1ISJA

Crystal structure analysis of bst-1/cd157 complexed with nmn
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
250
structure length
250
Chain Sequence
WRAEGTSAHLRDIFLGRCAEYRALLSPEQRNKDCTAIWEAFKVALDKDPCSVLPSDYDLFITLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKADSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bone marrow stromal cell antigen 1
publication title Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 87
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2001-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 1isjA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1isjA02
2EGGA 2X9VA 4MVJG 3S2FA 1ZK2A 2C2XA 4YYZA 2AQKA 1RM5A 2GYYA 1P31A 4I5DA 1RM0A 4B4VA 5HS4A 1H6AA 2NQ8A 3W6UA 1J4AA 2HMWA 2JHFA 2ZB7A 3K8ZA 3HUDA 4GBJA 2W8ZA 1XG5A 5TNXA 3DR3A 3P5SA 5G2OA 1PJ2A 3RSHA 3TJRA 3BIOA 1UXKA 4NIMA 2CZCA 4INAA 4HKTA 2AE1A 2FR1A 3DOOA 2CDBA 5DP1A 2JL1A 1PGJA 3E6AA 4MVJI 2X4GA 3E18A 4F46A 2VHVA 2I3AA 2ZATA 1T24A 3PGXA 3DMYA 2F00A 2FR0A 4HFRA 1ZZEA 4RVSA 4PVCA 4HX5A 1LDBA 4G2NA 3WJ7A 5L95A 4IXTA 2XPCA 3I6IA 1PJSA 2Y0CA 5CEFA 3PHHA 4HNHA 4IQ0A 3JQ9A 3EDMA 4XR9A 3D0OA 4DIFA 5CAEA 4EEZA 4O1MA 3VKUA 4PG6A 5JAQA 4PGFA 3EZLA 4II3A 4O63O 4UAGA 4DQXA 4MIOA 2Y1EA 4L74A 3WTCA 3MTJA 4HNGA 2GZ3A 3BMNB 4AL4A 2FR8A 3UF0A 2GRAA 4Q3AA 4CM8B 3GH3A 1ZVMA 5IN4A 4UVHA 5H81A 2Y1GA 2DTEA 5AYVA 4CM1A 1J6UA 4MKZA 5L45A 1LQUA 1OBFO 4JJIA 3DBVO 3HB4X 2O3TA 5ER6A 3A9WA 4MPDA 3QWHA 1HYHA 5TT0A 1Y8RA 4PG8A 4ZJUA 2AE2A 2PY6A 3H9GA 1IPFA 3BMCA 1LDMA 3W1VA 4A0SA 4Y6RA 2I66A 1E7SA 1Z7BA 3QRWA 2RHRA 4ZICA 3QVTA 2VTDA 5EMHA 1SAYA 1M76A 4D0RA 4BO9A 2P5YA 3QVOA 4MP3A 3JQBC 1P0CA 3VH1A 2VZ9A 3NV9A 1ZIDA 4YAGA 5IXSA 1PJTA 3LZ6A 1GCOA 4BO7A 4KMSA 2HO5A 4CLOA 5JAIA 2JKVA 5L4NA 4AJEA 5IZCC 1W6UA 3IAHA 3K92A 1PS8A 1MX3A 2H1SA 5JDCA 3FNHA 3JCZA 4FGSA 3WGIA 3ZU4A 3AM3A 1KVUA 1X1EA 2GN6A 2WYWA 5AXDA 1RJWA 4BNJA 3QY9A 4DA9A 3IL2A 4K26A 3ZW8A 1YJ8A 3C24A 1KC3A 1GYQA 2G0TA 2SCUA 3KEOA 2BGLA 4BNIA 1VRWA 5IG2A 4NU5A 5L53A 1LNQA 1KEWA 2B35A 2WD8A 4CV0A 4IDDA 4Y6PA 3BHMA 3PYLA 2WEKA 3VVCA 2DPGA 4BNHA 1XEAA 3CH6A 5DBGA 1V3TA 3FNGA 3GEDA 4D45A 3KM0A 4ZHSA 2VRBA 3ETGA 3H9EO 3AUAA 4CMBA 3NX4A 1VSVA 3ZWAA 3JQ8B 2DAPA 3PJDA 4JCOA 5B12A 4CLEA 3QJ5A 4WOKA 5T6BA 1P9LA 1B26A 3RVDA 4CLXA 1NHGA 3F1KA 3DXFA 3KYBA 4KDEA 1U7HA 3H9UA 2Q2QA 4R1NA 1Q7CA 1MG0A 4FBGA 2P9GA 4D3DA 4DC0A 3ZWBA 4L4SA 1U2GA 4GX1A 1B8PA 4WNCA 1X7DA 1AHHA 1GADO 3WOHA 1NFRA 2OMEA 4QUKA 2YV1A 4NFYA 3P2YA 4YT5A 5I7VA 5IN5A 4I5FA 2Y1OA 3C7DB 4PFJA 3VDRA 2EERA 3VZRA 2YFQA 3I5MA 2NLOA 4XIYA 4Z0TA 1MA0A 1E6EA 4IIUA 3B6ZA 3G1UA 4XKJA 4CM3A 4IXWA 2JFFA 1AN9A 5KJ1A 3UOGA 1M66A 1U3TA 2YUTA 5CDUA 1QR6A 1GV0A 2F1KA 4L8VA 1I3LA 3ITDA 4BGEA 1B8UA 2DFVA 1TEHA 2CF5A 2XAAA 3CE6A 1HZJA 4RL6A 4BNFA 1UXJA 4OJNA 1DIBA 1P1HA 4E5YA 5C3MA 5JO0A 4IDCA 3NTQA 1KC1A 1DIAA 1X13A 4ROSA 2PH3A 1EK5A 1D1TA 4ILKA 4GQAA 4TMFA 1XR3A 2EKLA 3KYCA 3GRKA 1YQDA 3GZNB 3WJAA 1EUDA 2EP5A 1TXGA 4OKIA 2YQ5A 3O4RA 1A7AA 2PZJA 2ZCVA 2J3IA 2Q1WA 2FP4A 3K73O 3S1LA 1UUFA 3PZBA 3RUIA 4Q9NA 3Q3CA 4B7UA 1UP4A 2GSDA 1B3RA 3AUTA 1R16A 3GGOA 3CMCO 2HRZA 5F1PA 1M75A 2AA3A 4NQZA 1ZMOA 3CUKA 4RCVA 1DIRA 1K0UA 2ZJ0A 1LQTA 2X9GA 3OQ6A 3ZNQA 3WNQA 1MB4A 4WLUA 2EKPA 1TVEA 4DLAA 2PLAA 4R3NA 4N5NA 2RCYA 2D5CA 4B79A 1NYTA 4BNLA 4WPGA 1HDYA 3V1TC 3JQCA 4J49A 3E48A 1O5IA 5KTKA 1W0CA 1YBAA 3NDJA 4BGIA 5L9AA 1L7EA 1GFSA 2VZ8A 1NPTO 1LC0A 1IB6A 4MOWA 3VPSA 2WSBA 1C1XB 1PJLA 3ROKA 4NHEA 3UW3A 1LX6A 3RAJA 2CF6A 2HSDA 2Q1TA 2C7GA 3MWDB 1XKQA 3H8VA 3QWBA 4XQCA 3RI3A 3V2GA 1HDZA 3MEQA 3OF2A 5DOVA 4MVJP 1YVEI 2C5EA 1BXZA 1PL8A 4NU6A 1E6UA 1N5DA 4IDBA 4WLVA 4BO6A 4RPLA 3PI7A 4AVYA 1HXHA 1HYEA 2HDHA 4BNWA 2PKQP 2VWGA 4WEQA 4J43A 5LDHA 3GPDG 2UDPA 4XJTA 2X23A 3DBLB 1E5LA 3JV7A 4RJTA 1CWUA 4WLNA 2VNAA 5TLSA 1YOVB 3RUCA 5JAZA 4H16A 2FZWA 3JQFC 2E82A 1K3TA 1G0OA 3GZ4A 3IJPA 2VHWA 1NM5A 4PLCA 1XDWA 4QEDA 5KJFA 1YDEA 3CPSA 1LTHR 3F4LA 3ZWNA 4OL9A 1Y7TA 1JWAB 1UAGA 3DZBA 2WM3A 3WXBA 4LMRA 3NRCA 4P8RA 1U5AA 2BD0A 1V8BA 3RUHA 2BFPA 3TWOA 5JAMA 2ZB3A 2RAFA 3BXXA 4W9NC 2GGSA 4IUYA 1RYEA 3RROA 1YE3A 2VOJA 5B4TA 2OOSA 1Z74A 2PKQO 9LDBA 2NACA 4JK3A 1JQBA 4YCAA 5AXBA 2PGDA 4PLPA 5TT1A 6ADHA 5JXWA 1ML3A 3RBVA 1TB4A 2QRKA 4O6VA 3PRJA 3RUEA 2JAHA 4E30A 3I4FA 3ZI0A 3V1YA 1E7YA 1VE9A 3N74A 2WDZA 4YQZA 5JPIA 2O4UX 4CODB 3WQRA 4WCFB 4CMCA 4TROA 1I32A 5AXCA 3RBZA 3VOSA 3WGZA 2DLDA 3OJOA 4NH4A 3FPLA 1KERA 1ZFNA 4BIIA 5L40A 4M1QA 2ZYDA 3VZQA 2Y67A 1OC2A 4A10A 1GY8A 1A9ZA 4Y8VA 1DLIA 3IUPA 4J1NA 2DTDA 3ZWXA 2O50A 4TKLA 3RKRA 3JQ9C 3TNLA 5EIOA 4QTZA 3PJGA 3EAGA 5COQA 4W82A 2NVBA 2HCTA 4D43A 3A14A 4NG5A 3JQEA 3NT2A 2OP1A 1BVUA 3RIHA 4ZN6A 1DDOA 4CV3A 3AUSA 4ZQFA 4I9HA 3SLKA 4U5QA 4CR8A 2VHYA 2C07A 5A9TA 1B7GO 2O3JA 5HBRA 3DZFA 2PGLA 1U28A 2BGMA 1C0IA 4YJFA 1WVGA 3IOYA 8ADHA 3W8FA 1XSEA 4LVCA 4YR9A 5IZCA 1MV8A 5ENDA 4B7CA 4DYDA 1A71A 1GUFA 1YB5A 1ZMTA 2GZ2A 1Z45A 5TS3A 1HZZA 3PPIA 1YB1A 4EZBA 2Q1UA 4BKOA 4Z6KA 4OH1A 3HJAA 4CM4B 4RLSA 3RJ5A 1XA0A 3PHIA 1GQQA 1UP7A 1DOHA 3KB6A 3KLMX 1RWBA 1YBVA 2QX7A 2UYYA 