1ISPA

Crystal structure of bacillus subtilis lipase at 1.3a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
179
structure length
179
Chain Sequence
EHNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternate conformations observed in catalytic serine of Bacillus subtilis lipase determined at 1.3 A resolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords lipase
total genus 69
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2001-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ispA00
3NUZA 2WQZA 3M3DA 4Q3LA 3WLAA 3LS2A 1Z68A 5JALA 2HM7A 2R8BA 4BAZA 3B3QA 4KJXA 4X94A 3OOSA 3ILSA 4GI1A 1CUVA 5ALFA 4W1QA 2OQVA 1BN7A 4QNNA 1Q83A 4UFNA 1E8MA 5J3JA 4NVRA 3O4IA 1WM1A 3VVMA 2XUFA 5K3FA 1ZD2P 2HFKA 1LZKA 5JADA 2QT9A 1UFOA 2O7VA 3WK4A 2VJCA 4BC1A 3FSGD 1MNQA 2I03A 3LCRA 2WJ6A 4DNFA 4C88A 2JF0A 5ALUA 2WHQA 4M0EA 4Q3KA 3FYUC 3R40A 3MGAA 3WKAA 3OPMA 5LKRA 2PPLA 1THGA 2DHDA 1CEXA 1JMKC 4CG2A 1WHSA 2GBCA 3SX4A 5EIEA 5AH0A 3SK0A 1UOOA 2Z5GA 3DLTA 4B82A 2XQIA 1QLWA 1R50A 1UK6A 4K6KA 4W1PA 1QIDA 2J4CA 3ZLTA 3S2ZA 1J07A 2AJCA 4TPKA 2B4KA 4IH4A 1IMJA 3H0CA 5CT5A 2WKWA 2XUDA 1WCYA 1IUPA 3RK4A 3V9AA 1CR6A 5JANA 2H9YA 1ZGCA 4ZI5A 4DMKA 2FX5A 4ARAA 4GECA 3IUJA 4MEAA 2AJDA 3L1JA 3WWDA 4EY6A 3FVRA 4I19A 3G0GA 3H1AA 2XUGA 1XZEA 2WFLB 5JZBA 2W6CX 5D7BA 3AIMA 3UMJA 2AXEA 1AGYA 1QIMA 4UUQA 2QTBA 3BE8A 3QBJA 2YASA 4B84A 4EY7A 1XQVA 4PSCA 5FP0A 4WJLA 3WK8A 1D07A 3QMWA 4ZGBA 2HA3A 2B20A 3H2HA 3C43A 2OGTA 4JEIA 4BTLA 4J0HA 5CH3A 4WFKA 3BXPA 5LIPA 3R3ZA 1MN6A 2WIGA 4G1FA 5ALXA 3WK7A 3OC0A 5AICA 4BE4A 5JD4A 3RKSA 1L7AA 4X91A 2DCMA 3VKFA 2ES4A 1JJIA 1Q84A 2XMRA 4J0DA 3R0VA 4J0GA 4S0XA 3K9BA 4AN0A 2XE4A 4B9AA 2AJBA 3HXKA 2BJHA 3M82A 1N5MA 3A2NA 5AKLA 5ALTA 3PE6A 4ZREA 4C4YA 1Y7HA 4NMWA 3FCXA 4UHCA 4C01A 1QTRA 3PICA 2D5LA 3D5EA 1YA8A 1XKTA 5EHXA 5AIAA 2XUOA 2X8BA 4N8DA 1BRTA 1TCAA 4J03A 3WIBA 1DT3A 1GQRA 2JEZA 4YPVA 4B83A 1ZI6A 5EFZA 4UBMA 1QIJA 4QWWA 2I3ZA 4A16A 2WIDA 3C87A 2O2HA 2XUJA 2WUGA 1A8QA 2OGSA 1PJAA 3EQ8A 3R3XA 4HVTA 2PKYX 5DJ5A 2VF2A 2IX9A 4DNPA 4X97A 2J3QA 1A8SA 1XZAA 1MJ5A 4KR0A 4XVCA 1XZLA 3TEJA 2JGKA 3F67A 2VQ6A 2JGFA 1E3QA 2BUAA 3F96A 4E46A 4EY8A 3X3HA 1EB8A 2WUEA 3U0VA 4MEBA 5AKEA 3LP5A 2O2IA 5CT9A 3A2MA 4BTVA 2XUQA 4J3JA 1Q0RA 2WFZA 5AKZA 1G42A 1LGYA 2OCGA 4DIUA 1BEZA 2PUHA 1F8UA 4OD0A 5A7FA 4LHEA 4Y2PA 5EHNA 4DM7A 2HRQA 4OUKX 4N8EA 4LXIA 4BP9A 1HDEA 5ALIA 4X85A 4U2FA 4X92A 5HFNA 5A7GA 1U65A 3M83A 1J1IA 2OAGA 4XIIA 3V1LA 3IIIA 2QMQA 3WYNA 3OURA 4D9JA 1JU4A 2ECFA 5E4YA 2B61A 1EH5A 1K8QA 4BATA 1SCQA 1W52X 3PUIA 3MUNA 2J3DA 5I7UA 4PF1A 3CN7A 4BAUA 3GELA 1P0MA 3G0DA 1F0NA 2YXPX 2XMGA 1I6WA 3VISA 5D3KA 2QR5A 4K2AA 5YASA 1USWA 4CI9A 4OYYA 4QLOA 3AIKA 4JH0A 5HZGA 2UZ0A 3H19A 1XRPA 4PQEA 3AILA 1XRRA 3ICVA 3C45A 3W9UA 3RM3A 3O9VA 3HC7A 2CJPA 5FOQA 3VDXA 3RARA 4GW3A 3IDAA 5ISMA 1B6GA 2QUAA 1GPNA 2PSJA 2PBLA 1R9MA 1MT3A 3IA2A 3QYJA 2AJLI 2ORYA 3WKBA 4AO7A 5HQ3B 1DWOA 4Q82A 4H7KA 1XZHA 3HRHA 2CBGA 5HFAA 3QPCA 3KWFA 1EDDA 3GFFA 3WI7A 4N8SA 2HU7A 4X6UA 3K6KA 2IITA 4LIPD 3IB3A 5AP9A 2Z3ZA 1BEEA 1U2EA 3A2LA 3D2AA 4DTCA 1YSCA 4X6XA 2PUJA 1DWQA 3KXPA 1SC9A 1DT5A 4FBMA 4JYMA 1GKLA 3STUA 2VAVA 3G8YA 1EX9A 1VOTA 4Y2TA 1CFJA 2HU8A 4WFIA 1XRQA 3WYDA 3IBTA 2EEPA 4PNZA 2X76A 1E5TA 3G9UA 1K63A 5JARA 4J0KA 4I3FA 3VXKA 2G5TA 2JGLA 1JKMA 4BDSA 2DFPA 1XROA 3IUNA 4EB0A 4U2BA 2PU5A 2VEOA 5AI8A 1WB6A 3WIOA 2X5XA 1FFEA 2XMZA 4AMYA 4M0FA 1GXSA 5JAHA 4C87A 3FLAA 5AM0A 5FPPA 3U1TA 1W6RA 4DGQA 5IH7A 2ROQA 4EY4A 2VSQA 3ZV7A 2QKYA 5E4JA 1JFRA 4UBIA 2D0DA 2HU5A 4FTWA 1N5RA 5HF5A 1C4XA 5JZSA 3CCCA 4QWMA 2XQGA 5K3AA 4BCBA 2RAUA 1IUNA 1T4MA 2ACEA 2XUPA 4ZWNA 5ALMA 4B0OA 1JJBA 1XQXA 2HADA 3FYUB 1QFSA 1YA4A 3EF3A 1H2YA 1R9NA 3PI6A 5CH8A 4UPDA 4LKOA 2I3DA 2RIPA 4OB8A 5CXXA 3AZOA 1LPBB 1QTIA 3BF8A 1CUDA 5K3BA 1UT6A 4G8CA 3FBWA 1E66A 5AI0A 4KEAA 1QIIA 5HKAA 1H22A 3DD5A 4LXGA 5HK8A 4H0CA 2Y6UA 2DHEA 3BJMA 3C8DA 4Q05A 5HF6A 3DS8A 3D7RA 5CURA 4F60A 2V97A 1EK1A 1XZKA 4HTAA 2QJRA 4K6HA 4BZZA 4HXFB 2PSHA 4A23A 2XUHA 4MXDA 1UKAA 4BZWA 4AZ0A 2HFJA 3DYVA 4L9AA 4KAJA 4BVKA 3JWEA 2YYSA 1AURA 1N1MA 3MUOA 1CQZA 1QIFA 2FJPA 4H7JA 2DHCA 1W1IA 3QM1A 3C6YA 3VJLA 1FFAA 2GYVA 3E4DA 3O9MA 1W4LA 3ICWA 4OU4A 5FPQA 4C4XA 1N8SA 1X2BA 2XQJA 5AM3A 3KDAA 1XRLA 5AK3A 4BVLA 5IKXA 4UBLA 3DOHA 3FAKA 2BGRA 4H35A 1JJFA 4E14A 4K5QA 2RI6A 