1ISPA

Crystal structure of bacillus subtilis lipase at 1.3a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
179
structure length
179
Chain Sequence
EHNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternate conformations observed in catalytic serine of Bacillus subtilis lipase determined at 1.3 A resolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords lipase
total genus 69
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2001-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ispA00
4X94A 4J03A 5SYNA 2WG1A 2LIPA 2V98A 3V1KA 4INZA 2HHAA 3H1AA 3LIIA 3F97A 5E4TA 2CJPA 3C8HA 4BP9A 3KWJA 5LZ2A 4X6YA 1QONA 2AJDA 2C4HA 5T4EA 5AHXA 2WKWA 3I6MA 1FFBA 1SC9A 2QMQA 1CUIA 2VATA 2JEZA 2WU3A 1THTA 5JYCA 5AI8A 4BAZA 4LXIA 4KRXA 3V1LA 2XB6A 3DOHA 5DYYA 4ZGBA 2QXUA 1FFAA 4GBGA 3NGMA 2BUAA 3FYTA 5F4ZA 2UZ0A 2JGFA 4LIPD 2Z8XA 1EHYA 1EVEA 2XMBA 1GXSA 2C5GA 3C6XA 1QGED 2XE4A 4AN0A 2AJBA 1P0IA 3H19A 3ZV7A 3FAKA 2Z3WA 1ZJ5A 4ZV9A 5FRDA 3U1TA 3PDCA 3MGAA 4E11A 2WIFA 4WFIA 4I4CA 1IUOA 4X71A 3PF9A 3PFCA 4L9AA 3H2IA 5CH3A 1YAJA 5HF5A 1XZGA 4TPKA 3QYJA 4XWGA 3BJRA 4N8DA 1XQYA 3Q0TA 4WCVA 1XFDA 5HZGA 1WHTA 2HU8A 2DHDA 3F67A 3WK5A 2OPHA 4PW0A 2ZJ7A 4E14A 5AOCA 2RHWA 1QIKA 5EIHA 1VXRA 3ESAA 1H2WA 1H2ZA 1QO9A 1CV2A 1YB6A 1ZD2P 4DSZA 4H7FA 4CIBA 4J0HA 1CEXA 5ALIA 3WIBA 1K63A 2C5FA 1X2BA 2YXPX 4BCBA 3IIIA 3FYUB 4FNMA 4C6HA 1CIJA 3WL6A 3SX4A 5JASA 4YPVA 1BN6A 3DKKA 2O7VA 3I2GA 1HBJA 2XUAA 2PVSA 4K5QA 4YK7A 4U2GA 5LZ5A 3UUFA 3O9MA 2JBWA 5EGNA 4FDMA 2G5TA 4Q1VA 1HQDA 2VAVA 5HK9A 2OXEA 4OD0A 1XLWA 4QNNA 5AI0A 1EX9A 2XUDA 3QZUA 4PV7A 5EIEA 3H2JA 2XLBA 5ALQA 3GZJA 4AMZA 1FFDA 4A16A 1EK2A 1TK3A 3WJ2A 3DCNA 4K6HA 4UBNA 5JAUA 4FTWA 1UWCA 2QUBA 4PF1A 5AM3A 1XLVA 4BVKA 4ZV7A 1E8DA 2XMRA 5A6VA 5ALDA 1UOOA 2I78A 4HS9A 1EB8A 3RARA 1XLUA 5CT9A 3I2IA 4LYDA 2WFZA 4B84A 4X85A 5AKZA 3FVRA 4Y7DA 5LP1A 5ALPA 3ED1A 3H2HA 1E8MA 2G63A 4EA6A 1D07A 4HTAA 3STVA 3WMRA 2WUFA 2FUKA 3VXKA 5AK5A 2RONA 4C01A 2OGSA 2PSHA 1J1IA 4OB6A 1C7JA 5K3EA 3PE6A 4N8EA 4NS4A 3VVLA 3G02A 4UBOA 1UKAA 4JH0A 4QE3A 5A7FA 2R8BA 1H23A 3STUA 2JGMA 3IVMA 4FBMA 5AI9A 3WKEA 2RHTA 1N5RA 2ZVDA 3CCBA 1CUVA 3ANTA 1BEEA 2ROQA 2PSJA 1N1MA 4BVLA 1QIDA 3IDAA 2JGKA 2V9ZA 4H7IA 4YASA 5C81A 3WK4A 2B20A 1E66A 1R3DA 1EDEA 3OURA 3OM8A 4K2AA 3SWWA 3H0CA 3DYVA 1W75A 4XX1A 3R3ZA 5AKJA 4H7DA 4PSUA 1A7UA 6YASA 5A62A 1EH5A 3PUIA 5JAOA 1IMJA 3DNMA 5HFNA 3ICWA 1CUXA 1WPRA 3R3YA 4W63A 1MU0A 4HRXA 4RGYA 1XQVA 2PSEA 1CQZA 1VA4A 3VISA 4Q3KA 3E3AA 3QVMA 2VTVA 5ALJA 1LPOA 2VA9A 3WL5A 3M3DA 3MUOA 4CFSA 1J2EA 1VLQA 3FSGA 3EBLA 3KXPA 5YASA 4OPMA 2VAXA 5BWBA 3FWHA 2QVBA 2XMSA 3FLBA 1WB6A 1UKCA 2XT0A 3WIOA 1ODCA 1RWQA 1H22A 4MWTA 3DL7A 4WDRA 1ACLA 5AM5A 4EY5A 1EXWA 1UK7A 1BROA 1AKNA 3BXPA 4UPDA 4Y2TA 1JJBA 4GECA 1YCDA 2JGJA 1CUYA 4DNOA 1UFOA 5JIBA 4UBLA 3W2TA 5DYTA 4G8DA 2Q0XA 4XIIA 4MJ3A 4G1FA 4OYLA 3G0GA 1QO7A 5KWJA 3ZLVA 5FDFA 1G4HA 4BB0A 1W76A 5FUMA 4FLEA 4KAJA 5ALTA 1R88A 4FFWA 4JEIA 5ALMA 5CRIA 4W1SA 2HA0A 5AIBA 3VJLA 2OCKA 4WY5A 4AQDA 4YX9A 4BDTA 1U65A 4FHZA 2XMCA 5CT6A 1TCCA 1A8SA 2XUHA 2YASA 1HL7A 5EHXA 2Y1KA 5CH5A 3ILSA 2BAGA 4EB0A 1Q0ZA 1BN7A 2PX6A 3WA6A 4BRZA 2I3DA 2XUQA 1XZHA 3QITA 3FBWA 4GHWA 2GBCA 1W52X 3FSGD 2OCIA 1YAHA 1DT3A 3WL8A 1CUBA 1QFSA 4ZWNA 4FNGA 2VQ6A 4QDXA 3D2BA 4AO7A 4AMYA 1OCEA 2VT7A 4J0IA 2RIPA 2VSQA 2OAEA 2QJWA 1MAAA 5AP9A 1GKLA 4BE4A 2XUIA 1CUZA 3ESDA 3R41A 3I2JA 1U8EA 1SCKA 1SOMA 4C88A 2P8SA 3G7NA 1LZKA 4FMPA 4Z49A 2WFMA 5FP0A 5IKXA 5EIAA 3IURA 2V97A 1K8QA 4KR0A 2X5XA 3EQ8A 4AX4A 1SFRA 3A6ZA 4ITVA 3WWPA 3G0DA 2AJ8A 2QTBA 1NU8A 4X90A 2ORYA 2WIJA 5HF6A 4CG2A 3JWEA 4BTVA 2WILA 2GBFA 2XUJA 2PM8A 3IB3A 2HA6A 1CUJA 3V1MA 1A8UA 1WM1A 5ALFA 2PU5A 4KE6A 1EVQA 1R9MA 5HQ3B 2WJ4A 4IH9A 3DQZA 4PNZA 3U0VA 1ODTC 2CBGA 2WTMA 5JD6A 1QIJA 5AI4A 5AM4A 3AZOA 5ALNA 4G4GA 3GROA 3TEJA 2FX5A 1YA4A 4OU4A 3OC0A 4AZ0A 1RP1A 4J0CA 5FXMA 1XRRA 3R3VA 2ZSHA 2ONCA 1AURA 5T4BA 1DINA 2OAGA 1BCRA 1CUFA 3LS2A 1ISPA 4PO3X 3ANSA 3LCRA 3W9UA 3EQ9A 3LLCA 2JF0A 1CUGA 4B83A 3H04A 5E2IA 3DJYA 3UMJA 3HJUA 4BC0A 3A2NA 4FOLA 3QM1A 1XRMA 4Y2RA 5I7UA 4CIAA 4GW3A 3YASA 3H1BA 3X3HA 1UK8A 5I8PA 1I6WA 2XDWA 4UBMA 2PL5A 1QIFA 3C45A 3WJ1A 5DYWA 2PSFA 1L7AA 1UOPA 3R40A 5AM2A 1SCQA 4J0DA 1U4NA 1VE6A 5ALZA 3IA2A 1XZCA 5ALOA 2RGUA 4U2BA 2WHRA 1CUUA 4BAGA 2WJ6A 4ARBA 5LIPA 4MXDA 2OGZA 1P0QA 1CQWA 2QM0A 2J3QA 2DQYA 5CBKA 1CRLA 4IHAA 4B9EA 5DNVA 3QBJA 4C4YA 1YB7A 5ALSA 2G4LA 1YS1X 1XZFA 2XMZA 4X91A 2XI4A 5HCUA 2C0QA 4ZXFA 1ZD4A 4MQMA 1G66A 2WM2A 1F0PA 1QTIA 4UBIA 3FYUC 3DEAA 3I2KA 1WCYA 3N0TA 3KDAA 1N8SA 3LIPA 1A8QA 4Y2PA 2GYWA 4EY6A 1AZWA 2OLEA 5LKRA 1XRQA 4M0FA 4OB8A 4EUSA 4UUQA 4QDZA 7YASA 2QUAA 2AXEA 4M0EA 1MN6A 5C8XA 4HAIA 4W9RA 3G9ZA 2BGNA 1GPKA 3L1HA 4C4XA 3O4JA 3CXUA 3A2MA 5CW2A 4L0CA 3LP5A 1LPMA 4LXHA 2ZSIA 3WZLA 1QIEA 5CT5A 3G9TA 3D3NA 1JT2A 4BBZA 4CCWA 1N5MA 5C8ZA 4WFKA 2OQIA 1MNAA 5D7BA 1DQYA 3V9AA 2ES4A 3WI7A 4UFOA 3STTA 1XROA 1ZI6A 4DLNA 3R3WA 4AZ3A 1ZGBA 4IH4A 2YYSA 5IVKA 5JATA 5ALWA 2Y2UA 2QR5A 2CKMA 4XVCA 5JANA 5AK3A 3ZI7A 2HRRA 2ACEA 