3WYBA 2WYVA 5L7WA 7ADHA 1NFFA 4UUMA 2QZZA 2W2KB 3DHYA 1PJCA 4E4YA 2V6FA 2AG8A 1R4MB 5TIIA 1HWYA 1GEGA 4QX6A 3ENNA 3IMFA 4FGWA 4JX8A 2EKQA 3WSWA 2I9PA 4F6LA 3JYPA 4BO5A 3FR7A 1P1IA 2FMUA 3CEAA 1I30A 3BMOB 1BGVA 2ZIZA 5HM8A 5I8ZA 3LLVA 2PV7A 1U3UA 3AM5A 4J3FA 3TSCA 4CMEA 2VNSA 5T67A 1ZCJA 1JTVA 2YFHA 3V1UA 4RPHA 5JDIC 2UUPA 2DT5A 3KZVA 4FJ1A 1UH5A 1HE2A 1R4NB 3T4XA 4D0SA 4KUEA 2NVUA 1NVMB 3W4KA 2FWMX 1WDKA 1E77A 1PZGA 4N54A 4JN6B 4L9RA 5CDTA 4E0BA 1OC4A 4C7KA 4QO8A 4RGBA 1T2DA 4PLWA 1PGPA 5G4KA 1GCUA 1V9LA 2VYND 3D5QA 4PZCA 4OXYA 1BRMA 3U5TA 4BB6A 5F5NA 3DL2A 3FNFA 4QQRA 2NV6A 4NDNE 1P45A 4PRKA 3WGYA 1FJHA 1LDNA 3FD8A 2Y68A 4KWIA 4BKQA 4RF3A 1F0YA 4NZ9A 4M89A 2C59A 3B20A 2VCYA 4NBUA 5FF9A 4BL5A 3F1LA 4MDHA 3PQDA 4NNJA 5DCUA 1A4UA 3DOJA 3VPXA 1UP6A 3GG9A 4XEHA 1HETA 4LCEA 5IF3A 3JQ7A 4TVBA 2YHUA 4B4UA 2PGJA 3GQVA 2AEMA 3FSRA 1N7GA 4IJKA 4E32A 5FWNA 1K6XA 5T8KC 4GMFA 3WBBA 1ZBQA 2NTJA 2O2YA 4MIEA 2Q4EA 3PFFA 2VZ0A 4EDFA 2H9IA 3SC4A 3LU1A 4X54A 5JC8A 3RC1A 3SJ7A 4DRYA 4PG4A 4YJHB 4YRBA 3WLEA 2A9FA 1DRUA 1ISMA 1I3NA 2J3KA 1H6CA 1VKNA 2VUSA 3Q11A 3F5QA 4DQVA 5ILOA 2JJYA 3L9WA 5IZ4A 2NNLD 4RQUA 4NFHA 2VYNA 4YEDA 3I9LA 4EJ0A 1F06A 1K6IA 5BSHA 1LRLA 4IZHA 1JN0A 1IYZA 3KYDA 5GZ1A 3R3SA 5CEJA 2JFHA 1GAEO 5CPBA 1HDCA 1EBUA 3HZZA 5L3ZA 1T25A 3SBOA 2GERA 2I3GA 4OSPA 1B15A 1Y8RB 4WGGA 2HK7A 1P0FA 1H9BA 1PR9A 1LDEA 2AQHA 2OZPA 4XX0A 3NEPX 1M2WA 3JQDA 2W4QA 1IL0A 1NBOA 1XQ6A 5HS6A 3OHSX 4XA8A 3UFXA 1E1NA 4BNMA 1ORRA 2BI7A 3FPCA 4RZHA 1HEUA 1B0AA 1CF2O 3F47A 3LSYA 3NDIA 1Y81A 3VAZA 1Y5MA 3ZV3A 4BMVA 2Y0DA 5DF1A 3DC2A 5T5QA 3NT4A 3R3JA 4YWJA 4MO2A 1F14A 2HJRA 4Z9YA 4CPDA 2Y99A 2V6BA 4RDHA 4UEOA 4R1UA 1CETA 1TLTA 1HLPA 2ZB4A 5EJ2A 2ZYAA 4MVJE 4CLOB 2D2IA 2Y66A 1DC6A 4F45A 2HU2A 4DBVO 4HFNA 3WR5A 2Y1CA 3QQPA 2VT3A 4R3WA 1DEHA 1WDMA 4OGWA 3BAZA 4J1QA 3PDUA 3VH3A 3AWDA 2QW8A 3KXDA 1VC2A 1VL6A 2B4RO 3H5NA 2O3RA 3AI1A 4YJDA 3FBGA 1E3SA 4O0LA 4MVJD 2AEJA 3NTOA 4WLEA 1MGOA 4PG5A 1NR7A 3X2EA 2VRCD 4TVOA 2VYVD 3LLSA 3ROPA 1ISIA 4PCVA 5DZSA 1VSUA 3DO5A 3U9LA 5JE8A 1KBZA 1ONOA 2A4KA 2IZZA 1M6HA 2OGUA 3DTYA 4BO3A 1ENOA 4BNUA 5KJEA 1PZEA 3DBRB 4J7UA 4PRLA 3SEFA 1B14A 2VWQA 3C7CB 4M55A 4ND5A 5THQA 1C14A 4Z3DA 3WIEA 1QLHA 2C82A 1C1DA 1PJQA 1H93A 2PTGA 4YACA 4D44A 1DFGA 3GEGA 2I76A 1HSZA 2EW2A 3OETA 3RWBA 2B5VA 4J6FA 3UCFA 1WLYA 3E5RA 4Z9XA 4FR5A 2FY8A 3E9NA 3W8EA 3BTVA 3HN2A 1BSVA 5I7EA 3K30A 1HYGA 5JMPA 3WMXA 1JU9A 1QYDA 2X5JO 3KSUA 3I9KA 4EUHA 4NBTA 2B4QA 3U3XA 3KTDA 4RVFA 3ON5A 1E7WA 2OORA 3CKYA 2X0NA 4W9NA 2O7SA 4J2OA 3RUAA 3WNVA 3WS7A 1SMKA 3KSZO 3C7AA 2GNAA 1ZXBA 1JW9B 3N7UA 5DBIA 3O8QB 5A5FA 1BTOA 2DPHA 3LK7A 4ALMA 3CZRA 4LRSB 5COAA 3ZCXA 1QYVA 3L07A 4KUGA 2DM6A 3NT5A 1P1FA 2IODA 5JY1A 5KJ6A 1ZXLA 2X0IA 1BW9A 5KCZA 3OEYA 4GSLA 1T4DA 4MVJA 4TKMA 3QSGA 4CR6A 1NPDA 3QWFA 3PP8A 2B4TO 2HMSA 1F17A 1MP0A 1PJ4A 1AE1A 1S6YA 2H63A 2VRCA 4FFLA 3VTFA 1XWFA 1SOWA 4M54A 2VYVA 4I9NA 2C20A 1I3KA 3QV1A 3PLRA 4E2WA 1NAHA 1LRJA 1Y1PA 3WG9A 2XXJA 3GLQA 3W4IA 4JLWA 5A9RA 2EF1A 4BNZA 1ZK0A 2FSVA 1K6JA 1CEQA 3DEYX 4PG7A 4EEXA 3GVPA 3ZV6A 4TRJA 2HJSA 3HADA 4AJKA 3ZWCA 1HKUA 3EUWA 5H82A 4M8SA 3BTOA 1N1GA 5FEUA 2Y1DA 3JQAD 3AK4A 4ZVVA 1KEPA 1NX6A 2DU8A 2X0JA 3IC5A 4B8ZA 1RM4A 4J0EA 4OO3A 5FI3A 4AJJA 3TL3A 1ZSNA 3WIDA 2CD9A 2P4HX 2WMDA 3RC7A 3ZU3A 4CUKA 3CZMA 3EC7A 3ZWWA 2P91A 4B3HA 2WD7A 2Q99A 2O48X 1MC4A 1KS9A 3S2EA 1EVJA 3QHAA 1S7CA 4DLLA 1EE2A 1IHXA 4YXFA 4WNIA 2OP0A 4D7AA 2BRUA 1C0PA 2PH5A 3PYXA 1A7KA 4FOOA 5JMWA 4C4OA 2ILTA 3O26A 2NTVA 4XD2A 5ILGA 3Q6IA 2CFCA 2H5LA 4HXYA 3OIFA 3RC9A 2BLLA 5MDHA 4YA6A 3LQFA 1JVBA 4MP8A 3S2IA 3PWKA 1HT0A 1Z82A 3WFJA 5B37A 4D46A 4CMAA 4BKPA 1PWXA 1KYQA 5B4VA 4R9RA 3VH2A 1R66A 2GO1A 4K28A 4IZIA 3M2PA 2E48A 2X6TA 4BV8A 1NQ5A 3R0IA 3QVSA 1GYPA 4FOSA 1VJ0A 2X5OA 5JDIA 2NU6A 1AXEA 5F3RA 3STHA 1MXFA 4L4RA 4CM6A 2UUOA 4CUZA 1N2SA 3OQBA 4CMHA 1T2AA 3JQAA 2J3HA 3FWZA 1U5CA 2GN4A 3R6DA 4E13A 2BGKA 1BVRA 1YL5A 1EUCA 4FB5A 4HFMA 2BI8A 5A9SA 1B3BA 3EMKA 3MJVA 5BR7A 5KKCA 3TZCA 3WGGA 3EZYA 5DBFA 3WYCA 1VL0A 4NMHA 1WWKA 3KETA 1LJ8A 5L7TA 1LXCA 3NYWA 2YV3A 3F9IA 1SEPA 1N7HA 4U0KA 3PVZA 1N9GA 3QIVA 1X7GA 1GR0A 3B70A 2VT2A 4U6QA 3KBOA 2JCXA 4N5LA 3TZHA 5IDQA 1G6KA 5MGBA 1MFPA 1DIGA 3GHYA 4WUVA 3RFVA 1MG5A 4CMEC 1H0KA 1QSGA 1NXQA 1ULUA 1OMOA 3LF2A 1V0JA 2EJVA 5EL0A 3M6IA 4OSOA 3DHEA 4RF4A 4OM8A 4IQGA 5AOVA 3LT1A 1PS0A 2Q50A 3ZWVA 1HF3A 5DNAA 1IHYA 5FI5A 3ZU5A 4CMIA 2D8AA 5KNLA 1IULA 3OJLA 2DVMA 3I9NA 3L6OO 4BS9A 1BXKA 5T8KA 3L77A 2BFOA 3WYEA 4IBOA 5IAAA 3O9ZA 4XYMA 3GPIA 5JY6A 4IJWA 4PLHA 4J0FA 4PN3A 5IFLA 4CLRB 1B2LA 3NTRA 1QG6A 2IXAA 8LDHA 3ASUA 3Q9UA 4WASA 5K6AC 3MJCA 3GGGA 3ULKA 1GEEA 2EV9A 2GN8A 3GHHA 4YDRA 1Z75A 3DB2A 4J4BA 1WZIA 4P4GA 1XHLA 3RASA 2YHIA 4W6ZA 2JCYA 2V6GA 4TSKA 2YQ4A 1U3WA 1GYRA 4Z0HO 4JP2A 2CNBA 4M86A 4UUPA 4IY1A 3QLJA 4UULA 5GMOA 3ZNPA 3OEWA 4JJGA 3AU8A 4XWYA 2VUTA 3KOUA 1M67A 3PEFA 5B1YA 2ZTUA 1N8KA 3AI3A 3D7LA 3ONEA 3JYNA 9LDTA 3NKLA 4BMSA 2FRDA 3IIEA 4GX5A 3ZHXA 3HDYA 3KLPX 5TGDA 5U1PA 3D64A 1JAYA 2VHZA 3AOEC 2PZLA 1HDRA 1X0VA 1O9BA 1NP3A 3SJUA 