1ZJ4A 3WQHA 5JASA 3HACA 1MU0A 2V9ZA 4GLBA 1WOMA 1X2EA 5HCUA 3DEAA 1CUIA 1KU0A 4FOLA 2IIVA 1WHTA 3PDCA 3WK6A 1FSSA 2HHAA 4PW0A 4WDQA 5ALWA 1KU6A 3R3WA 4FWBA 3AUKA 3ED1A 1TKRA 1SCKA 1YAHA 2OCLA 3C5VA 4B6GA 4W9RA 2PU7A 4MWSA 5E2IA 5ALGA 2GBIA 1FFCA 5AOBA 2WIJA 4X6YA 4QDXA 4BE9A 2GZRA 4BBZA 1XZJA 1T2NA 1K4YA 1EB9A 5DNUA 2C0QA 3G0IA 2JGMA 5C8XA 3PUHA 1JU3A 2G5PA 4F0JA 5C81A 3F98A 5ALPA 5DYYA 4CCYB 2RHWA 3WL5A 4AO6A 2PX6A 5CTAA 3WJ1A 1THTA 1YASA 4G5XA 3NWOA 3O4GA 4YX9A 2G63A 1XRNA 3P2MA 1ZD3A 1TRHA 3G02A 2JGEA 1C7IA 1MAHA 4X7BA 1U4NA 1CVLA 1R1DA 3DKRA 3N0TA 3NOXA 2XUAA 3W9BA 5AI6A 2WUFA 1XZMA 1EK2A 3BWXA 4CFSA 4C6HA 1HQDA 2C58A 1GQSA 1XZDA 5EIAA 5AK5A 5AI9A 1Y7IA 4OPMA 4GWLA 3H18A 5SYNA 4NZZA 2G4LA 5I9IA 4QDUA 1VKHA 5CBKA 2Z3WA 5ALNA 1CV2A 3L1IA 1CUFA 3PF8A 2ZSIA 4FLEA 1QZ3A 3HABA 2QUBA 2XB6A 1C7JA 1CRLA 3BL8A 2HDWA 4UHHA 4F21A 1DQZA 5FXMA 5ALZA 5IVHA 1DWPA 2O7RA 1DQYA 3EBLA 4G4IA 5DTJA 1OILA 3A6ZA 5AKGA 4X93A 3I2FA 4E11A 3IUMA 5HK9A 1ORWA 4YASA 4WY8A 2WTMA 4DMFA 4ARBA 1VA5A 3FVTA 4BAGA 1H2XA 3G0BA 3I28A 5AKIA 1QJ4A 5AJHA 4U2DA 1EA5A 3O0DA 4TVKA 5EIHA 5LP1A 1VZ3A 4ITVA 1PFQA 3AINA 2EDAA 3WA6A 2FJ0A 4B85A 4NS4A 4ZXFA 3H1BA 1AQLA 4YK7A 2GYWA 1NU6A 4AX4A 4PSUA 2CB9A 2HA4A 3G7NA 3KOOA 5AOCA 1VLQA 3ESBA 5C8ZA 5JAUA 1CUBA 4XWGA 1JI3A 1CUCA 1CUYA 4MWTA 3DDUA 4FHZA 4PSDA 1H2WA 1LBSA 4J0JA 1LNSA 4X90A 2LIPA 2ZYRA 1DTEA 3I1YA 5D6OA 1TCCA 4B9EA 4EBBA 3DL7A 3GROA 3HEAA 4AXBA 1K5PA 4UHEA 1ZGBA 4G9EA 2JIDA 3WMRA 4AN1A 4C4ZA 4F5ZA 3ZPXA 1ODSA 4CCYA 1IZ8A 3WJ2A 3BIWA 2XQKA 1X70A 2HA0A 5JIBA 1XZGA 3N2ZB 1NX9A 2QZPA 4KYVA 2JGJA 1WPRA 2WHRA 2H7CA 2PVSA 3LIIA 1JMYA 2VT6A 2EDCA 1CUUA 1ORVA 2XUKA 3PF9A 5IVIA 4WCVA 4BC0A 2I78A 3QVMA 1UK8A 5K3FB 1J06A 4BCDA 5LYYA 2XMSA 3R41A 4H7FA 3HJUA 5JD6A 3VJMA 4A5SA 3V1KA 4LYDA 3QZUA 4X3CA 4UBJA 1BN6A 1GPKA 5JYCA 2BFNA 4IO0A 3IULA 1A8UA 3L1HA 1WB4A 1YS2X 2XI4A 4KAFA 4U2GA 1U8EA 3QMVA 3OG9A 1MTZA 5BV7A 4Q3OA 2XLBA 5ALHA 2Z8ZA 4CG3A 5AOAA 3KD2A 3WZLA 3WWEA 5AKJA 5C7YA 3UUEA 4LYEA 3BDVA 1W75A 2ZYHA 5EHZA 5A71A 2O2GA 3I6MA 4Y2VA 4P93A 1EXWA 1LPSA 5AM4A 3H2JA 4N5IX 5A7HA 5A62A 1CUWA 3D2BA 4Y9SA 4MQLA 3FSGA 2QXUA 4HZGA 5HF8A 2WU4A 1ZIXA 3D59A 4AZ3A 4Y2XA 3V1MA 4EY5A 3LLCA 3TRDA 3LIPA 1LPNA 1XLVA 2ZSHA 5SYMA 2K2QB 3ZLUA 1EDEA 1DX4A 1ZI9A 2QOEA 3T52A 3ZWQA 5AO9A 2W22A 3I2IA 4V2IA 4GBGA 4X95A 4J7AA 5AI4A 4N5HX 5FLKA 2WFLA 5CH5A 5DTIA 2P8SA 4ZRDA 1R88A 2OG1A 1CLEA 4IH9A 4X00A 3STVA 4J0IA 3BIXA 3SC2A 3W05A 3I1IA 3IURA 4IQ4A 4IHAA 3AFIA 2XMQA 3ANTA 2PM8A 1QIKA 5AKYA 2VJBA 3UUFA 5CT8A 3VVLA 1CUHA 3PFBA 1LPOA 2WJ3A 2GBFA 1LPMA 3VJKA 1TK3A 3C6BA 3AIOA 1WPXA 5LZ9A 2QS9A 2HA6A 5CT4A 1UOPA 2JBWA 4UBKA 1YB6A 4BCCA 1L7QA 1HPLA 5EHQA 5T4FA 2XMDA 5ALJA 4GHWA 2H7YA 1B41A 3I6YA 1VE6A 5K3CA 1DX6A 1ODTC 1ZJ5A 3I6ZA 1UXOA 4DMHA 5AIBA 4GEGA 3H04A 4FNGA 2PSFA 1RYYA 2Y2UA 5A6VA 5A2GA 1F0PA 1MX9A 1XQWA 2HA7A 2HA5A 3WWCA 1GGVA 1UK9A 5KREA 4ETWA 5EI5A 4XX1A 1HLGA 4AMZA 5ALEA 1XQYA 5DNWA 1HBJA 3V48A 2WG0A 1XKLA 3Q8WA 1XFDA 3IUQA 3EQ9A 2ZJ6A 4JYPA 2OCKA 5LZ5A 4H7HA 5ALOA 1R3DA 5C8VA 3BDIA 3B12A 4BDTA 4W63A 2WIKA 2BGNA 3O95A 4GDMA 3W04A 5AM1A 4Y2JA 4TGLA 5DNVA 4DMCA 1QO9A 4RNCA 4EA6A 4BYMA 2ZJ7A 4DSAA 4QA9A 2CUTA 4W1SA 5AK6A 3HYSA 5CW2A 4HAIA 1QOZA 3E3AA 5JZ9A 2YH2A 4H18A 4XJVA 2E3JA 1TQHA 5JAOA 4RGYA 4HRYA 1UZAA 3QMMA 4BRSA 3AJAA 4G4GA 4Y2QA 3C70A 5LKAA 4FFWA 4B7ZA 4B80A 3STYA 3K2IA 1O6GA 4BRZA 3WKDA 5ALKA 1QGED 4KACA 1XRMA 5EGNA 4H7EA 4QDOA 3A70A 1VE7A 4Y7DA 2ACKA 1QFMA 1O6FA 5LLSA 4GXNA 3D2CA 4FMPA 3F9CA 2VTVA 3Q0TA 1BU8A 5KWJA 4UHBA 1XZFA 3G0CA 1MX5A 5BWBA 5T4HA 2WG2A 4UBNA 4QDZA 3WL6A 4EUSA 3O4HA 3TGLA 4AB1A 4ROTA 3FYUA 1CUAA 1ACLA 2Y6VA 3WK9A 3FNBA 3HLKA 4UBOA 1BCSA 4MYSA 2HA2A 2WFMA 3NGMA 1YR2A 4IH1A 4INZA 2WJ4A 4EZIA 4U2EA 3JYHA 3ESCA 2H1IA 1IZ7A 2C5GA 5FKJA 3D3NA 4HRXA 4PO3X 2RHTA 2OCIA 4Y2YA 1AUOA 3S8YA 1ZD5A 4FNMA 3DKKA 5HQ3A 2QJWA 5ALDA 3DJYA 4Q1VA 4QLAA 5ALSA 5BWCA 4U2CA 1KEZA 1CUXA 2PSEA 4RE6A 1ZI8A 1ETHA 1G5FA 1YB7A 3I2HA 3G9XA 4P9NA 5CXUA 1WB5A 2VA9A 5CMLA 5AKHA 1MO2A 4L3WA 2XT0A 1QO7A 3D0KA 1VZ2A 1BCRA 3D4LA 1SFRA 1ZD4A 4JNCA 5LZ8A 3G9TA 4M0MA 4Y2UA 2BUBA 1XZCA 2BUCA 1IVYA 5FRDA 4CCWA 1RP1A 5K3EA 4H7DA 2DR0A 1GZ7A 1TAHA 1ACJA 2VJDA 3FWHA 1R4ZA 2DQZA 3WZMA 5D3ZA 1YAJA 5AM2A 2CZQA 1UKBA 2Z8XA 4J0CA 3ESDA 1A88A 1G66A 5T4EA 3DNMA 3BF7A 1TIBA 1VXOA 4UFPA 2J4FA 3R3UA 3O4JA 3EIOA 