1ISJA

Crystal structure analysis of bst-1/cd157 complexed with nmn
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords bone marrow stromal cell antigen 1
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1isjA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1isjA02
3W6ZA 3PFWO 3V5NA 1GUFA 4BNUA 2HSDA 3KEQA 4D3DA 2HQ1A 2YV1A 1WPQA 2QW8A 3WR5A 3INRA 3RBVA 4XX0A 4RDIA 1RJWA 4QUKA 2CSUA 2W2KA 3NJ8A 2HJRA 4N5LA 1HLDA 1MXFA 2O2SA 1ONOA 1D3AA 3GG9A 1I24A 1PL8A 4GGPA 4CM8B 4RZIA 5TS3A 4AJ4A 4IIVA 2AA3A 3E8XA 1PIWA 4M8SA 1ZBQA 3GMDA 3AM4A 5A9SB 1ENYA 1KY4A 1X13A 2VT3A 1QP8A 4TRRA 1LLQA 1K5HA 5DF1A 4XIYA 3VPFA 4AICA 1Y8RB 3H9JA 2C82A 3C24A 4OXNA 5CPBA 4YR9A 3G1TA 3IMFA 4R16A 3NDRA 5A5FA 3L77A 2EF1A 1MC4A 2VHXA 3E48A 2JCXA 4FJ0A 1W8DA 4WCDA 2R00A 4K9DA 3HN7A 1KERA 2G82A 4QECA 1N2SA 4DPMA 1T1SA 4GLLA 3PIDA 1ADCA 3EZYA 2IZ0A 3Q9NA 4CMGA 5B12A 2O3QA 1HLPA 1N8KA 1AGNA 2H9IA 4BS9A 4BIIA 4D0SA 1PS0A 2GERA 1DFGA 4PVCA 4UUOA 3ANNA 5HS6A 1NWHA 3AI2A 1EBUA 4BNVA 5I7VA 3JQ8B 4XQEA 4RPGA 1YGYA 3PYXA 3ZU3A 3V1TC 4CR7A 2HDHA 3DO5A 4IQ0A 3WGHA 4BO5A 2AG8A 4NG5A 3I23A 2Z1MA 2X9NA 3ZHBA 2W2LD 1E5QA 3IJRA 4D79A 1IZ9A 1MA0A 2J6IA 3ZV5A 2W2KB 1MFPA 2CVQA 4Z9XA 4BVAA 5CP8A 3M1AA 5DN9A 4Y98A 1ARZA 5FI3A 3IUPA 4GWKA 3RFXA 5FWNA 5A3VA 3WGOA 4L74A 5DBGA 1XCBA 3KSDO 4JBGA 4RVHA 2J3HA 1P9LA 3TL2A 3SVTA 4WLVA 2HAEA 1XQ6A 2UUOA 4YB8A 4BL5A 2Q3EA 5A4DA 3CMMA 2VOJA 4CV2A 3K9QO 1Y6JA 1YL6A 1Y8QA 3QV1A 3ZI0A 1OZAA 2YZ7A 3PGXA 1M76A 4NK4A 3U5TA 3DMTA 3G49A 3ZWAA 9LDTA 1WMBA 4Q3BA 5A1TA 4Y9DA 4M1QA 3VH2A 4Q3AA 1DAPA 4Q39A 5IDXA 3RC7A 5CDYA 4CMHA 2Q99A 2DBZA 5TIIA 2BFPA 2FP4A 3MJCA 1PEDA 3PPIA 3ZNPA 2W4QA 1R12A 2SCUA 2BHLA 1YOVA 2O4CA 2X5KO 3AI1A 1MGOA 4YAGA 1SOWA 4FCCA 3M6IA 1RYDA 2POQX 4XWYA 3ROMA 3RBXA 3RI3A 1SOVA 2EG9A 3PDJA 5ER9A 3WGGA 3U4IA 2NVWA 4W9NC 4CPDA 3V1UA 4GL4A 1E3IA 4RLSA 2VRCA 4OXYA 4EITA 1SEPA 2GNAA 5JYEA 4P4NA 4MP3A 1T2AA 1VKOA 4F6LA 2I67A 3C1AA 3C7CB 1HDXA 5JS6A 3RAJA 3LQFA 4RVFA 4Z6KA 2O3RA 4J1QA 5JAMA 1K6XA 1NFFA 2H1SA 4XGNA 2J5QA 1JA9A 2OOSA 2P4QA 3UXYA 4ZHSA 3JD4A 1F12A 1ONNA 4ZRNA 7ADHA 1A9YA 2X86A 2DFVA 3CMCO 4W4TA 1OBFO 1VJ0A 1LLCA 3PVZA 4FD3A 4B3HA 5AXDA 1NFQA 4WEOA 4IDEA 5U4QA 1MUUA 1Y8QB 1PGNA 1CF2O 5DDIP 2BGLA 1ADBA 3GR6A 4FJ1A 3GNTA 5TT1A 2IXAA 4JBIA 2Y0DA 4OIMA 4QX6A 3ZDFA 1NX6A 1R0LA 4PIVA 4OHUA 4BNWA 2BI8A 2C54A 4IXTA 1ZVMA 3OETA 1P1KA 1Z75A 3EMKA 4HUJA 1ORRA 1LRKA 2PZLA 3PLRA 5TX7A 1U8XX 4U6QA 3ANLA 5TJ9A 1XU9A 2VYVD 4OO3A 3ORFA 1VM6A 2P9CA 1YQXA 5EQDA 1JW9B 3GOHA 4A10A 1G0OA 4HP8A 4L75A 1YOVB 5KJEA 2PKQO 4ZA2A 3AUAA 1C0PA 5TSDA 1NBOA 4UVEA 2Z95A 2D5CA 1K89A 2ZTLA 4B7XA 1RPNA 2QRJA 3VH1A 4J6FA 5ER6A 3TRIA 4DC1A 2H63A 4OMUA 5DCWA 3KYBA 4FFNA 2FSVA 4BO1A 1P1FA 1G0NA 4LVUA 3TZHA 3GVXA 1KEWA 3GHYA 1YXMA 3RKRA 5LDHA 1NQ5A 3W1VA 4ZN6A 1GADO 1ID1A 1IE3A 3S2FA 4CM3A 1VLLA 2JHGA 4AJOA 1F14A 4IMRA 4XQGA 5KJ1A 1E7MA 4B4OA 2OP0A 3T7CA 4E21A 1UZNA 3DBHA 4DGSA 5B4VA 1E77A 2D1YA 3PQFA 2P5YA 1P1IA 3MJ4A 3PWZA 4A03A 1DO8A 3AW9A 4R69A 5EPOA 3TZ6A 2JAPA 5DOZA 5G2OA 1HF3A 3EYWA 3KSZO 1S7CA 5EJ2A 3WFJA 5GY7A 1PR3A 4QT0A 1M67A 2Z5LA 3QSGA 3RVDA 1J0XO 4EJMA 3T4XA 1C0LA 1T26A 4H7PA 4BQRA 3QWFA 2X9GA 4J2OA 1E7RA 4OAQA 3I9LA 1M2WA 1HSOA 3NGXA 1YH3A 3PTZA 5KVVA 3QWIA 1A9ZA 1P0FA 1NHGA 1Q0QA 1HYEA 2WTBA 1V8BA 4UEJA 2ZATA 5MDHA 2GN4A 4YAEA 5JY6A 1C1XA 1A72A 1OFGA 4D45A 3KHUA 3WTCA 2ZTMA 3VVBA 1ZH8A 3TQHA 3WSVA 3NJ4A 3UVEA 3DFUA 1H6AA 3K2BA 3ZHXA 4TSKA 3GUCA 3KEOA 4HBGA 3NT4A 4E13A 1WXDA 3HN2A 3OJ0A 4MVJD 1KC3A 4CV1A 4DMMA 2J3KA 2JKVA 4Q9NA 5BSHA 4YAKA 4DPKA 4MKXA 4YRAA 2IZ1A 1R15A 2D8AA 1DLJA 2PZJA 2VNSA 4CUJA 3LT2A 1NYTA 1N7HA 3DZHA 4OH1A 1EVIA 3DZJA 1U2DA 4DYDA 1V3UA 4YQZA 5HWSA 1UZLA 5AXAA 3DBHB 4E12A 3BA1A 2ILTA 4GSKA 4NR0A 4L4SA 3U09A 4J43A 1YKFA 1BW9B 3LDHA 4BNMA 3DWFA 1MX3A 1H5QA 1PJCA 4II2A 1M6WA 4Q3NA 2G0TA 3STHA 3IUSA 2CF6A 7MDHA 1VJ1A 4H16A 3ZNNA 3VDQA 4B7CA 3ULKA 3JQBA 1LDMA 2NQTA 4IDGA 2AE1A 3GG2A 1GPDG 3S1LA 1B26A 1I3MA 1JAYA 2GLXA 4W7IA 1Y9AA 5CHEA 1YONA 1UH5A 1EUCA 3I52A 3H5RA 3NEPX 4HV4A 4DYVA 4YWJA 5IN5A 3RC1A 3VH4A 1PZHA 4DA9A 4ZICA 5JBIA 4Z9FA 4XA8A 3FI9A 3EDMA 3DBRA 1AXGA 3OBBA 3WB9A 1LQTA 3NDIA 3PJFA 4B8ZA 4ALIA 8LDHA 2X23A 4HXYA 4K6CA 2BFAA 1BRMA 1GYRA 1YQDA 1JWAB 1F0YA 4KUGA 1NQTA 2DAPA 1C1XB 3WWYA 4XYMA 3A28A 5JDCC 3VTFA 4YJFB 1A27A 4D3SA 4F46A 1SO8A 1KY5A 1BXZA 3K8ZA 1F17A 3WSWA 4AJJA 1ZK3A 1P1HA 3RBZA 3U0BA 1ZMTA 2QIOA 3E5RA 5CDGA 2Y1FA 2YHIA 3OFSA 4PLYA 4E30A 3BMCB 3D1LA 3PP8A 4ALKA 4AJHA 1LSUA 3AWDA 4EW6A 1NXQA 1JDJA 1E6UA 5DNAA 1WZEA 1ISJA 4PZEA 1DIRA 1LJ8A 3E82A 3EK2A 2D3TA 1LDGA 4R68A 2ZB3A 1MC5A 1MLDA 1ZJZA 1I5RA 3B1KA 3IKVA 4U7WA 4DLBA 3ONEA 1J4AA 4UUMA 4PLWA 5L53A 2FY8A 4OXKA 4RLHA 4JP3A 4LMRA 3WBFA 2WEKA 6LDHA 5KIAA 1MG0A 1TLTA 5JO9A 1DC6A 4GX1A 2BH9A 3WYCA 1U7TA 1M66A 1A71A 1XIVA 4UULA 4IMPA 5GZ6A 3WGQA 4BKUA 3AM3A 3AU9A 2LDBA 4O59O 5CDUA 4W9NA 4BV8A 3ZH2A 3PHIA 3QW2A 1FF9A 1XQ1A 4Z0PA 2Q45A 4NFSA 4ZJUA 1HE2A 4R9SA 4NZ9A 4QXMA 2JAHA 2PKQP 1XA0A 4WLEA 2OP1A 1DAOA 1UXIA 4KTVE 3ROKA 