1XGKA 4ZQHA 1K89A 3S2GA 3NJ4A 4CMKA 1R15A 1ZKMA 5JYDA 1H94A 1NNUA 1LDYA 5A4DA 2WWRA 3QP9A 3R1IA 1EDOA 4XYBA 3PHLA 4H3VA 2Q1SA 1SZJG 2HUNA 1T2FA 4QXMA 4URFA 3F3SA 1JLLA 1BDMA 3PGJA 2X9NA 2J8ZA 3ETEA 4NJOA 1ISFA 1CRWG 2EHDA 1DBVO 3ZU2A 1QRRA 2E6UX 4IS3A 1WW8A 2CSUA 3RUFA 4QFCA 1ULSA 4AJLA 2JHGA 4EJMA 3JYQA 4R4JA 4YAJA 4BNVA 3I4CA 4CM8A 1E92A 4KP7A 3AFNA 4RF5A 4DWVA 4BNKA 1ONPA 3VTZA 3IS3A 5CP8A 2WE8A 1DAOA 1KVRA 2UVDA 4IGEA 1ARZA 3BHIA 2VWHA 4GL4A 5JS6A 3VPGA 4CQMB 1J49A 4JJFA 1ZJYA 1LSSA 2ZTMA 1EE9A 1CQIA 2QRLA 3H3FA 4J4HA 2X5KO 3AI2A 3ANMA 4Q3DA 4D41A 2EGHA 3UCEA 3ZWYA 3RKUA 3B1FA 2H6EA 1W8DA 4FDAA 1TT5B 1XU9A 3JYLA 4FFNA 1UJMA 3IKVA 2Q46A 3E8XA 1I36A 3Q2KA 5JBIA 1YDWA 3LC1O 4I08A 3RU9A 1DO8A 3OA0A 2GR9A 4GLLA 1NVGA 2YYYA 1EEHA 4E5PA 2ZB8A 4Z0PA 3DHNA 1SCUA 4WJZA 3GUCA 3GT0A 3OMLA 1HDOA 4XIJA 1Q2XA 3F46A 4OYRA 2HQ1A 1JWBB 1ZK1A 3DZGA 2ZQZA 1JVSA 1PGQA 1P77A 1W73A 1QYXA 3JQ7B 3S8MA 2I5PO 3MJSA 2I6TA 1E3WB 1PQUA 2DBVO 1QLJA 3EY4A 1PTJA 3H65A 4UVEA 1F8FA 3K2BA 4RQTA 4BNTA 1TA4A 3AJRA 3JQGB 4CLDA 2NADA 1WAMA 4BQPA 1EZ4A 4A7PA 3JQ8A 2OBYA 3GNSA 4IJUA 4R1SA 4MVJH 4D3FA 4LW8A 1DRWA 3OICA 4E5NA 1FDUA 2QYTA 4EITA 2D3TA 3ANLA 4BNXA 3DAPA 2BHLA 3GG2A 2IZ1A 4FJ0A 4PZEA 2Z1MA 1Y8QA 1BWSA 1Z7EA 4NFSA 3L0DA 2IYOA 5FFFA 3LT4A 3TF5A 5EESA 2IYPA 3I83A 3JD0A 1V3UA 1OZAA 4PLZA 1WZEA 1ZJZA 4R1TA 5DN9A 3ROQA 3WBFA 5JCJD 3AY7A 2C2YA 3MTGA 3ASVA 5AVOA 3P7MA 4XR4A 1PR3A 1IE3A 2ET6A 4ND2A 4K6CA 3V5NA 4ESOA 1DC4A 1YO6A 3ZH2A 5DCYA 4OMUA 4DL9A 1C0KA 1FMCA 1WMBA 4P4NA 1T2CA 1DAPA 1RM3A 1SB8A 3H2ZA 3EVTA 4CQLA 2E49A 3EVNA 3V8BA 4YJGB 1SEVA 2B69A 4EBFA 3WGOA 5C7OO 3HHPA 1ZSYA 3OIDA 7MDHA 4OAQA 4MVJM 4R5MA 4I5EA 2C7VA 4DIBA 5A1TA 1I3MA 1CDOA 5ICMA 3I9MA 2GUGA 4HBGA 1AHIA 2GDZA 1Q1NA 2BF7A 2X86A 3L4BA 2WYUA 1HLDA 3RQSA 3DQPA 4CM9D 3ICCA 4NJMB 4CMJA 5A3JA 2B0JA 3K5PA 3GZNA 4NK4A 3E5MA 4DPKA 5HWSA 1JKFA 2PFGA 4DMMA 4RF2A 2ZTLA 1ADCA 3GFBA 3KUXA 2I65A 1D3AA 3AFMA 5EINA 3F6YA 2X1HA 3DBHA 2WTBA 4OIMA 2CVZA 1YBMA 4HV4A 2NTNA 4IMRA 3UCXA 1L1FA 5JCJA 4F6CA 5ICSA 1KY5A 4FFRA 4JBHA 3HB5X 4IQ8A 1ENYA 4NBRA 4XYEA 3WTBA 2AMFA 1MFZA 4Y67A 4P22A 3KRTA 3C1OA 2VQ3A 3PXXA 4YQYA 4XQGA 3MJTA 1E7QA 4UVGA 4LISA 1BXGA 3DAFA 3FN4A 2P9CA 4IIVA 5IDWA 5DULA 4B4WA 5TRTA 3N58A 5TX7A 3VH4A 3OFSA 4HP8A 4PLFA 2E4AA 3GN2A 3HN7A 3L6DA 2P5UA 3ZNNA 2YDYA 3JTMA 1SO8A 3T7CA 3K9QO 3F5SA 4IDEA 1XYGA 3BA1A 4MIYA 1LLUA 1QXSA 2UV8A 1GZ6A 3FRJA 1E3EA 2OHXA 2VHXA 1UXHA 4E2XA 4RPJA 4S3MA 3X2FA 4EYEA 4J2HA 5K6AA 3SXPA 1FXSA 2Z1NA 4CM9A 3AU9A 4R69A 4B7XA 4BGVA 1XELA 2OL4A 3GNQA 1NAIA 3HDHA 1BW9B 4CUJA 3L6EA 5ENVA 1H6DA 2B36A 2NU9A 3BHJA 3DAGA 4IS2A 3NUGA 3AOGA 4J7XA 3LDHA 4RO0A 5DCWA 4Y6SA 1E5QA 4OQZA 3A1NA 4IDAA 2POQX 3I23A 1EQUA 2DBRA 3LT0A 1EVIA 3CMMA 1PU2A 4TZKA 1A9YA 1PL6A 3TOZA 1NWHA 2Y93A 3Q9NA 3K96A 4I9UA 3GVIA 1DIHA 1KVSA 1PZHA 1YQXA 3OJEA 4WK6A 1EFLA 3JD3A 1PS9A 2XXBA 2V7PA 1GDHA 1EBFA 1ZSVA 1YS4A 4G65A 4GWGA 4G5HA 3H5AA 1M6WA 1MLDA 3V2HA 6LDHA 3AOEA 4ALIA 3GMDA 4WEOA 5ITWA 2A35A 4BHTA 4GGOA 1RPNA 5KIAA 2PD6A 4J7CA 4BQRA 4HY3A 4OOEA 5GZ6A 3IQDB 3ZV4A 4K6FA 4TWRA 3E1KA 1B8VA 1QV6A 4K1LA 4R5HA 3U09A 5BNTA 3UICA 1IUKA 1KVTA 5IJZA 1KVQA 1ZW1A 3HDJA 2DBQA 4CR7A 4DGSA 3U0BA 5BSFA 3GUYA 4AJIA 1LEHA 2HK9A 3UGKA 3T7EA 2XOXA 1XQ1A 1E7MA 1JAXA 4DC1A 2IDZA 3WWZA 3OSUA 3BMCB 3MJ4A 2YJZA 1GUYA 4EW6A 5TF4A 1EFKA 3LC2O 4H7PA 1OOEA 3W4JA 4AJ2A 4QSMA 4BMNA 1I8TA 4YT4A 5JW6A 1CYDA 2X0RA 3K6JA 2NM0A 1DC3A 5BNIA 2P4QA 2EEZA 4FC6A 1PEDA 1R37A 2PZMA 5G0UA 4UUNA 3MWEB 1SC6A 1PJBA 4GLOA 2YDXA 1CJCA 2RHCA 4UVDA 1DRVA 4DIOA 4YAKA 5A5EA 5DT9A 1I24A 3C3XA 3D3WA 4O59O 1VI2A 3ST7A 4L76A 1YGYA 2BMAA 5BNFA 4KQWA 5HRUA 2IXBA 4N5MA 3F4BA 2XF8A 3GEMA 1DC5A 3CTMA 3QVWA 3OP4A 2GLXA 3RU7A 4TZTA 3DMTA 4W7IA 1PL7A 5H83A 3WQSB 2JD1A 2WJPA 1L7DA 3PJFA 1KETA 4DBZA 4JXKA 1ZEJA 4CM4A 2DFDA 3ABIA 5GZ3A 2AXQA 2GCGA 2Q49A 1GTMA 1WNTA 1N9GB 2J5RA 4KTTE 4XDZA 5K0ZA 3UVEA 1OI7A 2W2LD 2FPGA 3BMQA 3B1JA 4XB2A 1WPQA 3TZQA 5T64A 1JKIA 3LT2A 4WLOA 5AQ1A 5JFOA 2PZKA 2W2KA 5KKAA 4RDIA 1HE3A 3WFIA 4J90A 1QV7A 1R4MA 1H6BA 3GDGA 4CMGA 4ZRNA 4BV9A 1FK8A 4PLYA 3BMOA 3CIFA 1CQJA 2CDCA 3TFQA 4MKRA 2J5KA 3WWYA 4ZQEA 2IEBA 3W8DA 2B5WA 1I2CA 5DP2A 3LC7O 1UDCA 1Q0LA 4A73A 1DLJA 5G0SA 1D4FA 4ZQGA 3EGOA 1NQTA 3OJ0A 5L51A 3DZJA 1Z6ZA 2R00C 1YL7A 3BYZA 3ENKA 3OJFA 3HDQA 5THKA 4GKBA 4LCJA 3ONDA 2FHSA 2OFPA 3H3JA 3KSDO 3DZIA 5TJ9A 4E5KA 1OAAA 2C5AA 1VJTA 1OFGA 4XJSA 1U4OA 1ID1A 2A94A 3ZW9A 3GVCA 3D4PA 2AEFA 4AFNA 5AXAA 2IEDA 4UUOA 3FCOA 1TI7A 2WE7A 4II2A 4TRMA 3INRA 4QT0A 2W2LA 2E37A 2YY7A 3DTTA 3M1LA 2HMUA 1UDBA 1O95A 3AY3A 1WMAA 3BTSA 3ETDA 2C54A 2JD2A 1E1LA 5CG2A 4GSKA 1J0XO 3GMSA 1VJ1A 4K9DA 4A27A 5BQFA 1Y6JA 3G3EA 4F3YA 4PLGA 5J23A 3KYCB 1D7OA 4J4TA 4RLHA 3E9MA 3GNTA 4UEJA 1GD1O 1GL3A 1E3LA 4U6SA 4HFJA 4DQUA 5F1KA 1I01A 1LC3A 3NDRA 4M49A 2Q4BA 5I9LA 4BNGA 2EWMA 1R0SA 3UXYA 2GN9A 4LSMA 4GPD1 1Q7GA 4YJHA 3OIGA 5COBA 4ALJA 4XRGA 1O8CA 3WMWA 3INTA 5CDSA 5LC1A 1MUUA 3NAQA 1LLCA 1SOVA 4E21A 3COSA 3U4DA 4P4LA 2DUUA 4M87A 1E3JA 2R6JA 4ND1A 1IOLA 1Y9AA 3PJEA 3GAFA 1LLDA 4IMPA 4R54A 