4MJ3A 1XLUA 4C89A 3WWOA 3DQZA 3WKCA 4KAAA 3GUUA 4HXGA 1DU4A 1H2ZA 3MVEA 5KWIA 3E0XA 1CPYA 2NW6A 1EVQA 2WIFA 2V96A 3F97A 1MNAA 1E8NA 1CUJA 5CRIA 2GBGA 5HKBA 3FLEA 2OGZA 2XUIA 1GKKA 3H2IA 1QIGA 1H23A 4CIBA 3DYIA 4G4JA 2OPHA 4OB6A 4ZV9A 5H3HA 1QIEA 4OCZA 2GZSA 2WUDA 4OU5A 1AX9A 1P0IA 2WU3A 3WWPA 4FFVA 4EHBA 3EQ7A 2CEKA 3FYTA 2JGIA 3BJRA 3OTQA 3HZOA 3C8HA 2BCEA 2DSNA 1L7RA 4Q34A 2B9VA 2ONCA 5K5EA 2XDWA 3I2KA 4WY5A 4BP8A 4B81A 5FDFA 3ZI7A 3IVMA 3FOBA 1CUZA 3T4UA 1UWCA 1RWQA 4UHFA 3KSRA 4G9GA 1P0PA 1QONA 1XLWA 2C5FA 4AO8A 3ANSA 1Q0ZA 5DYWA 4L0CA 4AQDA 1CUGA 1M33A 4PV7A 3SWWA 5I8PA 4FBLA 4FDMA 3B5EA 4KE9A 2BAGA 1GT6A 1FJ2A 2ZJFA 3H2GA 1MPXA 1LBTA 4H7IA 1AC5A 3GBSA 2WHPB 3C5WP 4QEKA 3AZPA 3F8SA 5E4TA 4O08A 5T4BA 3C6ZA 1HKHA 3WK5A 2RGUA 5F4ZA 7YASA 5JATA 3PFCA 2H7XA 4DYHA 5ALLA 1OCEA 4OSEA 2HIHA 1CQWA 3QITA 4HXEB 2OXEA 3G9ZA 3H2KA 4FLMA 1E8DA 2Y1KA 3R3VA 4DNOA 1BE0A 2BKLA 5ALYA 4MYDA 1OXMA 2WM2A 2XMBA 1UOQA 3STXA 2QRUA 1JT2A 5LZ2A 1BS9A 1QIHA 4G8BA 2AJ8A 2OAEA 2Q0XA 2HRRA 1ZIYA 1LZLA 4L72A 5AM5A 3DOIA 1K6EA 5BOVA 4RPCA 4H77A 1NU8A 5CT6A 1VXRA 2XMCA 1YCDA 3W2TA 5IVKA 3CXUA 4CG1A 3R3YA 4P92A 1W76A 2OLEA 2DQYA 2WHPA 2XQFA 4RE5A 2GYUA 6YASA 1EDBA 3STWA 4KRXA 4P08A 1ODCA 5ALQA 1AKNA 2QXTA 2RONA 3I2GA 2VATA 3FCYA 3H17A 2PSDA 4B0PA 1YS1X 1UK7A 3WA7A 1MX1A 1EHYA 2WSLA 3JW8A 1Y37A 2WLSA 4Z49A 1AZWA 2WILA 1LLFA 2C7BA 5KBYA 2R11A 5IVDA 2FUKA 1P0QA 4I4CA 1ISPA 5FV4A 5LZ7A 3WKEA 1CIJA 4Y2SA 1F6WA 3GA7A 4LXHA 5AHXA 4ZV7A 4OB7A 1TCBA 1BROA 4DNQA 5JAPA 2V98A 5JD5A 1CUSA 5ALVA 1GPLA 4FLFA 4DLNA 4X71A 3QPDA 4WDRA 3CCBA 1HL7A 3YASA 2VT7A 3AZQA 1G4HA 1ZOIA 2QVBA 5AKKA 3FLBA 1MAAA 4MQMA 2QM0A 1XZIA 2CMFA 1XZBA 3HI4A 5AKXA 5HF9A 1DINA 4OYLA 5AI5A 3KWJA 3CN9A 3STTA 1VJ5A 3OM8A 2ZYIA 3E1GA 3WL7A 1EI9A 2VAXA 5ESRA 1SCIA 4QE3A 4QDTA 1EVEA 2C4HA 5K3DA 1QE3A 2PL5A 4BVJA 2XLCA 3QH4A 3ZLVA 2WTNA 2WG1A 4JUIA 1A7UA 3M81A 2Y2VA 3HSSA 5LZ4A 5DYTA 4KE8A 4WFJA 4G8DA 2ZVDA 1LPAB 1FFDA 3RLIA 2HL6A 4K6GA 5ALRA 1S8OA 4Y2RA 3WL8A 2VJAA 5DLPA 1IUOA 1PV1A 3GZJA 4QZVA 1ZICA 4UHDA 4FKBA 1LPPA 4E15A 2C0PA 3DL4A 1J2EA 4HS9A 4W1RA 3TJMA 4KE7A 4UFOA 1CUEA 3W06A 1AMNA 4CIAA 3ESAA 2ZYSA 1E89A 1VA4A 4BB0A 3V1NA 2CKMA 4KRYA 5AK4A 4DSZA 3I2JA 1EINA 3QPAA 5DWDA 3DCNA 1SOMA 2OQIA 1FFBA 2JEYA 1UKCA 3C6XA 5FUMA 4KE6A
chains in the Genus database with same CATH superfamily
1M75A 1USUA 4PFSA 4OXKA 1L8XA 2ZYTX 4DJFC 2Q5OA 1V5WA 1FFGA 2DFDA 3HBJA 3UCFA 2R6FA 2VYVA 5JALA 5AVUA 5KQRA 1SPXA 4IDOA 3SQXA 4LRSB 2XZLA 5IUJC 2QYOA 1XOIA 1HZJA 2AT1A 2MMGA 4RHCA 2X0NA 1W2HA 1KI2A 2VHXA 3QLTA 4Q93A 5TS3A 3OOSA 1XPRA 2R1TB 4I5GA 1AQIA 1HYHA 2BFBA 4GI1A 1NNEA 5DH9A 4PPNA 4IIEA 1KGDA 4MA4A 3GCWA 3R0JA 4PGFA 1SVWA 4NCIA 4WH0A 1BN7A 3WQQA 7ABPA 2WKPA 4II3A 1O2DA 3IDSA 1WF6A 1QQ6A 3NHUA 4CTMA 1M2NA 2ZZKA 2R1ZA 3GRVA 3WRYC 1OBVA 1U8CB 5ILGA 5I7WA 1QU2A 4KQ1A 3VU9A 3FKQA 1IEXA 1NX6A 1Y8ZA 4DXAA 1L7XA 1JQJC 3NBFA 2BJWA 2XUFA 4N5DA 4C3UA 1WZUA 2Q4DA 2HFKA 5JW6A 3N8KA 3GPDG 5JSFA 1PDOA 2FH5B 1EYZA 2O7VA 3JSAA 4YRJA 3G5UA 3O9ZA 3WK4A 1YRHA 1VFPA 2I03A 5B1EA 1FP2A 1FTNA 3VYRB 4Q4AB 2XJ9A 2ERCA 4Q66C 4C88A 1JKJA 2QLBA 2A1UA 4BKOA 1QQAA 3BFPA 1SRRA 2Z98A 3CRW1 4K9DA 2WV9A 1YFKA 2A9JA 3BE6A 1O3YA 2PKRA 2VYNA 2I7TA 2DH5A 4NNPA 3R7LA 1XTPA 3ZN2A 1NW7A 2EKPA 3NVMB 3R40A 1EK5A 4UPEA 1U81A 2DR2A 2FQWA 4TRRA 1M6EX 1EVJA 1RJ9B 3JWHA 2I2DA 4Q6BA 4H4CA 5EKXA 1UMDB 4LBYA 5K20A 1KMMA 2GZHA 3MFQA 3W7AA 4OQPA 1ISSA 1W93A 3SS9X 1D2AA 1UKVY 5J59A 1THGA 3GVXA 2A9VA 2Z4RA 1PWYE 3OFND 3OSZA 1NJSA 5A03A 2XB8A 1U7UA 2VUSA 3FD8A 3GLKA 3BEDA 4NBSA 4PPGA 4R41A 5CIWA 2XOEA 2NUTA 3CPEA 1DTSA 2IDZA 3CY6A 1GNQA 2JFFA 3A6LA 2VYND 5HS4A 2FSHA 2GPNA 2ZAMA 3KTAA 5AVJA 4O4LF 1GNPA 1VJCA 5AH0A 3SK0A 3SX4A 3TR5A 3AFGA 3VPGA 2G7MC 2YJZA 1UOOA 4K26A 4D57A 2Z5GA 3C3MA 1L4HA 1MAVA 3DLTA 1JEJA 2QD4A 4D99A 2WSYB 1ANKA 3OKCA 2A0YA 1RWPA 4GR4A 3T5BA 1U8YA 1M2OB 3L9XA 3W8FA 4CIDA 2UYHA 2JFYA 1LI7A 3A28A 2OHJA 2WMNB 1XDUA 2V3VA 3VOAA 1UK6A 3WGTA 2H4HA 4K6KA 1TI7A 1RLOA 3I0NA 1A76A 1W88B 4R9SA 1V4VA 3AUAA 1E5VA 1WXHA 4PWYA 2FI1A 4IYJA 1X14A 3ENKA 4REOA 2PAAA 5K8TA 4IAOA 1N2OA 2P3OA 4F97A 4ZHQF 4HDKA 4TRJA 4XYLA 2P6NA 2H18A 4IH4A 1LBEA 2X7HA 3M89A 4UD6A 2WKWA 1F0KA 1WCYA 1IUPA 3ZJ4A 4RK4A 5JC8A 3U6KA 3KDPA 5F23A 5DHFA 4ZI5A 1OLXA 2Q1YA 2V3CC 4ARAA 4G6ZA 3BAZA 4M76B 2CCGA 4Q7JB 4MEAA 1M0SA 2AJDA 1PCXA 