3TRDA 4OSEA 3AINA 3O0DA 2H1IA 2HU7A 4E15A 2WLSA 4UHFA 5AH0A 1QIGA 2G5PA 1IVYA 2E3JA 1Z68A 2XQJA 4F60A 1KU6A 1XZDA 1MX5A 2AJCA 2JGEA 2HA4A 3I2HA 2WHQA 3F98A 1MX9A 4UBKA 1HPLA 3PI6A 1GKKA 3PF8A 1Y37A 2PUHA 4N5HX 5ISMA 4BCCA 2CMFA 2HA2A 5IVHA 1BU8A 1E3QA 3ZLTA 4EY8A 1Y7HA 3T4UA 1QFMA 4X93A 4J0GA 3WWEA 3GBSA 3WWCA 3BL8A 1ZD3A 5C7YA 3OTQA 4I19A 1DX4A 3RM3A 1CVLA 2PPLA 5T4FA 4AO6A 4BE9A 4DM7A 5AKYA 2CEKA 2OCLA 1JMKC 1CFJA 3S8YA 3NOXA 4G9GA 1ETHA 1JI3A 4BATA 4KYVA 1F8UA 3WK6A 3C6YA 4X6XA 4WY8A 5EHNA 1PV1A 1OILA 1TIBA 3ESBA 4FLMA 4FWBA 4DMKA 1AGYA 4S0XA 1LGYA 1VJ5A 1S8OA 3I28A 2XUGA 5AKXA 1MJ5A 4N8SA 5BOVA 2Z3ZA 4GWLA 2HRQA 3IUQA 3D5EA 4EHBA 4A23A 4HZGA 3OG9A 3UUEA 3FCYA 4QDUA 1P0MA 1QOZA 2XMQA 3C43A 3C5VA 3E4DA 3QPCA 1LZLA 5ALRA 2GZRA 5ALGA 4H7KA 2HA3A 4KAFA 1ZJ4A 4K6KA 1T4MA 3B5EA 5DNWA 3EIOA 4DIUA 1ODSA 2BGRA 3QPAA 1CUSA 5ALEA 1TKRA 4BP8A 2QT9A 2AJLI 3RK4A 3BIXA 2D0DA 3WKCA 4KE7A 2OQVA 5K3AA 1EDDA 4Q3LA 1EDBA 3B12A 3STYA 4KJXA 4AB1A 1CUWA 1VKHA 1IUPA 2B4KA 3G0IA 2ZJFA 2O7RA 3DLTA 3WK9A 3CCCA 3F96A 4G8CA 4MYDA 1WOMA 3MUNA 1XZJA 1XRLA 3I6ZA 3C5WP 5A71A 2J4CA 1MNQA 1Q0RA 1USWA 2PSDA 2RI6A 2IITA 5JAHA 4H18A 4OYYA 3WK7A 1OXMA 1CUAA 1F6WA 3D4LA 1WHSA 5FOQA 2OCGA 4BTLA 3D2AA 4FLFA 3O95A 1ZI8A 3IULA 4QDOA 3C6BA 2RAUA 2C0PA 5AOAA 1XRNA 5BV7A 1WB5A 1XQWA 2ZYSA 4EZIA 2WIKA 3WYDA 3EQ7A 4X97A 3K2IA 1WPXA 3WKDA 4HXGA 1E8NA 3C6ZA 5LLSA 1XKLA 4DGQA 1NU6A 3BE8A 3TGLA 4EBBA 4C89A 1WB4A 2XQKA 2PBLA 3HYSA 4NMWA 4G4JA 4PSDA 3GELA 3KD2A 2PUJA 1F0NA 3NWOA 2NW6A 3WKBA 5KBYA 5AK4A 3BDIA 2BUBA 3PFBA 3R3UA 1QLWA 2HADA 1T2NA 3IUMA 2BUCA 4BVJA 5ALKA 4ZREA 4H0CA 5JZ9A 5HKAA 4MEAA 2WIDA 3I1YA 4X95A 2GBGA 3AUKA 1GPNA 2JIDA 2O2HA 3VKFA 4UHCA 1BCSA 1LPPA 4Y2XA 4B0PA 3W05A 1AQLA 3DOIA 3HI4A 4G5XA 2BKLA 5CURA 2VT6A 4Y2QA 5E4JA 5K3FA 2Y2VA 3WK8A 3AIMA 4IH1A 4LHEA 1PJAA 4C87A 1C4XA 4DYHA 3O4IA 2ZYIA 3H2KA 2QJRA 4OCZA 2VJBA 4AN1A 1GQRA 4Q34A 3STXA 2WTNA 1E89A 4EY4A 2ZYHA 1MO2A 1DWQA 3FNBA 4B6GA 5AI6A 2XQGA 1GZ7A 3BIWA 3BJMA 3G8YA 1DX6A 2H9YA 1Y7IA 4JYMA 3F8SA 3FCXA 1FSSA 3M82A 2DFPA 1BE0A 4KE8A 3S2ZA 5FLKA 2QKYA 2W6CX 3FLEA 1FFCA 1VE7A 5CT8A 5AKGA 4U2DA 4UHDA 2WUDA 1R9NA 3WA7A 3KWFA 2O2GA 1L7QA 3PICA 2BJHA 5DTJA 5AKIA 1LPSA 3O4HA 2HA5A 1FFEA 1J06A 1H2XA 1LPBB 4DNPA 1VZ2A 4CI9A 4CG1A 3W9BA 3GFFA 4P93A 1XRPA 4V2IA 1AMNA 2O2IA 3C70A 3VJMA 3D7RA 3TJMA 4OU5A 2WFLA 1J07A 1CUEA 5EI5A 3W04A 1XZAA 1AC5A 1ZOIA 1LPNA 1JJFA 1ZD5A 4Y2UA 3T52A 3HZOA 5K5EA 1QIIA 5LZ7A 3WYNA 1QZ3A 5J3JA 4QLOA 1CUHA 1DT5A 3SC2A 4X7BA 4N5IX 5JD5A 1UKBA 5AO9A 3ZPXA 2W22A 2DCMA 3C8DA 1O6FA 2JEYA 4UBJA 1XZBA 5CT4A 3HLKA 4AO8A 4X00A 2VEOA 4NVRA 1YS2X 2VJAA 4ZI5A 4PQEA 4E46A 3QMVA 4CCYB 3DDUA 3QMWA 5LZ4A 3WL7A 2BFNA 3GA7A 3GUUA 5K3CA 5D3KA 2VJDA 4PSCA 2GYUA 1O6GA 1C7IA 1HDEA 5ALLA 5D6OA 3BF7A 1EA5A 4KACA 2GZSA 3HXKA 3E0XA 4GLBA 4KE9A 4L72A 2HFJA 2R11A 4W1QA 2CZQA 4DMHA 3N2ZB 5ALXA 5DTIA 5CXUA 2PU7A 3FOBA 1EK1A 2Z8ZA 3DKRA 1ORWA 1YSCA 1ZI9A 3C87A 4U2EA 5HK8A 3K6KA 2B61A 4DMCA 1AX9A 4TGLA 4BRSA 5JZSA 1ZIYA 3AZPA 4DTCA 5IH7A 4CCYA 4MWSA 2ZYRA 3VVMA 4M0MA 1Q84A 3CN7A 4Y2VA 4BAUA 1K4YA 1SCIA 3A70A 3RLIA 4OB7A 5K3FB 1UK6A 3IUJA 1XQXA 4MQLA 4RE5A 4UFNA 2OG1A 1LLFA 2BCEA 4J7AA 4HVTA 1JKMA 1VA5A 3D59A 5KREA 5K3DA 4OUKX 2H7CA 5A7HA 5AJHA 1ZICA 1X70A 2EDCA 4WFJA 4DMFA 1CLEA 1MT3A 4AXBA 1AUOA 1M33A 2K2QB 4GXNA 4W1RA 1PFQA 5DJ5A 1JFRA 5JAPA 4BZWA 2I3ZA 1MPXA 2VF2A 2VJCA 2WHPA 2H7XA 1R1DA 3PUHA 3STWA 3H18A 4UFPA 5T4HA 1ZGCA 3D0KA 3R0VA 4RPCA 2CUTA 5AOBA 5FPPA 2WIGA 2QZPA 3WZMA 1K6EA 3NUZA 2J4FA 4DNQA 4I3FA 1MX1A 5CXXA 1MTZA 4G4IA 3QMMA 1P0PA 3K9BA 4H77A 3AFIA 4JYPA 4Y2YA 5E4YA 2V96A 3EF3A 4UHBA 4F0JA 1TAHA 4RE6A 3DS8A 3WQHA 3G0CA 4Q3OA 4MEBA 3B3QA 4QWMA 3KOOA 1UT6A 4H7JA 1IZ7A 2XQFA 3G0BA 2FJPA 3A2LA 4Y2JA 1BS9A 5LZ9A 3VJKA 2EDAA 3E1GA 2WHPB 1XZLA 4ZRDA 4RNCA 1XZIA 4QDTA 5JARA 1TRHA 2H7YA 4KEAA 2DSNA 4B80A 1DTEA 4O08A 3WWOA 1JMYA 3HSSA 5D3ZA 5EHQA 3QPDA 2Y6UA 1VZ3A 2XMGA 2ZJ6A 3WKAA 5LKAA 3O9VA 3HRHA 3OPMA 3AJAA 1W4LA 4L3WA 1EI9A 2XQIA 4P9NA 5FPQA 1THGA 2I03A 4GI1A 5JADA 1CUDA 2FJ0A 1QTRA 5HFAA 4B0OA 2ACKA 1E5TA 2ECFA 5EFZA 4EY7A 4BZZA 3I6YA 3AIKA 3H17A 1L7RA 2HA7A 1QIMA 4JNCA 1LPAB 3O4GA 4XJVA 2HFKA 4B9AA 2X8BA 5CTAA 1W6RA 1TCBA 2YH2A 5H3HA 4HXEB 3P2MA 5AKEA 5HF8A 4D9JA 4CG3A 3HC7A 3IUNA 5DLPA 1R4ZA 5BWCA 3V1NA 5A7GA 3G9UA 4P08A 4H35A 2QS9A 5LYYA 1DQZA 1TCAA 3R3XA 2X76A 1UZAA 5SYMA 4B81A 4IO0A 4Y9SA 2DHCA 2HDWA 1GGVA 1JU4A 1UK9A 5ALHA 1MAHA 1Q83A 3AIOA 3HABA 1XKTA 2WFLB 3WWDA 2Z5GA 1R50A 3F9CA 4B85A 3G9XA 4LYEA 5K3BA 2HL6A 4LXGA 3AZQA 1EINA 5AI5A 5DNUA 4LKOA 1LNSA 2XUOA 4KAAA 5IVDA 2WUEA 4GDMA 1UOQA 3I2FA 2JGIA 3ICVA 3W06A 2WUGA 3MVEA 2GYVA 1RYYA 3FVTA 5AM1A 2HIHA 1X2EA 4Y2SA 3H2GA 5HF9A 4B82A 1DWPA 1B41A 1CUCA 1GT6A 1YR2A 1XZEA 4QWWA 1IUNA 5ALVA 4U2FA 5A2GA 4ETWA 2CB9A 3IBTA 1FJ2A 2D5LA 3Q8WA 2XMDA 3ZWQA 4DNFA 4WJLA 4X3CA 4A5SA 5AM0A 2WQZA 1QJ4A 5I9IA 5AKKA 1DU4A 4HXFB 5HKBA 4NZZA 2IX9A 2IIVA 1GQSA 1LBTA 1BEZA 1VXOA 4QLAA 3SK0A 1IZ8A 5EHZA 1ACJA 2XUFA 2WG0A 4KRYA 2QXTA 3QH4A 1XZMA 1CPYA 4X6UA 5ALYA 1LBSA 4MYSA 5CH8A 4BC1A 