2I5PO 4P4GA 2DC1A 1TT5A 3K31A 1LSOA 5F5LA 1DIAA 4CLHA 1DB3A 5BT9A 3NTQA 4E5YA 4AJ1A 1NASA 4G65A 5KOIA 2HLPA 2YHUA 4XKJA 2XPCA 3Q9UA 1ZEMA 3KYDA 3GN1A 3VPGA 1DPGA 4L9RA 2FZEA 4CL8A 4JBHA 1BXKA 3AUSA 4NJOA 4TROA 1U2GA 4ZQBA 2YHIB 1UXJA 2FWMX 1GTMA 3KTDA 1AXEA 2RH4A 4IDFA 5CEEA 2GZ1A 2IODA 5A04A 2ZK7A 3FCOA 5EMHA 1PJSA 3MOGA 3OH8A 4TRJA 4QQRA 3BAZA 1PS9A 3NX4A 1BDMA 3F5QA 2R6JA 1PGJA 2BMAA 3KVOA 1MV8A 2VHVA 4IGEA 3AY3A 4ND3A 3ONFA 4CODB 3G0OA 5CG2A 2NNLD 3E9QA 1T24A 2DVMA 3BYZA 3E5MA 3OJFA 3GA0A 3N7UA 5T57A 4WOKA 4A73A 4CV3A 2GSDA 1QRRA 5A3JA 1TXGA 1MP0A 1Z6ZA 3GF4A 1LXCA 3UGKA 1GDHA 4ALJA 2WWRA 4M87A 2HMSA 1U3TA 3WTBA 1PQPA 3RJ5A 4BMVA 4XB2A 3MEQA 4C7KA 4BKPA 2A35A 4P22A 4NU5A 3I9KA 2BGMA 1GEGA 2H6EA 1CQIA 3HDHA 4Q3DA 1WVGA 1PSDA 3MWEB 4C4OA 2OBYA 1TT5B 4J9UE 4PLFA 2VWPA 4XR9A 5DULA 1EQUA 4Z3KA 3ADOA 3M2TA 4EGFA 3UFXA 4QO8A 4BNLA 1EVJA 3IS3A 3JD2A 4IJVA 3NTRA 4E5PA 1YRLA 1NVMB 2VZ9A 3KYDB 1EEHA 3IP3A 1EFKA 4IJWA 4AJLA 4GI2A 1ZXBA 4WLFA 3DZKA 1RM3A 1U3WA 1E6EA 4OSPA 5KCZA 2RHRA 3FD8A 3HZZA 4BUCA 4R1SA 2Y1DA 3TWOA 3AM5A 3BTVA 1HKUA 1YB5A 1T2EA 3Q2KA 3AOGA 3OJEA 4FFLA 1TI7A 3QLJA 1AHHA 1J49A 2GCGA 3K2EA 3WJ7A 3DTYA 2YV2A 2X7HA 5F1PA 2B4QA 5G0UA 1LSJA 1RWBA 3PQEA 2CMDA 1NVTA 3ADPA 3LK7A 3GDGA 4YT5A 5H82A 3SXPA 4E5KA 3GN2A 3JQCA 3C7AA 5BQFA 4IM7A 3Q6IA 4O1MA 3RUAA 3NRCA 2JFHA 4DLLA 1QYVA 3ZZNA 3ON5A 1QYDA 2Q1WA 1YO6A 1LRLA 1O9BA 4AJ2A 2P9GA 3FPCA 4BNNA 4YAIA 5EL0A 3L9XA 3RJ9A 2VTDA 5KJFA 5U1PA 3DAGA 1NPDA 1JKFA 1K2WA 4YJDA 3H4VA 2HK8A 1RYEA 4E2YA 1GQQA 4KUHA 1X14A 3VTZA 3OIGA 1Q7GA 4E2ZA 5DCYA 4MINA 4TQGA 2GZ2A 3IC5A 1WLYA 4Y6PA 4FBGA 3KETA 5DCUA 2V6MA 4NH4A 2V6BA 1GUYA 5C5IA 1ZMOA 1FMCA 3I1JA 1L7DA 4IBOA 2Y1CA 5JAZA 3OQ1A 3DOJA 3CEAA 3O8QA 2HU2A 1DEHA 4OYRA 4TWRA 1P45A 2HJSA 2X0RA 4GX5A 1V0JA 2AQHA 2CDAA 3JQAA 4CV0A 3KV3O 2I76A 1F8FA 1Z45A 4IDCA 1ZZEA 2G17A 3DHNA 4I5GA 4IJKA 3ZV4A 2Y0EA 2PZKA 5G4LA 3QP9A 2O3SA 2YY7A 4MO2A 1I33A 4QFCA 3ST7A 3ITKA 4DUPA 1PJQA 5CPFA 5IFLA 3V8BA 1GR0A 2X9VA 3OEYA 4CM6A 4WPGA 2NTJA 3P2OA 5BNIA 1N1GA 2DBRA 4RZHA 1E3SA 1H2HA 5JDCA 1B3BA 1GAEO 1BXGA 1QV6A 2E4AA 4MKRA 5I8WA 3WOHA 3CIFA 3W4IA 4FOSA 1P1JA 4Y6SA 2ZCVA 1L1FA 4AJPA 3UN1A 4RQTA 4PRLA 5G0VA 2HK9A 1UJMA 3GFGA 1OAAA 1ZK2A 2PWZA 3GY0A 3TOZA 3PHLA 1DIGA 3AU8A 3GPDG 3QIVA 5ENVA 5TQVA 3DQPA 5LCXA 5J23A 4J7CA 3FNFA 1UAYA 4YJGA 4WGGA 2VYNA 3Q2IA 3TDKA 4XRRA 1PQUA 2EIHA 1E7YA 3NAQA 4BKQA 1RM0A 4XDZA 4K6FA 4YJHA 5TF4A 3RU7A 4MVJF 2YFHA 4RVDA 4BHTA 5COBA 4DVJA 1ZK0A 4LMPA 1I3LA 1BDBA 3CUKA 3O8QB 5EQFA 5GMOA 4IUYA 3RIHA 1I8TA 4PG5A 4TRMA 4MP6A 3CINA 2Q4BA 2QQ5A 2WJPA 3BIOA 3JQAB 4NBTA 3H5AA 1Y7TA 3X2EA 2ZQZA 1QORA 3BTOA 4FC7A 2DPGA 2JCYA 4NBWA 3DZIA 1LUAA 1PWXA 2X0JA 5DZSA 4AJIA 1T4BA 1DC4A 1XYGA 5HBRA 5BNTA 1YB1A 3IAHA 3JQBC 4LCJA 4O6VA 3ETGA 3TSCA 2BLLA 3QVWA 2HKIA 2GPTA 1J5PA 3VHRA 3ABIA 4CM1A 3R3JA 4D46A 1DIHA 4YT4A 4MVJE 1P77A 4ZU3A 4EEXA 4EDFA 4BMSA 3F4BA 3S8MA 5I7EA 5G4KA 4OQZA 1BXGB 4W82A 1VI2A 3OSUA 3RCBA 3SBOA 3UUWA 2Y05A 2C5EA 1HT0A 3FTNA 1C3VA 3PK0A 4PG4A 3H9QA 5JAQA 1XSEA 1Q7CA 2EJWA 3FN4A 3U4HA 1LDBA 1O94A 4RDHA 4AG3A 3RUIA 3LLVA 3UCEA 1SB8A 1E7QA 4IGFA 4NBUA 1KETA 2BF7A 1E6WA 5L51A 1T2DA 2Y1GA 4KDEA 3SEFA 1E7WA 2NTNA 3HJAA 1CRWG 2DUUA 4O0LA 5KNLA 1ZW1A 4GLOA 5L4SA 4IDDA 2DKNA 1Y5RA 2PD4A 2VHWA 4YJGB 2VRCD 3T7EA 2VHYA 3HB4X 3WQRA 3N58A 4W6ZA 4D3FA 4PN3A 1VPDA 4BO3A 3OM9A 4YJHB 1GCOA 2DTXA 3PYMA 3QVTA 5ILOA 1UZMA 2FR1A 3UCXA 5BNFA 1EK6A 1QV7A 1VC2A 3C1TA 1B16A 2ZIZA 3JQ6A 3CE6A 4RJTA 1UP7A 3HG7A 1BMDA 3GUYA 3GAZA 1H94A 3VZSA 3PZBA 4WUVA 4I5EA 4OJNA 3WNVA 3ZW9A 1NHWA 3VH3A 1QYCA 1TEHA 2GN6A 2O3JA 4K28A 4IINA 3CZMA 1D7OA 1KOLA 1CEQA 4TVOA 4KOAA 1ZCJA 3ZWYA 4L8VA 4XCVA 1X7HA 1X0XA 4ZQFA 5FFFA 2PH3A 3U4DA 5IDQA 3UKOA 2O7QA 2X6TA 2AW5A 1G1AA 2C20A 3I5MA 3WMXA 1HYHA 1ZJYA 1H6BA 3LF1A 4HKTA 4WNIA 1W73A 3AUUA 5G4KB 4J0EA 1AE1A 1YDEA 1FJHA 2EP7A 2EW2A 2GN8A 1R6DA 1EBFA 2PTGA 2VQ3A 2YDYA 3WX0A 3WFIA 3K73O 4X54A 2ZYGA 3KLMX 2VWHA 4JGBA 3UHAA 1YBVA 3BHIA 1F8GA 5EIOA 3ZWNA 4DMLA 1YVEI 4H15A 1AHIA 1UP4A 4H3VA 1FDUA 3NDJA 3ZU5A 1SZJG 4GH5A 1HE3A 5H83A 3OIDA 1N92A 4RQUA 1U4OA 1AUPA 1B3RA 3GGGA 4HWKA 5IXYA 4BQPA 3VZQA 1VSVA 2B69A 3KBOA 1ZSNA 2IXBA 3TZQA 1YBAA 1YJQA 2AQKA 2FN7A 4HY3A 2YDXA 4CL3A 5IJZA 4P8RA 5EINA 1X1EA 4NDNE 3U49A 4NFYA 3FNHA 4ITUA 3H9EO 1O0SA 3B70A 4DBZA 1X7GA 4HX5A 4QSMA 2NSDA 1VL8A 2IYOA 2FPGA 4OGWA 2GN9A 1YL7A 2QYSA 1GQYA 2VN8A 4CMEC 5AQ1A 5A03A 5JLAA 4GGOA 4I1IA 2OXIA 3KXDA 1BWSA 3HNPA 1HYGA 3UCFA 1CWUA 1B8UA 2IEBA 3PWSA 2Y1OA 5C7LO 3JYOA 1XU7A 2Q1TA 1HETA 1U3VA 4PLPA 1H93A 3IQDB 3DHYA 4L4XA 1LBEA 2JD1A 3H2SA 5CDTA 3C1OA 1PJTA 1LEHA 2O50A 2JJYA 4KWHA 2IE0A 3GLQA 5JSFA 5B4UA 2I6TA 1UDCA 2W90A 1J6UA 1T2FA 4DWVA 2DBQA 4LVCA 4MVJG 1SCUA 5FYDA 8ADHA 4TKLA 5JCXA 3QWBA 3GVPA 3RUHA 3EW7A 3Q11A 5L4NA 4F3YA 4LN1A 3WGIA 2WD8A 1E3LA 2OBNA 1BW9A 2D59A 1KVQA 1NNUA 4RO0A 1XELA 5L7YA 3K96A 3F47A 2PV7A 3UW3A 1ENOA 4FW8A 3KRTA 5HTOA 1EK5A 3F6YA 3JQEA 3PXXA 2VT2A 3R0IA 4RPLA 4OOFA 4R1UA 2VZ0A 2H5LA 1R37A 3PI7A 4II3A 5ITVA 4MVJH 