2RJ3A 2H1CA 1IPHA 2BR5A 1P4GA 2ZYDA 1HDIA 1JFSA 1JFFA 2RAPA 3GOHA 4Q9HA 2ZI4A 2JW5A 1RWMA 5ICMA 1QVRA 2FYTA 4F72A 4LJ8A 1BE8A 4O4JA 2XUGA 4IGKA 4MKHA 3I9V6 1B2RA 3VKGA 2QY9A 3F78A 2JLBA 3EQ2A 1W34A 3S1LA 1T9KA 3GVHA 2WK1A 5CNJA 5B4UA 2O0LA 4U5QA 2BJVA 4U00A 4QOHA 1OPRA 1D1SA 2G5GX 1RRKA 4X7PA 2DSTA 2I9PA 2OFPA 3T7KA 1QIMA 1X7WA 4UUQA 1NMEA 5F1OA 2QPAA 2IYUA 2OAP1 1IBSA 3TFQA 4U7HA 3L8DA 1NT4A 4Q4AA 2Y0PA 1U7ZA 2J6IA 4W4TA 1WB9A 1CZOA 3TDKA 4WJLA 2V7UA 1YZFA 3DPSA 3MB8A 4OV6B 4NBVA 1D07A 1T8YA 2HMWA 2HA3A 2AR7A 3SJBA 1QYXA 3R9XB 3H2HA 1IYZA 3C43A 2GI4A 1A82A 3GMIA 3DG9A 1U2PA 5HZHA 2FSPA 5IHPA 1W59A 1PR6A 4O63O 4LPKA 2BFFB 4ZA2A 3BXXA 1P6UA 4WFKA 2R7AA 1SUCA 5CH3A 3ZV5A 1YJXA 4X20B 1MN6A 3EVAA 4HNGA 4L1KA 4PX5A 1HDRA 1KI1A 1G64A 3UXEA 3UJ6A 1N7GA 3OC0A 1ECPA 1L3BA 3U7EB 1SEPA 1VYHA 3AFOA 1G17A 3PFIA 4XXHA 4IXNA 5LL6P 4XWAA 1E9BA 3LWZA 5EP2A 3PVSA 5CHEA 1L7AA 2XNDD 4X91A 2ZRFA 1M0WA 3BOSA 5E7QA 4RKQA 5KNDA 3VKFA 3F8WA 3SYLA 1U7WA 3PC4A 3ZHZA 3FYCA 5EZYA 1EIZA 2AG6A 2ZTVA 5SYAA 3D4NA 2FUCA 1JJIA 5BQXA 5DPMA 4IXTA 2XMRA 1WW8A 1B00A 2IUEA 1X7DA 3WISA 2Z9BA 4ZK6A 4WKNA 4M46A 2EW1A 4TWBA 3LK6A 4DR7B 2GRJA 1XDSA 1JEQB 1QPBA 4JNKA 2DHRA 2XE4A 4LY3A 5A1TA 3ZIAD 3HB0A 1ICEA 2BJHA 4QQRA 4AUEA 1C9JA 1AHHA 2AGVA 3EZ7A 1UP6A 2ZS8A 1N5MA 4RK6A 4WADA 5FBZA 2YRXA 2UXBB 4ZAWA 5AKLA 1Y42X 4N03A 3TN7A 4O2BA 1Q22A 5CLGA 3PE6A 1QRAA 2XF8A 4HBZA 3EG9A 3EW7A 2J0VA 2OMEA 5D87A 3ESQA 3IQFA 3A05A 3MCUA 1W48A 2BF7A 4S1OA 5F9MA 4AF6A 2ZRKA 4QJ5A 1C30B 4AF7A 3E05A 3ZHXA 3NPAA 4EGJA 2Z9CA 1VLJA 3DUFB 1VPDA 3I0ZA 3N39C 2G36A 1Z7WA 4YWJA 5ICSA 1GTRA 2E55A 3AM5A 2WFAA 3B1FA 1FRNA 3DC7A 4PG5A 2YZ2A 2XUOA 2X8BA 2O1SA 1DJMA 4N8DA 1Y80A 3UKDA 3EXIA 3UXMA 4IMRA 3OIFA 3E61A 3QLVA 1N4AA 1ZVVA 2IF2A 1VKNA 4J03A 1XJ5A 4LYYA 4CKEB 1JH8A 4BXOB 2V7GA 4LFAB 4BO3A 4MDFA 2JEZA 3NR2A 3Q9NA 3QMPA 1OVGA 2E5LB 4XIJA 4KOAA 1CFZA 5D84A 2W6MA 5IH3A 1GNLA 4YS6A 1QIJA 2J0EA 3D6TB 3HGQA 4QWWA 4ND8A 2WIDA 4A16A 1JJAA 3EF1A 4B32A 3JQEA 4AUNA 5F4BA 4BJ1A 1XEWX 1QHSA 2IPLA 2HQBA 3H0KA 4WPGA 3QY0A 4P4NA 2X2OA 4BB5A 1PJAA 3R3XA 1P2DA 5A04A 1JG3A 4DMLA 3VSCA 4IOMA 3IUPA 3OLZA 4A82A 2I6FA 1PNOA 1IN5A 3CLHA 1EFRA 1OX6A 2AFIE 4QBFA 1Q3HA 4DNPA 2P6RA 5DRTA 3HHEA 1DVRA 3BFKA 3H5WA 1MJ5A 4JLKA 4N0EA 4ZVRA 1WSDA 2GZAA 4B4WA 3IP7A 3TEJA 1ZN9A 2O5RA 4HVLA 2ZRAA 1VE9A 3HZZA 4ZYZA 1FPMA 1I3NA 4FCCA 4P6VF 1B6SA 2KM1A 2VYVD 2Q9BA 1KAHA 2QD5A 3UJBA 1EZ4A 2JGFA 2YINC 4EX7A 5CB4A 1VQ1A 1L9KA 1C41A 1T0UA 5HUJA 1X1EA 3KPUA 2BFMA 2X5OA 2ZUUA 4XGIA 4BLWA 1RHUA 3C1AA 1EB8A 5IK2A 4EY8A 4NPHA 4NK4A 3AEUB 4LW8A 3NM4A 3V4ZA 3U0VA 1JTEA 1H1LB 4OLAA 2OLKA 3LP5A 4LFBB 2O2IA 3OWOA 1RKBA 2PYIA 3NHRA 2E37A 2VRCA 1XMXA 2NTVA 1DKNA 3OH8A 2JLAA 3MC1A 4K6MA 1JDTA 1GY8A 1KEVA 2XUQA 5FA6A 3UMGA 4H4DA 5BN5A 3BQ9A 4J4HA 3QUAA 4KZKA 4TTJA 2WFZA 4F2GA 2FPUA 1N2CE 4FN4A 3E9DA 4U6NA 3HM2A 2HHLA 2MT9A 3GQBB 3IP8A 3EZXA 1JHMA 2FEKA 1BEZA 1TUBA 2R8RA 3L2OB 3VV3A 3U4QB 2O2YA 1UXIA 4OD0A 2M32A 3GGGA 3QLUA 4QOEA 4KB5A 4KBYA 3CXRA 3RVOA 5DYIA 2E2WA 4X1YB 3T54A 3SVLA 4A3SA 3DLAA 1ZN7A 2ZIXA 1ABFA 3IS3A 3IIJA 4NE2A 2NVUB 5JROA 1KMHB 3C3XA 4D7AA 2BFWA 1IJKA 5DT9A 4F5WA 3SXJA 5E6UB 4GPIB 3RUAA 4BP9A 2PXAA 1JR2A 4TL8A 1E3EA 2YWFA 1E2MA 1ESZA 2FR1A 4L27A 3F9RA 2IK8A 3FZGA 2JFUA 1QOPB 1EFKA 2HF2A 3AHFA 4PZPA 3T7EA 5M29A 3AB8A 4OQZA 3QYAA 1TM3E 1G60A 1ORHA 2W00A 4X92A 5DN9A 2IY8A 5HFNA 1IMOA 5A7GA 4CF6A 5BV2P 3TRFA 5KQPA 1L5OA 2VPIA 1UP7A 1E2NA 3INRA 1G8AA 3M83A 1YTLA 2CXSA 4HP8A 4Z0HO 1JQ5A 4EITA 4NOMA 1RADA 3JARA 1P1IA 2QP3A 2C61A 3ODGA 2X5NA 5BR4A 3I42A 4PIVA 3WYNA 3TVDA 1Y0BA 2X86A 1SBQA 4JP3A 3HL4A 1YHZA 4MV9A 1CB0A 4UD2A 2B61A 1Q6ZA 2G25A 1WV1A 1FXUA 4UC0A 3HKBB 1EH5A 4GP6A 2EW2A 4ROSA 4DGSA 5L53A 1NBWB 3TGPA 2AE2A 1QV7A 1WWKA 3AONB 5MFZA 4X6LA 4BGVA 2X8JB 2AXPA 3PYXA 1I0IA 4XVUA 5I7UA 1JAZA 1PFVA 1TEZA 3WYBA 3EA0A 5BT9A 2ZATA 4AJPA 4BAUA 4OGGA 3G0DA 4YT8A 4X84A 5DIFA 1L4UA 1F0NA 2YXPX 2P2ZA 3I04M 4CM6A 4QULA 4DMUB 3NTXA 4I1YA 3JZAA 1RXCA 3O1IC 1I6WA 2HKIA 3OLXA 4M1WA 4PC7A 4RDIA 3VISA 5KMGB 1W36D 4TLLB 1T29A 4K2AA 3C5EA 1R0SA 4N9QA 1F2UB 2OBNA 2QX8A 3DBHA 4V24A 4E70A 3PDIB 4TYNA 4J6FA 1DC5A 2XE7A 4Q16A 3DXXA 4QHTA 5EY5B 5IXYA 4FDLA 2DTDA 4J9VA 2PWAA 1KDZA 4E22A 1SVIA 5JCPA 3AR2A 4PQEA 4CEIB 4BLPA 2NVWA 1ES9A 2W2KB 3F90A 1EFVB 4TQAA 3U3RA 3WLTA 4ZKEA 1TF5A 5FLXA 3VU8A 2I8LA 4DRXB 