4FIZA 1WP4A 1ISGA 2Q2WA 1YL6A 4L0QA 1NR1A 3TZ6A 1DJNA 5G0VA 3DONA 4R41A 4J91A 4WCDA 5F1OA 1NTOA 4XGKA 1O94A 2LDBA 4YB8A 5BSGA 3C8MA 3L4BC 4E33A 3PK0A 3GAZA 1Y5RA 4KWHA 3TFOA 5F21A 1D8AA 1V35A 2BELA 1A5ZA 4D42A 1UR5A 4FD3A 4I5GA 1HDXA 2HLPA 2P2SA 1MC5A 1UZMA 2PD4A 3E9QA 1PGOA 2I99A 4J1SA 4GX2A 2RH4A 2FSSA 4XYGA 1HL3A 4P38A 4RPGA 2EG9A 4LRTB 3FHLA 5U9CA 4IINA 4CL3A 1ISHA 2NVWA 5CEEA 3QA9A 2CMDA 3KO8A 4BKUA 1PGNA 4ND3A 4EUFA 3WLFA 3JD2A 4N18A 3DZKA 3TRIA 3C1TA 3PLNA 3JD1A 3VZSA 3SVTA 1VKOA 2CUKA 1DSSG 2DC1A 1CIVA 3C1AA 3GFGA 1H9AA 1ZNQO 3IUSA 4FS3A 4GX0A 4JQCA 1O0SA 2AQIA 1XU7A 2HKIA 3QE3A 2VUUA 1EMDA 3E03A 4AG3A 1PIWA 1E7RA 2W90A 5ER9A 4OXNA 5JYEA 1YH3A 1I5RA 2FN7A 1VL8A 1P3DA 3PWSA 5G4LA 3VHRA 3GDOA 3RFTA 3G17A 3GRPA 3I3OA 2ZCUA 4FFMA 2X22A 3DBRA 2RIRA 1XLTA 2PR2A 3WSVA 2P68A 5KVCA 3LF1A 1I2BA 4WLFA 3RC2A 1X7HA 2JD0A 5JCXA 4WECA 1GQYA 5EQDA 2GD1O 5I9MA 3T4EA 3Q1LA 2I67A 3I6QA 4GH5A 4JGBA 4GMGA 3C85A 4FW8A 4KTVE 4KDFA 5ADHA 1HTBA 1LSUA 4OQYA 3NGXA 1LI4A 3ADPA 2ZJ1A 3GVXA 3GK3A 5ES3A 3I1JA 1N92A 1Y8QB 1KY4A 5EERA 3GF4A 3M2TA 4XDYA 1QYCA 3MCVA 3WX0A 5KVQA 4B8WA 2NUAA 3HQ4O 4MP6A 3GN1A 2X8LA 5B4UA 3O8QA 1ADBA 5CFZA 2BFAA 4PLVA 3OH8A 4HUJA 3PWZA 3PYMA 5DOZA 4ZRMA 4Y98A 2LDXA 1SBYA 1GPJA 1QORA 1Z73A 3PQFA 5G0WA 5CHEA 3ZWOA 4CV1A 3ICPA 5HA5A 5CG1A 2Q2VA 3D4NA 1YB4A 4BO8A 2FPPA 3PDJA 5BSEA 1P1RA 4CQLB 3VC7A 5A03A 3MZ0A 3EYWA 3VPHA 1FDTA 4XGNA 2GZ1A 5LCXA 4YJFB 4CM5A 2Y0EA 4AJ4A 4BOYA 3WDSA 4FC7A 3EHEA 4PLTA 4GKVA 4Z3KA 4A03A 4DXHA 1NQAO 2B37A 2BFMA 3G49A 3U62A 4YVFA 4CLHA 2A92A 3BMNA 5KWEA 2JCVA 3CXRA 4WKGA 2QIOA 4DREA 1X0XA 2YZ7A 1BHSA 3GC6A 4WCFC 3MOIA 1YQGA 3FR8A 3DBHB 4RPKA 1AGNA 4R9SA 3ORFA 3PZRA 1NFQA 3UUWA 2GF2A 4R16A 3BTUA 4HWKA 1LRKA 3H9JA 3WGTA 4DPLA 1Q0HA 3DFUA 3VZPA 3I9OA 3TQHA 5JO9A 1ZK4A 4RV9A 4E31A 1I2ZA 5A05A 4E12A 2PKRA 1RKXA 4LK3A 1BXGB 2D1YA 4LGVA 4ZQBA 3HWRA 3HSKA 1MXHA 2NVUB 3RD5A 2QZ9A 3L9XA 4A5OA 3QWIA 4Q3CA 3VKVA 3EW7A 1JDJA 5G4KB 4FPXA 5KVSA 1T26A 3DMTC 4Q3BA 2AW5A 3VPFA 1I0ZA 3ZNOA 2J5QA 5C7IO 4XQEA 4JBIA 2X7HA 3DOCA 5A02A 4JNKA 1EVZA 1T1RA 3WGHA 1PSDA 4CV2A 3P19A 2R00A 1W4ZA 1UDAA 1UXGA 1XCBA 4S1VA 5DDIP 4Z9FA 1BDBA 2HMTA 4AJHA 1UZLA 2ZKLA 5EN4A 4FSHA 1FDWA 2PNFA 2DKNA 3H6KA 2DBZA 4W7HA 1LBEA 2GASA 2HMVA 4WE3A 4IPTA 5GY7A 4EUEA 2EIHA 2ZK7A 3FF4A 5CDGA 2FZEA 4XB1A 4E2YA 3Q2IA 3UKOA 3O38A 4NI5A 4B3IA 4XCVA 4FCCA 1VM6A 3DDNA 3HE3A 3FBTA 4R01A 3M1AA 4HADA 3DWFA 3TZKA 5LDGA 4RVDA 3G1TA 3MOGA 1X15A 2O23A 2B83A 4DUPA 1GV1A 4Y9DA 1HE4A 4BO2A 1LUAA 5KOIA 2PWZA 4NBVA 1SB9A 1EVYA 4D79A 3NGLA 4ND4A 5JLAA 1SPXA 1YXMA 2HRBA 3AW9A 3IP3A 4O5OA 3RUDA 4GI2A 3PHJA 2VWPA 4ZD6A 1ZH8A 3TOXA 3ZV5A 3GOHA 4CLRA 3I9JA 3JYOA 5ITVA 1QYWA 5F5LA 5C37A 4W99A 3KYDB 1V3VA 2G76A 2Y1FA 3H9QA 3FTNA 1LLQA 3JSAA 1ZO8A 2W98A 4Q3EA 4ALKA 2AHRA 3ANNA 2AG5A 3B1KA 2VTEA 1NPYA 3RJ9A 1G1AA 1RYDA 3ZN2A 2V6MA 4W4TA 1PZFA 3HNPA 1R6DA 4DVJA 4Q3NA 3QVXA 1VPDA 2UAGA 4QECA 4FN4A 5BT9A 1ENPA 3IDSA 3RFXA 4FFOA 1R0LA 4YTEA 3PTZA 1UXIA 3INGA 3GY0A 1T1SA 1U3VA 2FOIA 4WOJA 4XQ9A 3TN7A 3D1LA 4TQGA 4DTIA 4B3JA 1FDSA 5JC1A 5FYDA 4MKXA 4B4OA 2IZ0A 1U8XX 1R12A 1KEVA 2P9EA 3OBBA 3PQEA 1AXGA 3EK2A 1HE5A 5L4LA 5EPOA 3IP1A 4CQMD 5TJHA 4TRRA 4AICA 4AJ1A 4CJXA 5I7SA 5K9ZA 1BMDA 1PWZA 4CM7A 4J1TA 4YRAA 3DFZA 1LU9A 1VLLA 1YWGO 3D3WB 4NBWA 4E3ZA 5T57A 5KVVA 3ROMA 2EJWA 4AJOA 3U4IA 3P2OA 4ALNA 1G0NA 1BG6A 1QP8A 4ID9A 3HFGA 3AM4A 3JQBA 4BVAA 2QRJA 1EDZA 4J9VA 4FQ8A 4Q39A 4BNYA 5L7YA 1E3IA 2C0CA 1LSJA 1R0KA 3GVHA 4DMLA 1HRDA 2QYSA 2ZTVA 4OKNA 2G82A 2ZQYA 4PIVA 2VOEA 2J3JA 3KHUA 4PVDA 3LVFO 4ZA2A 1C0LA 3FI9A 3H2SA 1LA2A 4MJLA 4IDGA 3VVBA 1GZ3A 1U9JA 3K2EA 2PK3A 4TRNA 3H5RA 1EQ2A 4L75A 3V2UA 2NSDA 2GPTA 1QMGA 3BMQB 1PQWA 3ITKA 3S55A 3WICA 1GZ4A 2EP7A 1C1DB 1IZ0A 1K5HA 5A06A 1ZK3A 4PZDA 1DFHA 1DB3A 1JA9A 2HAEA 3GR6A 4ITUA 4KZPA 2OBNA 4RZIA 1U1IA 4EJ6A 2NWQA 4DYVA 1AUPA 1NQOA 1UAYA 2Q3EA 2PD3A 3UN1A 5JSFA 5TQVA 4OXKA 1IPEA 4LVUA 4IGFA 5C5IA 3I52A 1P1JA 3WB9A 5JNLA 3HFSA 1C3VA 4GVXA 2O3SA 2O3UA 4GGPA 2RH8A 2X58A 1GPDG 3WGQA 2D59A 3OECA 3A4VA 4YBZA 4CQMA 1EK6A 2IRWA 3HG7A 4EI2A 2EXXA 4JP3A 5A3VA 4KQXA 3QW2A 2HK8A 3U49A 3FWNA 1JKJA 1A27A 1NWCA 3AY6A 5JDCC 3FTPA 1DPGA 1C1XA 1DFIA 1NVTA 1WXDA 1X14A 2JFGA 1K2WA 2QHXA 4U8GA 4AJNA 1TT5A 4AJPA 4BKRA 5I9NA 1T2EA 4IJVA 3MJEA 2IE0A 1O89A 4U0JA 4YAEA 3W6ZA 2CDAA 1GUZA 1ENZA 3DZHA 2D5AA 4NR0A 4H15A 3A28A 5U4QA 1YRLA 5CPFA 1ZUD1 3LYLA 3ZDFA 3ZHZA 1U4SA 1KOLA 1LDGA 4UREA 1I33A 4RVHA 2G17A 3DBLA 4LN1A 3Q0EA 1XIVA 4OOFA 4BNNA 1YOVA 3UH1A 2G1UA 1T4BA 3IJRA 2OXIA 3ZZNA 1D1SA 3SC6A 2AQ8A 4J9UE 3OQ1A 4DLBA 1FF9A 4R68A 3U4CA 1E3WA 4QO7A 1YKFA 4MVJF 3VDQA 4I8XA 5IDYA 1F8GA 1UZNA 3KVOA 3D5TA 3OA2A 1HSOA 4E5MA 4U7WA 1ONNA 1IY8A 1P74A 3JQGA 5IXYA 2NU7A 2TMDA 1HDGO 2O2SA 2TMGA 4D3SA 3PIDA 4IDFA 4XGIA 3E82A 2QQ5A 2BH9A 2YW9A 2WD7B 1EUZA 2QG4A 2NU8A 4MINA 4JROA 1KIFA 1ISJA 2O4CA 4ONEA 1H2HA 4UVIA 1ZEMA 2DUWA 3G79A 3TDKA 4A26A 4YT2A 5L4SA 4FJ2A 4DPMA 5CDYA 3ZWPA 1GU7A 4L4XA 4RVGA 3ZWMA 5TC4A 3AUUA 2D0IA 2CVQA 1P1KA 4WCFA 3ZGYA 2Y05A 1ADGA 3GA0A 1H5QA 4J16A 2V65A 4G81A 1YONA 