3INTA 4A7PA 1HE5A 4TVBA 5I9NA 3DTTA 4B4WA 1YQGA 2CDBA 4BO6A 3IKTA 3FR8A 3GQVA 2EKPA 3WNQA 4GVXA 3PWKA 4IY1A 4KUEA 3JD0A 1TT7A 2ET6A 1HRDA 1VL6A 2DPHA 2JFFA 4BNKA 3H2ZA 2FHSA 3GEDA 3AI3A 3H5NA 2FRDA 4UEOA 4FDAA 2BI7A 1DHTA 2X58A 3KZVA 2Q46A 1GZ3A 2GD1O 3AFNA 4FC6A 1IOLA 3PHJA 4IIUA 5L9AA 1M75A 1TA4A 3P5SA 4E5NA 4CM7A 3R1IA 1ISIA 1C0IA 4YJFA 2BELA 4J49A 1VE9A 4KDFA 2W98A 2O4UX 1HDZA 2GYYA 4BB6A 4CLDA 4F45A 1IPFA 3IDSA 2NU9A 1OI7A 4W99A 3Q3CA 5T64A 1UP6A 4N7RA 1V3VA 1YE3A 3BMCA 4LISA 2RAFA 1K0UA 1JVBA 1V3TA 4PLTA 3ZWMA 3MZ0A 5TT0A 2F1KA 3ZWVA 2P4HX 1U5CA 3NT2A 1NFRA 1E1NA 4E5MA 3LF2A 4JJFA 3A06A 2NM0A 4QFDA 1H6CA 3HQ4O 4DREA 3RC9A 4YT8A 4GKBA 4R5MA 3HE3A 5FF9A 2C29D 4XEHA 3D7LA 1XGKA 3UICA 2FOIA 4O63O 3H9UA 2ZB8A 2X8LA 1ISHA 1ZXLA 2WYUA 3S2GA 4HFNA 4W7HA 5COAA 1XG5A 3OF2A 4QO7A 4Q3CA 4CJXA 3B1FA 4GBJA 4E32A 1ZSVA 1I10A 2BFOA 3E9NA 4LRSB 1Y5MA 3LC2O 2DFDA 4XB1A 1I3KA 4EBFA 2QG4A 5TLSA 1HZZA 4ZD6A 3WBBA 4CQMA 3DZFA 3DMYA 1WWKA 1YWGO 1DFHA 2O2YA 2HO5A 3H7AA 3PZRA 4YTEA 1LLDA 4WCFC 1GV1A 1CJCA 4UVHA 4DRYA 2Y66A 4ALLA 4CMAA 4CR8A 2OO5A 1ZKMA 2CVZA 4R4JA 3D3WA 4BKOA 3RASA 1H9AA 2Q1UA 1B8PA 1DC5A 2XXJA 4NJMA 4NIMA 4NU6A 4FOOA 3GT0A 5IN4A 3SX2A 4MPDA 4CM9A 1HDRA 2P2SA 4Z0TA 5L95A 3LU1A 4HFRA 2VWQA 3BHJA 3FSRA 4J4BA 3VZPA 4CMJA 5F3RA 4GWGA 2PLAA 2YW9A 3VKUA 5FI5A 5CG1A 2YUTA 1A7KA 4A2CA 4EI2A 2J5RA 1NVGA 2J8ZA 1ULUA 1D4FA 4I9NA 4KP7A 4AVYA 1BVUA 1OMOA 3KLPX 4E33A 3DAPA 1T1RA 2NVBA 1U1IA 1NP3A 3SLGA 4Z9YA 3LSYA 3HDYA 2ZTVA 3ZWWA 3KYCA 2C2YA 2PNFA 5C37A 3ZWOA 2JHFA 4WOJA 1IHYA 3DZBA 4EUFA 3ZNOA 2OORA 4YACA 3E9MA 2RHCA 1ZK1A 4RGBA 4L0QA 5CEJA 3PFFA 3C8MA 1Q1NA 2IZZA 4ZQGA 1LDYA 1N9GA 4P4LA 4MJLA 3D4OA 2B35A 1PJ2A 9LDBA 4GMGA 4CM4A 4XYLA 3DB2A 2Z1NA 2NU6A 5AOVA 4A0SA 4I9HA 5JCJA 4DQVA 4J0FA 1EE9A 4N5MA 4PRKA 2ZQYA 3EUWA 4CQMB 2C07A 4MP8A 2I66A 2X4GA 3H3FA 4HNHA 1XWFA 4YVFA 4WASA 2P68A 2O7SA 3CTMA 2RCYA 5L7TA 1QYWA 3D3WB 1T25A 1D1SA 2J5KA 5T6BA 3K6JA 1NPYA 4NJMB 3FTPA 5THQA 2IEDA 5C7IO 3JQ9C 5ICMA 4RF2A 1C1DA 1EQ2A 4D44A 2UVDA 3L4BC 4Y67A 4R3NA 3MOIA 5JMPA 2D4AA 4R1TA 1FDTA 5JPIA 3IOYA 4PCVA 2B0JA 3QVSA 3ZHYA 3AUTA 4CM5A 1QR6A 3QWAA 2A4KA 3CSDA 2GUGA 2I3GA 3NUGA 4YRBA 4FN4A 2WD7A 4R51A 4L76A 4B3IA 2HMVA 5C3MA 2VUSA 3WJAA 3D64A 1BG6A 4CLRA 4MKZA 3ICCA 3KYCB 2VUTA 4P38A 3U3XA 1ENPA 1LI4A 5KKAA 3F9IA 2D0IA 4CMEA 2AQIA 2Y67A 1PZFA 1ADGA 1MXHA 3DL2A 1P44A 4XZ3A 3ZWPA 3W8DA 1NTOA 1DFIA 1MG5A 1DJQA 1HDYA 3PYLA 4Q3EA 1XDWA 4B3JA 5HS4A 1NPTO 1K6JA 4FFRA 4XDYA 3L6OO 1N9GB 1PQWA 3E1KA 3QY9A 5ES3A 1P0CA 4CM4B 5JY1A 3MWDB 4IJUA 5K9ZA 4EEZA 3O38A 3ZU2A 2Y0CA 3ZNQA 1PJ4A 3BHMA 3JSAA 4CQLB 2XXBA 2UAGA 2P5UA 3S2IA 3GDOA 4DC0A 4ZRMA 1SEVA 1K3TA 3A9WA 4JJIA 3D4PA 4PLGA 1D1TA 4E2WA 2CVOA 1HE4A 2A92A 4ONEA 1DRUA 1C14A 3TNLA 2HUNA 2WDZA 3FHLA 4KQXA 3OJOA 4JIGA 3L0DA 2WE7A 4FSHA 4EZBA 3EZLA 3HSKA 4KZPA 4LGVA 1DSSG 1C1DB 1QLJA 4GX2A 1P33A 4G5HA 4I8XA 1DDOA 4J90A 3PHGA 3RUCA 1O89A 4J1TA 4NFHA 1LDEA 4YYZA 2DBVO 1GZ6A 1KEUA 3FBGA 2YYYA 3GEGA 4PLVA 1DC3A 4FQ8A 3WQSB 2WD7B 3HDJA 2B4RO 2WYVA 1PGQA 2O3TA 4J91A 5LDGA 5K6AC 2VNAA 1KYQA 4CLRB 4RL6A 3DOCA 1VL0A 4XR4A 3LC1O 2WM3A 1W0CA 3OJLA 2OL4A 2VWGA 5EERA 4ND2A 2NUAA 4PG8A 4MOWA 1I2CA 4XYEA 3FRJA 3MJSA 5BSEA 3JQAD 5I9LA 1DIBA 3JD3A 4GAEA 4J16A 4PG6A 5DOVA 2Q49A 2V65A 5G0TA 1QLHA 1LA2A 2AEMA 3JYNA 1LX6A 1BVRA 1A5ZA 1U28A 1N5DA 2A9FA 1GFSA 4B8WA 2EW8A 2HCTA 3RKUA 3T4EA 3KOUA 3ZCXA 2EV9A 2FPPA 1P74A 4JK3A 2B83A 3ZWBA 4GPD1 3HDQA 4N18A 3GPIA 4BO7A 1QYXA 2B5VA 3B20A 4JCOA 2Y1EA 3QQPA 1I3NA 4U0KA 2GR9A 2PGDA 1N7GA 3LC7O 3EVNA 2NACA 3I9NA 1A4IA 4RV9A 1CYDA 5AVOA 2CDCA 4BNFA 2JFGA 3QHAA 1A7AA 1JAXA 1DXYA 3ZHZA 4J4TA 1K6IA 1X15A 2NWQA 2VYND 5T67A 3WGYA 4NBVA 3RWBA 3GZ4A 3QJ5A 3WWZA 3AFMA 4S1VA 3WG9A 2I9PA 4RPJA 5IF3A 4ZVVA 3B1JA 4WK6A 2PGLA 1Q0LA 4N54A 2ZKLA 4OQYA 3GFBA 1E3EA 1F06A 1PJ3A 2QRKA 3ANMA 4RORA 5AXCA 2DT5A 2JCVA 2YQ5A 2EP5A 4UREA 5MGBA 5GZ3A 2TMGA 3U4CA 1T2CA 3GK3A 2J3IA 4XQ9A 3OIFA 4YRDA 4WCFA 3DXFA 1ZSYA 4C7JA 3PJGA 4DTIA 3CH6A 3EGOA 3AY7A 2PR2A 4J1NA 1R4NA 3C85A 3OA0A 1X7DA 4K26A 2EKQA 1KC1A 1PGOA 3V1YA 1EVYA 3JYPA 1LC3A 4R41A 4B4UA 4L4RA 2FSSA 4DQXA 1MFZA 4KQWA 2C5AA 2G76A 3MTJA 4Y6RA 1UDBA 4M54A 1UDAA 1SAYA 5H81A 1SMKA 5F1KA 3R6DA 5L7WA 4PLCA 1IULA 1JKJA 3O9ZA 4YA6A 1XKQA 3GC6A 5B4TA 1Q7BA 4WJZA 1VKNA 3AY6A 4I9UA 5KVCA 1H9BA 4E0BA 2VUUA 1EFLA 2E6UX 3DC2A 5JC8A 4IPTA 2GASA 2EJVA 3DEYX 1H6DA 3RUDA 2VCYA 2HK7A 2Y99A 1GZ4A 1NQAO 3QVOA 4D42A 2X1HA 3TZKA 5KKCA 3MJEA 5I7SA 4S3MA 4L73A 2I65A 3VDRA 1DLIA 3D5QA 3VAZA 4FR5A 2XAAA 3GRPA 1IPEA 4IZIA 4BNJA 4TKMA 3LYLA 4JXKA 1RKXA 4PLZA 4JP2A 5AYVA 1O6ZA 4RVUA 3TL3A 2HMUA 3K92A 4INAA 1U4SA 3G1UA 1I30A 3E18A 5COQA 4WCFB 4XQCA 4IS2A 1JKIA 1CDOA 4FPXA 3HWRA 5KTKA 3U9LA 2RBEA 1R4NB 5LC1A 3RU9A 4DIBA 4DL9A 4TZTA 5JW6A 3QA9A 3JQ9A 3L6EA 5IZ4A 3WYEA 5DT9A 5HM8A 1G6KA 3L4BA 1GPJA 1BSVA 3WIEA 4OM8A 3EY4A 1BTOA 1KVRA 5FEUA 2PZMA 3H8VA 3MCVA 3MJTA 3UF0A 2HRBA 3CPSA 5L45A 3ROQA 5JE8A 5IDYA 2IDZA 2WMDA 3EC7A 4DBVO 4BNYA 5U9CA 2HRZA 2OFPA 4FS3A 4EJ6A 2DQ4A 3A4VA 