3DD5A 3M83A 4G9EA 5ALUA 2J3DA 1G5FA 5LZ8A 2WG2A 5KWIA 1ZIXA 5AKHA 3DL4A 1UXOA 1XZKA 2WJ3A 2HM7A 1G42A 5IVIA 2DR0A 1KU0A 4FFVA 4QEKA 3ESCA 1B6GA 4Q05A 3WLAA 2PKYX 5C8VA 5JALA 4ROTA 3BWXA 4QA9A 4QZVA 1H2YA 4C4ZA 1ORVA 2Y6VA 2XLCA 3OOSA 1JU3A 4P92A 4BDSA 3M81A 3RKSA 4X92A 4FKBA 5JZBA 4J0JA 2EEPA 3AILA 5AKLA 2OGTA 4FBLA 2JGLA 3VDXA 2GBIA 2WU4A 4IQ4A 2QRUA 1CR6A 2C7BA 2XUKA 4H7HA 4UHHA 4F5ZA 4JUIA 5FKJA 2C58A 3CN9A 2B9VA 3D2CA 1A88A 4ARAA 2DHEA 3FYUA 5CMLA 3BDVA 3JYHA 4B7ZA 5JD4A 4G8BA 2XUPA 3I1IA 1U2EA 3HACA 4BCDA 3L1IA 3KSRA 2WSLA 4GEGA 4W1PA 3L1JA 4BYMA 1KEZA 4K6GA 5DWDA 1JJIA 4WDQA 4TVKA 4U2CA 1VOTA 2DQZA 1HKHA 1YA8A 4UHEA 5HQ3A 1QE3A 3V48A 5AIAA 1NX9A 4F21A 3HEAA 4HRYA 3JW8A 1TQHA 5FV4A 2HU5A 4DSAA 4J3JA 5ESRA 1GPLA 3FLAA 3BF8A 1EB9A 1QIHA 1HLGA 1YASA 4Q82A 5AICA 1W1IA 4H7EA 4J0KA 5AK6A 3ZLUA 3DYIA 1K5PA 1DWOA 1BRTA 2QOEA
chains in the Genus database with same CATH superfamily
3COJA 2OA0A 5EJ9A 3HDVA 5JUWA 4MV1A 3ZWDA 3KAQA 4J03A 1WUYA 2JFOA 3H5IA 4WTOA 4X60A 3V7WA 5HYVA 1HNWB 1FMLA 1FDRA 2EFCB 2QW8A 2WG1A 5I9SA 1T2CA 3WB1A 5K05A 5MN4A 4XYGA 1EFPA 1JV2B 1ATZA 4G9BA 4PYRA 1WULS 2HHAA 3CRQA 4YH1A 3QKSB 1DC6A 3SGLA 2ZS7A 3F97A 4CV3A 1G8FA 1JAIA 4RJLA 4B6FA 5FX2A 4RSHA 3UK1A 3TSCA 4BP9A 3BRSA 1WSWA 4UXJA 4NCAA 1I2AA 2FK8A 3ECCA 5FUXA 1G8AA 2H7VA 5J23A 2QTLA 4D0SA 2JVJA 2FP4A 4HV4A 2PR7A 3PD7A 4B3SB 3TNYA 4UM5A 1ZU4A 3KO8A 2C7OA 4GR4A 4OAQA 1Q14A 4PIMA 3KB8A 5AHXA 3DTVD 5CDSA 4CLEA 5CLFA 1QB7A 3KKQA 3OU6A 4L51A 5F2NA 3ZV5A 4EFNA 1BKSB 3BAZA 5I4BA 5FEMA 4P38A 2AXNA 3PJEA 1XE3A 2FSUA 3P0IA 3M3HA 2H4XA 1XDWA 2OKCA 4Z99A 1ABBA 1PGJA 2OXIA 2LCIA 5JYCA 1NBIA 3SMQA 1H6DA 2YWCA 4L28A 4Q9HA 4J1TA 1E3TA 1DIRA 1HYHA 5FWYB 5A4KA 1VLHA 5GQSA 4BAZA 2R00C 3GCWA 4H1UA 4LXIA 4TV9F 3G59A 5LOVA 3T5MA 2QXUA 3QE3A 4B4VA 4AZTA 2BUAA 4DIOA 4FCCA 3FTQA 1TLTA 5EKXA 4YXWA 2Z6QA 1UBMS 1W0CA 1C3OB 1TM7E 2YV1A 4XPIA 4XASA 4CUJA 4EYOA 1ZKDA 2QBYB 1E69A 5GM1A 2XMBA 2Q21A 1IPFA 1GXSA 3N5KA 1MIOA 1UBTS 1GNLA 5DLDA 3W9YA 4ALIA 2PK3A 5E0KB 4EGQA 3KQWA 4H1HA 1ECPA 2VHEA 4KRFA 1NKTA 2J08A 1DQNA 2PUGA 3RSGA 3DV0A 3H19A 4J8PA 3ZV7A 3FAKA 2Z3WA 1N2HA 1EWYA 1YIDA 3UAGA 1VPWA 4IP0A 5FRDA 1DV2A 2W2KA 1H9BA 4AKSA 1N25A 3TRJA 3B6JA 4B8YA 1DBIA 1TZKA 1Z6ZA 4MRRA 5CB0A 3AVXA 1X7GA 3JU3A 4MVJM 4HDNB 1QH8B 3A58B 1OU0A 3U4CA 3DD1A 3QE9Y 3Q87B 2WIFA 4G26A 3PGVA 4WFIA 4I4CA 2BJWA 4A6XA 2FSPA 4DUPA 3PFCA 2BJVA 2BY4A 3H05A 4GVPA 2OM6A 1PJQA 3GUVA 4L9AA 3U3KA 3NNDA 4OQLA 3ZS8A 1GGFA 2DETA 3RRJA 1T5OA 1OGJA 3FWZA 4YYZA 4RSRA 3GNQA 4GX2A 1Y4UA 3QYJA 5LWHA 1K7EB 1XL1A 2EX0A 3QXJA 5THQA 4AMUA 4N8DA 5ELLA 3WGJA 4JQZA 3SZ3A 4UCQA 1J2JA 1I2BA 2DP4E 1XFDA 3K0CC 4IAOA 3RSCA 1M2VB 1V39A 3LNCA 3N39C 4OGFA 3RT9A 1H8HA 3LHKA 2HU8A 4RLQA 5JU6A 2CV2A 1N6OA 1G5TA 2Q5IA 2ZEJA 2O6LA 3F67A 2YJ5A 2PYDA 5E2AA 4BNDB 4M0KA 3OY7A 3MTIA 4PW0A 4BEWA 1WNTA 4F1WA 2RHWA 3P2JA 4F12A 3Q8LA 3KALA 1K8XB 2CY0A 5JJCA 3B6KA 4FR0A 5EIHA 1O9GA 1H2WA 5BW6B 4DL9A 4DSZA 1CV2A 1FSZA 2CHUA 3O5AA 1H8ED 2PMFA 3KT3A 4JSRA 4R7ZA 3AF1A 4J0HA 2WT8A 3RWOA 1WVMA 4F86A 2Z9DA 2GPJA 2Q0HA 2C4MA 5CFNA 3WOHA 1BKDR 1PJ3A 1CEXA 2B99A 2R5WA 5B3KA 1H2FA 1FFYA 2GJ9A 5FBQB 1WKVA 3VKVA 1X2BA 2YXPX 3BQ9A 3KU1A 1Z2AA 3NM6B 1H9AA 2ASEA 2F48A 5T6BA 4BCBA 4FMDF 2NYVA 1V8BA 2NXNA 4BUZA 5K8UA 2IX3A 2PT5A 4AX8A 1GYRA 5FL3A 3TD2A 1Y34E 2QLTA 2P0EA 3K0FA 3NONA 2HHLA 2PNFA 2ILTA 3KVYA 5JASA 3U7QB 1LTQA 1E1LA 2VJMB 4YDQA 3LPDA 1A9RA 1K9SA 1KEWA 1PJZA 4EFKA 4S2EA 4DV3B 4YYEA 2VWGA 1WBBA 1T1SA 4QTTB 2QIPA 2M6LA 3LBYA 5DB4A 3U7RA 1UFRA 16PKA 4MV0A 3RNLA 3W8DA 3DKKA 4DM3A 2VHQA 3DBRA 3GUHA 3NP7A 2DBVO 1ONOA 3C74A 2JG3A 2VL7A 3K7EA 1ZW1A 1JIXA 1WUJS 3LJKA 4O4HA 4YK7A 2QGFA 1JPNA 3COYA 4U2GA 5E38A 1KAQA 3PX2A 3PQ4A 1O5TA 1AE1A 3PT9A 1E6MA 2IYNA 1ZM2A 3SHVA 4FYHA 1GT91 2AVDA 3NP9A 5EGNA 3NV9A 2FCRA 4EX7A 3U4QB 3PK0A 2YWHA 2CVFA 2G4VA 5GY7A 2QRQA 3FGZA 2G5TA 4YMIA 3L6RA 1D4AA 3MGCA 4GM0A 4DLRA 5B7QA 5I6DA 1FSGA 3CM0A 4TLBA 1Y5RA 4M98A 2OXEA 2WWVD 4I66A 3R23A 1PS0A 1G3UA 1A95A 1I6LA 3SM3A 1JEQA 4M87A 4OKNA 3VSEA 4B3TB 3RW9A 2XUDA 4GZLA 4RH0A 3TQHA 4CL0A 4NONA 1NY6A 1XZNA 4M6WB 4A8JA 3L01A 3Q15C 5F23A 1XVIA 3R7WA 4A0SA 4XWWA 3OY2A 2I2CA 5BMVA 3P71T 2QLMA 3HRKA 3FPAA 3PC4A 5FTNA 1W8DA 2AC7A 5ALQA 2DH5A 3GMIA 3ZHRA 1Y1RA 3ZR4B 4AMZA 1FFDA 1RJWA 3G6WA 5E2BA 3HCCA 4IGAA 1MH9A 1BFUA 1NQVA 1X1CA 1BXGA 1KFKB 2VQEB 4TMYA 3HXPA 1SQ6A 1XD9A 1T3ZA 2JH3A 2X6QA 4K6HA 4L73A 3ZVMA 1F2TA 2WMOB 4ZJYA 2BGGA 4QFDA 3P0EA 3H6HA 5KYKA 2RKOA 1M67A 3K72B 3Q7PA 2F8LA 3GRUA 2I4OA 3OX1A 4XYLA 1H4VB 1DO2A 1JEJA 4ZV7A 1BE8A 2TS1A 3QTTA 3QWHA 5AW5A 1UOOA 1CC1S 1W9HA 4MDYA 1XTRA 2IC5A 5I9TA 3VR0A 4CIVA 1CZUA 3ANYB 4DQKA 5CT9A 1E6EA 3LZCA 1BDJA 1E0SA 4CF6A 3MMNA 1DRKA 1UZLA 4B84A 4KFRA 4X85A 5JZOA 1HSOA 2VT3A 1L8XA 1OGIA 1IVNA 1T43A 1Y6RA 2X9NA 4P34A 5LP1A 1GQQA 1W9MA 3B70A 3M5PA 5EJ5A 4LI0A 2AFHB 3Q6NA 4MPTA 2HDHA 4MMZB 5F5LA 4QKQA 3E9MA 3WMRA 4X20A 1GPDG 3HCAA 2PMKA 5D7NA 1M2VA 2PA3A 3IC5A 2WRZA 3P0HA 2CFCA 2OP1A 1FP2A 2ZTUA 3H5VA 3HXLA 3B9RA 3KZOA 1RYZA 5JS7A 1VJCA 2IPMA 5DN9A 3S5JA 3D2LA 3VXKA 