2NSHA 2MINA 2XCRB 2GBLC 1OQAA 1R4MB 2VJQA 3F1KA 1BD3A 1XXHE 1HT3A 1FX0B 4QT0A 2GHTA 4C0JA 3CPJB 3KALA 3GD5A 3DOCA 5ABPA 3MCZA 1QDLB 2PKQP 4CV2A 4ZYLA 2G70A 1GYQA 1JQDA 3WGLA 1QYCA 3FI9A 3RARA 3B6EA 3D6FA 1Y9ZA 3IDAA 5BUQA 1Z7EA 4NFSA 3CS3A 4DV3B 5A2QA 3UJ9A 3I9V1 3MTGA 4R0MA 2PBLA 3CSSA 3TNFA 4YJ2F 5HP4A 2VPXA 4TRMA 2VCEA 5JDCC 4WECA 3KOUA 3OF5A 4IGAA 6GPBA 3T1NA 5JS8A 5MF6A 1LLCA 2AN3A 2XD4A 4OEHA 4YDHB 1GPYA 1W0JA 2AJLI 3QYJA 5I8ZA 5EWJB 3RRYA 3DLIA 4BWFB 5FWXB 1CVRA 3ZUGA 3QSGA 2ZSKA 4NV0A 1XZHA 1MOPA 3AP1A 4QVKA 3D8TA 3ENNA 1SK8A 2CBGA 3QPCA 4EB8A 3HJHA 1JQLB 5JISA 1DV2A 1EDDA 3GFFA 1EFTA 4N8SA 1NLMA 3H65A 2X9QA 3ITNA 4MGIR 1IG3A 3WHKA 2AZDA 4TS4A 3HYRA 4B4KA 1BKSB 4YXWA 3V55A 4LGVA 3PR2B 2J67A 4G0MA 3IGFA 1HRKA 1KDPA 3A2LA 3QVWA 3AFHA 1SC3A 4HNAA 3N0XA 2BZSA 4INJA 1U3FA 2IZ1A 2NU9A 2AG5A 2YL2A 3A32A 3TB4A 5KJFA 1I3KA 4DXDA 4X6XA 4N0MA 3IDZA 4UE2A 4BFUA 4CV1A 4PZ0A 2OR3A 3KXPA 2GQ0A 3WNVA 4K8RB 4JYMA 1NPDA 4DRZA 2CF5A 1IN1A 1NXSA 4QBGB 3STUA 4R7ZA 5BQ3A 5TQJA 1A9QA 3VPSA 1SCUB 5GONA 1D2GA 2IA5A 2XGGA 4HTFB 1NYTA 4J07A 4M1KA 3TUJC 4C5BA 4ONEA 5G3ZA 5TJ9A 5J58A 1FU7A 4JSRA 5DBHX 1Q7EA 4LJ5A 4RLQA 3TW8B 1RJFA 5IAGA 1XAIA 3T4PA 3UM9A 3IE2A 3IBTA 3RVSA 3EA4A 5BNFA 5KPDA 2EEPA 1AS3A 2ZSDA 1PKEA 1JJVA 2XWBF 1PYDA 2HTEA 2ZXFA 3BJZA 4HYYA 4JP5A 1MC4A 1UMCB 4OKSA 3R8CA 3LSYA 2PG3A 1T1RA 1TJPB 3OQ6A 2O54A 2JIRA 3A3OA 4PAGA 3WLMA 3LHDA 3KYIB 4HT3B 3OKPA 5LJIA 4JIGA 4KWCA 1Q0LA 4NDZA 3M9XA 1K63A 3E70C 2J3KA 3M6VA 4GQBA 5EMMA 1L4NA 5JARA 1TA4A 2G04A 2ZT6A 3MLBA 4LF9B 2C5BA 1GLNA 3TI9A 2G5TA 3VXKA 2PXXA 1SM4A 3E0QA 2F3SA 2DFPA 4JGIA 4M9ZA 2WPNA 3ZHVA 2I1VB 4URWR 2GK7A 2A3RA 2ZS9A 3GCXA 3U5ZB 3QVSA 4WLEA 5EERA 4IHKA 4QHSA 4C0BA 4DLTA 4U2BA 3AOEA 2CNKA 5IMSA 4B43A 2WICA 4F3KA 3OD1A 1G20A 2WUVA 3WIOA 4J8PA 4MIKA 3F46A 4G67A 2X0IA 4LEIA 3ZWYA 2H07A 2DETA 3JATB 1JE1A 2P2GA 4R71A 4M0FA 4DDMA 1NOJA 1PR5A 2DY0A 4QBKA 5AM0A 2EC5A 2WINI 4LYAA 5CAEA 2CNOA 2DWCA 2Y27A 2VEDA 1LU9A 2FGKA 3CA8A 3LQ2A 3U1TA 2E4VA 2RGEA 1DKQA 3WAJA 4XLLA 2VAPA 2GRUA 1QF7A 4AMVA 3T94A 3A27A 2V58A 2GJ8A 2F55A 3OJ0A 3O26A 4TSFD 1NBAA 1RTTA 4GNKA 4LHXA 3MJEA 3IMEA 3N2GB 3FNFA 4BBPA 4UEQA 3L92A 4KV9A 3ZWDA 1E3TA 1PYOA 1U3VA 1W87A 2D0DA 3LLUA 4NE9A 3KBBA 4I55A 4F56A 1RABA 1KEWA 1PI3A 4ZAGA 1N5RA 1HQYE 3M7IA 5E3JA 1E63A 2P2LA 5I7OA 2XQGA 5ALVA 5F9HA 4AFNA 1NWHA 5TV2A 2XKKA 2IOFA 5LOVB 4IJ6A 1G7TA 1D7AA 2QQEA 3A8TA 3DKIA 1QO0A 1BEUB 1SVNA 1T4MA 4YEDA 3ZS9A 3ZHSA 2ACEA 4UE3S 4TSFA 3SQWA 5E6RB 1IULA 1L4EA 3FROA 4Q03A 3H1EA 3VZPA 4AU1A 4BFTA 1XQXA 1WUJS 1PJSA 2D1QA 1L7DA 2NPFA 4ZFNA 3ZDAA 1SY7A 2IW3A 5A3SA 2GEKA 2YMQA 1IHPA 1NNI1 2VHWA 3UAWA 4YJFA 2QE7A 3TTWA 3PITA 4DJDC 1N1DA 4BLQA 1U0EA 4EUEA 4OB8A 2JBAB 5LSAA 4UDOA 1KJYA 3PZRA 1CUDA 4QFDA 3RBAA 5SY4A 3C97A 4RGVA 3QX9A 1N78A 2N3ZA 4G8CA 4DW8A 4UEWA 4M89A 5AI0A 3L4JA 4N76A 3FTQA 4O4HF 2VDQB 3RODA 3DD5A 3LPMA 3CPHA 4REMA 4RZUA 1LSOA 3L0ZA 1D2RA 3ROEA 3K20A 5HK8A 2PEZA 2C3PA 3GVPA 1GTG1 1SXJE 1IY8A 2FPIB 4R6XA 3WNBA 5B4TA 5L40A 4NJEA 4JLPA 3BJMA 1CERA 1Y5MA 1IJBA 2R79A 2XF2A 2FWPA 1JVNA 4CVNA 4MKGA 2F90A 2QVGA 4OJKA 4S1TA 5C34B 3RYCA 2WYWA 4F6RB 3FBGA 3ND5A 3NHYA 3ZV6A 3E9CA 4BX3A 3PYLA 1Z5VA 3CC8A 1YMVA 4G97A 3J80A 3NTQA 4K6HA 1OGYA 3KRTA 4UU7A 4A23A 3ZCQA 4BHTA 3HRKA 3ILVA 4P3YA 2QGFA 3IV6A 5A5EA 1DIAA 4XGQA 1FA9A 2HFJA 4NCHA 4EPWA 3BWMA 4KAJA 4CV0A 3THXB 1V71A 3B5JA 1DRVA 3S2UA 1K66A 2YYSA 4HBGA 4JN6B 3MUOA 1NFQA 5E6SA 3SZOA 3I34X 1P2UA 1ZWLA 1E18A 2C9MA 2J87A 1DBPA 4W8HA 3TD9A 3BGWA 4A1FA 4BKRA 5DKFA 3LKVA 1BFKA 1BMTA 3AESA 2ZT8A 3QM1A 3N2EA 4Y6SA 3TMKA 1L0BA 4PLFA 3ROFA 1SKYB 3D2LA 3VJLA 3T7AA 3S4YA 1DX9A 2IQ5A 2VAMA 4JR2A 1NL3A 1VE3A 2GYVA 3CHYA 3QKWA 1KK1A 1NGSA 3E4DA 3O9MA 3QQ5A 4EO7A 1W4LA 1RCFA 3FTDA 4AS1A 4OU4A 2GF0A 1CU1A 3CM0A 2BC9A 4DV6B 1NWCA 3F5MA 2F67A 3OJOA 1Q1GA 2AYXA 4ZJUA 3P20A 4JGBA 5AM3A 1TT5B 4TVBA 1ZIOA 4F3NA 3LF2A 2B82A 2D1TA 4N3BA 2E49A 1MO5A 1Z8NA 1D09A 3RC2A 3NIWA 4LMPA 2EF1A 1U9ZA 1KTVA 1G2QA 1U1GA 4R0NA 2DG2A 1SUFA 3IVGA 2H4FA 4WT7A 3C1UA 5LXTA 2HCRA 1RE0A 2JAXA 1AB6A 4MAFA 2OB2A 4ER0A 1XCPA 3V32A 5A9SA 4AJJA 2GFHA 3U4IA 3G5AA 4G65A 1URPA 2BCGY 2LUOA 1WQ3A 1VC2A 2BKEA 2RI6A 2QRHA 4FYJA 4Q7MB 1J0XO 3RRZA 3UOAB 5A05A 4COKA 1SUDA 2J3EA 1EFUA 3ZWBA 5KQSA 1S9HA 1ZN2A 2WWTA 3D7KA 1K2WA 3G2IA 3QI2A 4UUOA 4IIFA 3UWMA 4CMEA 4QT4A 5EIEA 4MRNA 2V9ZA 