4XZ3A 3SX2A 4YT8A 4ALLA 1J5PA 3KV3O 5I7FA 3PHGA 4A2CA 4N7RA 1O6ZA 1E1KA 4BO1A 1DXYA 3KEQA 4FFPA 4IM7A 4UEKA 4QFDA 5G0TA 3D3EA 1X1TA 1P33A 2YV2A 3ONFA 1SNYA 3CSDA 1A4IA 1E1MA 3JD4A 4YPOA 1N1EA 1DHTA 4XRRA 3UHAA 3UAGA 4KOAA 4JIGA 5TSDA 4LMPA 3RBXA 4RVUA 3JQ6A 4R51A 2FPIA 1B16A 1PX0A 3ADOA 2C29D 2J6IA 5A04A 3WQQA 1IZ9A 2O3QA 5EQFA 3ZHBA 4YJGA 5C7LO 1FDVA 3A06A 3JQAB 3H4VA 1U2DA 4EGFA 3QWAA 3IKTA 4E6PA 3BZUA 1A72A 3PIIA 2CY0A 4XYLA 1QKIA 5A9SB 2OO5A 4BO0A 1F12A 1WDLA 1TT7A 2Q45A 4NPCA 4NK5A 3G0OA 4BO4A 4YRDA 3RCBA 4GWKA 5HTOA 3GGPA 3NJ8A 4CL8A 2PA3A 4NJMA 3O03A 1CERA 3U4HA 3OM9A 1NASA 1U8FO 1LSOA 2DQ4A 1U7TA 4I1IA 4BUCA 4YAIA 1DHRA 2O7QA 4L73A 3TL2A 2D4AA 3SLGA 4OHUA 3TPCA 1NHWA 4ZGWA 4CMIB 3FNEA 4E2ZA 1H2BA 1GQ2A 5IDXA 2Z95A 2R2GA 1Q7BA 4JBGA 2JAPA 3CINA 3L4SO 2Z5LA 1Y9EA 2EW8A 4RORA 3GDFA 4GAEA 4GVLA 1YJQA 2DTXA 4LSWA 1E0DA 1V6AA 2ZYGA 1KEUA 1I10A 1P44A 3ZHYA 2NQTA 2OUIA 3JQFA 4BGUA 4ZU3A 4C7JA 3D4OA 2BKAA 3PFWO 2CVOA 1PJ3A 4BB5A 1ADFA 2RBEA 1R4NA 1E6WA 2VN8A 4KUHA 1DJQA 5KJCA 1Q0QA 3H7AA 5I8WA 2G5CA 3K31A 2YHIB 1PQPA
chains in the Genus database with same CATH superfamily
1MHTA 4XD7A 1T9GR 4AWAA 2FMTA 4YYZA 1BS1A 2ZUFA 5C81A 5DGDA 1OIXA 2PKXA 3MRVA 1RM0A 3P0HA 4I5DA 2WJVA 4Q7JB 4Z8YA 3VOAA 3ZLBA 2AYXA 2PT7A 3V4PB 5EEGA 1MW8X 3P0IA 3QYPA 2VJBA 1W36C 4JUFA 1JSLA 1RTTA 1ZQ1A 5JWHA 2Y1LA 3EVGA 5B7NA 1ZRSA 3F97A 2FPWA 2W8ZA 5CA1B 4MI3A 2J4CA 3PD0A 5BQ3A 5ALXA 3K32A 3ZVLA 2RCNA 4JB2A 1UXKA 4NIMA 4V0LA 2FR1A 3R9IA 2PVPA 3DOOA 2B3TA 2CDBA 2RONA 2JL1A 3DQQA 3BRQA 3E6AA 3OE5A 4MVJI 5DP1A 3EX7C 1RAHA 2YZNA 4XWTA 3R3UA 1WUTA 2W0SA 5EWMA 4A9AA 3OHMA 2PZAA 5CU7A 4Z1MA 2WB2A 1I2DA 1F20A 1E20A 3G9TA 3I62A 2ZATA 4K88A 1HMYA 1WQ3A 1C9JA 3AZQA 4BMCA 4EMBA 4R9NA 4HFRA 1ZZEA 2W4IA 1MIHA 4PVCA 4HX5A 1N6KA 4D0NA 4MWCA 3BB4A 1KU6A 2OSVA 1JJFA 4EG7A 5KQSA 4B48A 4BKMA 5EEHA 1A2BA 2Y1WA 3CW9A 4BTLA 4OSEA 1ICIA 4KK3A 4HVLA 4XR9A 2DJ5A 3G2LA 1W0JD 4EEZA 2MYPA 3F5FA 3HKCB 1ZISA 3GFPA 3QPDA 4O1MA 3O90A 1M2KA 1IUNA 1UBEA 2WZCA 3EZLA 4II3A 4UAGA 5T3UA 4DCUA 1XMQB 2ATIA 1L5HA 4R71A 2Q3CA 4BTEA 3MTAA 3NM6B 2YINC 3QPWA 2HU8A 2WFAA 4ZALA 4HNSA 4S24A 1Z28A 4HNGA 1K0FA 4YRTA 3BMNB 4D98A 5K0CA 2YIDA 3K0FA 2VXYA 5LKAA 1O08A 2FR8A 1CUDA 1X19A 4U02A 3DD1A 2DT8A 3Q6NA 3TCKA 4Q3AA 1ZVMA 3AF1A 2F67A 4YHBA 3UJPA 5J9FA 3WBKA 5IP5A 2OHFA 4IHJB 3PFKA 2AH5A 4L9WA 3HI4A 1RQXA 1I6MA 4JJIA 5AJHA 1MO6A 1UBCA 4ZJUA 4ZHQF 4PG8A 4COOA 2TSYB 2PY6A 3CVOA 1DBRA 3H9GA 4JY7A 3BMCA 4JUDX 1LDMA 3A1DA 3W1VA 3CEMA 1N8NA 4UNSA 4EJSC 1KI3A 1E7SA 2GZRA 2YWBA 2UZ1A 1P73A 3L2OB 3QRWA 5FO0A 2CXOA 4E5VA 1W30A 3QVTA 1FU7A 3PHBE 2BJVA 2C9OA 2R1ZA 3O2JA 5D1NA 1RBYA 2L18A 1O1YA 4DSZA 5BMOA 3SK0A 3I28A 3QVOA 4BO9A 2WQ6A 4M9QA 3GGCA 2EFJA 4WH0A 1KO8A 1ZNZA 2IHUA 4XASA 1D2RA 4PXYA 4QUGA 5TQ2B 4OMCA 2ZDQA 2BEUB 5CA0A 1ZJ4A 1U28C 1GCOA 4ZJPA 5BN4A 2QLTA 1SBZA 2OD7A 3HA3A 3HA7A 3Q6MA 4D9NA 2L19A 5L4NA 1ULZA 3ILSA 5F1YA 3UMRA 1U7OA 3BD7A 1HZZC 1NN1A 5CB4B 3I9FA 1JSZA 4I1RA 1DQYA 1NBME 1VE5A 2OY0A 3O0TA 1JBKA 3FNHA 3OM0A 4DRXA 4WAUA 2ALJA 4MJ7A 3AM3A 2IHZA 3W8RA 1GGMA 1PR5A 2GN6A 2VI5A 4HMPA 1V5EA 1RJWA 4R2JA 5AXDA 3OD5A 2BMWA 4R05A 4BNJA 4EFDA 3C4QA 4MJ3A 5H3CA 2OQ2A 1LVUA 3C24A 1UKYA 2IGTA 4ESVA 5C8ZA 1EIZA 1JFRA 2G0TA 1S2NA 2SCUA 3KEOA 3TCNA 2K2QB 3DFMA 3L7BA 1E60A 4Z4EA 5L53A 3I30X 3OZCA 3TLJA 2JGMA 3LPLA 1UJ6A 1PKXA 4Y6PA 3VO9A 3U39A 3BHMA 3M33A 4DG5A 5MGNA 3VVCA 5DNCA 1HE8B 3H18A 2CWWA 4BNHA 1XEAA 1RLJA 4C07A 4HZUB 2BMEA 3GEDA 1SD1A 1USWA 3KM0A 3TD6A 2VRBA 3QBJA 1QYRA 1USUA 2XWQA 3AUAA 1FUKA 3NX4A 1XVAA 4Y1RA 5ECWA 4CKCB 4C7OA 1RS0A 2GDJA 2FOLA 4DG8A 5E3JA 3RPEA 1RZ3A 4QVGA 3KJEA 4CLEA 1SXQA 1ZVJA 3K0KA 1IN6A 1ZUWA 4N0PA 1B26A 2XUPA 4RACA 3RVDA 4E88A 1V11B 1DXHA 2YV5A 3GLHB 4UE2A 2HGSA 3CZQA 4EZEA 1U7HA 3H9UA 1A76A 4UJ3A 3GCGA 5ECYA 2Q2QA 3R5XA 5K8VA 1FMJA 2L2QA 1FFHA 3MLAA 2XRFA 4Q7QA 3ES9A 1TL7C 3KKQA 3QV2A 3X1ZA 3ZWBA 4EYKA 2FTKE 1U2GA 4GX1A 4TZ6A 1B8PA 1EDEA 1XDSA 4WNCA 1OA1A 1W6RA 1L5QA 2DSNA 2ZVQX 1AHHA 1P5RA 2O8VA 2VCHA 3BJEA 3HV2A 3LGSA 4KGZA 2WF5A 5I45A 2J31A 2YV1A 1R27A 4P4UA 2V5UA 5SYNA 2F3UA 1UC5B 3E7PA 5L6MB 1Z8NA 4BAGA 3PKIA 4PFJA 4LQDA 1FFWA 1HLFA 4KVZA 3FTCA 2J3MA 5DPMA 1NKTA 3C3EA 3LBIA 4GKKB 5JAUA 3I5MA 3V1LA 5JRJA 2XIQA 2P5TB 3WDLA 2FZCA 4IIUA 1ULTA 2I2WA 1CT9A 2JFFA 1BJRE 4IXWA 1AN9A 4TTPA 5HFAA 2XCIA 3ZE6A 4D9CA 4UOZA 5JADA 3MXTA 1W0KD 1QR6A 3QUQA 1X9GA 1S5PA 3ZVNA 1GV0A 1TU4A 2XY4A 1QHFA 1I1NA 5AW9A 5LA6F 3VR5A 4B3FX 1OGJA 1Z6PA 4TLAA 1D2AA 3T3MB 4DA8A 1TEHA 2CF5A 1Q92A 1HZJA 4RL6A 4BNFA 1UXJA 4HH1A 5BYKA 1U3CA 4CT4B 3OQMA 2JLCA 3MVEA 2A9KA 1MOSA 2DE0X 1NLZA 4Z2YA 3NIBA 1M72A 4QBFA 2OKGA 2BCJQ 4IDCA 5JO0A 1U7UA 1O57A 4YTEA 1KC1A 4GQBA 1RWXA 2EIXA 2ZUVA 3OCJA 4ROSA 1RZRD 3TUJC 3NMUF 1XLUA 4GQAA 1JI3A 4TMFA 1XR3A 3HBAA 2J45A 3P26A 1L5RA 1T8PA 1ZJ6A 4QG7A 2Q7OE 3ZTYA 5I7WA 1E1CB 2EP5A 1AZSC 4BCBA 3B1WA 3D1VA 2B20A 1A7AA 2C8KA 4AX8A 3WMRA 4K6MA 1NBAA 5LBTA 2J3IA 5ALNA 3MYYA 2Q1WA 1CUSA 1AQJA 2ZR7A 3AZOA 3CUVA 4KQKA 1GU0A 2YJGA 3I01M 3S1LA 7REQA 3O8NA 4KR3A 4I1PA 1N8SA 2Y4NA 5TPWB 3AJDA 3ZXYA 