5HRUA 2PRIA 4NJEB 1YONA 2IZ5A 3KFLA 1UKZA 3O4VA 4JDPA 3H2BA 5KTOA 5C8DA 1I36A 1JKFA 4UM9B 3RIGA 3VYSB 1G2IA 4TSFA 4HUTA 1CQIA 1RM5A 1EG7A 1GADO 3FUUA 4IDCA 3SR4A 4BJHB 5IM4F 5LCXA 2H8KA 5P8WA 1KAGA 5EMKA 4FT2A 2CLLB 2JKYA 3DEYX 4WJKB 3AMVA 3K2QA 4CM4B 2VO1A 2R68A 3RSFA 2BFDA 5DMHA 1JHUA 2W6OA 4MV5A 2NG1A 3WHKA 1PFKA 3TIFA 5JNRA 4LWPA 1J24A 2FEXA 2G70A 3D8RA 2WM3A 5K3EA 2R84A 3M33A 4PN3A 2AG5A 5EVCA 5BO5A 3NMUF 1QHIA 4JS0A 3K09A 1U0TA 1HL3A 3PE4A 3TZQA 3VVLA 3ZD9A 2D54A 3LDUA 3FHCB 4A6PA 3G02A 4MPRA 1G19A 1Y6QA 4IIGA 3TUIC 1UKAA 1J0BA 2GN6A 4D4HA 1OKKD 3KJFA 1ZD9A 2QR3A 2ZI4A 3BKXA 4IDDA 4YCMA 3UJ9A 2CV1A 1CULC 4EGJA 4LHVA 4RZSA 2WNSA 4X61A 2YYYA 3RAGA 1DOHA 2YWXA 2DTEA 1B23P 5DHTA 2JNWA 2X5OA 4ZCSA 4BNHA 1GRVA 1N5LA 2K7ZA 2FPIB 4A6EA 2JD1A 4YB8A 4ER7A 3S0JA 2FWNA 4LE0A 4RSGA 4US1R 2EKBA 1IB6A 2J07A 4FBMA 1NP6A 1HFWA 1VKNA 1O0SA 3L4BA 2J9RA 4UC0A 5TVKA 5JYBA 4IW3B 4R2XA 1FFXB 3CCBA 4Q03A 1CUVA 2QN8A 4L7VA 4LJ7A 4NE2A 5F78A 3ZBPA 2CNWD 4YP9A 3WLQA 1JEYA 4D0NA 1L5QA 3ANTA 3VR5H 1OZ0A 2BFWA 2QQGA 3SBXA 3RTDA 1HT1E 2M98A 4WKCA 1K97A 2A88A 4QT4A 4MPPA 3KLOA 1UQUA 5B3JA 3ZG6A 5D01A 1DG1G 2VNJA 3G5LA 1N1MA 3SQLA 1GLGA 1KP2A 2Z56A 5DGTA 1IOWA 1PD1A 5G4KA 4N3BA 1SC3A 2OSVA 2YHIB 5K8LA 2IWHA 1XVVA 3F5QA 1BJKA 3CEAA 1ECCA 3WK4A 4BFUA 2PV7A 1E5LA 2IYAA 3DDWA 4H6PA 4IQGA 4CN9A 3SD7A 1EDOA 4TUYF 3PBKA 1R3DA 3OZGA 4NZPA 1EDEA 3EIUA 4OV6B 4WKNA 2VTKA 3FRJA 3IVCA 1RFGE 1YQQA 2PUBA 2AMYA 1EQUA 2XA9A 1K27A 2QTZA 2O05A 1TADA 3GARA 5E95A 3FH0A 4E09A 2C3MA 4IIJA 2PAFA 4NH4A 4JP2A 2KLBA 3OU2A 3B1KA 3DBLB 4FYVA 3R76A 5JQGA 3W5DA 2W5UA 3KD3A 3QE2A 4XX1A 4UPEA 3IPLA 4UOQA 2WNHA 5HUHA 5L9AA 5TT1A 2H0AA 3SHOA 2QTRA 3L79A 3QPWA 3R3ZA 2XCRB 4H7DA 1DKLA 3GT4A 1A7UA 6YASA 3R5TA 1EH5A 3ZWYA 1WXXA 2ZJ2A 4GXRA 4JVOA 2ZWOA 3JATA 1T36B 4JFRA 5DRYA 3WRWA 1CZKA 1PDVA 3DNMA 4FFPA 2K87A 5IJ0A 1P44A 5FUYA 3SIXA 3T4EA 3CGWA 3X2SA 5F21A 5KOIA 3ICWA 5HFNA 2WK1A 1RC1A 4L5AA 2J3JA 3R3YA 2VPTA 3HY3A 1WAMA 3OQJA 2VWQA 4GX1A 2BHTA 1OXKB 2W2MA 2XAAA 3TAXA 1A5ZA 1LI5A 3QUQA 1RC0A 3DMNA 1ZUHA 5KKAA 2C5HA 4F4HA 4MLPA 2IF2A 4H31A 1Z4OA 1RQRA 2IIPA 1DMRA 2OMKA 3LDHA 2PNJA 3RYHB 3RAFC 4I7EA 3U7GA 3PG5A 3KWLA 1I7DA 3E3AA 3HPRA 4DHWA 3HI6A 4LGVA 3IVGA 1F12A 4F38A 5C1DA 4KXVA 3QKWA 3CFYA 4HDMA 3CW8X 3LT5A 4GKVA 1D2NA 4E33A 1F38A 1Y1QA 2ANBA 4XIFA 4CIWA 1P19A 3GT0A 4KHPB 3A0RB 4UVHA 3A3NA 4LCEA 1V8FA 1JR3D 4O4LA 3E8SA 4ZAZA 5C1PA 2VAXA 4F3CA 1MVNA 2UU9B 3FWHA 3K70C 4DJEC 4XRGA 1XQ6A 1WB6A 4C29A 1D3AA 2VSXA 3GJQA 4WZBA 5DT9A 2XT0A 4F7WA 4YRKA 5LXTA 3Q88A 1NVDA 4WKBA 1C4KA 4L9WA 4AJLA 1PJCA 4YCSA 1C3JA 3GW8A 2DX7A 3WV4A 3AFHA 3TTUA 2D2FA 4H3SA 4B6QA 3IFSA 3SYMA 3AHDA 4LVUA 2RB4A 3GEPA 2L69A 2B4TO 3JVUA 3BXXA 2XVMA 2GSDA 1F7VA 1UPCA 1B2LA 4KPGA 3RI3A 4DFDA 3MAGA 1AKNA 2E5FA 2YV4A 1U8XX 3BXPA 3DAGA 1J97A 5TMDA 3SN6A 1Z47A 3CZAA 4IDEA 1HGXA 1KK3A 4R84A 3N75A 4GECA 1QB8A 3AUTA 4ZOLA 1CUYA 1IAVA 3C15C 4AP5A 4DNOA 5L4SA 5ULLA 4QJ3A 1TZJA 5JIBA 3B5IA 2EYQA 2V6JA 1PWXA 1S2DA 1DFHA 1Z5VA 1EGHA 3EIWA 4LK2A 4Y9UA 1CZNA 1KDPA 3FDZA 1QNFA 3F3SA 3MJDA 3TF5A 3CWQA 2CL5A 2Q0XA 3PPVA 1YUMA 4MJ3A 1TPYA 2J3KA 4NMHA 4R1LA 4YS6A 5IAJA 4A27A 3G0GA 3O73A 1T4GA 4YI5A 4CM8A 1W8IA 1H3NA 3DFIA 3ZLVA 1OWPA 3MHPA 1LLQA 2ZR7A 1BVYF 5HTKA 1Y1LA 4PLCA 1JGTA 3W1VA 4KAJA 3LPLA 3WFZA 2EFDB 4WUTA 5LMZA 3KT6A 4R51A 4FFWA 2AS0A 5ALMA 5DP2A 3E9NA 1N6HA 3C3PA 2C0CA 1AKUA 1JZSA 2BLNA 3NASA 3R4VA 1TECE 1COZA 5AIBA 1T2AA 3HMKA 1SC6A 3ITEA 5E1OA 1Z88A 2OV2A 4H3KB 4UUPA 3H42B 1S9HA 1UWVA 2IGTA 3C8UA 4FKZA 1R5JA 4K9MA 4BVEA 4QJBA 2PUAA 1CZRA 3HKCA 1RI4A 4MULA 1NYRA 4LRYA 4CU2A 1R0LA 4Y6LA 3T34A 3THOA 4MJ7A 3LKVA 2QAGA 2V5UA 1C0PA 3A7DA 3D1JA 3GLHA 4PRYA 3F1KA 5CT6A 2Z4RA 5JISA 1JPJA 5JCJA 1GN9A 1L5OA 2IHNA 3K9NA 3KM0A 1BE6A 1RXCA 4HEQA 4BRUA 3X2EA 3VR3A 1I3CA 1ZLXA 4E5DA 3UCFA 4BRZA 2VPWA 3AR6A 1Z6XA 4JBIA 1D4OA 3VAAA 2BRUC 1S2NA 2XUQA 4KDCA 3VDNB 2DBQA 2RI0A 4QOSA 4MI9A 5I5EA 3DOCA 2OD9A 1XO1A 4DJ5X 1FMFA 3MS2A 1XU7A 1GUZA 1E9CA 3KPWA 3LBAA 4JJAA 4KZPA 3BMQA 5IULC 3GU3A 3RSSA 4YLEA 2JCGA 1PV2A 5BV0A 3BMOA 5HQJA 2CFOA 5ENZA 3UNXA 3VU1A 2CJYA 2ISSD 1Q92A 3EC1A 1UMKA 5CFQA 3VR4A 4J1TC 4M1WA 1CIPA 1L7XA 2BEKA 3E2MA 3HDJA 3T9DA 1F60A 2E55A 3MW8A 3PP8A 3KL2A 2JANA 1PGQA 4ZWNA 4FNGA 2Q3DA 2QM3A 4QU5A 3PRKE 2YJ6A 5ICFA 5DHFA 3DMYA 1TMGE 9ATCA 1J8DA 1ZXLA 2L2QA 3EPPA 4GOND 3ZDYB 3DH0A 2C3PA 4F97A 3D2BA 2HWWA 1X8JA 4B8ZA 1P81A 4AO7A 2PTHA 4PQRA 1XU4A 4F96A 5KOHB 5BWOA 2QX9A 4U2KA 5E8JA 1GU1A 5TQ2B 1JFVA 4F2GA 1EA7A 3MTAA 4HF7A 4B17A 2EFEB 4QBIA 4ENPA 1Y48E 1YQWA 3P4UA 3Q7RA 5H82A 3LW7A 5AJZA 3EUEA 2BMJA 2UZ3A 4BNXA 2R6R1 2B8EA 3D6HA 4OUDB 2BKXA 4R1SA 2N1MA 4DR7B 1R0XA 2W58A 1Z4KA 2AF4C 4PGFA 5IFLA 2B1QA 4O4HF 1AKEA 5BR1A 4MI3A 4GP6A 4PFJA 1V45E 4AW9A 1KAMA 1WVGA 1PZNA 1A9YA 2LIVA 3UKJA 2XIQA 5HSGA 5J43A 4C88A 2G09A 1SXIA 3G7NA 4J90A 4QFMA 4Z49A 2JBHA 3B9PA 3IBCA 2BFEA 5LUBA 1S2IA 4QUBA 5BRNA 3IURA 1C0IA 1GYPA 1NKSA 2AHOA 2G9NA 2FSGA 1WWKA 5F9FA 1Q0HA 1RPJA 2JASA 4P3OA 1QG0A 4H16A 1NXOA 5DV9A 2ZT7A 1IONA 4TN1A 1OREA 5H80A 1SCNE 4QJ5A 4YC7A 