4ATNA 4BKQA 4BNZA 3GGDA 3CO5A 4Y1RA 5HYVA 2J5QA 1BMDA 2P5YA 4EJ2A 1QQ7A 2R65A 4N5NA 1WW2A 1ZL2A 1M66A 2VDWA 3VNAA 4DCPA 1KEEA 1OASA 3JAKA 1TT7A 4RZQA 1XI2A 4C0WA 1RXWA 1L5KA 2IVFA 2ODEA 3IVRA 3JQ7B 4W99A 1EIWA 1GAQA 2OVBA 1T6YA 5LU9A 3G2KA 1LBQA 4RLSA 5T8KC 4X45A 2HHAA 1UXJA 1SB8A 4WDQA 2RH5A 4YRGA 1V25A 3NB0A 1XTVA 4MQBA 1UBRS 3WSTA 4ZZIA 1U9YA 1YC5A 4YYEA 1KU6A 3SE0A 4JLNA 5JTTA 1DJPA 2WJIA 1Z5NA 4H27A 3DD1A 5CPBA 5LQJA 5KDOA 1GPDG 2VCYA 3JQAB 1VMDA 2J9FB 3LH5A 4HR7A 3WMWA 1CYEA 4E5VA 5U9CA 3L84A 4X3PA 4W9RA 5BSVA 1M8KA 1U6JA 1Q77A 4KPUB 1W47A 5E2IA 3HYLA 2C1XA 3OIGA 5E1MA 3RB8A 1LXCA 3O4FA 2A4MA 4NS1A 3ABIA 3Q15C 2J1LA 5JXJA 1Y6FA 5AOBA 3L1UA 1Z82A 5B37A 4V2UA 1IQRA 4Q3BA 5HTOA 3ETCA 1ODJA 3B36A 4X6YA 3E9MA 3U37A 5IKPA 2YFQA 4MLPA 9LDTA 2W71A 5E6SB 1WVIA 1K4YA 2XAAA 5E0OA 1EB9A 1KJ8A 4FMCF 1N57A 4YP6A 5H81A 4C6TB 1E2QA 2A4KA 2Z58A 3U4QA 1SU6A 4XA8A 2BHSA 3TTYA 2XBUA 4L16A 1CY4A 2J3MA 1TJ5A 1ZUIA 2AVDA 2G5PA 4WLNA 3C14C 5TE9A 3EA5A 1MB9A 1OB5A 3PNQA 2DTXA 1Z45A 3PNSA 1OI2A 1C4WA 1E5DA 1BW9A 2DLDA 2PX6A 3C3KA 1TVEA 1LDEA 1IPEA 3JVUA 4L7QA 3WB0A 3WOHA 5CFMA 3B60A 3QE4A 3NTUA 4BUZA 5K0FA 4B44A 2W43A 2GAAA 1JDBC 1NJ2A 3P2MA 2B8EA 4GPTA 1FFXA 4ZGWA 1X38A 4LVCA 3VZCA 5L4LA 1ZH8A 5K05A 3TCXB 3U3XA 1TRHA 1X80B 4IV8A 1HE2A 3G02A 3SZLA 3ZK7A 3OZSA 3JQ8A 2AD1A 1FRZA 2ILTA 1ZVMA 3ETNA 4HADA 4KLNA 3CVOA 4HDSA 4YQFA 2EP5A 2NXCA 2GASA 1T9DA 3IEIA 4Z0PA 4D9EA 5DP2A 4CQNA 1SC4A 1L5NA 2P8JA 3N0TA 1G5IA 3DV2A 3UV6A 4CGZA 1A69A 4CL3A 3BB3A 1J8QA 2GPYA 2POCA 1LF5A 3W9BA 1O94D 2JD2A 4FQ5A 3RIHA 2FN9A 1YR8A 1U5CA 3JVDA 1J2RA 1NRXA 1WVMA 4MYCA 3C74A 1DOAA 5DGHA 5KC9A 1ENZA 3QYFA 4DIOA 1YJQA 5K03A 3O2NA 1XZMA 2K87A 2LZ0A 1PTKA 4RKEA 2WKSA 2CHFA 3DZ8A 3NDPA 3H7AA 1E4EB 1BWSA 4JASB 1NI4A 2HLHA 3L82B 4UAVA 2C58A 4C6HA 1CW2B 1P1KA 1GQSA 3CZRA 4DWVA 1MGOA 3PQ2A 1XZDA 4QTYA 3FXAA 1J0EA 1RJWA 3OVMA 3ICCA 4OL0A 5AI9A 1U1DA 3IPCA 4E03A 2PA3A 5IF9A 3WB1A 2FEPA 4L28A 1O97D 1YNSA 2DT5A 4GQIA 5IUNC 3PPWA 1DC4A 1K7FB 3H18A 5ILQA 4CNQA 4EMUA 4UDYX 5JPIA 1ZVJA 1C3XA 4ABTA 4RW0A 1O96A 3QLJA 4KO3S 4OJTA 3HY3A 1RQLA 3PQ8A 1NRWA 4PX2A 1RD4A 4XM2A 2CK3D 4FYYA 4I8DA 3I01A 1GKIA 3IH5A 1XZ8A 4NF2A 3HCCA 1LB1B 4RZ2A 3RTGA 3EVNA 1GEEA 1GL7A 2XCQA 4UTOA 5DBIA 1UINA 4P80A 3A26A 2QM7A 2H5IA 3AMVA 1UFQA 4G5YA 1D7OA 1J2TA 1O94C 3ONDA 4D3DA 3Q8XB 4AKGA 1XMJA 2A0KA 5LOVF 4PG7A 1POXA 4TZKA 3B3FA 3MGKA 3LQRA 3B9RA 5B5SA 1M72A 3PXXA 3TTXA 2R7MA 3NBKA 5H4GA 5A4MS 3M8KA 1KYWA 4FLEA 3IAFA 4RD2A 1QZ3A 3TQIA 1FDUA 3HABA 5EOVA 4XEHA 1E9EA 2XB6A 2W98A 2C2OA 3IR6A 3PVZA 1C7JA 1CRLA 5FJIA 1DHRA 2D2VA 2V54A 4DKJA 3BWCA 2WJPA 2HNBA 4TXJA 1F8FA 4K40A 3NJ4A 1TLTA 5IJAA 5BPFA 2RD2A 5BORA 3ZXUB 4B6FA 1DWPA 1R00A 2DFKB 1J8MF 1J8VA 2OV2A 4P4SA 2B4YA 4G4IA 4MP3A 5F7JA 4GGOA 4IEEA 3CPSA 3DEFA 4Y2HA 2FWRA 2PUBA 4B47A 4RDXA 3A6ZA 3A6FA 3TTUA 3S28A 4X93A 5D3QA 5JWHA 4DYVA 1U0HC 2XTAA 1IOZA 2ZDGA 3HR8A 3MGBA 2VFAA 4LJ4A 3EQZA 3AV3A 3FZNA 3HFGA 3OCWA 3OM9A 5HK9A 4BMOB 4DR2B 2ATEA 3H42B 3DB1A 4LY6A 5FPTA 5KNBH 4WY8A 4MV8A 4H60A 4Z2AA 4QM6A 1J8YF 1NUQA 3KD3A 4DMFA 5LMUB 2OD9A 1WTCA 1VA5A 2QTVB 3EIEA 3RFTA 5GV8A 1TMYA 3GLVA 2QR2A 2V7WA 2GTIA 3HCBA 4QYTA 1LRLA 3PGA1 1AE1A 3TR6A 4F06A 3TYXA 3H4MA 1QJ4A 3KVYA 5L3QA 3THYA 1DGQA 4Q01A 2YWRA 1T10A 4REQA 2CNBA 1F14A 1D2MA 1K5DA 3HKCB 4NOKA 1C1HA 1U04A 2F1JA 1R9GA 2RHDA 1V0JA 2X23A 3BXOA 3EXG1 3I83A 4IY1A 2C3UA 1E0JA 2PKXA 2XITA 4JQYA 3GNQA 4OO3A 1XO1A 2WY2D 3R76A 4CM8B 3GZ4A 2HQ1A 2A67A 4J1SA 4KNWA 5BN1A 2A0UA 3NKLA 3UW3A 1ZQ9A 4ZHSA 4WACA 1UMCA 1E9RA 2FR8C 4B85A 4N48A 4LZLA 4P5EA 2V59A 1OBOA 3H9QA 3G88A 4PLHA 3A1TA 3SHVA 4HLNA 5T8KA 1EVZA 1B15A 2GESA 3GC6A 1NU6A 2JLYA 4PSUA 5I45A 1I5OA 3OQNA 1NQOA 2MSKA 3RRJA 3EXAA 1ZSYA 5L45A 5AOCA 2GCIA 1ZK3A 1EVKA 1VLQA 3DHEA 1BXGB 5C8ZA 4U9HS 3GRAA 2Y0EA 1GIAA 1NY5A 1JI3A 1XVUA 4WKCA 4CQLB 1HNWB 2EFEB 4ZCQA 4A6XA 4FOPA 3N7UA 1OROA 1PSZA 2CE7A 3DEJA 3AG5A 3LW8A 5LBUA 4BWYA 1W5SA 3EG5A 1IHDA 1MIOB 2OOKA 3HUTA 2OQ2A 1SUSA 3IT2A 1QHFA 4JBNA 1ZGGA 1FP7A 2I54A 2DWPA 3EF0A 4YJGA 3AR9A 2JGNA 4E2WA 1DS6A 2DUWA 2ZREA 1LBSA 3N9IA 5DNAA 5EZ5A 2WZQA 4J0JA 4OLBA 5IZ4A 5H8WA 1XTRA 4FDUA 1Q3TA 4DQ0A 4D8XA 2BMFA 2LIPA 2GAIA 4TRNA 4JSYA 5I7AA 2D4AA 3I1YA 3QBVA 3VKWA 4ALKA 4YCSA 2CV1A 2SKEA 2BBSA 4M0LA 1JTVA 1FNBA 3ZCSA 1FNNA 1SVUA 5G02A 5T3UA 2PDAA 1TCCA 1JZTA 1OWLA 4B9EA 1T5IA 