4B7UA 2EX4A 3GLFA 1B3RA 3OQNA 2Q07A 1VBNA 2CMGA 5M3BA 5AFSA 4G4JA 2Y6UA 1LVGA 2VP4A 3MELA 3AEUB 1XCJA 4OHXA 5TMPA 1VKRA 3P0JA 4KJZA 3DO6A 1M75A 2QPOA 4QGSA 3CUKA 1C4KA 3FWKA 3HL4A 1GSIA 1XEXB 5DASA 1QF6A 1CUWA 4LOIA 2VAWA 4Q6WA 4HWGA 3J81k 2XMQA 4WLUA 2C58A 2EKPA 1T36B 1V8OA 4LOAA 4CIYA 3P9ZA 1TM4E 1OYOA 3IBFA 1GNLA 3O4GA 3EG9A 1WY5A 2JAQA 2PGXA 2QQGA 2RCYA 5A0TA 5ALFA 3BJIC 2ZPAA 5IVHA 2ZYIA 1P2TA 3FPJA 5JG7A 3DP9A 4BNLA 2P1RA 3Q8XB 4RVOA 1BX0A 2B6NA 3UJHA 1OX6A 3FDJA 1ZQ9A 2QU8A 1O5IA 1T2NA 2RHJA 3PC7A 1OLOA 1PLLA 1W0CA 3CNQS 4LHSA 2XD4A 5KTKA 5EUQB 3NDJA 3ZDBA 4TQ9A 4M1MA 3B38A 3L93A 3II6X 1GFSA 4OHFA 3FM9A 4TLEA 3STXA 4V2UA 1LC0A 5GONF 6YASA 1IB6A 4MOWA 1JKJB 2C31A 4NBLA 1PJLA 4N40A 4NHEA 1SUCA 1JPJA 3SXUA 3STUA 3N8KA 4BC1A 2HSDA 5IBCA 2XMZA 3MWDB 5FL7A 3G9UA 4G1EB 3V2GA 4ENQA 1HDZA 4I7EA 3MEQA 2FI1A 2H2WA 1GN9A 4ER6A 1BXZA 1PL8A 3SZGA 2WTEA 1DG3A 5FOWA 3CUEF 2H0AA 3PI7A 3TM5A 1HFKA 3CEPB 5J40A 2BEVA 5BSVA 3I1FA 3QU2A 3IDFA 3RF6A 3H97A 4AY2A 1NVVR 4XJTA 1GPYA 2X23A 3JV7A 4F4CA 1PKEA 3FGPA 4RJTA 3AWIA 4GYKA 4BFTA 2FWJA 2VNAA 5ES4B 4PCLA 8AT1A 3GGDA 5TLSA 1TJNA 1UM9B 1ILEA 3RUCA 1E2NA 3GFVA 4JQZA 1Y63A 4HDRA 1QPBA 4Q9KA 6AT1A 1THMA 1QOQB 1RZUA 1G0OA 3QBVA 4G26A 3GZ4A 3PHCA 1YJBA 3LI2A 1JDNA 3F7MA 1S1MA 1XDWA 3W9YA 1RPAA 4D4KA 3WLPA 1QZXA 4F2GA 4QJ4A 5JV5A 1H23A 5LQAA 4HDNA 3B12A 3UOAB 1JWAB 3THSA 4DGQA 3NR2A 1KJQA 3L0YA 4WK4B 3UANA 2TRSB 3CQ9A 4OHCA 2PUBA 1J24A 4P8RA 3E1GA 3KT8A 2WJGA 5BOVA 2PBFA 3BXXA 4UTZA 3OLYA 3PNBA 1P29A 4LHXA 4F06A 6GPBA 5FULA 5EKXA 1NQUA 1YTLA 3JWPA 2K2WA 3TRJA 3E9EA 4JC8A 1P4SA 1TEXA 5JCZA 1YE3A 2B98A 2VOJA 3AESA 1UBFA 1Z74A 2OOSA 1Y3HA 2P0YA 1SA0B 1BCSB 1OROA 2NACA 2PKQO 3TLKA 3GA7A 2ZREA 4DG9A 1P9NA 1NULA 1TAUA 4O6VA 5G40A 3Q7RA 3ZI0A 1E2UA 3AVOA 1E7YA 3PDCA 1VE9A 4JYBA 3N74A 3USCS 1I1QB 4ZCTA 1YR3A 4CODB 3QM1A 1CJMA 1JA0A 4N47A 5AOAA 3RBZA 3CVVA 3VOSA 3I8SA 3U7IA 1MTOA 1ZFNA 2AVNA 4M1QA 2ZYDA 3COWA 3VZQA 1GY8A 2N75A 4P53A 1E4VA 4HH4A 5HJ7A 4G1UC 4ZEXA 1IN5A 1JKXA 2IQ5A 1H66A 5GGXA 3ZDAA 1NSYA 4H7IA 4NSNA 1RI4A 2O8DA 4GP7A 5EIHA 1RE1A 2ROQA 2R7AA 3JQ9C 5EIOA 4QTZA 4EJSA 1FY2A 1S02A 2HCTA 2D2XA 3ANXA 2GCIA 5BWOA 1JPVA 4OQFA 3JQEA 3GIDA 2OP1A 4QPDA 3RIHA 3TQFA 1DDOA 1TO1E 1VYHA 4BC0A 4YNBA 1V8DA 2KE5A 1V6SA 1E9FA 1BCRB 1TK3A 1PYDA 2IDKA 1KI2A 2P8JA 3AV0B 5CLQA 1NMEA 2YWFA 3TX6A 3N07A 4UCXA 2XUHA 1U28A 3QNUA 3IPXA 4YJFA 4JKIA 1ST2A 3DA8A 3A1VA 3GQBB 5I7AA 3R7NA 1NTRA 5IS2A 2H00A 1WV1A 1ZOSA 4L9AA 2NPIA 4A5SA 4YR9A 4NZZA 1A71A 1GUFA 1ZMTA 2GZ2A 2IPNA 1JQDA 5TS3A 1HZZA 3PPIA 1YB1A 5CK5A 5GIOE 2JFNA 3VM6A 1B8NA 2FEMA 2MINA 4NOJA 4QLAA 1E8NA 1UM8A 3AR6A 4O08A 5AP9A 4J75A 4CM4B 4RLSA 4JV5B 4AW9A 1V9SA 2PKYX 1OZ0A 1GQQA 1LH0A 1TC1A 4EYSA 3K0EA 3WLOA 4AI6A 4CU2A 1MEEA 2CXNA 4ABYA 4BP9A 4OEHA 4D97A 2CYAA 5F52A 2UYYA 4IH1A 4V0SA 1JDPA 2ILVA 1OBOA 1NFFA 2H1IA 4D9HA 1CZHA 4AXXA 3TZBA 4IIXA 2FN9A 2AOXA 3WC4A 1G8HA 3ADKA 1HWYA 4RJIA 1RQLA 4U7JA 2HJHA 4GSYA 3P32A 4V24A 2XMGA 1B1AA 1YU6A 2CUNA 5KSWB 1F8XA 1S1CA 2WFLA 2EZTA 2AVDA 2M1ZA 1I30A 5BRJA 3C70A 4PNHA 5I8ZA 2PV7A 4WVLA 1Z5UA 4QHSA 4CMEA 2NP7A 1FXUA 1QZUA 1GCIA 1RXUA 3M5WA 3G2MA 2VNSA 3LHIA 4BLPA 5K2OA 3E2IA 1ZN2A 1I3OA 5JDIC 2IJGX 1AZWA 3O8RA 3NPMA 4KUEA 1MJFA 2QE6A 5E4TA 2V7BA 3W4KA 4V3CA 2NYVA 3AW8A 4ZZIA 2GN0A 4B34A 1BKDR 2Z2ZA 1NSTA 4XJVA 3LRTA 3O92A 5CDTA 1W2WB 3DOIA 3BXZA 4RJJA 2CW5A 2OM2A 3O4FA 3D5QA 2VYND 4LY6A 5LQDA 2EF0A 1F7UA 1HFEL 3AEQA 1BRMA 3IQWA 3R40A 3TM4A 3U5TA 1CV2A 1KFBB 1RWKA 1YZKA 4UZSA 3CG0A 4LDRA 1WBDA 3DL2A 2FUG1 3UXMA 4CI9A 4YQFA 4QQRA 2ENWA 2HRCA 5SYMA 2O54A 1L4YA 5B2ZA 1HURA 1ZIPA 1FJHA 1SWWA 3CW2A 1NT4A 4ZK6A 1YR2A 2ZVJA 2XEDA 3V97A 4D8UA 4LYJA 4NZ9A 3F71A 1TCCA 3KB8A 4M89A 1XVUA 4NBUA 1Y6FA 4ENUA 1TVKA 3KQVA 3PQDA 1WP9A 1A4UA 3DOJA 3VPXA 2PGAA 4XEHA 5JSKA 5LUAA 4AP6A 1S8FA 4TVBA 4D6YA 5IF3A 1I3CA 2OFOA 4A36A 5AKYA 4B4UA 3TGPA 2PGJA 3EIEA 2AEMA 3IQHX 3QU9A 2R8OA 4HBZA 4UMVA 1ACMA 4IJKA 4MYUA 4QULA 5T8KC 5HX7A 3H8WA 1XAJA 3JVUA 4EK9A 3CH7A 2BY4A 3DCNA 4MIEA 2PUAA 4EDFA 2H9IA 4Y2TA 3SQOA 2G7MC 1SHKA 1ODFA 3LU1A 3PGLA 4I4LA 3ZR4B 2P1DA 2Y1KA 3R7AA 2Q6TA 2I2BA 4KWTA 3K16A 5CAEB 4N4AA 3CNNA 2A9FA 1NN0A 1J5XA 3IKJA 1I3NA 5FV7A 1C1HA 4DYHA 4RHCA 2AJDA 1U8ZA 1A96A 3VDNB 3V4RA 2GBIA 5IJAA 1A5SB 3GJZA 2RG7A 2C4VA 1VIDA 2X2EA 3TYXA 1U0HC 4ACAA 3W77A 4ZVKA 3MWYW 3ZGLA 3L3BA 3ORHA 5DYTA 1R88A 4YRCA 1Z47A 5BSHA 1LRLA 4B40A 3MWLA 4MWEA 2DF8A 1A2KC 3GJ8A 1JN0A 4AUKA 1IYZA 4MS3B 2FLKA 4PAQA 1GAEO 5F7OA 3MJRA 1KJWA 1HYBA 1HDCA 1V7ZA 2G63A 2NW6A 3D7NA 2PMKA 3OX3A 4B3SB 5BV0A 3SBOA 1A69A 2I3GA 3LTEA 3U80A 2PT9A 4AMVA 3ZS9A 4B71A 2C61A 3FROA 4WGGA 1PK7A 2F59A 1P0FA 3V48A 3VU0A 4AMGA 1M6EX 4PBRA 3SD7A 2OZPA 4XX0A 1IXYA 3AEKA 2CJWA 3JQDA 2W4QA 1JIQA 4U7HA 4L6AA 4C05A 3NOQA 4JBNA 4N5IX 4XA8A 4BNMA 1AK1A 1DT3A 3BE5A 1ZAKA 1B0AA 3LSYA 2GHQA 2WWYA 5FD8A 3NDIA 2J6CA 3SVLA 2B1RA 3ZV3A 4LRUA 3OQOA 3DDUA 3EIXA 3LD9A 3DOFA 4V39A 1R64A 4BMVA 1VL5A 4B6EA 3HBFA 4LDQA 4YWJA 5C4MA 2P9BA 1NJSA 1F14A 2GJSA 1P7YA 2FZKA 4Z9YA 2GZHA 4CPDA 2OR3A 1XF9A 2V6BA 3D2LA 2H51A 1OBHA 4UEOA 