1PGOA 2FPUA 4DRZA 1CD5A 1QJCA 5HIIA 4KQKA 2C99A 1YRLA 2LPMA 5A9SA 3P9CA 4CKBA 4A0RA 1HRDA 1P4GA 1VL0A 2WUVA 3LUJA 3PCRB 4IEEA 4TKZA 2X5KO 2ZWAA 3DMTC 2CWWA 3FMIA 3ZIUA 1DCFA 2R8OA 4OQPA 3HCBA 3OUTA 3BQNB 1EPUA 2QSUA 5H83A 2YXBA 4DF3A 2BGTA 5K3OA 2HMTA 4MRVA 5IJWA 4LDPA 2ZRJA 5PNTA 4GM4A 1GCGA 4V24A 2FPGA 2NTJA 5B64A 3VYWA 2VAMA 2VR1A 3L1UA 3F47A 3JWEA 1GG9A 4BUCA 3S44A 4OGLA 5FWXB 5B30A 5BW4A 5BSFA 3CW2A 1R0SA 3KR9A 1YQ9A 4Z4EA 2JIOA 1W6UA 1DUIA 1H42A 2C5AA 2WILA 4UNQA 5G53C 1I10A 3FDIA 3KOWA 4YQEA 3M2TA 4KKVA 4PBRA 2RGEA 3V1MA 4JLNA 3L6EA 2R8PA 4LDRA 4WD3A 5KOJB 4OL0A 5LQMA 4IPTA 4JBLA 2C59A 3CU5A 4HEJA 5EN4A 4KE6A 5BQXA 4MQ4A 4IRXA 1B8UA 2FMHA 4NAUA 3AUUA 5FBLB 1NATA 2OM2A 4D3DA 4FB4A 2CD7A 1G9TA 1MC1A 4YUXA 2J87A 3BIOA 3I52A 3T3EA 4RULA 1G38A 2FUCA 1F2DA 4FQ7A 5EJFA 2WJ4A 4ZT3A 1SQGA 3WBKA 1SKMA 4FYIA 4L0MA 1G7SA 2II6A 1WSBA 3NS7A 1HZZC 1QS0A 3ZGVA 1XGKA 1V4VA 1ODTC 4WXMA 4PS0A 3LOPA 1QIJA 2ZG6A 5GTDA 1KC1A 3NBMA 1ODKA 2R66A 3NU1A 1PL7A 1PT8A 4HDKA 4MQEA 4FMDB 3Q7QA 1K75A 3HDQA 1EFVA 2JFWA 4XSHA 4PPNA 1FYXA 4EA9A 4OU4A 3GIDA 4IHJB 1N57A 3EFOB 3WGUA 1Z29A 3DTTA 3SVZA 5FXMA 4BXOB 3MILA 1XRRA 3A3YA 3CLKA 4B79A 3A4IA 4ZMSA 4Q9IA 1NXPA 3PFNA 3EIFA 2X5NA 1U0HC 3VPAA 3GGSA 3IOEA 1SKYE 3AL3A 5AVOA 3EDCA 4BMSA 3GRYA 1ECLA 2OAGA 3OQ6A 1W0KA 4FOSA 1VG0B 1IQPA 3TZKA 2IYLD 1CJVC 3LS2A 3QNMA 3BICA 4FYKA 4JBNA 4KC0A 3UXHA 2ZU6A 1FQKA 1IDOA 3RIMA 2HBZA 3KR2A 3ANSA 2OHIA 2C7GA 3RBZA 4Q1BA 5LDDC 4JI0B 2VNSA 3WMWA 3T7KA 3OMLA 3W4IA 3LUHA 3I8SA 2RC5A 3TGPA 5K6AA 3MQFA 5FUWA 4WZAE 5GZ6A 4B83A 4IWNA 3KZ1E 4Q7EA 1OJLA 2GETA 1PR1A 1GPBA 4C0BA 2ZJ1A 4GWKA 4I9NA 4ZT7A 1LH0A 2ZWVA 3UQYS 4CF4A 5I7UA 4FJ1A 1W5FA 2P78A 2P9TA 2ACWA 2A9QA 2P4SA 2BV3A 1V16A 4KMMA 3A6LA 3WGTA 4D79A 1D1TA 1B43A 3PQDA 4B8WA 4IOKA 4V02A 5DH9A 4C1NA 2OHGA 1HSZA 5L7WA 2Z6AA 1K2WA 4ZEXA 1SXHA 4HDSB 1LLUA 1SU8A 3PXCX 4XGKA 4FWTA 1OB2A 2QB5A 1HYGA 3FVWA 4Z9AA 3V7YA 3EVTA 1JDBB 4YHHB 3F71A 3E4CA 2XWSA 3HHPA 1J8VA 2X6TA 3QBVA 4KXYA 4AF7A 5LMUB 1RLIA 4EMUA 4BYGA 4XFDA 1N0UA 2P9FA 3FNFA 4R6XA 1YDEA 3EXFA 1E79A 2G4CA 4A8HA 1IWPB 2B2XA 3I9LA 3OTOB 3VC2A 2RJOA 3JQBA 2EERA 5EUQB 2DFLA 4OFZA 2CGEA 3KE9A 4A8JB 5IVPA 4CMEC 5GJVC 3VMMA 4PNPA 4E08A 4RPJA 4RWZA 5IKMA 4FI3C 4D0RA 1RWKA 1LFDB 4LOLA 3A6HA 5KNBA 1W19A 4TXJA 1W29A 2K2WA 2W2XA 4ARBA 4EG7A 1QF6A 2ZIGA 1D09A 3WDSA 1I7QB 1YZGA 2AV6A 1U7ZA 2AL7A 2OV1A 3PL5A 5JJ5A 3A06A 2DQYA 3AERA 2O7QA 3BMOB 2ABWA 3F5SA 3GV0A 4YVFA 4RVNA 3OQBA 3PNVA 3NIFB 2X9GA 5CCDA 3TQQA 4YUZA 4ZU1X 1CRLA 1FDWA 3INGA 5SY4A 4F56A 2ZKLA 5BW5A 2PUEA 3CR7A 3A9RA 3ORHA 3Q1KA 4HAWA 5A9RA 4MW5A 4DLTA 2WB4A 1XZFA 4MWZA 2GDJA 4QNMA 2G1KA 2B1GA 3AEUA 2YUTA 4K81B 4TMXA 4X91A 5HCUA 2PXCA 4ZXFA 2FU5C 2GTIA 3P9NA 1G66A 1IM5A 1PR4A 1F0PA 2BFFA 2WM2A 3G5MA 3PQ7A 4IHKA 1NONA 4URXR 5JO9A 4QHYA 4NE7A 3T15A 3A4LA 2QTHA 3ZNPA 1G0NA 1P5ZB 2ODTX 3SC4A 3EZ7A 5AVKA 5BQ5A 4Z2AA 4H08A 1V7CA 1AKQA 3W2GA 3JQDA 1RVDA 4OQDA 3PEWA 2WZDA 4I55B 4KQJA 3TRHA 1N8SA 4UTZA 5TMBA 2AR7A 2GYWA 3QVLA 1UIRA 1AZWA 1BHJA 1EWRA 4MS1B 4RENA 3TQOA 1EAYA 5FPSA 1SCJA 1FOEB 3SZMA 3RJMA 4CTNA 5BPFA 2OB2A 4RDHA 1NURA 2B36A 3NW9A 4PCVA 1ZAYA 1EK0A 1PR9A 4CQMD 4TTSA 2NT4A 5GGYA 1NY5A 4JI5B 3WXMA 1AUVA 4NIMA 3UJAA 5D2CA 2GERA 2XT6A 1Z13A 4F6RB 2I87A 3AVQA 2ATEA 3P2YA 2D0OB 7YASA 3GVXA 3I73A 3BZBA 4FSXA 2AXEA 1A1VA 1BX1A 1KL7A 2WI8A 1QLJA 3G85A 3CC8A 4EM6A 4MJLA 4PG4A 4O3MA 3G0HA 3PJFA 4J9VA 1E7WA 1V1RA 2N3ZA 2SKDA 5FBZA 2A0YA 3LDGA 3QHQA 2NXEA 3OJCA 3PT5A 2OC4A 1GQYA 1L8OA 5LA6B 1DAGA 2EZ8A 4QPPA 3LPNA 4Z51A 3SXUA 2Y3IA 4WPGA 2VVTA 1JQLB 4CIXA 1YL5A 3OZEA 3W6PA 3OA2A 1EFUA 3TCKA 4ZQEA 1SVMA 3A2MA 2ZUEA 1K6IA 3GDOA 4DLWA 2BR3A 2B3DA 1ORTA 2BMFA 3NXSA 1YC2A 1O0BA 1OLUB 3SR0A 5KPDA 3OMXA 4MVJF 3CBGA 2ZSIA 1V11B 2X1MA 4UPVA 1J2RA 1ATIA 3DTVB 1KSGA 5C7IO 1SBQA 1RQPA 1RLJA 4BBZA 4F45A 1HMYA 4YMHA 2M1ZA 5C4MA 1BDHA 4C43A 3AB8A 3AKZA 2A57A 3EDRA 3O8RA 2IE0A 2Z08A 3NX4A 4OA5A 4B71A 2C2GA 4KVZA 4HH3C 2AX4A 4AUNA 4ZI7A 2AI2A 2PKQP 3D31A 4LZPA 4RACA 5FQOA 4EKYA 1JL3A 3GLGB 3Q8KA 3HCOA 4EGCB 1F8XA 2ZS9A 3B9BA 1JYSA 3FNEA 4LDAA 3UG6A 3ELWA 2HTEA 4MYTA 4ZO7A 4EG1A 3UM9A 4JYCA 3TH5A 3N86A 4DPLA 1MJNA 3DDHA 4DLNA 4AZ3A 4LF8B 4RVDA 1ZGBA 4NU0A 1Q57A 1W0JD 3BM5A 4XWKA 1L4FA 2EV9A 1JU9A 2C57A 4YMUA 3P0JA 5LUAA 5AK0A 4Q4AA 1VC2A 5JATA 4QVIA 5EINA 3VR4D 1G5QA 4ABTA 5KJ1A 1E3SA 2VUHB 1DX9A 2YIJA 3NOVA 4QSMA 2JKZA 3BSSA 4ZZ1A 2D13A 4NOKA 5EJEA 4GKKB 3VNBA 1KJWA 3IEKA 1A2QA 5EE0A 5CTJA 5G41A 4BNUA 1KVTA 3S5UA 1PR5A 1B93A 1UZUA 3QLTA 4YRRA 3P94A 1DAIA 2HWUA 1Z39A 1YWGO 3IV9A 1E99A 2ODBA 3PIIA 4B44A 3EHDA 1AUQA 4MLZA 4BNIA 3TW4A 1VP3A 2PLFA 1QVRA 4C7BA 1E9BA 3OP1A 5JPCA 4IHJA 3DZKA 1X1DA 1W93A 2H5EA 4OSEA 3TTXA 1N9KA 3UQZA 3F3MA 3E2IA 4P7GA 3O0DA 4R8SA 1ENZA 1AUPA 1KMMA 2HAEA 1AN0A 3DKIA 4MWGA 4QAJA 4JWTA 4M0CA 4MHSA 3GWGA 2DUWA 4ID9A 3GVPA 2P1RA 3KUKA 3SS7X 3CTPA 4LJ4A 3ZD8A 4OQNA 1I94B 3MWDB 2UUBB 2CLIB 1CNEA 3FPBA 2E3JA 1Z68A 4MRPA 1L4KA 2PZEA 3WICA 1T3GA 2XQJA 4XWAA 4A3SA 2M6RA 3STHA 5CM2Z 4HWTA 2ZRDA 3F5MA 3MXTA 4C7JA 1MX5A 2AJCA 3QPVA 5BV2P 2JGEA 