1SG6A 5C1PA 4X84A 4AG5A 4F8JA 4EMBA 3WV5A 4FN4A 2XV1A 3CUVA 1CZNA 1YUBA 2XJ9A 4B3HA 3EYWA 1E0KA 2Z09A 1QVRA 5C1IA 5E3JA 3G2NA 4MGZR 4BLQA 1BMTA 2LD4A 2C3OA 1WXXA 3HYRA 4G56A 5J4YA 1Y42X 2EBFX 2IUTA 1F38A 1W47A 4MJ7A 4B6FA 4U4AA 1V3VA 1VCHA 3LOUA 3HY4A 4DIBA 1U5BA 4AG3A 1B7GO 3AFOA 3S8YA 4WKCA 4RADA 2UXCB 3CJQA 5FTKA 1TKAA 2JI7A 3K2QA 2R1ZA 4G1FA 2VDNB 3FBWA 1J9GA 3HCDA 1QP4A 3TSZA 1BH2A 4AZ0A 3E23A 5LP1A 4IVRA 3UOWA 4KQGA 4KQEA 2VUSA 4MB2A 3NTUA 1NJ2A 2B7CA 4J90A 4MUNA 5CA0A 3VTFA 3ZUGA 4GGMX 5E38A 3U44B 3PEUA 3RRZA 1A8QA 3RSQA 1E3DA 4MRNA 2X0EA 3ESBA 4BBAA 4OSOA 3EZ6A 2JFNA 1QG2A 1IBMB 1OUMA 1Z2CA 1P74A 3DR3A 3PYMA 4KGDA 3ICEA 1XYYA 2D7DA 3SZGA 4TWJA 1RZRD 4P80A 2XDQA 1PNRA 4RTSA 4LNUB 4DTIA 4BLSA 3KQKA 4RKEA 2HMVA 3BRWD 4HF7A 5KNBA 1OH6A 2BPOA 1L4NA 1Y5RA 3JRNA 4N5IX 4P1ZA 4JT8A 5E7IA 3FYUC 5EHNA 3LC7O 4MMXB 1IN6A 3Q3GE 1JH9A 4HEQA 1RMYA 3K9GA 3EF3A 3FPAA 3CC8A 2C2OA 3A9WA 1VJRA 4PO1A 4EHLA 3F4LA 2GXSA 2WHEA 3D1LA 3MS7A 4FHFA 5KTMA 3OU7A 2ZBQA 2B21A 2DTDA 2VRBA 4IHJF 4YH1A 4W1SA 4GMDA 3VKHA 3DT8A 1LLCA 4E5KA 4ZJPA 1JV2B 2IQ5A 5NULA 3WGLA 3MCAA 4CMBA 5HSGA 3OE7A 2OC4A 3GPBA 2ZR0A 1G7CA 1KMNA 4G3XA 3FWZA 2MSWA 4UFNA 5DBHX 1P0CA 1JKXA 5T67A 3TTYA 4BP9A 3IPYA 3V8BA 4JQCA 2Q8QA 3PR2B 1NVUQ 1L5RA 1T1GA 2VHEA 5KYUA 3AX6A 1LY1A 2OCIA 4BNWA 1PHRA 1L6RA 3ZWYA 2F00A 1W5BA 4V1CI 3D3WA 4E1VA 4J4BA 2X4DA 3NJRA 2QUIA 2VCEA 4M1YA 1E0JA 3IQDB 5MF6A 1DBVO 3EVFA 1ILWA 4UNPA 2QLTA 4HNGA 1R0LA 5ABPA 2ZB7A 1FB5A 2PGDA 1JPNA 2UUAB 1Z4OA 3H5WA 5M7EA 4OHMA 4HLQB 2CL5A 1O6ZA 4C6RA 1NQTA 4QREA 1II8A 4BC0A 2M32A 3Q9LA 4JLPA 4JUFA 3SX2A 5TEWA 4EFMA 3ZD9A 2GD2A 3WQBA 4H7PA 3UA3A 2Q6KA 3ONEA 1LI5A 5AD1A 5CX1A 3IPXA 4G36A 1TF5A 1TPZA 1RABA 4CM1A 2XCQA 1L1EA 2YMPA 1QH8A 2H51A 1G9TA 2WK1A 3CJTA 3QELB 3ZK7A 3OQIA 1K5HA 2I34A 3SR3A 2JDID 3TLCA 3H5VA 4NRDA 1P75A 5IBPA 2HBYA 2FFRA 1ZM7A 3ESRA 2AFRA 2GPTA 2QLJA 2RGGA 3HWX1 2Q4EA 2XAUA 3UB3A 2WU3A 1DX4A 1F06A 1BMQA 5COBA 2DR0A 3L5OA 3C7DB 2ATVA 2G71A 3AXSA 4PWYA 3LT1A 1A2QA 3F71A 4TLLB 3PKZA 4LZZA 4XSGA 1RWOA 1KERA 2I8CA 3A6KA 2JIRA 2EL9A 1ZW6A 2OO5A 2OR3A 4FDVA 1Z0FA 1XMIA 1KH3A 1MNQA 3O9ZA 1G20B 3A3OA 1Y4SA 1DJPA 5A4KA 1SO8A 1U2RA 3UUFA 4MW2A 2RAPA 3ZQJA 3VU0A 3G6WA 1CUCA 3WK8A 2D3WA 5E3IA 1P7CA 2C2MA 3QMMA 4D9HA 3CLKA 3E15A 1E77A 2EF0A 3U81A 4GLBA 4OU5A 4LHYA 2HF9A 5ESDA 2O2YA 2OV4A 4NQRA 1P1RA