2QP3A 2ZB4A 4ZOLB 2Q3LA 1B6TA 1SOUA 2ZYAA 1KJZA 3NHRA 1JEQA 4YJ3F 5J2TF 1VLHA 2FQXA 4CLOB 3HJCA 4RTSA 1MJGA 2Z83A 4P34A 4DBVO 4WFJA 1XZIA 4LYFA 4JI8B 1FLDA 4LBYA 3S7ZA 3V7WA 4TS1A 2UYGA 5B57C 5JQGF 3QQPA 3OQVA 2VT3A 1VOTA 4PBTA 3G9ZA 3LOQA 3PDUA 4H6XA 3AWDA 4HYQA 4EUSA 1CY2A 3A4TA 1VC2A 1VL6A 2B4RO 2ZDGA 4Y9TA 3H5NA 4UHFA 2IVFA 4LXUA 1RLIA 1I14A 3KTAA 3QQ5A 4O0LA 4ARVA 1U0TA 2YJTD 5JROA 4LYGA 2WLTA 3T5PA 2HXSA 1NW3A 1R6TA 3O2SB 1NR7A 1JB1A 3X2EA 1OT3A 4TVOA 1GGEA 2O8BA 2AI3A 2VYVD 3KQQA 4PBSA 4D4MA 2JCSA 4S1OA 1SURA 1IC6A 1KBZA 2A4KA 2IZZA 3TW8B 3DLPX 3ZIDA 4BO3A 4BNUA 1XTPA 3NB0A 1PZEA 5C8YA 5J1SB 2OV4A 3SEFA 3VNSA 3PXGA 4M55A 1C14A 5ALWA 5AUPB 4HSGA 1QLHA 3RVNA 2BEJA 4E3WA 2MDTA 2X7JA 4JB0A 1GUAA 5AI8A 2EW2A 4FUQA 4UJ5A 4J6FA 5K09A 4HX2A 2YWRA 4PSAA 4TWBA 3HN2A 1TLFA 1QPZA 3FZNA 1U1CA 2ID8A 5I4BA 1K3FA 2X5JO 3IPLA 4W5RA 1JAIA 4NBTA 1HE1C 5DISB 1QTQA 1LS1A 4N65A 4OA8A 4K8OA 2PQ2A 2WJYA 3AF5A 2RSLA 1EFRD 3BRWA 1YFZA 3V4ZA 4C0KA 3UBTA 2X0NA 4QREA 5CW2A 1PEYA 2F9MA 2JFUA 4AQYB 4C0SA 4D3ZA 3V9AA 2IY8A 2FW6A 4EKEA 1KYIA 3KSZO 1UPUA 4HRYA 3VR6D 4D99A 4QOGA 4XFJA 3O1IC 2G9ZA 2F7SA 4P84A 3QITA 5A5FA 3F5DA 2QRPA 1NVDA 2FPOA 2QZPA 2VHTA 3KR1A 1ND5A 3H2YA 3LK7A 3V32A 4ALMA 2J9ZB 5COAA 3PTLA 1SUWA 2D00A 2EAUA 3G8CA 5BO5A 1P1FA 4EFNA 4IDNA 5JY1A 2W42A 1K88A 4AROA 4DFDA 2OCPA 3HVKA 2YN4A 1Q1QA 2X0IA 4EENA 3AR8A 5KCZA 3OEYA 4GSLA 2MSCB 4TKMA 3ROZA 2BMDA 5KUTA 1BX1A 2G4CA 1B6GA 5LOVB 4S1NA 4MWOA 1AE1A 3K8YA 4Q4JB 4DV0B 2H63A 2QTBA 2VRCA 2V98A 1XWFA 4M54A 1TD9A 3BD8A 5F2KA 1T1GA 3W7AA 4KB5A 1RP7A 3PLRA 1VECA 3B8EA 1QC5A 3GLQA 5A9RA 3FKQA 5BNWA 2CLLB 2NMVA 3QKSA 4G5OA 1N0IA 3B5EA 1ZK0A 4BNZA 1MH1A 3GJYA 4ARZB 2CBXA 5EE0A 1T9CA 4PG7A 4HLQB 1UBNA 3PNQA 5E6SA 4TRJA 1RJDA 1CY4A 4ZEWA 1GAXA 1N36B 1TM3E 5C1PA 3HADA 3OX4A 3C3YA 3V6LA 1HKUA 3ZZ0A 4OQLA 4NBNA 3I5XA 2ZUUA 4KXVA 4N49A 5FOTA 5H82A 1XOIA 3FGOA 2Y1DA 3JQAD 4ZT2A 2FWBA 3HN6A 1H2XA 3W7VA 2WKWA 4II7A 4BXOA 4YLEA 4CETA 5ICCA 3UAWA 3IC5A 1KEZA 2FETA 2PWPA 1HL7A 3ZIAD 1F9AA 1TFRA 4MV3A 4WBNF 5AK5A 4GOXA 2YVUA 2CD9A 4HNAA 1NG1A 2WMDA 3CRQA 2PUJA 3BEOA 1GVNB 4DCGA 3MWGA 3EDQA 4CUKA 4H4EA 1YIDA 3ZWWA 4XFKA 1V95A 4HWPA 3H9BA 1FFGA 2QPLA 2O48X 2Q99A 1MC4A 2FA9A 1FZQA 1KS9A 3BCHA 3MTIA 5LP6F 1EE2A 1CY0A 2OILA 2EC5A 4D7AA 2BRUA 3IPRA 3PYXA 4EKIA 2JNWA 1E9DA 2RKBA 3EZ2A 3K15A 4YIKA 3SM3A 4C4OA 1UBMS 4ZI5A 4L8LA 2H5LA 4WZ6A 1ZHFA 1MGPA 3EQ8A 4AZWA 1PCXA 2BLLA 4MYRA 1K97A 3LQFA 3PXAA 4WDRA 1GSHA 3EXHA 3NTUA 5HKBA 3LO8A 4COKA 1OPRA 2C2OA 3PWKA 1Z82A 3CWQA 4D46A 2ZEJA 4BKPA 4CTNA 1KYQA 1RQNA 1M1YE 1Y6QA 4MAAA 4BVEA 3MNFA 4DDMA 1OASA 1QR2A 3EF0A 1AF7A 4RULA 2GO1A 4DT1A 3KJNA 4L6IA 1KSJA 3M3PA 1IN1A 3DB1A 1NQ5A 3QVSA 4TPKA 4FOSA 3COJA 4C6HA 4ZYWA 2XECA 2F55A 5JDIA 3K4PA 3G2JA 2AZTA 3KR2A 3ZUPA 5CD9A 4GI7A 1T5DX 1MV5A 4FBMA 1UT8A 1T2AA 4A92A 1MF7A 1H4QA 1T3SA 2CDRA 4LIPD 4M7RA 4ID3A 3FWZA 4IH9A 4F2WA 4N0QA 2R5NA 4OYLA 2IU4A 4N8EA 5J2UA 3LP6A 4LPKA 1X1QA 4S2UA 2BI8A 1B3BA 2X1MA 4RK4A 3WYCA 2DGDA 3FTDA 3R0ZA 1L7AA 3U3MA 2JJMA 4K9MA 3KWLA 1BGXT 1MRNA 5L7TA 1C7FA 1LXCA 2JGLA 4FYKA 3UT5B 5CFOA 3F9IA 1SEPA 4BVLA 4U0KA 4LEIA 1EJ0A 1R9MA 1T1JA 1GR0A 1X7GA 3OG9A 1FUIA 2VT2A 4U6QA 4KACA 1JA1A 1TZMA 2JCXA 2V74B 3TZHA 5IDQA 2SICE 1NNEA 1MFPA 1DIGA 3GHYA 3RVOA 2R7LA 1MG5A 3IAM1 2R6ZA 1H0KA 1YFLA 2X8AA 1HEIA 3C8UA 2OQIA 4V0KA 1OMOA 5EL0A 1NLMA 3DKRA 3DHEA 4HPXB 4OSOA 1JIKA 4E5DA 5IT5A 4JJ4A 4IQGA 1BA3A 2I7XA 3ZWVA 4NQRA 4U7TB 5DNAA 5A7HA 4CMIA 4EB6B 2P90A 2D8AA 2BZ0A 3A7DA 1IG3A 3OT1A 2B4AA 3L6OO 3DL0A 1BXKA 3MRTA 2Y0BA 4RA6A 5T8KA 2BFOA 1NNSA 3FIJA 3H7IA 4HPWA 4YXWA 5AM2A 4OI4A 2WPNA 3A10A 2GZMA 2VJYA 3O9ZA 1DKRA 1J0DA 3GPIA 4RABA 5C32A 1L7RA 4Q4AA 3RTDA 3HKBA 1KBOA 3NTRA 1EB8A 1QG6A 4X92A 8LDHA 1Y7IA 2DEUA 3ASUA 2TECE 4HR7A 4G0XA 5DHFA 4JBWA 4F6RB 2C42A 5IT0A 5LZ2A 1GGHA 1C4XA 3AH8A 3BWDD 5I7HA 1CXZA 3GHHA 1WY7A 1KL7A 3BK1A 4NMMA 4YDRA 4B6FA 4ENTA 2PTHA 4P4GA 3RASA 5DWQA 2YHIA 2UZ3A 1Z3CA 2HD4A 3S0JA 4CKEB 2I34A 2P9TA 5B7QA 3ZJVA 2YQ4A 2ZE8A 3DKVA 4Z0HO 2W00A 1AS2A 2C3OA 1C3OB 4FT2A 4M86A 5JTUA 4UAVA 3KD2A 1J39A 3TO5A 4BBZA 1CUJA 2BZSA 4MRMA 3GLIB 1Z4JA 3A0RB 3D6JA 2ONJA 1NBMA 3OEWA 1CNMA 2VTKA 2YIJA 4RKRA 3OFNA 1F4PA 1R1DA 3NEAA 4L0CA 4D56A 5B1YA 1Z37A 3AI3A 3D7LA 1K86A 3A2MA 3K2QA 5ALGA 2Z57A 2XNDA 3NKLA 4BMSA 1CVRA 1BYUA 2RK3A 2I2AA 5TGDA 1QAMA 3G5LA 4M9CA 5K0ZA 4US1R 3IEXA 1JU3A 221PA 5LZ8A 5E1MA 4CIAA 1C7QA 4EELA 4X6YA 1E8DA 2JHCA 1NP3A 3I4LA 3R6TA 3NI2A 4AURA 4C76A 2ID7A 3V2IA 2JEOA 3EGDA 1K89A 1ZRMA 4GOND 3NEYA 4H3KB 1NRXA 2QL7A 3T34A 3TAUA 1NNUA 2NZYA 4ZP1A 4A23A 1DC7A 2IZ5A 1LDYA 5A4DA 2Y27A 1QIFA 3KEGA 4DJ5X 1LPSA 3IO3A 5EE3A 3AVUA 1EDOA 5CBPA 3L7NA 4H3VA 4KRFA 4C30A 4URFA 1AM4D 3GLRA 4L5BA 1JLLA 2A0YA 2J3QA 2R1VA 4DLZA 4RQAA 1WABA 3ZY5A 2E21A 4LYHA 5ITZA 4K0KB 2ZAGA 1QK4A 5H1YA 4INPA 1LLFA 4PYOA 1SJ9A 1GTL1 5D01A 1WMEA 4KLNA 3UATA 2CSUA 4R7TA 2IP4A 2QUAA 4AT1A 1ULSA 2OZLB 3M4ZA 4XUEA 5GJVC 4AJLA 2ZBEA 4D9EA 2JHGA 3OCVA 1LZLA 4R4JA 4EJMA 3M3HA 1KYWA 5E0KB 4F4UA 1KH1A 3AFNA 4G5SA 3NCHA 5JXJA 4M6WA 4EARA 3D0QA 4Q4HA 1VKJA 