1L2TA 1TYEB 5A3QA 1R00A 1KR2A 3AEZA 3H9JA 5EEHA 3PNPA 1MX9A 1E5VA 3H9EO 1T1IA 3ONDA 1NXQA 5TDHA 4UBKA 1Z8NA 1PWYE 2GFIA 3SPXA 3PUXA 4HLUC 2BE7A 5LQNA 3BT7A 4HVAA 3TE6A 3UWSA 4B3FX 2I2DA 4A26A 4N5HX 3WRXA 2QPLA 4UUMA 2CMFA 1SIBE 2BMDA 2AFIA 4N54A 4O0LA 2HA2A 4J16A 3HFGA 3S1LA 1BU8A 3ZLTA 2Q6OA 1ES9A 1W36C 1RCTE 4HX9A 3S28A 3N2GB 3IJRA 1H0KA 3OBBA 2QI9F 4MVXA 2WAAA 1S3GA 3MG9A 4LWQA 3VOAA 3AR5A 4CIYA 4NJEA 1M75A 2VBIA 3B38A 3ZU5A 4HB2A 4KUHA 2F9FA 5G40A 1HK7A 1D5CA 4L6AA 3DEZA 1YJAA 3HBLA 3OI7A 3AQ4A 3OTQA 4BQSA 3TRIA 2EKLA 2Q3JA 3HFSA 4DR1B 3FPSA 4P6VF 1E9EA 1AVTA 5H5JA 2IP4A 4Y0NA 3AUAA 2BH9A 4BE9A 1OFIA 3RU7A 4DM7A 4KMRA 2H3EA 2QAGB 2CEKA 4DLBA 5U4XA 4ZYVA 1Y0BA 1JMVA 3I3OA 4E3WA 1CFJA 3S8YA 4GKAA 4G9GA 1ETHA 3O2NA 5KYUA 4ZRMA 4LJLA 5KHOC 5M2QA 3SZUA 3TPFA 4BATA 3BZUA 3RK0A 1S4QA 1GL7A 3QFCA 2YC4C 5A3VA 3C6YA 5C5CA 8GPBA 3LUKA 5KINB 2IPOA 1RIFA 4TMFA 3WB2A 5JZMA 5TEVA 3RUIA 3WRVA 1OILA 4DJJA 1TIBA 4FWBA 4R0VA 3WKEA 1AGYA 3KT8A 4S0XA 3JQ9A 5CGQB 2ZSFA 3M4XA 5EAIA 5ARCA 2A30A 2CYAA 1S8OA 4HAVA 1FK8A 4TOIA 2F3UA 4XB1A 5AKXA 3DFKA 4N3NA 3P9ZA 5BOVA 2WT9A 3EDOA 2Z1MA 2NQ8A 3KEFA 4IJWA 1FW8A 3WMGA 3MGBA 2OD2A 3O90A 3PDIA 3R3SA 1DS6A 2O0JA 2OHVA 2ZRGA 2PX2A 4Q4HA 4B2IA 3V4PB 3I61A 2AYXA 3OZVA 5AUQA 1AB6A 4M7RA 3D5EA 1KWKA 1H2HA 4A23A 2OGUA 4H6VA 4NENB 4ZO4A 4ZQIA 4WBNF 1EP9A 1TYZA 4MW0A 1SEVA 3RK1A 2RBGA 5F3RA 3VO9A 2DBYA 1OTXA 5BUCA 2IBTA 1K06A 4TRNA 3LLVA 4L4XA 4CDGA 4KNVA 2XMQA 4ZQBA 4WK0B 4MGZR 1K7FB 2HMAA 3C43A 2KW5A 2XV1A 1X8KA 5ICSA 1G8JA 3QIAA 2G71A 4GBMA 4AYXA 3E4DA 1GEGA 2BDEA 2PGNA 1RAEA 1MD9A 1SXGA 3HDHA 4JLBA 4RABA 4JUAA 5ALRA 1XMPA 1OHHA 1ESMA 2JZCA 2NO6A 3I4FA 1QRAA 1BFKA 2GZRA 1KYQA 3LH5A 2HA3A 4FQ8A 4INOA 3UOGA 3ZTTA 4C07A 4EPXA 1EG2A 2EWWA 1ZJ4A 4WXYB 3AWDA 1T4MA 2HCJB 2R1VB 4MVJH 1M2NA 1CB0A 1UPAA 1GCIA 2H17A 3ZXSA 3EIOA 3F3YA 5IDYA 3EEBA 1SELA 3K5WA 3NAQA 2FPLA 4LQLA 1I4WA 4PVDA 4B5KA 2O3TA 3ILXA 2AJLI 5HRCA 1SIWA 3WKCA 4IV8A 4JSTA 4YRGA 4KE7A 1IBLB 2UV8A 4PLTA 2V8BA 3DBIA 2W98A 1HEYA 2IYQA 4FNAA 2R751 4K6MA 5K3AA 1E5XA 1Q0SA 4GRIA 2IOFK 4U1RA 4KXUA 3X43A 5C8YA 1W1WA 2C61A 3V7NA 1CUWA 4WE3A 4AB1A 2WVGA 1Y1PA 3CISA 1NWHA 3QEMA 1N0HA 1LRJA 2IDMA 3U7IA 1EWQA 3B13B 2VS1A 1MEOA 3LHIA 1ZR2A 1JH8A 1CY2A 3PEEA 4XOUA 4AMGA 4YMWA 1UKYA 1FYVA 2YWFA 4KVGA 4Y7CA 5WRFA 4RMHA 3UA3A 3U16A 1GPH1 2NU8B 4DUYB 4LRSB 1G3IA 2A5FA 1S0UA 1GP2A 3FG9A 1VSTA 3RHZA 1FZTA 4X7RA 4KHZA 3NHUA 1SBZA 5CD1A 4H3HB 3JAKA 1CS0A 3X1ZA 4JI1B 5K4GA 3FPFA 5DULA 2IJGX 3B1WA 5D8DA 1JTEA 3FPLA 2Z09A 2QG9A 1WOMA 4QYIB 4XCQA 5JAQA 3DAFA 3I6BA 2O8VA 2E21A 3MUNA 3U26A 2HSJA 3D7LA 2JAPA 4FMCB 3H1GA 4LXUA 5A71A 2J4CA 5KJ6A 4D0GA 3DWFA 3RC2A 3UB3A 3E6AA 4EQZA 4R1MA 3B1VA 4W5TA 2PSDA 3MRTA 4JJ4A 2IITA 5JAHA 4AY2A 2YX1A 1JH9A 2MTBA 5FL7D 1Y3HA 1T3HA 1OXMA 3LPMA 1SXJB 2PCLA 2POQX 3HH8A 1E9VA 1RZ3A 2Q9BA 2HWYA 1CUAA 4NCBA 1WF6A 2I6QA 1Y63A 2BLLA 3OE5A 1G4UR 2OCGA 3G13A 4YAGA 4HDMB 4FLFA 2WF8A 3JWPA 4I1OA 2J3IA 1UH5A 4M8IA 4NYJR 4TV8B 1E2KA 1ZI8A 2D62A 3D43A 2IHYA 3IULA 4QHTA 7REQB 2R6HA 4LOAA 4QDOA 4XR9A 3TD6A 1C0EA 2BFBB 3E2PA 2E4XA 3KLBA 4E2XA 1E1CA 3I04M 4ER6A 1Y6FA 4NP6A 3QX9A 3FZEA 5IF3A 4DZZA 2W2TA 2RB5A 3EVNA 1WB5A 1XQWA 3VU8A 2BN4A 4HDKB 2Y71A 1SKAA 3WYDA 4MQ6A 3EQ7A 1ML4A 2JFFA 4UM8B 5EYPB 4I2VA 2I1QA 3K2IA 1DAFA 3LG2A 3VPDA 3WWZA 5IDQA 4DB2A 3MZ0A 3Q3HA 1PL8A 3EQZA 5AVXA 5KNDD 4GZ6A 3B1JA 4TQUS 1M8PA 3LF1A 2C8KA 1NC3A 1FY2A 1OFGA 4I99A 4YRLA 3SJ7A 3IS3A 1HA3A 5LLSA 1ORRA 1Z0IA 3NZEA 3ZV6A 2WJWA 4G0UA 4GT1A 3TE7A 1EYZA 5IAOA 1NU6A 1ZUD1 3BE8A 4JI7B 3PFGA 6NULA 3SQXA 5K03A 4HB4A 3Q7EA 3K09C 4JL8A 2BGIA 4R8VA 3NHAA 2Q3BA 2PBLA 5F9MA 2GAFA 3MJFA 1YZFA 3DVSX 1X87A 2J6CA 3K1YA 5JSZA 1B76A 2LR0A 5DBEX 3ESXA 5TT0A 3DUFB 5C32A 2QAIA 2ZETA 2Y92A 4YDRA 1O94C 4IIDA 2IY8A 2OFXA 5E9JA 3TQFA 2J8ZA 1Q95A 3QKRB 4J4HA 3WG9A 1QO0A 2AXQA 1PX0A 2VTBA 2BSQA 2R5NA 1BWRA 1DIBA 2HT6A 4MKXA 3BD6A 1XALA 4OK5A 1Y1KE 3MTBA 4CFZA 1ENOA 3IOBA 4GLJA 5JPIA 2P9GA 4DV4B 1ZNZA 2CNOA 2O0LA 3DW3X 3EGXA 1LFAA 1AQJA 4YJ2F 3QWAA 4D6PA 4E1BA 2BFBA 2ISQA 4L57A 1T4BA 3A1WA 3BDIA 4ECEA 4TZ6A 3CRNA 1DEXA 1QLWA 2JD0A 6ADHA 4OHVA 1VPVA 2F4NA 3IUMA 1NX6A 1QDUA 2F62A 5B1IA 4D8XA 4JU9A 4P22A 2D2IA 4OOEA 3QX3A 1TUGA 4QYWA 2WMDA 2DUJA 4ZREA 3O8NA 1M7HA 3LC2O 3E84A 3JTMA 4P4GA 5HS4A 4LXXA 4RK0A 1RMYA 1O77A 1J2YA 1KJIA 4YV2A 2UUCB 3OQNA 5HKAA 4TV9B 1XMJA 3C6KA 2PRKA 4Y6QA 3UMCA 5JS6A 5T5QA 5JXGA 1JEAA 1VE5A 4PVCA 3BZWA 3FJ1A 1M2KA 2GN4A 4IDPA 4A4DA 4BV2A 3Q41A 4EEKA 4R2JA 5FWDA 4LWZA 3LCUA 4A1FA 3UPUA 4YPFA 1EXMA 1LKZA 1VJRA 2HRBA 2IUEA 3ML1A 1H0RA 4J1QA 3VR5A 4CMIB 1EDZA 4EB6A 3K8YA 4ESVA 3W05A 2JFNA 4ATNA 1T0IA 2QRJA 2WAOA 1A9XA 4IRMA 2VN8A 3B8HA 3AJRA 3G1UA 2Y05A 1TTHA 3HI4A 3MINA 1EJBA 2EP8A 2V7VA 3ORRA 3I37X 3GPBA 2HX1A 4FHEA 2VT6A 1WBDA 5TEWA 2XE6A 3RRMA 3V32A 1NN5A 5E4JA 2PKQO 1FC0A 2Q50A 1YXMA 3G2LA 2XRYA 3E7XA 3IT0A 2AEMA 2Q7XA 4TS3A 3AIMA 5ARBA 1K66A 3U7FB 3DLPX 1M0WA 1FMJA 1JWBB 1PZMA 1ZVMA 3ZH2A 2ZUTA 3QEJA 1W4RA 1U63A 3OQIB 3H2KA 2REOA 1P2VA 5JDIA 4AN1A 4C0LA 3UWPA 4RAOA 3IVXA 1C9YA 3FTNA 3ZHBA 5FYDA 