2FMUA 1Y81A 4NK5A 3JQGA 2QRLA 3NV9A 1FDSA 3TFQA 3SLKA 4HNGA 2C7VA 1R16A 3W6UA 3TJRA 3KM0A 4JNKA 4NQZA 1H2BA 1EDZA 1FXSA 3VOSA 3PHHA 2AE2A 4JQCA 4CMBA 3DFZA 1LDNA 4I08A 5DBFA 3VPXA 1PZEA 3ZN2A 3C3XA 2LDXA 1BGVA 3OEWA 1IYZA 2C59A 3M1LA 1O95A 1GUZA 4OOEA 2Q1SA 3W4KA 4YT2A 4OL9A 5IDWA 2NADA 2UDPA 2E49A 3AJRA 1E3WA 3PLNA 3ZGYA 5JO0A 3C7DB 3GVIA 5A05A 2FPIA 4MIOA 1KVUA 2W2LA 3VVCA 4DQUA 1LC0A 2AQ8A 3BTSA 4UEKA 1B14A 2GGSA 4Y8VA 2X22A 4A26A 4GMFA 1XLTA 3GEMA 3WLFA 1GD1O 1ZEJA 1QG6A 1FK8A 2I3AA 2AMFA 4DLAA 5I8ZA 4M49A 4N5NA 1Q0HA 2AHRA 3Q1LA 1R66A 4BGIA 4E4YA 5BSGA 4O5OA 2CZCA 2PGJA 4UVGA 4BO4A 3HFGA 4BNGA 2O23A 5BSFA 3AOEC 5IXSA 1KVSA 3TOXA 2BKAA 1B0AA 5K6AA 1I2ZA 1B8VA 1KEPA 2OMEA 4J1SA 4K1LA 4NPCA 4CLEA 1IY8A 4B4VA 5CEFA 1FDVA 1PL7A 1WAMA 2ZB7A 2OGUA 1PX0A 2ZTUA 3JQFC 4U0JA 4WLOA 4ZQEA 5THKA 3WS7A 1TB4A 4E31A 4JLWA 1EDOA 3JQGB 1EZ4A 1ZK4A 3F1LA 5BR7A 3P2YA 5CDSA 2PD6A 3NGLA 2PD3A 3SJUA 4M89A 4BNZA 4BO2A 2EXXA 3P7MA 3VZRA 4EJ0A 1DRVA 3B6ZA 1D8AA 1OC4A 3DDNA 2YQ4A 3K5PA 2P9EA 1Z7BA 3E03A 2UYYA 5IZCC 1YS4A 5TC4A 3ENNA 2GDZA 4QTZA 1HZJA 1I0ZA 4YBZA 4E3ZA 3I4CA 3QWHA 1ULSA 3H6KA 1GYPA 3WXBA 2HMWA 3CKYA 3OECA 4G81A 4CLXA 3ZWXA 2X0IA 5A5EA 1SPXA 1I2BA 4D0RA 1E3WB 2BRUA 4BOYA 2NV6A 1U8FO 3WYBA 1NR7A 4EUEA 2J3JA 5HRUA 4LSWA 4URFA 5JDIC 3JQDA 1EE2A 3FNGA 3CXRA 4Z3DA 1Z73A 1QSGA 3BMOA 4MVJP 3HUDA 2PA3A 3G79A 3WLEA 1DBVO 1FDWA 4GX0A 1HEUA 3DAFA 5L4LA 5ITWA 2R2GA 3V2HA 2XF8A 1Y1PA 1VJTA 4RPHA 1R0KA 2ZJ1A 3FPLA 3I9OA 2ZB4A 2EGHA 4PLHA 1I32A 3ITDA 3WICA 4NHEA 3WIDA 4XIJA 3H9GA 5JNLA 4MVJM 3GH3A 5L3ZA 1GU7A 3ETEA 1HSZA 4M55A 4GSLA 3D5TA 4ALNA 3DBLA 4UVIA 1HDCA 3FBTA 1YB4A 3INGA 1IHXA 2QHXA 4R5HA 4PFJA 1V9LA 3GMSA 1RM4A 3GGPA 3GNQA 5A9RA 2NU7A 5T8KC 1MB4A 3JQ7A 1EMDA 1X1TA 1DHRA 3V2UA 2BFMA 3I83A 2IYPA 1Y9EA 2WSBA 5DP2A 3FWNA 3KO8A 3PDUA 1GL3A 5A06A 1I01A 1EUDA 1ZUD1 4TMFA 1YJ8A 5JAIA 3ONDA 4AFNA 4E2XA 2YJZA 5B1YA 2ZJ0A 2DLDA 1AN9A 1JVSA 3H65A 4R9RA 1EUZA 2PY6A 3F1KA 1ML3A 5DBIA 2VYVA 4PG7A 1B15A 1VSUA 3PQDA 5EN4A 4NBRA 1KEVA 2E48A 3A1NA 2Q2QA 3O03A 1PJBA 3D3EA 5T5QA 4RCVA 3JYLA 1E7SA 1QMGA 5EESA 5I7FA 3ROPA 3TF5A 2B36A 1BHSA 4KWIA 4LK3A 3WQQA 3GGOA 4CQMD 3WMWA 1P1RA 3F46A 3BMOB 4RVGA 1E1MA 1HWYA 2PKRA 2QYTA 1ISGA 4EUHA 3E6AA 2Q2VA 3RFVA 4G2NA 1U5AA 3RUFA 4WE3A 3JYQA 3RFTA 1UR5A 2V6FA 3LT0A 4PZCA 1JU9A 3IL2A 3ETDA 4MIEA 1NAIA 1LU9A 4CM9D 1GY8A 1KBZA 2EERA 4FFMA 3GVHA 1E92A 3FF4A 3OMLA 1GV0A 5C7OO 1PS8A 3TPCA 1YDWA 2NTVA 1KVTA 1WP4A 3SJ7A 1NQOA 1DRWA 2AEFA 3HADA 1E5LA 3DBLB 4BGEA 5KWEA 3PJEA 1U7HA 1OC2A 4KMSA 5KJ6A 2YFQA 5TJHA 4WNCA 5TRTA 3FNEA 4ESOA 4AJNA 4EYEA 2E82A 3OQ6A 3JQ7B 3S2EA 5A9TA 3L6DA 5AXBA 3KSUA 5IAAA 2TMDA 1WDKA 1CERA 1WMAA 2ZYDA 4PGFA 1ZIDA 4RF5A 4ZQHA 2AXQA 3HHPA 1XHLA 4CR6A 1ADFA 5ICSA 4YDRA 1IL0A 1HTBA 4YQYA 4YPOA 3RQSA 3WDSA 2WE8A 4IZHA 1IZ0A 4MDHA 3VPSA 1HDGO 5KVSA 1SC6A 3FWZA 5IG2A 3GAFA 2DU8A 4ZGWA 2EHDA 4BKRA 2EGGA 2A94A 4HFMA 4WLUA 2ZCUA 3D4NA 5JCJD 3NT5A 1E1KA 4HADA 3RC2A 1JTVA 1NAHA 2JL1A 3X2FA 4Z0HO 3VKVA 3W8FA 3DZGA 1TVEA 2PH5A 2X0NA 2CF5A 4MVJA 4ND1A 3WGTA 1E1LA 3IP1A 5TGDA 3I9MA 2UUPA 5G0WA 3SC6A 4D43A 1P31A 3HFSA 2B37A 5L40A 3OHSX 5JFOA 1X0VA 4I5DA 5TNXA 1XR3A 1Z7EA 5B37A 2E37A 1PTJA 2GZ3A 3GHHA 2FZWA 4YAJA 1B2LA 1NM5A 4RF3A 4WKGA 3L4SO 5JMWA 2OHXA 3BMNA 3DONA 1UXGA 2CY0A 2BD0A 3PRJA 2DTEA 3QVXA 3U62A 4DIFA 1HDOA 1WNTA 4B7UA 4D7AA 3RSHA 1KIFA 5CFZA 3DHEA 4UAGA 4BNIA 2Q50A 3BMQA 5JXWA 3ENKA 1O5IA 2VTEA 1T4DA 3JCZA 2F00A 1PJLA 4UUNA 1GCUA 2CFCA 5ADHA 5F1OA 3F5SA 4XJTA 2V7PA 4BNTA 3LVFO 4IXWA 4CQLA 2R00C 3HB5X 1VRWA 1JLLA 1UXKA 1LTHR 1PGPA 1L7EA 1E3JA 4JX8A 4CUKA 1UAGA 3PGJA 3H3JA 1ISMA 3JV7A 4YCAA 4IDBA 2O48X 2QZZA 1LNQA 2NQ8A 3O26A 4CMIA 1ISFA 1GQ2A 1LRJA 2DTDA 4J9VA 3AOEA 3QRWA 4FB5A 2X5JO 3GZNA 4XGIA 4XGKA 2UV8A 4R1NA 6ADHA 3P19A 2ZYAA 4NI5A 5I9MA 3V2GA 4J2HA 1CIVA 3DBRB 5KJCA 3JQFA 4FGSA 1Z74A 1CQJA 3BTUA 2C2XA 2VOEA 3I4FA 1V6AA 3UH1A 1B7GO 4AJKA 4BV9A 2C0CA 5JC1A 4R54A 2D5AA 4HFJA 4AJEA 2NVUA 1A4UA 2EKLA 1W6UA 4PZDA 4TZKA 1SB9A 4CMCA 2VRBA 1U3UA 3OP4A 2OZPA 4JJGA 3QE3A 1EVZA 5ILGA 2WYWA 5IZCA 2BGKA 2JD0A 2Y68A 2VZ8A 2O3UA 4BNXA 4J7UA 5F5NA 1R4MA 3PIIA 4MVJI 4RVSA 2Q4EA 5HA5A 3BMNB 1KS9A 3JD1A 2RH8A 1QKIA 3LLSA 4LCEA 4MIYA 1SBYA 3CZRA 3A14A 3BMQB 3PEFA 1PU2A 4XD2A 2P91A 4LSMA 2V6GA 4D41A 5JDIA 3K30A 1ZFNA 4R3WA 3IJPA 4OKNA 4ALMA 3GRKA 1P3DA 4QEDA 1WDMA 1UUFA 1YBMA 4IS3A 3ZV3A 1YL5A 3DMTC 3VC7A 5ENDA 4RF4A 1R0SA 1IB6A 3RUEA 1S6YA 2QX7A 1JQBA 4CLOA 3L07A 4E6PA 3ZU4A 3EHEA 3ZWCA 4M86A 4R01A 3LT1A 2AG5A 4CMIB 2PFGA 1PWZA 1QXSA 5KVQA 1IUKA 3F4LA 4XYBA 2NLOA 3GZNB 1N1EA 3BZUA 2QZ9A 3M2PA 5GZ1A 2NU8A 1PZGA 1OOEA 2D2IA 4GKVA 3RD5A 3MTGA 3EAGA 4JN6B 1W4ZA 4B79A 4KTTE 4GQAA 2YV3A 4BGVA 4BO0A 4OSOA 3NTOA 4DPLA 5DP1A 2CD9A 3G17A 3D0OA 3ASVA 3GNSA 4IDAA 4I5FA 2W8ZA 3I6QA 4ND5A 5T8KA 2NVUB 4WEQA 3ASUA 4OKIA 4BO8A 4CUZA 4NNJA 4BGUA 4CMKA 1LSSA 4WECA 5K0ZA 1V35A 1H0KA 2DM6A 4ND4A 3FR7A 3SC4A 2C7GA 4UVDA 2EWMA 3ICPA 3EVTA 1UXHA 5F21A 1R4MB 4FIZA 1NWCA 3ZW8A 3S55A 5CAEA 2B4TO 3GDFA 4YEDA 4FFOA 