1ONPA 1Z29A 4JLBA 3VTZA 3L8ZA 2Z9DA 1AURA 5J47A 2IIPA 2Z09A 5CP8A 1QKKA 5JNWA 1C30B 1D2GA 1TM7E 2WP0A 1JFTA 3GLHE 2GWRA 2HC9A 3RVPA 2XKJE 1M0SA 1XZEA 1DT5A 1JYFA 1ARZA 3BHIA 1X86B 1WDTA 2JASA 3GX1A 3OF5A 3FLMA 2HWUA 1J2RA 1X7ZA 4Z4IA 3DUWA 1CQIA 1EE9A 4L50A 2V9PA 3OZVA 4QARA 4D41A 5C18A 3IUEA 3IURA 2QTNA 1IJBA 5BOSB 1SKAA 4QICA 4BVBA 2HYDA 2HIHA 1U2QA 1Z5ZA 1MB3A 4INOA 4DIMA 3OU6A 3W3ZB 4OHPA 2QD4A 3NHJA 3TDNA 4HVCA 1XPOA 2QIPA 3NATA 4DF3A 1S2IA 3Q2KA 5JBIA 1Z5OA 2RI1A 3LC1O 1OD6A 1V8FA 2X8JA 3OA0A 4LYAA 1S9DA 3KOXA 4DCPA 1R6VA 2KBEA 4MLPA 2GR9A 4BWYA 2W2QA 2AR7A 3MGKA 4NX2A 2P27A 1AB6A 1ADYA 4NTZA 1CUGA 2GBLC 2XKAA 4Q9IA 4DNFA 4ODIA 4Z0PA 4O4HB 5IJ0B 4RJ2A 2X15A 1WXGA 1NVEA 3WGUA 4FFVA 3U61B 3FNIA 2GK6A 3L8EA 1TJ3A 1XQYA 2AW3A 2GAAA 2RMKA 2VNKA 1C29B 1KYTA 1QS0B 3OMLA 1DCFA 3PDHA 1Q16A 3GROA 4OK6A 4TT3A 3TTUA 3ZGVA 1JWBB 2J7KA 3B85A 3CN9A 3DMHA 1PGQA 3D0RA 1OXKB 1QH8A 1P77A 1W73A 1X1RA 2CCGA 1K9VF 2PU7A 3AETB 4I6GA 1UMBA 2IYLD 4E1AA 1E3WB 4LF9B 4QUIA 1DXOA 1QQ5A 1T6BY 2B94A 1K6MA 4CF4A 2ZSUA 1PJAA 1DBSA 1I80A 3EY4A 4A3SA 4UVEA 3KDSE 4PZPA 4RQTA 1R4ZA 1O3YA 1TA4A 1QZTA 4ZZ2A 2VDNB 5BR4A 1GN8A 1WAMA 3M8KA 2G07A 5HDQA 4EG0A 3P2MA 1CUEA 4AMYA 2OORC 4IDQA 4PHTA 2NXNA 4KYIB 1J00A 3JQ8A 2CCKA 3GNSA 1BMQA 3D43A 4R1SA 4WQMA 3R7SA 1NF8A 4O2AA 2GTHA 2YZKA 4IIJB 3QPVA 1D7AA 1G5HA 1DAHA 2HNAA 1Y80A 3ANLA 3CISA 3M9WA 5NLLA 3TCXB 3UMJA 3VI3B 1LPPA 3GG2A 2B4YA 2GJAA 2IZ1A 4AYXA 3HWSA 2PU5A 2WHPB 3LXUX 1EHIA 1TUBB 4NFSA 5FFFA 4KPFC 3VPDA 3B1VA 3LUJA 5HNKA 2YOGA 1PWEA 3IAEA 4RY0A 5G41A 4LI3X 1COWD 1ODSA 5LYJB 3E3NA 3BS4A 5B1DA 4JSTA 5BMVA 1EXMA 2J85A 3JD0A 4PLZA 2PZFA 1P6UA 5P21A 2TMYA 2BGGA 1Z62A 2D06A 2O1EA 1J09A 3IUJA 4U9UA 5EWJB 3ASVA 3T7SA 3B9PA 2H07A 5ED0A 3SS9X 1M83A 1PR3A 2CJFA 3DV0B 1IE3A 2BHRA 1QFZA 3BUSA 3I5UA 4ND2A 5H80A 4B9EA 2B9EA 4M1TA 4MDFA 3EEYA 3ADCA 3NBUA 2FSVC 4G5RA 3ZH2A 5DCYA 1AA9A 5F7ZA 4D2IA 1TF2A 2H11A 4OMUA 1O95C 3D6FA 3Q3EA 4UDYX 3WFZA 3M70A 4RMHA 1INLA 1HO3A 1DAPA 3W1EA 3GAMA 2Q7DA 2BR4A 3P0EA 2C96A 4ZOEA 5DK6A 1NOJA 3EVTA 3NWOA 2JLAA 3WLNA 3ZC3A 1W5BA 1YE8A 4CQLA 2AX3A 2BFWA 3C5WP 4F5DA 2CUTA 3HU5A 2B69A 1WZCA 3F74A 1VLJA 2NAFA 4Z9BA 4I4CA 4NONA 1JYEA 2EBWA 2G9RA 2NO9A 4D74A 4RHUA 1B76A 5SYAA 5CVTA 2CL6X 5CT8A 1I3MA 2OC4A 3VSAA 1YBFA 2GUGA 3KWFA 4GICA 1PLKA 3BF7A 4HBGA 4QVKA 4KO2S 3S28A 5DTQA 2PCJA 1RBZA 3L4BA 4ZREA 4ISBA 4B3BA 4J0JA 2QAJA 2F90A 3ICWA 3UK0A 1JFLA 5FAXA 2NZVG 3AGQA 3MUNA 4KPUA 5E8RA 1UAAA 1TW3A 4X24A 3E5MA 3H13A 4CFZA 5HWSA 4ARBA 1ZUNB 1N4DA 3RK0A 3KUXA 3CZPA 2VJKA 2IWRA 2I55A 3HZRA 1D3AA 3NM4A 1SXJE 3N2ZB 3F6YA 2IEGA 4GC9A 4GC5A 3E5HA 4RK7A 3U7FB 2XRZA 4N6OA 3NIFB 3LZCA 4HI0E 4HV4A 2OOKA 3RIMA 2NTNA 4DXAA 2BFBB 5L3SB 1YDHA 2C1ZA 4OHWA 1P3Y1 1IWPB 4RLQA 3JQQA 3EGXB 3WLJA 3HB5X 1XD8A 3HP1A 3T95A 3H99A 2ZJ7A 4MSUA 5JAPA 3KRTA 4L5IA 3P4YA 4CN8A 1G8MA 2VQ3A 4JR2A 4YQYA 1UBTS 4FYMA 4XQGA 2QMOA 4ZFNA 4Q7EA 5GM2A 1E7QA 4BJHB 4S12A 3LY7A 3ESDA 1AKMA 1NJ8A 2OAP1 3PNLA 1CY1A 3Q3HA 3FN4A 4LISA 3T4PA 4IIVA 2YWJA 5IDWA 4YRLA 2XNCA 3ZE1B 5TRTA 2VSOA 4LQLA 4TYPA 3CEHA 1V43A 3KU1A 4FR2A 2YWGA 3JTEA 3HN7A 4QOSA 2P5UA 4Y9RA 2VK1A 3NOXA 4U2EA 3WL8A 1IM8A 1E9BA 4TS9A 4TV8F 1U99A 4R0VA 1LLUA 2MR5A 4HAIA 2ZWVA 3ND6A 5HQTA 5LFAA 2XXAA 1GZ6A 1XZNA 2XNHA 2XNJA 1OYVA 3IX7A 2NO5A 5JVDB 5K3AA 3V8NA 3X3HA 2QBYA 1QWSA 2HHJA 4DMUB 1FX0A 4ZMSA 3CZCA 4RPJA 5IVPA 2XT0A 3NBFA 4EYEA 3PUYA 1TEZA 3C3DA 3FFTA 3K1JA 3OPQA 4M1YA 4E4TA 3AU9A 5JNSA 1ATZA 1ESCA 1XELA 3UV7A 1GARA 4CKZA 3R44A 3AG5A 3HNRA 3GNQA 4KPEC 3CXUA 3C4JA 1J8QA 3U31A 5CJPA 1POXA 4M9UA 3HDHA 4B82A 3HCNA 1QP4A 4EDHA 5BXYA 1UDRA 3L6EA 5LD2C 3I32A 1DNPA 1G2IA 2B36A 2Z4SA 4HS9A 4PONA 3BHJA 3FWHA 5GV8A 3VR4H 4F4HA 1IM5A 1Y9ZA 3NUGA 2DBYA 2ZIVB 4E03A 3LDHA 2P2DA 5HF9A 2IV3A 3L8FA 1EQUA 4IX9A 3LT0A 1F9EA 4KE6A 3RDPA 2RB4A 1PU2A 1U0GA 3EGIA 1OVMA 4CCSA 1NWHA 2Y93A 1BMTA 2IYFA 3P71T 4I9UA 2BBOA 1PZHA 4YGYA 3BAFA 3VYVA 4FI3C 1KDTA 3FDXA 2XV1A 5EYPB 1EFVA 3ILXA 1PFQA 2FKNA 2H31A 2WUEA 3MIZA 1FDRA 1PJZA 2IIQA 2P9YA 4J0KA 4MWTA 4V0NA 4AAYA 4MQUA 1E2EA 5K01A 1K27A 5REQA 3QUCA 4MITA 1LK5A 2NO4A 1GQOA 3QMMA 3ZEIA 2L0XA 3H5AA 1MLDA 2JFOA 3X1JA 1KIAA 3GMDA 3MLBA 5ITWA 5K4GA 4BHTA 3P94A 1RPNA 4EHLA 2OCIA 3ZX4A 4RTJA 2PD6A 2EZ9A 4U7PB 2QQFA 2C97A 4KE9A 4TN5A 1R0CA 4MUAA 4QYIB 1NNI1 4TWRA 3ZV7A 1QV6A 3NGMA 3ME5A 2VUIB 4K1LA 1IQUA 1N2IA 1BU8A 2B7BA 2GCNA 1HK7A 1KVTA 2TS1A 3AHFA 4I1VA 4M8KA 3IIMA 3ZHVA 5IJZA 5JCPA 5KTYA 3T3OA 1KO7A 2X8BA 3KP1A 3U0BA 3CR8A 1DZIA 3BKWA 3K9BA 4M4SA 1M8KA 1HQCA 1GJRA 3FYDA 2JGNA 2HLNA 4Q48A 2AG6A 1E7MA 1NZJA 1X9IA 3IP9A 4C4RA 3NAZA 1ECLA 1IBSA 2C1EA 2YZGA 1O97D 1JBQA 1FBTA 3ELDA 3KKMA 2YJZA 1UFRA 2VAXA 4OP1A 2B1QA 2KI5A 4WACA 4EEKA 1K66A 5IK2D 2PO7A 4ZDJA 5MN5A 1J9ZA 3JALA 4KR7A 1G5FA 5DGXA 4AJ2A 2HBRA 4HDCA 4JBYA 1VCNA 2BJHA 5AKGA 2UXBB 2B5OA 3NH6A 4G0MA 2I4OA 2QD2A 1PEDA 3MCUA 4FC6A 1C3LA 1MAVA 3MWEB 2PX4A 1N7IA 3ZQ6A 4UXJA 4DR6B 3UWOA 4HEA6 3CRMA 1CJCA 1XTJA 4BBAA 4EG5A 3OIWA 2W6JD 2WNIA 4PV7A 2V7EA 2EFYA 2PCLA 2WT9A 3C39A 3M1YA 4GR5A 3KT0A 4OUDB 3C3XA 4ZCRA 3C8HA 4UDOA