2CXUA 4RS3A 4E21A 1E89A 4RPKA 1O6CA 4G4SP 4NKRA 2WM8A 2M32A 3GD7A 5C4GB 3A8TA 4OM7A 3P96A 3FNBA 1BJTA 5HMLA 3PTLA 3OLQA 4CGYA 3D4BA 3O94A 3FLMA 4Q0MA 2NYAA 4X8MA 2RHLA 5AI6A 8MHTA 2ZIWB 3NVAA 1LUAA 3QKUA 2ILVA 3KRTA 4D44A 1E20A 1F8YA 3SC3A 2W71A 3G5AA 3G8YA 1U1GA 1QYIA 4NULA 5ENDA 4QOJA 1RBQA 1YVDA 2GK3A 3HU2A 5JQWA 5CJJA 3UYLA 4A91A 3SX0A 2I7VA 1Z7EA 3H11A 3M82A 3ZTWA 4DWVA 1BE0A 1SU6A 5IN5A 2QPTA 1WD5A 3GEHA 3UMMA 1BHO1 3N8DA 3TX2A 4FW9A 1P29A 3W6NA 1ISRA 2JAOA 3ZWOA 1S01A 3KJXA 4UQLA 1QORA 2GZ2A 1N5KA 3FPJA 1W30A 2NXJA 2WPDD 5TR9A 2GRUA 5K9ZA 3WA7A 2EZTA 1SD2A 3I5YA 2FX2A 1JFLA 2X3FA 5HE8A 3L8ZA 1BAPA 4WOKA 2EFHB 1F48A 1OVMA 3UK6A 4B6JA 3O4HA 3D3QA 3ETDA 2HA5A 1M0SA 3I4LA 3L18A 4YI3A 5EWJB 1UJ5A 3TVTA 4Q4CA 3DV0B 1NP7A 1H2EA 2N0SA 2BIFA 4DNPA 4CG1A 1ILWA 4R6WA 4Y1GA 4Z4QA 5I48A 1SBCA 4CMJA 3NHSA 4V2IA 5TV2A 3QOFA 1RYFA 2O2IA 1IG3A 4MGEA 4Z0TA 3TJRA 1KZ7B 4MQUA 2J5XA 3GCGA 1CUEA 4BQRA 1GY8A 4Y9DA 4GI7A 4WSOA 4E5YA 1G2OA 1OZHA 5AVZA 5FYQA 1JR3A 1XZAA 1E2UA 1OBVA 3W6OA 1K1EA 4LJ8A 1A69A 1SOAA 2X2PA 1U2DC 3UV6A 1ZOIA 1NYLA 3GLHE 2R4QA 4G5YA 2VUTA 4CU5A 2W90A 2BR5A 4Y2UA 4IOLA 1PK7A 3QBDA 1SD1A 1WMDA 4JB3A 4JN6B 3OCJA 3EVCA 3FFAA 2R6AA 5JHGB 1VE1A 1QZ3A 5J3JA 4AU1A 3B60A 4JL6A 2JLCA 3A1TA 3ND6A 4C3VA 4CJXA 3KC2A 4N9QA 4X7BA 4N5IX 1UL1X 4M86A 5JD5A 5KQSA 1K3FA 1DZ3A 1PN3A 2P2DA 5AO9A 2P35A 4RELA 1G6HA 1FUYB 1ADCA 1PJ8A 4OHMA 1QQAA 4B74A 3C8DA 1O6FA 2H6EA 1UBEA 4NEQA 4TM8A 2JEYA 5DN6D 1YV9A 3PE3A 4F5YA 3A6JA 3RTGA 3FD8A 4UBJA 3T99A 4IO1A 3VAYA 1TUBB 3AM1A 3N7TA 3JWIA 4NZNA 2DSTA 4A82A 2Y4NA 4QULA 5ITSA 4EGFA 4IS3A 2IVFA 1RZRD 3HDTA 2ZWMA 4RKRA 3GFTA 3QQ5A 2PLWA 1GG2A 1YU9A 1PG2A 2N75A 3HFRA 1GLNA 2PH1A 1DFGA 1JSLA 2PJUA 5BN3A 5LDHA 3AFMA 4CCYB 4K2HA 3JALB 3DDUA 4B3RB 5K8CA 1KYTA 2ZJ4A 1U9YA 2O8FB 3F8TA 4R68A 3WL7A 1AY0A 3SXJA 1A5AB 5L3SB 2HMSA 2FPXA 3LL4A 3AVTA 4EHKA 3GLTA 2EBHX 3LKBA 5I7AA 1ZVVA 1UMCB 4OIMA 1GZ5A 1QF9A 4MTCA 5IT4A 2L19A 5FBWB 1AO3A 2GYUA 4IG4A 4Q48A 3RS7A 2VYCA 2YRFA 1VBFA 5LYJF 1C7IA 4YJ3B 5K8IA 2JFBA 2HLHA 4X1IB 3WLKX 4XB2A 4QVGA 5EIBC 5CB8A 1T24A 3JVDA 5EXTA 3FDXA 3L1KA 4UAUA 5L3RA 4YJHA 3SJUA 5CFLA 1EP2B 4AQ7A 4M3NA 2CLFB 1QFJA 4ZVLA 1DG9A 2YY6A 3DT8A 4KACA 3RC7A 3BGWA 3L0YA 1UBRS 3VYUB 4MS4A 3V00A 1MJGA 3WYBA 2AUMA 1CFZA 2QU7A 1FE8A 3SY8A 5ER9A 3U39A 2NO7A 4AN4A 1EJ2A 4R3UC 2Q2OA 2QUZA 4C9BA 1WHTB 1ESEA 2YXNA 3R7DA 2YZNA 3F6EX 2ZFUA 3N2ZB 4RIHA 3RSHA 1Q6ZA 5CXUA 3BOSA 2DFKB 2G72A 2ZAMA 2I55A 1HZJA 2C9BA 3ND8A 4X8LA 5FLEX 3S68A 3VR4H 1ZMBA 4BX2A 4F3RA 1ORWA 3LLUA 2I34A 5FTWA 3C87A 5HK8A 1H2BA 1OTYA 1PCXA 2WLTA 2GD0A 2Q07A 2X0EA 3RYIA 1UBOS 2B61A 1W4AA 2A1UA 1ZN2A 2FE4A 2ST1A 3AC0A 1Y8RA 3CZ4A 2G40A 2ZANA 4QUKA 1V6CA 3EPRA 1M6HA 3RVJA 4C14A 5G0TA 4GLFA 3SEFA 4BRSA 1U0JA 1ZPDA 3DO5A 3W2HA 4NRDA 2ZZNA 4ENUA 3HUFA 4PLHA 3CONA 2AG8A 1KH2A 1E32A 2HJ9A 4V0NA 1Z08A 5IH7A 1BYIA 3EQ2A 1JUDA 4CCYA 2ZYRA 4IDGA 3GLFA 1Z26A 3FFWA 1Q84A 1SJ9A 1VHDA 2V0NA 3GFRA 3LC1O 4NK5A 4Y2VA 1NOKA 4RTSA 5C8YF 2QTGA 1V16B 1GGKA 4GQBA 3HB5X 1K4YA 1REQA 3RLIA 2J3HA 3KHKA 4OB7A 2O8DA 1N2XA 1V9CA 3DMTA 4HAOA 3ELDA 2WP8J 3IUJA 1OC2A 1RYEA 3EZ6A 3LRXA 1YACA 1C9KA 5FWAA 4O5OA 4YJFA 1PZHA 3AXSA 3VM6A 3ROEA 1XJ5A 4Q7QA 4KZKA 1RWXA 2DERA 2VKQA 5A4IS 3H1EA 1PG0A 3SKVA 2B8TA 1EE1A 4UFNA 5DNAA 4N0QA 1OBOA 3F6YA 3SSMA 5JNSA 3RYTC 1XK7A 2HU2A 4YP7A 2VQFB 2CV0A 1XZ8A 2VHJA 3DE3X 1W44A 1FNDA 5FV7A 3SBEA 5K3DA 5KREA 4ZZ3A 4IZIA 4EX6A 1T9CA 4W7IA 1UJ6A 4GXTA 4I46A 2R1TB 4MW2A 4F3KA 3ICQB 4AKHA 1U7PA 4AY3A 1C50A 3GJZA 4NQRA 4AURA 2GESA 2OQ2A 1VI2A 1JDUA 2V4MA 4P5EA 4EJ6A 2Y99A 1CLEA 1MT3A 1QUEA 1J8YF 1X42A 4F9EA 1BRMA 1AA6A 3D54D 3E3NA 3HQ4O 2RDMA 4GXNA 4W1RA 2OK8A 2E4AA 3KQPA 2P0AA 1ST3A 4QPDA 4RIFA 3C16C 2I3ZA 5JAPA 1USVA 3JWJA 4L3OA 4RKEA 2I1WA 3BD9A 4DUGD 2VJCA 2ZRMA 4DR5B 1QKJA 4U9HS 2XJ4A 2CVPA 2H7XA 1SZCA 1SXJD 4N5MA 3SQOA 1PSZA 1JVBA 3EXAA 1M1YB 2FPPA 4J91A 1J39A 1NNI1 2PCJA 4KTVE 4UFPA 5T4HA 5EERA 1CRPA 2DBRA 1KGDA 2PPVA 1PVDA 3NHJA 4YMSA 3K4QA 2JIPA 1BQ4A 1MUUA 2V1XA 3OUUA 1U3TA 5FPPA 5L3ZA 3GGJA 3PR3A 3QUCA 5EIOA 3WLLA 2AEFA 4TLMB 3EVDA 3JAWA 3WMEA 4S12A 3PV0A 2JLWA 4W8OA 2JCSA 4W8HA 3IAS6 4DNQA 3C85A 1CY8A 3JR3A 1K8YB 3HL4A 1A4RA 1MX1A 1Z6PA 2GBPA 3HU1A 4WZAB 4N0DA 3B20A 3THSA 3TK1A 3VSCA 3TRKA 1ZR4A 2Q4BA 1MTZA 2YINC 1D1SA 3H3XA 5KYVA 1QCCA 4LF4B 5H4GA 4LJ6A 4E2FA 2XRZA 4O2AF 1G8GA 1M54A 4CV2A 1ZZGA 2J5KA 1TA0A 4LSWA 1E7QA 3K9BA 4NABA 5IK2A 2QRVB 4J43A 4OSOA 3UW1A 1E2FA 3AFIA 4JYPA 4Y2YA 5K2MA 1RHUA 2FFJA 4RF3A 1UC5B 1XXHE 1NJ6A 5D84A 4CKWB 5JCPA 2DPYA 4CGZA 2UDPA 1CHNA 2WSSA 1WZNA 5AJWA 4D9KA 3BJZA 1G17A 1YDGA 3WQHA 1O57A 5AESA 3Q9UA 2V7EA 2YNMD 3G8AA 4HTFB 3MN1A 4Q3OA 1HH4A 5TB5A 5CFPA 3B3QA 5JWHA 1FTWA 1UT6A 1QQBA 1CYDA 4XJTA 2FJPA 5EXEA 2XBUA 1J5PA 3LQ4A 1M2WA 5FTLA 3DVRX 4ZVNA 5LU8A 2V3WA 1BS9A 1XLTC 1P2DA 3ETHA 4DCOA 3WNDA 3MIIA 4QU8A 5SZKB 3HN6A 3IPCA 3VJKA 1U90A 3ND9A 1X7DA 1U8ZA 4P54A 1DUVG 3DP7A 4BEBA 3IJ5A 4L8LA 2VBCA 1HQCA 1DEAA 1MH1A 1C7RA 3DO6A 5IUNC 2R6FA 2A9RA 5EZSA 1UBGA 3SE7A 4U02A 4IY1A 4LOJA 1C1HA 4ZYUA 3U19A 5CCBA 2B9EA 