2RIRA 1SNYA 1Q2XA 4BMNA 1ZNQO 4IQ8A 3LT4A 5A02A 3NYWA 3JTMA 3O4RA 1ONPA 2OUIA 4RPKA 4J4HA 3DBVO 3NKLA 1O8CA 3Q0EA 1XEAA 2B5WA 1PR9A 3PJDA 2Y93A 3AK4A 3I9JA 2X5OA 1M6HA 4XJSA 4TRNA 5G0SA 3IIEA 4CLOB 2XOXA 1WW8A 3UOGA 2DUWA 3WGZA 4DXHA 3I6IA 2GF2A 4J7XA 4XRGA 4BNHA 1CETA 3DOOA 1C0KA 4U6SA 4WLNA 4CM8A 1PL6A 4BB5A 4NMHA 4J3FA 1ZO8A 1ENZA 3F3SA 3OICA 1DOHA 2G5CA 1WDLA 3UAGA 4JROA 5A9SA 3KUXA 3W4JA 2I99A 1DJNA 3LZ6A 4LW8A 3L9WA 1JN0A 3DR3A 2G1UA 3R3SA 1HL3A 3COSA 1Y8RA 4FJ2A 3TN7A 1LQUA 1GEEA 3N74A 3BXXA 1JWBB 2PK3A 4DIOA 2FR8A 2JD2A 4A5OA 3KB6A 1RM5A 2AEJA 1Z82A 4U8GA 1NR1A 3W8EA 3TFOA 4U5QA 4XYGA 1HXHA 2IRWA 4F6CA 4IQGA 1U9JA 4LRTB 3TZCA 3I3OA 3ZV6A 3RROA 2GO1A 3GVCA 4PVDA 4ROSA 4GVLA 1E0DA 4FGWA 2CNBA 2HMTA 3OA2A 3G3EA 2CUKA 2GRAA 3MJVA 4FFPA 4A27A 2VHZA 3VPHA 5JYDA 1LLUA 3JQ8A 1I36A 2FR0A 4ID9A 4YXFA 2Q2WA 3OQBA 4UUPA 4BO9A 1GYQA 1WZIA 2EEZA 4ILKA 4AL4A
chains in the Genus database with same CATH superfamily
3N0VA 2RKBA 1Y7IA 1ES9A 3V5NA 3FMVA 2FFHA 3WKBA 3TG8A 4BP1A 1OB2A 2HSDA 2HPHA 4KQ6A 1CIJA 1P2SA 1ZIPA 1B0UA 4BC1A 2QW8A 3CCBA 3AIIA 2X8BA 1RXYA 4RQAA 3INRA 5EJ5A 4XX0A 4RDIA 3AKYA 4ZV7A 5JH7B 4QUKA 1QANA 3NJ8A 5G1PA 4RK6A 2Y0BA 2SECE 3NHLA 1MXFA 2I7TA 2XNSA 4GW3A 3GG9A 4UHDA 3RVQA 4CM8B 4QBFA 4WN9A 2XNHA 4FE7A 4W5TA 1KI9A 2Q3CA 4M8SA 1LK7A 4QJ4A 1GPLA 4KPUA 1K66A 1CLUA 2FFBA 3GMDA 5HF9A 1ENYA 2GBIA 1X13A 5SZIA 2W5UA 2ZJ7A 4TRRA 2Q5CA 3C3KA 4NZYA 5DF1A 3S2FA 3GJ8A 4ZEOA 3BJIC 4WACA 4M1WA 5FORA 4UQLA 2O57A 2HA5A 4C14A 4KMRA 3GAAA 2QIPA 2IU0A 4WSOA 4R16A 3NDRA 1YR2A 3AHIA 4GPIB 1BVYF 3F5DA 4BLTA 1W8DA 2H08A 1L5VA 2EATA 3CLUC 3KEGA 4LPSA 4MULA 3BOSA 3C45A 3HN7A 2XUPA 1KERA 1PNTA 3ND6A 2Q27A 5EVCA 4DPMA 4XH9B 3CVUA 4GLLA 3PEUA 3PIDA 2NPOA 2BCJQ 3N07A 1LI7A 1VL5A 2BJWA 1RAHA 1TYAE 2YMMA 2IZ0A 1X8XA 2XQIA 3IKJA 1I4WA 4CMGA 4EY6A 5F3WB 3FJYA 3KOYA 3QM1A 3LV8A 1N8KA 4RKFA 4L5AA 4E5DA 4BS9A 3SBXA 2DWCA 4BIIA 4YLYA 1WUJS 4PVCA 1DFGA 5FUVA 5IJ9B 4WY8A 2C9OA 1CHDA 1EBUA 3AI2A 3SIRA 1TUIA 2PGOA 1QZUA 1M1YE 3N1UA 3PYXA 4C08A 2Q2OA 3ROGA 4AZTA 4O2AB 3IVMA 4UBKA 1NSTA 4KIGA 1P80A 2F1HA 3VO2A 3VV3A 2ODBA 5BXYA 2FOLA 3DMPA 4IQ0A 4TMWA 4QE3A 3RBAA 4LBVA 3TOCA 5JSYA 4NG5A 4JZKA 3LVBA 2D1TA 3ZHBA 3FLEA 2W2LD 4GXRA 3TGWA 4BDSA 2OBXA 3H0EA 2BFEB 5TE9A 1MA0A 1U7XA 4YMGA 4HAOA 4Z9XA 2O19A 4FYWA 4X97A 3X1JA 1KRHA 1DI0A 4H17A 3CC8A 5DN9A 3UEOA 3DL0A 3BL5A 4Q9KA 1ARZA 4JLPA 3P9XA 2DJ5A 4XTRA 1U9CA 1L4MA 2AOXA 3G82C 4TXHA 1SHKA 5E3HA 1UOPA 3IUPA 3AFIA 1J00A 1AB5A 3OFVA 3OCVA 4IV5A 5CMLA 1TYDE 1EA7A 4BFUA 2KQUA 4ETMA 2I0FA 5HF6A 2QTZA 2ZP1A 1XCBA 2ORED 4IXNA 4CIBA 1T9KA 3TL2A 2JDIA 2HAEA 3LCCA 3TNFA 4OK5A 3EN0A 4LYYA 4QGBA 2VAMA 3OM0A 1I0IA 2AD1A 4YB8A 4BL5A 5H02A 4S1NA 3CMMA 2JAXA 5KYVA 4XD7D 1P91A 5DWVA 1CF9A 1DKRA 1PFYA 3EIEA 3FX2A 3HI6A 3GLVA 3QV1A 3ZI0A 4PYLA 4G8CA 1OZAA 1E79A 2FEKA 3G85A 1M76A 3U5TA 2BBWA 1VE6A 2QTNA 4JJ6A 1SVWA 2ZRJA 5BVGB 1RC0A 3EWIA 521PA 1RFGE 2JGLA 2XB6A 5C5CA 3ZWQA 3BWEA 2WM9B 4Q3BA 1EFTA 3FSGD 3RVPA 1QHNA 5DXFA 3KT0A 3LX8A 3IESA 4JB8A 4PM4A 2V6JA 1YQEA 4QODA 3TQIA 3OZSA 3L8CA 1JEOA 1GXSB 3AEZA 3BORA 4DBLC 2J9ZB 4LRQA 2Q99A 4EFDA 1OTHA 4UZEA 3CCFA 4BECA 2YIMA 3CUSA 5HKLA 2TECE 5FD8A 4NYMR 3MJCA 3QMVA 4NESA 1UKAA 3PPIA 5TS2A 1C3OB 3R7WA 1GPAA 2WWHA 4W5NA 4DQ0A 6REQA 1Y3DE 3B9BA 2BP7A 1SOWA 3K4PA 1RYDA 3HVJA 3ROMA 2R4UA 1XQYA 1WX1A 5ER9A 4A8JA 3UG7A 1WQ4A 2QUBA 3KKEA 4W9NC 2FK7A 2H3EA 4JBWA 5DGCA 4C7VA 2YJ4A 3M89A 4ZVOA 4RLSA 2CYAA 1Y48E 1C4OA 3HV0A 1WJGA 2VRCA 4DJAA 3G0IA 1KWKA 3DTVB 4HEA6 4MP3A 2QL5A 3G9XA 2JGDA 2I1LA 3SSNA 1M0TA 4UTZA 2RGEA 3RAJA 1N7IA 3LQFA 4WNAA 5CTJA 2O3RA 2GPYA 4O25A 4Z6KA 2CJWA 4FHFA 3V4SA 2AT1A 4B40A 1H3EA 3LGXA 5EKDA 5CA1F 5AKHA 1BS9A 2IUUA 1CB7A 2O1XA 3T94A 4EO4A 5LBTA 4ZHSA 3AM1A 1ZN7A 2GARA 5FPYA 2O0JA 2Q3MA 1A9YA 4ZRNA 1VMAA 2DFVA 3E3NA 3KB1A 2PGIA 4W4TA 1Z6GA 1LLCA 1TE2A 2CHGA 4YO7A 1NNEA 3FZGA 1P2BA 4K03A 2R7LA 4YCCA 5KC8A 4YAUA 4LVOA 1EFRA 1VJ5A 1Q17A 1RXUA 3TI9A 4LDAA 1QRUA 1Q74A 3A9CA 5REQB 4E03A 1WXHA 3ZTWA 3E05A 2WTEA 4K5QA 2BGLA 3GR6A 3IQZA 3LZCA 4KXVA 2P9HA 3GNTA 3LCMA 1JT9A 1WHTA 1WW3A 4PWZA 3DLAA 2IXAA 4FDLA 4JODA 3FVVA 1XZEA 4Q9AA 1OV6A 2F62A 5AESA 2Z4TA 5CVVA 1H1LB 3EZ2A 5BW6B 2C54A 3MW8A 1P6QA 1P1KA 1Z12A 4IRMA 1Z75A 3EMKA 2H54A 1ORRA 3HUFA 4JJ4A 2W0SA 2W2VA 4QYMA 3HKCB 2XMQA 1U8XX 3C5VA 4ZJYA 1CQZA 1XMVA 4CKXA 1NN0A 3QXSA 2RC6A 4F5WA 1SUFA 1XU9A 2WFZA 4NENA 4OK3A 4OO3A 4RIGA 5CB4B 3I9FA 3IAS1 3KTFA 3MB5A 2CUZA 5B2ZA 3BSFA 3GOHA 2SCUB 2IA5A 3UJ9A 4A10A 2FWAA 4L75A 1YOVB 1ZIYA 3HZRA 2YJ3A 1G42A 1UXOA 3IQGX 5KJEA 3MWJA 4BLOA 1PUXA 3AUAA 2O8DB 2I6UA 1QFMA 3PVSA 3E15A 4X44A 2BHSA 1AO0A 1XTUA 3QHQA 3ZE6A 4Z53A 1NBIA 4J6FA 1MTZA 2WOOA 2C9YA 3D3JA 1FFSA 2FWIA 2FSVA 1V1RB 2CNDA 2H8KA 2IYFA 2XRYA 3L0CA 5KYYB 2CV0A 1OWNA 2X2FA 1G18A 1Y7LA 3I04M 1N9ZA 1YXMA 5EJAA 5EAIA 1FYFA 5JSHA 1ID1A 1KAEA 1KF0A 2Z5FA 3BQMB 3IUNA 3D6MA 1VLLA 1SK8A 3JWGA 2NSYA 4IMRA 4OPMA 2XKJE 4QUEA 1E7MA 5IAKA 1T5TA 3ROZA 4D9NA 4ENWA 1X7WA 4B6QA 3UJHA 4LV5B 1G9TA 4I9GA 2ZI6A 4QULA 1HH4A 3PDIB 