3KT0A 2O0MA 3EW9A 3HEAA 2AA3A 2NPOA 2ZBUA 1UJ6A 3ECCA 3Q72A 5HCIA 4XPIA 1LS6A 3LL7A 4MTCA 2R6DA 4UHEA 3HFRA 2UUPA 3RUHA 4GF5A 4R3UC 4HFMA 4I36A 1P9NA 4OHKA 3SX2A 4AN1A 4C4ZA 5CFQA 4F3CA 2Q4TA 1UMBA 3H5IA 5TJHA 3RHZA 3O8QA 5G1OA 3ZPXA 1U98A 4YT2A 3D54D 2J5XA 2R62A 4YRFA 1IZ8A 5EEHA 3WJ2A 3HO1A 2IY9A 2JIOA 2AG0A 1GU7A 1VM6A 3LTNC 3T4EA 3KHTA 4ENRA 4EB3A 3CKKA 1XZGA 5JIBA 3FWNA 4OQDA 3ZU6A 3OQPA 2ODTX 2P67A 4KYVA 3CRMA 4C29A 3QU5A 3IQXA 1DUIA 3JQFA 4NOJA 4WRRA 4YQZA 3WTBA 5KSWB 3QNMA 3EYAA 4W5WA 2JGDB 3TFWA 4KO4S 2IPXA 4MB2A 4C7XA 2CL0X 3MSCA 5LWQA 2PVSA 4EOGA 4DUGD 1FDIA 5EQDA 3V4LA 3GLGA 1EEHA 2EIHA 1WRBA 4FC6A 4E4TA 3PDHA 3BSYA 1N0VC 1ORVA 3RSSA 1T34A 1Z4NA 2QSZA 2VXOA 2CFSA 3A0RB 3BJEA 1CE8B 1QR2A 1YGYA 3MINB 3MMPA 3UB2A 2RHMA 4GKJB 2VA8A 2F43A 1ZBDA 3H83A 1TF7A 2CWWA 1AU9A 1BKYA 3ZDRA 2D62A 2CLFB 4MRPA 3CKMA 3NNSA 5KTRA 1YIOA 3DMPA 1JIQA 2SCUB 1ZKMA 4BV3A 4OXIA 4EI7A 5IJ0B 1Q95A 1D4ZA 1T91A 4LXXA 4R7GA 5CM8B 5L7WA 1UJNA 2I6SA 2PKQO 3IVCA 4M8NE 4MPTA 4ILEA 4OJMX 3R41A 2QE7D 4RV4A 5LYYA 5IJ9A 4H7FA 3BTVA 1XLTC 3HJUA 5JD6A 1ST2A 4EB6B 3MS2A 3VJMA 4RZSA 3SC6A 1YZ3A 3BD6A 1NW5A 1Y3FE 5JRDS 2N1MA 1RXYA 1C3EA 3IXMA 4ND6A 2FPKA 2ZRHA 3EDOA 3OPQA 3RS8A 4UTVA 4UBJA 1BN6A 4MVJH 5C32A 4OQEA 1FU8A 5JYCA 2C95A 4EJSB 4OHBA 4B75A 4BOYA 2YXNA 3IULA 4IGIA 3JQCA 4EUNA 1YS2X 5FL7D 3R6TA 3VHLB 3REQA 3VHXA 4DA0A 4NZOA 4H3SA 4KAFA 4U2GA 3RVQA 1NW6A 3LVBA 3SEFA 4FHDA 4WZBA 3ZVRA 4II2A 3QMVA 3ZD8A 2FEXA 3EPLA 1SCJA 1QH8A 3FBTA 2NPIA 1PNVA 1IRIA 5ALHA 2CYBA 1WD5A 4A0HA 1EUZA 1K89A 4HDMB 1NVKA 1M5UA 3D7SA 3PGVA 1GUZA 2V7TA 4DARA 3N2YA 1IY1A 3WZLA 2X5JO 3U6BA 2VSOA 4WX2B 3KV3O 5C7YA 3TZEA 1VCIA 5DGIA 1UC8A 3PRJA 3P2EA 4LYEA 2HK6A 1V9SA 2AN5A 2X4GA 3OPYI 4TT3D 5CITA 1W75A 3B1VA 4OH7A 2PRKA 5GZ6A 5BW4A 2XRMA 2AI2A 4JI1B 5A71A 4DQUA 3SAJA 2O2GA 4OGKA 2X0DA 2EQAA 2C97A 3A2KA 4Y2VA 3KQPA 2VZEA 2WWYA 1U2GA 3RSHA 2ZYGA 3SMVA 1MC1A 4J75A 2UAGA 1U0TA 2P9ZA 4L8GA 4M38A 4UE6A 2QL6A 4JI6B 3TX2A 5FEUA 3KSAC 2BM8A 1TRKA 4HPWA 1MA3A 5A62A 1EXVA 2CMDA 1VBNA 3OI7A 3VPBA 3RBVA 1CUWA 5AMXA 2AFHB 2CVQA 4MCHA 4RA6A 1PT9A 2IRWA 3KLPX 16PKA 1K8YB 4DREA 5JXGA 3PC6A 4JUBA 4RDHA 3L0PA 4YRPA 3ADDA 4LG1A 2QXUA 4HZGA 1ENYA 4L8VA 2GARA 2P1DA 3NAQA 5JDCA 4UOEA 2WU4A 3AY6A 4MUMA 1ZVQA 4IKEA 3I53A 3V1MA 5CD9A 1T3SA 1EUCB 2CK3A 3KS9A 4EHNA 3UT5B 5J2UF 3NBUA 3CNBA 3LIPA 4YBZA 3LSTA 1ZLYA 1WZCA 4R9RA 1P5FA 3EIUA 3KZOA 4DZZA 5C3MA 3ETEA 4C30A 4DFDA 4IS3A 3OTHA 1RAGA 3GFBA 1Z33A 2HMTA 3F5DA 1VIVA 4RM3A 1TKBA 3H8JA 4NAVA 4DV1B 4RKWA 4I08A 3OC6A 1IJFA 1KQOA 3RVBA 3ZNOA 3IKLA 2CSXA 5AO9A 2W22A 2VYCA 4KJZA 4HQOA 3ZW9A 3MG9A 1Y4AE 2JLXA 2E4WA 4DLKA 1VLHA 4J7AA 1JDJA 3UMBA 3VKHA 4N5HX 1NLZA 1G8SA 3F2IA 2NO5A 3BHIA 4OFZA 4PZUA 1RBZA 1Z88A 2UUBB 2RK4A 1UWLA 4B46A 5BSMA 1IY9A 3QE2A 2BMJA 2R2GA 3N2KB 1QANA 1R88A 1EBBA 2XVYA 3EPPA 1T3LA 5LDDC 2R0QC 4U9UA 1PU2A 1Y3BE 4X1IB 1V96A 4IH9A 5DXAA 1F2TA 1TKCA 2EKLA 2NZ2A 1OLUB 1UBJS 2R6AA 3B2EA 1GEGA 3BRCA 3NUQA 3PV0A 2HXSA 3DBLB 4IICA 2OQRA 5KKAA 1F2VA 2PQ2A 3LYUA 4J0IA 5EZYF 3OE1A 2W2OA 5G53C 3W5JA 1BFDA 1LK5A 2GOYA 2RHHA 3BIXA 3MUFA 3W05A 4GL2A 5DGDA 3IURA 5PNTA 4C07A 4RTNA 3F5SA 1NUHA 3B13B 4O02B 1V7ZA 2HSWA 4BB9A 3ESRA 4OQFA 2FW6A 1ZR4A 4GR9A 2FVXA 5CVTA 3EEIA 4Z8YA 4I99A 3RPEA 4OYHA 2FSVA 1S8NA 3KPVA 5KOIA 1NPTO 2PS0A 4ZCRA 1G8PA 1YE5A 2FZCA 1P5JA 1KYTA 4J91A 5AKYA 3AY3A 3WRVA 4YRSA 1KYZA 5CT8A 1PR4A 1TLLA 2G9ZA 1IVNA 4HXYA 4AZ0B 4HDSB 3G1UA 3UV7A 2P79A 2YHSA 4XUGB 4CL8A 1XCJA 1ZDMA 1HLPA 1CJUC 3MXTA 3UHJA 5JPDA 4MW7A 5JYBA 1TK3A 4RY2A 3VPCA 2JVIA 3GDFA 4AAYA 1WPXA 3G5LA 2YJ4A 3F6CA 2H4JA 2IDKA 1JAXA 4EW1A 3RQIA 5BVGA 1IM5A 4NV1A 5BV8A 3A4TA 1CG6A 1UOPA 3TIFA 4B79A 5JMOA 4PZAA 3BWEA 1F8XA 1SVSA 5T4FA 2XMDA 2QG9A 5ALJA 3ZJVA 3I6YA 2ZITA 2GN0A 4MGZR 1SB9A 4I50F 3DNPA 3TLGA 1MQ8B 1AUPA 3ONFA 2J9XB 1ZNZA 1OA0A 3CX4A 1R12A 1ZJ5A 4CV3A 3QGMA 9LDBA 5AIBA 3H04A 2QYHA 4TL6A 4JI4B 2XDYA 2XIJA 3AEZA 3ZGOA 3T5TA 1M74A 4Z4IA 4I14A 4B5LA 2DF8A 1I01A 1SD1A 1GL9B 5ADVA 2OXCA 3VZSA 2VHUA 4QG3A 3B9PA 4GLJA 1UBUS 1M7BA 3O2JA 4JU8A 4M9QA 4TV8B 5K8JB 2APJA 4XDZA 3MT9A 2VTBB 2D8MA 2BFFA 3MTAA 4B4VA 4JAVC 4GG1A 4RPKA 3WWCA 5IP5A 2AB0A 1UJ2A 1DZIA 4ETWA 5ITVA 5EP3A 4B2PA 1VGRA 2PY6A 1OGJA 1M2OA 2JA1A 2VJYA 1KJQA 4H1TA 3SI7A 3AFMA 2C83A 4IDGA 4QUIA 5BYKA 1W9MA 1UM8A 2V4UA 1N0IA 1D8TA 2R7KA 2UZ1A 2X22A 3GF4A 5BW5A 