3K5IA 1F5SA 1W5EA 2QI9C 2YWEA 2HK6A 2Z2XA 2ZVJA 2WPDA 4FSDA 4O08A 4MKIA 3Q6MA 4OXXA 1ULSA 1XRSB 3WDLA 3JQAD 1OLOA 2QTWB 5FPKA 3G2QA 3AY0A 5BVHA 2HSEA 1FXWF 5JD3A 1X1BA 3QPDA 4IOMA 4QVKA 2NGRA 5M3BA 4Z7NB 4QRHA 3GJRA 1VZ3A 3C4QA 2IYSA 5JCOA 2BI4A 1O3YA 1YR7A 1O4WA 2XQVA 4DG8A 2BGWA 1NLYA 2OWEA 2XB8A 1GA1A 4V0KA 3AP3A 1W4LA 2ZIFA 1DGQA 1RE0A 3K96A 1UIMA 2QNBA 3ABZA 4O02B 4WKOA 1Y33E 2PD6A 4IYJA 3V34A 5GVSA 2ZRBA 4XQCA 1TRKA 2H07A 3MGKA 3ETCA 4J49A 2EAUA 3HUTA 1PEAA 2IYEA 4OH7A 3BK2A 3OAAA 4RZ2A 3BSFA 2DXIA 4A8PA 5AVUA 5HFAA 5JS2A 3VHLB 3N53A 4LCJA 5ECYA 4ZAWA 5ICMA 3ZE6A 3CNQS 4FEGA 2A67A 4KO8A 3RS3A 3PGXA 4M1MA 3GT7A 3ABOB 3I6YA 1S2LA 3AIKA 3DOFA 2JHGA 1G9XA 1BXRB 2GEUA 3TR5A 1L5HA 2GA8A 2RH5A 3CWCA 1LCIA 3EXIA 4N82A 4GVXA 3FF1A 2FY8A 4JJFA 4QXMA 2WOOA 3O4GA 2XKKA 3WJ7A 4ARUA 3B1YA 3OX3A 4B9AA 2IYXA 3O0TA 3Q40A 1F06A 2X9VA 4ZAGA 1TCBA 4QJ4A 3DMFA 3WLPA 2DEUA 5CNIA 1ZQ1A 3P2MA 5FNVB 5B1HA 3P20A 4AQYB 4TTJA 2O2YA 1H6CA 4TQ9A 3RYIB 1XCLA 3AJ9A 1OI7A 2NLOA 2G1PA 4GEKA 4LOIA 4MUBA 1Q11A 2Q1UA 4MVJE 3KZKA 3PEFA 1JHAA 2ZB8A 4IJUA 4RGQA 2O3QA 3UGTA 1HOXA 1R4ZA 3RFVA 4EB8A 5BWCA 1JQKA 1ZNXA 3ICPA 4G09A 2H5LA 3D6UA 4V38A 2FKNA 3QNWA 3G9UA 4W5HA 5KJEA 5JROA 3QXXA 2PJDA 3LGSA 3PGJA 2COUA 2GPSA 2DPHA 2P3SA 4RFLA 4QUIA 5EZYB 1TAUA 2JIZD 4YONB 3K35A 1KPHA 1YE3A 4PLYA 1ADBA 1B0AA 3DCIA 4R3WA 5FUBA 4K26A 1NHWA 4KN8A 2D1FA 4XSVA 3D4IA 3FHTA 2GSWA 3C3DA 5THXA 4Z0HO 3SQMA 2R97A 3FB1A 1E1QD 1GVNB 4IO0A 3HZRA 3DZBA 1QBKC 4GIBA 3SDZA 2QVCA 2G7MC 2HPVA 4YROA 4CYMA 1U2RA 5CVDA 1KEPA 1TFUA 3U7JA 1XKTA 1YNOA 1UC4B 2JD2A 3CNLA 2QX8A 3VH1A 4PLFA 1RPAA 1P1IA 3AKEA 1R50A 4BQIA 4DBZA 1XNQB 2JHAA 3KQTA 4Q3NA 1MX3A 1G2QA 1YULA 1SOWA 1TT5A 3SYLA 4QGBA 1WXEA 2J9FB 5EJGA 1W581 1VIMA 3G9XA 4KO1S 4EAQA 3B1FA 4LXGA 1J99A 1JJVA 4BPBA 3OFNA 1DNPA 3CLUD 4M2LA 1FS4A 4LQ4A 1YC5A 3HJTA 4FFBB 5ITWA 1AHIA 2D7CA 1FRFS 3WMFA 3AZQA 1W7AA 3UIEA 5TF4A 4FP9A 4PPQA 5T6MA 2VPZA 3HDYA 4K28A 4WWHA 5CLQA 3AW9A 1Q77A 2FF7A 1IVSA 1DKUA 2LKDA 2VDWA 1ISIA 2PGOA 2RGXA 2VRCD 3QNUA 4TMTA 1I2DA 5C1BA 3HYRA 2CL7X 2YQ4A 4M0DA 2P69A 2QG4A 5IVDA 2A1TS 1SCDA 4LI3X 4D4GA 4C7KA 5AW0A 1PLLA 3KBOA 3WNBA 3O93A 1XTUA 1U5BB 4CMGA 1R6DA 3CKKA 3OQHA 3AVYA 3KHSA 4QOHA 4D8UA 1OXUA 3W06A 2WUGA 2OYCA 4YMGA 4R8LA 4MA5A 1TEHA 2F3SA 4ND8B 2W11A 1Q16A 3LFUA 3PUKA 2GYVA 4RK6A 4CEJA 3RVKA 5DM4A 3WLRA 3FVTA 3LBNA 3IT2A 3ENWA 4HSEA 5J5CA 1RXVA 3OF5A 1HT3A 2HK7A 3T7CA 4B6EA 2OY0A 4Y2SA 3CPSA 5LN1A 3H2GA 1XCJA 5HF9A 3TLJA 1ZM4A 4BP3A 3I30X 3HU3A 1ZK2A 4B2PA 1GT6A 4BGUA 4P2GA 1LF5A 1W46A 2X19A 2XB4A 1P4SA 5KOYA 3CVXA 3Q9LA 1E2NA 1Y3BE 4IHQA 2H65A 4HATA 3R5XA 1Z0AA 2L18A 5EP4A 1WP9A 1IXRC 1NQOA 4WVFA 1WABA 4NSNA 1O03A 1HZZA 5ALVA 5ECGC 3O92A 3HR7A 2H2AA 3IHTA 2ZROA 1NKVA 1L5WA 1YQTA 2ZBEA 4PR0A 5G1NA 5AW8A 2XMDA 1JIQA 1D0IA 2H52A 4CKZA 4NCKA 4QC2A 5COQA 3OSZA 4WJLA 3PGLA 3D7SA 1ZGAA 3RS2A 1QP7A 4PAQA 4DSNA 3B1XA 1VJ0A 2ECQA 2RCNA 1N5JA 5I9IA 1YRQA 5AKKA 1LLCA 3TMKA 1QP4A 3D3WB 4BB9A 2BFOA 1T3TA 4M38A 3EOZA 2IIVA 2KE5A 3K5PA 4TMZA 2RGGA 3QGMA 4JP3A 2LTAA 2HIGA 3P19A 3PNKA 4B5LA 4Z4GA 2W6PA 4BFSA 1BEZA 2XE7A 1VXOA 4X1OA 4ZYXA 3VZBA 3ZWCA 1Z5OA 2RHJA 2XUFA 4MROA 1B4DA 1FVXA 2MYPA 4BJ5A 1U9CA 4P82A 3MWGA 4BKPA 1NN0A 3O2SB 1L7DA 2BHSA 1KSHA 1R4MA 2VK2A 2JH8A 3EGIA 3DGFC 3LWNA 5LPNA 5JMPA 4U0JA 5HQTA 5ALYA 1LBSA 1OZGA 2ZRNA 3H1TA 3OLXA 3AOEC 2YBEA 2WYUA 5HPYB 1QRUA 1NVKA 4N7JA 4NEGA 1MB0A 2BEWA 3M83A 1JNXX 1NPYA 2J3EA 4G9EA 4LHSA 4U7JA 5ALUA 4B6RA 2P5SA 2GCEA 2HF8A 1HLFA 1IZ9A 1WS6A 1Z5UA 1G5FA 2EZ9A 2JJ1D 2QLBA 4I4TB 5LZ8A 1ZVQA 3R24A 4LPSA 4X1YA 5SZJA 2QRPA 2VKTA 5AXAA 3TPZA 2EVWX 3FGOA 4LISA 1RRFA 4B3IA 1IPEA 1ZVJA 3IV7A 5LNK1 4BUJA 2AWNA 4ALMA 1L7EA 1ZUNB 3DL4A 3O84A 3DAHA 2AC2A 1X3SA 4GOLD 4J0QA 3AVWA 1XZKA 4C76A 2HM7A 1G42A 3G2MA 1JEEA 5IVIA 5L53A 5J2UF 1D9ZA 5A05A 3ZBUA 3AF0A 4QEKA 1QYXA 4NFYA 1JAXA 3ESCA 5FOUA 4IXWA 5K4HA 2GXAA 1LDBA 5JNTA 2PZKA 4MAFA 2AFIB 4I50A 3UJ3X 1JEYB 3L9WA 2RC6A 3FCSB 3A6GA 4KOAA 2I66A 2ZT6A 3UAVA 1ONBA 3BWXA 3K8OE 3C5HA 5GOTA 1NW4A 3U6BA 1IXZA 3OZRA 4PPFA 3DE7X 3L7NA 4C4ZA 2R48A 4ZP1A 4LFCB 5BV8A 4MIOA 4MRNA 1H85A 1JU3A 2R5FA 3CH4B 3DLCA 3SBDA 5AVVA 4BL5A 5CDFE 1AQNA 1THZA 4K0KB 5L45A 2BBTA 1M1NA 2XPCA 4NXNB 1JIJA 5FPYA 4X1IA 1UBLS 1NXTA 1CSEE 3QVSA 4I4TF 1XCMA 3RHTA 1TM3E 5LXTB 2OGTA 3PITA 1KZ1A 2JGLA 3KB6A 1GTZA 3EXIB 3V8MA 2O8BB 3EXFB 2B7CA 3AFNA 2QD3A 4MP8A 4QECA 1CX9B 4PONA 1R10A 2QRUA 2R60A 2QTCA 5F73A 1CR6A 2C7BA 2XUKA 2X2OA 1BXKA 3AR8A 3D3KA 4AYTA 1A8IA 1DXHA 1Z4MA 2XCIA 4OQYA 3IIEA 5FKJA 3R7WB 1RI3A 2CZGA 2HPHA 2XCTB 3M1LA 3COWA 4MUAA 4ALNA 1CQXA 2X42A 1ECJA 3OBIA 1T8UA 2B9VA 4XGRA 1P9RA 2ZBUA 5EWMB 1SUIA 1A88A 3S2SA 5I47A 1M2OA 3NV7A 4JELA 4RA9B 5KAMA 4LGYA 3PXUA 1GD1O 3VZSA 1SUEA 2DHEA 3FYUA 3D0RA 3I1JA 3PNQA 4GSLA 3FMVA 2NU9B 1F2TB 4BKMA 2CNLA 3MJTA 2JGDB 3TSZA 3FNQA 4B7ZA 4RZIA 1Z7BA 2C9ZA 3CNHA 3ETEA 1ZQ9A 1RR6A 2XUPA 3EOBI 4RV9A 4C0KA 1BFDA 3I1IA 2OGWA 2MSLA 1EJ6A 1U2EA 2VF5X 4DPKA 2Y1XA 2I65A 4G0QA 2C7QA 2ORWA 5HZKA 1K68A 3KSRA 2FSSA 4IXNA 3AF4A 3QEBZ 3IQDB 5IANA 2ZR8A 1V1JA 1RVV