4GQIA 2X42A 4UD6A 1SKBA 4AXBA 5DH9A 3CNQS 2D1YA 2OD7A 1X7YA 2FWNA 2X19A 3PQFA 3PWZA 4EABA 1YMQA 4A03A 3AG6A 5IS2A 2XSZD 3ORSA 3AW9A 1K27A 2VSNA 1E61A 2VZEA 1XAJA 5EPOA 4MAAA 4KR9A 4Z1OA 1GG2A 1TAUA 3QFRA 3M9XA 1EIZA 4K1XA 2DCMA 4YRSA 2JAPA 2WHPA 1NG1A 4LOHA 4Z49A 5ALZA 1Z2PX 2X4DA 1AK2A 2CLCX 3OKFA 5FTLA 1L8LA 1RI5A 2QP3A 4IIGA 2O06A 1T6XA 3NHWA 2EGUA 2GAFA 4N82A 1CDEA 2VAXA 5T4EA 3EJWA 3EPJA 2YNMA 1JDSA 1IY2A 1FTNA 2FUG1 1F8UA 2Z5LA 3QSGA 4H7EA 4N8SA 1SCBA 1J0XO 3RVDA 1QS0B 1T26A 4M1EA 1MENA 2QL6A 1II0A 1TD9A 1YJBA 1Z0SA 3QWFA 1XK6A 2UKDA 1ECCA 4CGZA 1W5TA 3U4QA 4LGMA 3NGXA 1YH3A 3AUKA 4I4TA 3IVCA 3QWIA 1AKQA 4BAZA 1NHGA 2BM0A 3WWPA 4X6YA 1FRQA 3SZUA 3PFKA 2H52A 3BAFA 4EH1A 4QU0A 4NCJA 5T4BA 3FPBA 1PNQA 5B3KA 6Q21A 5MDHA 4RJIA 4YAEA 4NYJQ 1XYYA 5JY6A 1A72A 5BWBA 5KO2A 1T0BA 4MCHA 3RS9A 4D45A 2XBMA 1CIPA 3ZBPA 1G20E 1HORA 1R64A 2RARA 3UVEA 1KFKB 2VJQA 3DFUA 4E07A 3K1AB 2P30A 1GGVA 3DPSA 2P62A 3K2BA 3KEOA 4IX9A 4FOTA 3EVBA 1JYFA 4Y0AA 2HB6A 3P26A 5LKAA 2I4OA 4EK9A 3HN2A 3DMHA 3T7AA 4MQ4A 1QIEA 3NONA 3P0RA 5BSHA 2F7SA 4DPKA 3V8RA 5FUQA 3ZJVA 1N0UA 3E61A 1R15A 1E1CA 1SCUB 1Z2AA 3FFXA 3KSMA 3RIGA 5BWOA 3QJYA 4BZXA 4EIWA 1OXMA 3KFVA 4AURA 4KPYA 2NAPA 3C3DA 3HU2A 5M2QA 4MQ5A 5LU8A 4XGRA 4AUMA 5I4KA 2GFHA 5TMPA 3EZ7A 3DBHB 3WLNA 4K87A 4PHTA 2B78A 1NOKA 3N2KB 4A0GA 4C87A 3DEIA 5AUQA 1DNPA 3PQ4A 4ZQCB 1MX3A 1H5QA 1PJCA 2CXRA 3VU8A 4II2A 1BOOA 4LYGA 1WUYA 2EBFX 1L0BA 1CQWA 2RJOA 3DF7A 3QVGB 3DWIA 4MW6A 3IUSA 2CF6A 3WLOA 3ZNNA 3KHSA 3IPCA 4ARSA 1F6WA 2AE1A 1TCCA 3CGWA 3OFJA 3GG2A 4DV3B 2RAPA 3THYB 3R24A 1Q5PA 5EMJA 4XM2A 3S1LA 5LWHA 3C8UA 4DMHA 4BPBA 4D80A 3CO0S 1Z2DA 3W2TA 3ZWKA 1F9EA 1Y9AA 5CHEA 1UH5A 1EUCA 5K3SA 3TM5A 1JX6A 3BE5A 5TEVA 4ZO7A 1BA2A 1M0SA 3VDXA 4YWJA 4C21A 4EO7A 4ZICA 1N2OA 1Y1KE 2WTXA 1UEJA 4FKBA 3FI9A 3EDMA 3ZU6A 3TW4A 2HLNA 3TLGA 2INGX 1LQTA 1DVRA 1MV5A 2GJAA 2P65A 1WPGA 3CX4A 3D0RA 3NDIA 3SQOA 3ZXYA 4ALIA 4GE3A 2BFAA 1BRMA 2G9UA 1JWAB 3GFFA 3QVJA 1A4RA 2PWYA 3NBMA 3WWYA 2OCPA 4KXYA 1LBIA 4F46A 3OZEA 4EP1A 1LFAA 1SO8A 2AFIB 2TYSB 3HJGA 1KY5A 3RSCA 4BQIA 3K8ZA 3CRQA 1AZWA 5K8JB 4RD4A 4YI3A 2DY1A 2HQOA 3W79A 1WQ1R 3RBZA 1E6LA 3BJRA 3U0BA 4EFLA 2QVXX 5B3LA 5E2AA 2Y1FA 1ZA1A 1DBIA 2YHIA 4Z8YA 1VOTA 2WSLA 2BKUA 3E9CA 3VYUB 2XCRB 1ESMA 3CRRA 1NYRA 2XYHA 1U8EA 4X90A 3WC4A 4ALKA 3AVYA 1L5HA 4O3MA 4M7PA 4OHMA 4EW6A 3S81A 3J81k 1E6UA 3B3AA 3CR3C 4REOA 1ISJA 1TC1A 2BBTA 1LJ8A 3EK2A 4Z4HA 3E35A 2UYOA 2V7XA 4R68A 4TKVA 2ZB3A 3W2GA 3ESRA 4B74A 1MC5A 1ILEA 1YZHA 1QQAA 3D1VA 3B1KA 3IKVA 3T3OA 4U7WA 2NPFA 1ZGHA 1V2GA 1XTKA 2ZWOA 3EJ6A 1YU6A 3ETCA 3HJBA 3KL2A 5IU6A 1OZGA 4ZJZA 1SGWA 1ZVKA 3FOAA 4OXKA 1J33A 4Q1DA 1GL6A 1I13A 3VNRA 1ZD5A 3H2GA 1T34A 1TLTA 1DC6A 4GX1A 3CJTA 2XRFA 4G9BA 1F8YA 1KMIY 4LDNA 5ICCA 4O02B 1XIVA 4QQKA 4UULA 2HX1A 1W9MA 4MLZA 4X1YB 4MUNA 4F1JA 3KKZA 4O59O 4D9HA 2IJGX 2IC5A 1K6EA 2FNAA 1BX3A 1DO2A 4BV8A 5LZ8A 4P3KA 5AJUA 3ZH2A 2AOUB 2G9VA 3OPQA 1XQ1A 4RL4A 3N2GB 3RTBA 3TLKA 3TOVA 4ZJUA 4WDQA 1HE2A 3O7MA 5JRZA 2JAHA 1QFZA 1X39A 3M34A 1QK4A 1XA0A 3OEHD 4WLEA 5FOWA 2I2DA 4KTVE 5K05A 4I1PA 1P5RA 3HSSA 2QRNA 2WF5A 4H4EA 3DDCA 3WOVA 4V3BA 1UBLS 2D2XA 4R1QA 3BDAA 3NTQA 3LTNC 1WOMA 4BP8A 4JXZA 5IAEA 1G60A 1KYWA 1FL9A 2YHUA 3URMA 4XKJA 2XPCA 3QU4A 1ZEMA 3D7KA 4LBZA 5M7EA 1AJEA 4M53A 4RJ2A 4ZAWA 4AWBA 1ZMBA 4Q16A 3STUA 3NP9A 2I55A 3WKEA 4DE5A 2R1VB 5EI5A 3EISA 3SQNA 1CP2A 1I80A 1UXJA 4DJEC 1OH6A 3ENVA 4OLHA 1BE8A 3HFRA 3RUPA 4IDFA 5CEEA 2O2XA 3P9CA 3NUQA 1Y5LA 1NR5A 3FCOA 4PTZA 5EMHA 2A1UB 1HTTA 2VDWB 2E21A 2OXCA 2A1TS 1OUMA 1E8MA 3JAWA 4I1UA 1E9BA 1R50A 1Y9ZA 1YI1A 1PGJA 2BMAA 1Z0FA 2R6JA 3F5QA 3G1WA 4IQFA 4M0CA 4XTCS 2WFLB 3SF0A 3G2LA 4KBYA 2VNIA 2XCSB 1DBQA 3VKFA 4CODB 3OZFA 2VZLA 1HR0B 5CG2A 2ZJ5A 4MPPA 2MCFA 2NZWA 1YR1A 1EHYA 3E9QA 4N76A 2R97A 1ESDA 1MVLA 4HDAA 4KQEA 3A9UA 4Z1MA 3GMIA 3MGBA 4UCQA 2MHCA 3MLAA 5C7OO 1YR9A 3GLHE 5T57A 4WOKA 4CV3A 2GSDA 2EJCA 1TTPB 5A3JA 1TXGA 1MP0A 3GF4A 2P2ZA 4LJ4A 2RHJA 3Q10A 3BRQA 3IAUA 4QM6A 1NBHA 1PV1A 3SZMA 3UXHA 2WWRA 3WFZA 2JGMA 2NT4A 2VJYA 4FCTA 4TS3A 3WTBA 3IV7A 4HRYA 1OYOA 3GJTA 3ZIAD 2ZS8A 3DB1A 2VPIA 3MEQA 4BMVA 4BNDB 4C7KA 4COOA 5AP9A 3AF0A 4WFQA 3RKSA 1IHPA 1CTQA 2D7CA 3NGMA 4F11A 5CDFE 1VTKA 1WOYA 3HKDA 2H6EA 3O74A 4INJA 3PSAA 3HDHA 2Q9AA 4Q3DA 4EF6A 5FOUA 2GTHA 4QWWA 1Z88A 2P40A 2W6ID 3RWOA 2OBYA 3A6ZA 3KE9A 1TT5B 1Z5VA 1MGPA 4PLFA 3UYLA 2HADA 2Q5QA 4QU9A 3I5YA 3ADOA 5DYIA 4RD1A 4A8JC 4AJOA 1R6UA 1G8SA 1EVJA 2QX9A 2IS2A 3NTRA 5K51A 2RFLA 1YRLA 3P96A 5KKNB 3BXGA 3KYDB 1SBZA 3IP3A 2A84A 4Q9HA 4ZVMA 1IFXA 4IJWA 4GI2A 4NZMA 2O5RA 1D2GA 1V5EA 4IJMA 1J9EA 5LN1A 1DQNA 4EKNB 1NQUA 3DZKA 1M2VA 1WO8A 4WLFA 2NG1A 4RMNA 3WGMA 1CRZA 4AMBA 1U3WA 4BX8A 5C8YF 3PA6A 4RK1A 2IHTA 4RY9A 4YLGA 6AT1A 3B7PA 3PLAE 4OP1A 1AQIA 3AY0A 1R2QA 1TPYA 2J6BA 4JLNA 3IALA 2RHMA 3NOVA 4B4KA 4DZTA 2PJZA 3TR5A 3AOGA 2Q3LA 1MDBA 2VBIA 3AF4A 3AUXA 3GEIA 3OJEA 4I8DA 2BR5A 1EKXA 1XI2A 3WGLA 4ZCQA 2JJMA 3AHEA 4O29A 3FFBA 1OFHA 2PUGA 2LGJA 2CFRA 2V7VA 3DTYA 1JJVA 2ZI4A 3NPAA 4C0WA 5F1PA 4AZWA 1LSJA 4Q37A 1Y1RA 4EDHA 1B8NA 2GK4A 4NS1A 4OQFA 5H82A 3SXPA 5KI6A 1OGJA 2CVHA 2LZ0A 3OTIA 3QU2A 5IW8A 4DRZA 5BQFA 1GJRA 3Q6IA 5AJWA 5IASA 3L7IA 5KOYA 1TMKA 2JFHA 3CB4A 3CONA 1W35A 1S4MA 3KEFA 1SFRA 2JAUA 1QYVA 3TUJC 1QYDA 3LFHA 1UWVA 3ONNA 5EZSA 1LRLA 1SZPA 1KFJB 2YOHA 2OD2A 1QPBA 2P9GA 4YAIA 5EL0A 4EHFA 1T3TA 4HHEA 1RJGA 3DAGA 4ECEA 1AKNA 1NPDA 1JKFA 3TSOA 3WDKA 4RHTA 1DUIA 1ZGCA 3H4VA 4YJDA 2H2HA 1AK9A 2HK8A 3K0FA 3TW6A 1HC7A 4HNAB 4WV3A 1QFSA 2ZW9A 2R8PA 3CR7A 3MAGA 1BGXT 3MSXA 1L9XA 1X14A 3MXOA 4J0DA 4KUHA 3QF4A 3OIGA 4ITVA 4PRZA 5JSZA 3IEPA 1TU4A 3GYGA 1Z0IA 1E20A 2RHLA 4MINA 2XNCA 4TQGA 2IL1A 3UFXB 3DE4X 3IC5A 3QLUA 2WA1A 4E22A 1T1EA 1WXIA 5CFLA 2FSVC 1QH9A 2LKCA 3T41A 3SXJA 3EQ2A 2BN4A 3GGJA 3KKNA 3P0EA 1QM5A 4HPJB 3B5IA 4I3HA 5C5IA 2P4EA 5E9JA 5CK4A 1FMCA 1KI6A 1OROA 2DCUA 1UT5A 4LZPA 1L7DA 1EYZA 1TA0A 3NPMA 2Y1CA 4IBOA 4M9CA 1XZNA 4ZANA 3PNQA 3OT1A 2QB5A 3B36A 3LPNA 4LZZA 1AGPA 1LW6E 3M9WA 4BX3A 2HU2A 1DEHA 1OD6A 1Z18A 2CL5A 5FLXA 3BB3A 1P45A 1V0JA 2IHBA 5B6PA 1J20A 1VSQA 1ZWLA 4EQ6A 2CDAA 4WL0A 3KV3O 4X1OA 1Z45A 2WPDA 4ZAYA 5BPFA 5CFPA 1ZZEA 2G17A 3TKLA 3UCXA 3CSUA 5C53B 3DEKA 3IQWA 1G2IA 4RJJA 4QXAA 3RIEA 2ZXFA 3MHPA 1FLNA 2C9ZA 4O2AA 3W2FA 4A8HA 4G4GA 3ZHSA 2C57A 4AY2A 4C6SA 5BNZA 4HGRA 2G9QA 3BDVA 4NRDA 1TMOA 1XX6A 5HOQA 5HF5A 5B58T 1PJQA 3TK1A 1X19A 3IQEA 3NEAA 4S0XA 2ROQA 3V8BA 1GR0A 2AI1A 5FPQA 3ZUGA 5BP7A 5K8UA 1WBBA 1FS6A 5K8LA 1XMOB 2NTJA 5EUMA 1T6YA 5BNIA 1N1GA 2DBRA 4JL8A 3AHDA 1E3SA 4JU8A 1B3BA 1GAEO 1BXGA 3FXAA 1VDMA 3RSGA 3T7JA 3GARA 1LD3A 4NMMA 3WOHA 2GBCA 5DK6A 2HIGA 2P3QA 4CTMA 5A4MS 3FF1A 1P1JA 4Y6SA 2ZCVA 3U3MA 3VR3A 4JT9A 3UN1A 4OHBA 3A32A 5LMNB 1OASA 3CUVA 3HR8A 4M8LA 1QQTA 2I78A 2JW5A 3AEXA 1OAAA 3B12A 1ZJ4A 1LPPA 2GNPA 2RGNA 3O31A 1ODFA 3LUHA 5JG7A 1K08A 4I6JA 3N7TA 3OOWA 1O97C 2QXUA 2EAUA 2QZPA 2Z08A 1NNI1 2WMOB 2HQBA 4GLJA 2WV7A 4G0PA 4U2DA 3L0ZA 2MSLA 3OTWA 3D3QA 2VYNA 4LQLA 2FSHA 3AERA 1JIUA 1MNQA 3DTVD 1R8SA 4FEYA 2RAUA 3EIXA 3K05A 2ECFA 4FLEA 4KAFA 2X7JA 2EIHA 4O33A 2C4HA 2DFKB 3NAQA 4U9UA 4XRRA 2BTQA 4CW7A 1JG7A 3QKIA 4YJHA 5TF4A 1BRTA 2ZDHA 2YFHA 3U2QA 1ICIA 4F4IA 2ZROA 1ZH2A 3AR4A 4WZ6A 4PX2A 3ZKWA 1YKSA 2Y9PB 4LMPA 4YIKA 5C81A 2COEA 1M7HA 4L5CA 8OHMA 5BPHA 1I8TA 3THWA 2F3TA 3LOQA 4TRMA 2WABA 2PO7A 1N8TA 4LYAA 4R8VA 1REQA 1EX1A 4LYFA 1L7OA 2Q4BA 4NBTA 3JQAB 4WK2B 5F2OA 1Y7TA 1OHHA 1ST3A 2W71A 2ZQZA 2BV3A 2IE8A 4NBWA 4P7GA 4MGIR 2OWEA 2W48A 1ZN9A 3KSRA 2ZIUB 5HBRA 3T9EA 4BWFB 1B2RA 5KMGB 4BXOA 4LCJA 2A9VA 2E4UA 4PQGA 4RA6B 3ETGA 1HEIA 2CLSA 3TSCA 4LJ9A 1VE7A 3KPUA 4ZYUA 1TTHA 5FB3A 2GPTA 4KFTA 1T0HB 5BV0A 2YKGA 1G21B 1ULTA 4UAJA 4YRZA 2PUCA 1RHUA 2D5IA 1ICEA 3S8MA 2ZIEA 4XIGS 4OQZA 1Q0SA 4JJEA 2WLTA 3CGGA 2O8EA 1W581 1OLXB 3DQQA 1VHQA 3FTNA 1PSZA 1T9HA 1XSEA 2QVLA 1Q7CA 4UPEA 2RGRA 2EJWA 4IHAA 3HCRA 2GF9A 3FW1A 4O4LF 5EHNA 3RRBA 3FN4A 3R77A 3KXIA 3U4HA 3QUTA 1KDOA 1V26A 3O5AA 1GGFA 1Q91A 5LL6P 4YCJA 4OHCA 4QQ8A 3RVKA 1SB8A 1E7QA 5JROA 3D4BA 4M6WB 4X3PA 3CNNA 5F9HA 3SEFA 1E7WA 4Z9AA 3PKZA 1U0EA 3R9KA 2DKNA 2QMEA 3T7EA 3BWMA 1VLVA 4PAGA 4DVGA 1N0IA 4G1UC 2A8YA 3M33A 2BMWA 4IIBA 2ZRBA 4TWZA 3UAVA 1Z15A 4D3FA 4Q93A 2DTXA 3B9PA 4BASA 2IV2X 3AVXA 4OQQA 2V3CC 1EK6A 2P3OA 2IF2A 2WTAA 4W7IA 3IE2A 4Y0VA 3IIKA 4UNRA 3B60A 4RTRA 2XE4A 4G67A 2R87A 4CNBA 4UATA 3D4IA 1I1NA 1P5JA 1U2RA 1NW9B 1WTCA 2F1JA 1IUPA 1B93A 1BMDA 2WNSA 1UINA 3D9QX 3EIOA 5AM0A 2AX4A 1IHDA 5ALIA 2P2NA 3ED5A 3PZBA 4I5EA 3V97A 4OJNA 1PFKA 2ZITA 5FHQA 3TW8B 6PFKA 2GN6A 4EW2A 1A97A 1O6GA 4OBBA 4RY8A 4UNNA 4X6XA 1FZQA 1MD9A 1SCNE 3SZ3A 4RADA 3ZWYA 4L8VA 2W42A 5JWOA 1CR0A 1X7HA 2AS0A 4E08A 2XF2A 2HPZA 2C03A 3LBHA 2E0IA 4FXPA 3OCXA 3U4DA 5EE0A 4PHFA 3T5DA 3UKOA 1RWKA 1U2SA 2C20A 3I5MA 1NJ1A 3ZD9A 1WSDA 2C8JA 721PA 3I12A 1U8AA 4WZAE 4ZT6A 1S8FA 3TINA 3E7DA 2ZE7A 5G4KB 1JP7A 1FTSA 2C78A 4GI1A 1K7YA 4J0EA 4UHFA 1VL1A 1YCDA 2Z83A 5GJCA 1R6DA 3L8HA 3P9PA 2KBEA 3L0BA 5JASA 5GGXA 3THSA 4PS1A 1SUSA 3F0TA 1NDHA 3K73O 3Q1KA 5IKEA 1CUWA 2XQVA 4DNFA 3ND8A 2ID4A 1SZDA 1NVKA 4FFBB 4EB6B 3FE2A 2XDAA 5DBEX 4HAYA 1YVEI 4H15A 2AJBA 5DNWA 3KVNA 1UDWA 5FL3A 3R5KA 4BJ6A 2FCAA 5SYAA 2DHQA 2YHAA 1SKYB 3HWWA 4EYKA 5FPSA 4LYDA 4TV8A 2P2YA 4Z51A 4ATNA 4EYQA 1BJTA 1N92A 1VBFA 3FCYA 3FPHA 1X80A 4RQUA 3Q3EA 3ZHVA 5AW6A 5KHLB 1B3RA 1IBKB 1MORA 5T4FA 3EVAA 3ZQKA 3RREA 3HRIA 3KBOA 3L49A 1ZSNA 4ZVLA 3TZQA 1RRVA 2FN7A 3CPHA 9ABPA 1Y4UA 1Z0DA 3HCBA 4P8RA 5HRAA 1X1EA 4P4TA 1U3FA 3DW1X 1ZM2A 1CUDA 1NL3A 2LIVA 2CXHA 1E2PA 4GPZA 1ACJA 1Q1AA 1LW7A 1O0SA 4PSKA 4DBZA 3S5JA 2VJCA 3GJZA 1CJMA 1EAYA 1FNNA 4D25A 4QSMA 1M2EA 1PP4A 4OGWA 3BGDA 4HL6A 4N39A 3UJDA 2H0AA 4BMPB 4ZMRA 1A8PA 2ZR7A 3TRJA 1XXHB 3KXDA 1TEZA 1RRKA 3PHBE 4ZCSA 3C6BA 1CRQA 1YHNA 2D1SA 2IEBA 3T61A 4DSZA 3NIDB 4QXPA 3EGVA 5C7LO 4ZJPA 1XU7A 2PS9A 2RAVA 3D6AA 1Q44A 3D7MA 2FXVA 4N03A 1Z29A 5LBUA 4K46A 1H93A 4TX1A 1WCIA 1SXIA 1C7EA 1MOSA 2ZIFA 1D0VA 3SU8A 1BXRB 1G1MA 2OO3A 1JEYA 3C1OA 1Z0UA 1T0JB 5AJXA 2JJYA 4XOIA 4LFBB 1A7JA 2IE0A 4HI0E 3GLQA 4Q3OA 2I2FA 3N8GA 3OU2A 4ZO9A 5CW1A 4XDGA 3R7BA 2QE7A 4ZPJA 1OTYA 2NZ2A 4GWLA 4AY3A 4NCBA 4E14A 3UK1A 4MVJG 5HQ3B 2XR1A 1SCUA 2FGJA 2DQYA 3ZZUA 4RTQA 1X74A 3RU3A 5JCXA 4N3AA 3HMKA 1YRAA 4F3YA 3SHTA 1RD4A 4V0ME 2NYRA 1KE1A 4LV8B 7AT1A 3WGIA 1OYWA 1ZIOA 5KYWB 4LDJA 1NOJA 3N3AC 1D1QA 3K6SA 3K96A 4W7SA 2H1HA 5DIFA 3CLUD 4G56A 1YIDA 1RMYA 4FW8A 3LO8A 1EK5A 1GKYA 3NWBA 3PXXA 2R66A 3ODPA 4MPTA 4RWEA 2PUWA 4R1UA 2M32A 1UJ5A 5CNKA 2VZ0A 3IE1A 5ALUA 1NQXA 3QGMA 3DDZX 2C98A 5ITVA 1HE5A 2QN7A 3I5XA 4V02A 4KKXB 1R4AA 1CR6A 4LF8B 1HNWB 1EZ1A 4JZYA 4BBPA 3DTTA 4B4WA 4BHTA 4Z4FA 2ST1A 4X84A 2WICA 3FR8A 2EKPA 3IILA 4UMDA 5HIJA 2B4KA 3PWKA 1VGVA 4GMHA 4KUEA 1HRDA 3SE7A 1AUOA 2IYRA 1JR6A 4QAQA 5EXPA 1XTJA 2H31A 2FHSA 5SYNA 2ZBVA 2IFTA 3BM5A 2H3HA 4XASA 4BGDA 5JBQA 3KQKA 2E87A 2Q46A 4CT5A 2YICA 1V9CA 3I5AA 1JYEA 4KLRA 4O4IF 4HMOA 4ZOAA 4EG3A 2EHJA 5L9AA 5MFPA 2HF9A 2CK3D 4CM7A 3R1IA 4DCPA 1ISIA 1C0IA 1CZKA 1L7QA 3FCXA 2BELA 2IIVA 1VE9A 3AGPA 3HVKA 3M6MD 4J16C 3ESBA 4BBAA 1OJLA 3KU1A 4CDNA 4YDQA 2ZYIA 2GYYA 3IAM6 1TYCA 2WTMA 4DXDA 3MC1A 2ES4A 3BULA 1QZZA 4NHOA 4GYWA 1OI7A 5T64A 3SLRA 3UJNA 4J0CA 1V3VA 4LISA 4LHZA 2NXWA 1JVBA 1C3JA 1XEXA 2FPSA 3ASZA 3MCUA 2P77A 4TXNA 3AZPA 1V3TA 3O9MA 4PLTA 3GPLA 3HYRA 1GG8A 4Y6GB 4JI6B 1SG6A 2YVQA 5C8YB 5HOEA 4CRWB 3D1JA 4QGHA 3RO7A 2UU9B 1A9OA 5J47A 3NASA 3ZWVA 1ML4A 1L5ZA 3EZXA 2P4HX 3NT2A 1NFRA 1E1NA 2E4VA 3LK6A 3MQ4A 4EB3A 3A06A 4DAOA 2PEZA 5J4KA 3PQ2A 1O1YA 3E27A 2H4JA 4H0CA 4LNAA 1ZL2A 1OF1A 1K8ZB 1XTQA 2A9RA 3PF9A 3FETA 3I42A 1PFVA 3HE3A 3EAQA 4EMSA 5A4KA 2C29D 5F98A 5HVNA 4K3VA 5CW2A 1T3ZA 1DT5A 5CBKA 3O4JA 1XGKA 2G1AA 1FDOA 1HE8B 4Q24A 4UDXX 1UDRA 1XVTA 2ZWIA 1TKBA 3H9UA 5FLYA 1QJCA 3A9VA 4PFSA 1ZXLA 2NZUG 3X1ZA 1IEVA 4HFNA 1P75A 3HPQA 3GOQA 1DQSA 1LTKA 3OCYA 1HDEA 3OP1A 3F6EX 1ZSVA 3HS3A 3P0HA 4CTKA 4WXYB 4J94A 4U2KA 1U8UA 1L4KA 4TXJA 1ECJA 2JASA 3F2IA 1NUPA 1I3KA 2A5LA 4TTIA 1IXRC 1MABB 4B80A 3ZDCA 3CWCA 4BUCA 1FMTA 1HZZA 2VQFB 1O7JA 3WBBA 4CQMA 5CA0F 3DZFA 2CB0A 1WWKA 3DMYA 4JUFA 4LY0A 1TW2A 3Q7IA 4HDRB 4TT3D 2OA0A 1WM1A 1N6IA 4BQFA 3FSEA 4YRCA 2QXYA 1E0KA 2DUMA 5DYNA 1QGDA 2EKZA 3D8RA 4MEJA 2VJKA 1XTTA 5IDVA 5JALA 4GGMX 1T3LA 2I4IA 3QUBA 2MIIA 1H9AA 4BQSA 1DC5A 2NZVG 1RLMA 4K6KA 4ZFNA 1ZOOA 4UZSA 3GT0A 3B1YA 3SX2A 2X5XA 2PDAA 4TLDA 3N8DA 4C9BA 4Z0TA 3UWKA 1DAFA 5BN5B 1QKJA 1XCLA 2VWQA 3FSRA 4HFRA 3TMAA 1T35A 3VZPA 4BZPA 2QYOA 3EGDB 3FFTA 5EUBA 2IUTA 5IKMA 1UIRA 2PLAA 3O1IC 3U44B 2P6PA 2YUTA 3FDIA 4CTJA 1A7KA 2ZU0C 3OZWA 2DETA 3IA2A 3KALA 1FU4A 1ULUA 1TM4E 3CNOA 4Q00A 1D4FA 3L79A 4RPIA 4XDHA 1NP6A 2WFLA 4P2BA 3SCZA 1DEOA 1GKIA 2VPQA 1NN1A 1T1RA 2NVBA 2OZVA 3L18A 4HEA1 4XARA 4C0JA 2ZTVA 1MR3F 3WAGA 3UUEA 5C37A 2VATA 4LX8A 2JKYA 4FCWA 3RNOA 2ZJFA 1EESA 2WIKA 3TW0A 1Z34A 1PG5A 2OORA 1EGQA 4WKPA 3E9MA 1SHTX 4MKIA 3R7NA 4RGBA 4HNTA 2VNJA 5CEJA 3GJRA 5KNDA 1L4EA 3C6QA 1J42A 4ZOCA 3L01A 3VHXB 1EXVA 1LDYA 4L28A 3D4OA 3FZEA 4EW1A 4Q4CA 9LDBA 4PQEA 4JC0A 2HCFA 1SVMA 4GMGA 5AW4A 2V5AA 3F73A 3E2MA 5GV8A 1FLAA 1L5SA 4R0VA 4D1YA 2RD2A 3TKAA 4J0FA 1I0LA 4V24A 4O2RA 2RB4A 2Z30A 3AVPA 2ZQYA 3DCIA 3JWEA 1UPUA 4UNSA 4EGCB 3PUYA 2G4VA 3S28A 3X1DA 1EXNA 1JAIA 3RTAA 3ZLTA 2C5FA 3VYVA 1E1RD 2CNKA 3QKWA 2P27A 5FADA 3IUBA 3WMRA 4IDPA 2FE4A 1GN8A 4ER7A 5IK2A 4QGAA 2AW3A 3CTMA 2RCYA 4IKOA 2H4WA 1ODTC 1CQPA 3IVRA 1D1SA 3LJKA 4COKA 4FSDA 5H4GA 2QSJA 1OQAA 2JFXA 5C7IO 1UBSB 1VPEA 1XRQA 3O3NB 5B53A 3D59A 2HLHA 3KP1A 3LFUA 5DISB 1V4VA 5IMBA 5KREA 4Y67A 3SJAA 1CULC 4GE0A 1J22A 2QG9A 1F0KA 1W93A 5EIBC 4R1TA 5LOVF 5KS2A 1CEXA 3LM8A 1MPTA 2CKMA 4CEHA 1OWPA 3NJRA 2A86A 3PC2A 3QVSA 3VNBA 4FKMA 5KYKA 1AUQA 5ELXA 2GUGA 2G1JA 3L43A 2QPTA 2YN4A 4R51A 3SYNA 4DMCA 4B3IA 2NO1A 2HMVA 4CKCA 1T5IA 3QYPA 3WJAA 4D4HA 4O1HA 5LNK1 2JAWA 3MINA 1ZD2P 4BLQA 1PYOA 2VUTA 1B6TA 2FW6A 4KDCA 4TUYA 4FUQA 3BERA 2ZRHA 5EWJA 5KKAA 2IU6A 3F9IA 3TKYA 3ZGXA 5FR2A 4BJ1A 4JXXA 1NLFA 4W5HA 5FBKA 3W8DA 5KDOA 1GA1A 5GJVC 4IH1A 1P1BA 5TXGA 2QLFA 1NPTO 1QDLB 4AWAA 1WKVA 2AYXA 2ZJ2A 1CZUA 5A6SB 2VTKA 2C4NA 5D51S 2EWVA 1Q84A 3QY9A 5JZOA 1Y6FA 1S2NA 3IMEA 5ES3A 1NE2A 2CCKA 2LTAA 5JY1A 2Q3BA 4MS4B 2J3EA 4ZTZB 1VMDA 2CJPA 2V98A 3M6VA 1ECLA 3TLEA 4AK9A 3ZNQA 4X93A 5JU6A 3OE4A 4PBTA 4EMBA 1ZR4A 3IB6A 3A9WA 4PLGA 1EGHA 5H16A 5A0FA 1JHRA 2EZTA 1G3UA 2Y1KA 3DMFA 1CE8A 3BGWA 4D4LA 3TNLA 2EG5A 4F5YA 3GLIB 2HUNA 2CNWD 2FVXA 2XGGA 4U7TB 2HYIC 4LOIA 2KMLA 2GZHA 4BX9A 1V8DA 1NZJA 2YBEA 4JIGA 6YASA 1EDDA 3EZLA 5KYTA 4LGCA 4NTZA 4E2FA 1IDN1 1XVUA 3SIWA 1K97A 1Y7PA 4YV0A 1D5CA 3IDOA 1P33A 2WU0A 1SK9A 3QNWA 4LA4A 1THGA 5DM60 4EJFA 2J0QA 4W8HA 3W3AH 1FRFS 4RYDA 3PD1A 4EY5A 2DY0A 3C3AA 2YV4A 5E0OA 1SUEA 3PHGA 1G98A 3RUCA 1O89A 1GUDA 3KQTA 4J1TA 4LXUA 4C1NA 1ADYA 3TTTA 1M34B 4YYZA 3WLIA 1GPUA 5HPYB 3ZVKA 1JECA 1DC3A 1XLUA 5BOSB 3QNUA 4IJQA 1FFXA 2IP1A 2O1EA 2YXLA 4J91A 4LOKA 4OJMX 3N2ZB 2VNAA 3AINA 3GFTA 1FU8A 2CBZA 3M70A 4L8YA 1JDPA 4YIHA 4RL6A 3G9TA 3OLCX 4CCYB 1VL0A 2GBLC 2V4MA 5JXGA 4MYSA 1TJ5A 1W0CA 2XZTA 4M4SA 3ZC3A 4ILKA 2UZ1B 2OL4A 5FL7D 3WRXC 2VWGA 1F1JA 3OAAD 4Z5XA 3RAFC 1ZCBA