2YNMC 4G0PA 1NIJA 1G5HA 5ALEA 2C82A 3KTAB 3HH8A 4FXOA 1UJMA 4EUKA 2Y9PB 4PC2A 1L7MA 2WG0A 3Q9SA 1HTBA 2RI0A 3Q8WA 1QRUA 1H3NA 3TKYA 1LX7A 2ATVA 2J85A 2ZJ6A 3DOFA 1LK7A 3N05A 3T3HA 5E1OA 5AVWA 5INTA 4FQ7A 1NBIA 3WQRA 1U8ZA 4PO8A 5J2TB 1TAQA 1U7DA 4RETA 3OEWA 1W5BA 2CD9A 4H7HA 4HWTA 5ALOA 1PLKA 2V6FA 3WGUA 5C8VA 3V1TC 2HJHA 6CHYA 1V7QA 1T4GA 3EH2A 1V1RA 1V7CA 4FFDA 3E03A 1XF1A 2G07A 3O95A 3WLIA 4L8WB 8OHMA 5AM1A 3K5PA 3OQ1A 5BO5A 2D2EA 5FFFA 5L4SA 4LF6B 3HEBA 1E1CB 2P41A 5L3RA 4G23A 1RPJA 5LQSA 4F04A 3UK1A 2I1LA 4XUEA 2PL3A 2WF6A 3A4LA 1H8ED 1RXUA 1X7ZA 2Q99A 2VNKA 2HWUA 4I8IA 4QA9A 3GLIA 4IJMA 3RG8A 2J3IA 5EYPB 3GFRA 3HYSA 3PG5A 5AK6A 1XNRB 1Z5GA 4V0OA 5JCZA 1REQA 1TVKA 4BRUA 4HAIA 1NT2A 1V43A 3VRHA 1Z17A 2R9VA 2AWNA 2X6RA 4K81B 2Q2NA 2YH2A 3IQWA 1XWFA 4L8YA 3OFKA 3DE6X 5IT9A 1AJEA 4TTPA 4RGYA 2CLMB 3CBQA 4PHGA 5FORA 2D74A 2PJDA 3EE6A 3P9QA 3RFFA 4LHSA 4LISA 1EDZA 1C0PA 4NZNA 1JAHA 3CB2A 2B4AA 3ZU4A 4G4GA 4BNDA 5K9ZA 2GN6A 3KG2A 3GP8A 1KAOA 3C7CB 3B6KA 4RIEA 1PJLA 4MW1A 4FFWA 3DGFC 4YALA 4HAVA 4B7ZA 2DUUA 2P4HX 1L5SA 3TLMA 1LWOA 4HD8A 4TL7A 3NRCA 3PIDA 1JIIA 1T8WA 4WXEA 2JG3A 3NYWA 1CZNA 2PEYA 3H87A 1Y3IA 1FVFA 3HUFA 4BRZA 1MH1A 1YF3A 1I2MA 3M6LA 4HX9A 1XJCA 1YZYA 4YB8A 1QGED 3U5TA 5K0TA 1Y82A 3AVUA 1GYRA 1LVHA 1TXGA 4QDOA 4ZP1A 3X1DA 4BQOA 4R1SA 2R1TA 4PZ9A 1QPGA 3VR2A 1NLYA 1E20A 2PJUA 2WR8A 4WL0A 1R6BX 1T2VA 2FWBA 3M4JA 4Y7DA 3SX0A 3AF1A 3H2ZA 2Q5HA 4ETIA 3BWDD 3NO4A 4G5GA 1SCBA 5DMHA 4BN5A 4US2R 1YQ9A 1XPJA 1D3AA 2W6JD 4JYBA 4R9NA 3SPXA 3R44A 5BWOA 2W2LA 1JGTA 3IPYA 5CB4B 4E1AA 3AVTA 3UN1A 1AT1A 4NU8X 2ZUCA 4FZRA 4GPEA 3DZFA 3AGQA 4FT2A 2IBTA 3ZK8A 4GDFA 2NYRA 4TMXA 1GCAA 1BU8A 4G5RA 3QKRB 3QOFA 3S2FA 4LJ9A 4UHBA 2JJ2D 3LQ4A 5EZSA 2XGJA 4YAJA 2WMDA 5HRAA 1BZYA 2HJGA 3AR3A 1MX5A 2AHRA 5T4HA 2XKAA 3C16C 4GPBA 1OREA 3NEPX 4QDZA 3DTYA 3KZNA 3A1CA 1GG2A 1KAMA 2G1KA 221PA 3PJFA 3SIPA 1NAHA 3WYEA 2D2IA 2CJXA 2YJNA 2AYYA 3B9QA 4R2JA 4ZQEA 2IHZA 1CF4A 2HSGA 5LXTB 2QQFA 4Y6OA 1YA6A 3M5PA 2I3BA 1JBKA 1ACLA 1U80A 4ZT7A 1ZMBA 2P9HA 1Z2OX 3CSUA 2NXJA 1C9YA 2GNPA 2IHUA 3PQDA 4JDUA 4UBOA 3TL6A 3WK9A 4P0QB 1I94B 1W4CA 4EKNB 2VUTA 4Q1DA 1OVMA 4QJIA 2GTHA 2WFMA 1KC3A 4ZPXA 5H7XA 2BDUA 3NGMA 2ZUVA 1YRQA 3S8EA 1QSGA 5HEKA 4YV0A 4IH1A 2ETXA 2SKCA 2WRZA 2XY4A 4JOBA 4INZA 2KBEA 3FPHA 4MQ4A 2DKNA 4OJQA 3JYHA 1CIVA 1QE0A 1LW7A 4KSCA 1PD0A 4R3WA 3SZMA 3WE7A 5HHTA 5FOSA 2Z1DA 4XD2A 4RL6A 3V7FA 2J09A 3NM6B 5K0ZA 3FPEA 3B1YA 5HXAA 1UH5A 5FAXA 3H1PA 1FFWA 1AY0A 2P7HA 5C0OE 2QB5A 3PEVA 3TTVA 4A8JC 1KOGA 1WQ4A 3T3GA 4QO7A 4P5DA 5TGZA 3P0EA 4K6OA 1M2VB 5FBKA 4CWAA 4MP8A 3C3BA 3EODA 3HXPA 4FNMA 5D00A 1Z0JA 5TR9A 1OZAA 4PNPA 4YNBA 1J23A 3LLMA 5MDHA 2INGX 2PD6A 5FT9A 5ALDA 5J5CA 4OI1A 5AXAA 3EY9A 1SVKA 1XMPA 1J56A 4DJ5X 4EWLA 1ZGAA 3NXSA 5BWCA 4I9HA 1Z63A 1P5HA 1T6ZA 2E4ZA 1V47A 1EUCA 4EW6A 1CUXA 4EO4A 4LHVA 2VK2A 4D3XA 3PWZA 3V1UA 5I4KA 2V74B 3DDCA 4LXTA 5B6PA 5J2TA 1ETHA 3D4BA 1Q44A 4LSWA 4G41A 2PZKA 1FSFA 3G9XA 3MBKA 3FG9A 4NBNA 4UQPA 4YUAA 2ZIEA 4NZPA 1XX6A 3RIMA 5BMVA 3GRYA 5JFGA 3EC1A 8ABPA 4YMWA 4Z3OA 1EWKA 4RJ2A 3EMKA 4WGGA 5KX5A 3LQKA 1VZ2A 2N47A 5I9TA 1BCRA 1GGJA 2NXNA 2HF7A 2FZWA 3D4LA 3FUWA 2O6LA 5EIFA 1SFRA 3U7IA 2ZE5A 3GIDA 1MFZA 4JNCA 2HGSA 5CR9A 5JNUA 3DA8A 2ZBDA 4PIPA 1BS1A 5LZ8A 1OC2A 1ATZA 1PN3A 3CX3A 4XVQA 4O4HA 4TM7A 1L7EA 1E61A 3A6HA 3V7NA 3HUEA 4D1YA 1XZCA 3OECA 4GO1A 2BUCA 2XWPA 3ABQB 3DMGA 1DBQA 2BDEA 2B34A 2FPPA 2Q6IA 3JY6A 3L6CA 4FYMA 4OLHA 3RKUA 3GXBA 3MF4A 2WHEA 5JDIC 3VO2A 1WHSB 3HCAA 2G4CA 3GD7A 4BLOA 1D1TA 1FFXB 4GMGA 1Z4LA 1DUSA 4H7DA 5EPOA 2DR0A 5KB3A 3UCXA 3WV5A 1GZ7A 3GDHA 1DKUA 1ECBA 1ACJA 1R0XA 2EL7A 3IQHX 3VQTA 2G28A 3FWHA 3HCEA 4GPD1 2DQZA 3CMCO 2HCTA 1JTFA 2IV3A 1VRWA 1R0KA 1YONA 3HB1A 3JQDA 4IHJA 4DKXA 1U2GC 2HZBA 4UMVA 5ES3A 2CXPA 1IONA 2CZQA 2H1HA 3KPWA 3T9BA 2CHGA 4AG5A 4ZI7A 1D0SA 4EY3A 1VPWA 2YHAA 3L04A 1YRBA 5J5VA 1E2UA 4PGAA 2IUUA 1B8OA 2AG1A 4BVGA 1Q7BA 1NXVA 1IN8A 3G2NA 1WZIA 3FNGA 4DEVA 1AH2A 5H9VA 5KAPA 5E2AA 4HDCA 4AULA 1NRJB 3K4QA 3L6DA 1VI5A 5T4EA 3I9MA 4QAQA 3BF7A 4FFOA 1MVLA 4PHHA 3CMMA 4RVNA 3OIWA 1UFVA 3PTZA 4AKIA 1ZC4A 2EV9A 2NM0A 4MRSA 3QEBZ 3EIOA 4LOAA 3L8GA 1ST3A 2A57A 4MJ3A 4NYJQ 4EB6A 2VP4A 4GRIA 1AD2A 1QFYA 3GFPA 2ON6A 2E82A 2VXYA 3EDCA 2GKGA 3LT1A 2FUEA 3IQGX 2WLTA 2C9YA 3I9NA 1ZM9A 3IR7A 4YJ3A 1JHOA 4KAAA 3P0IA 5F77A 2Q3EA 4YGXB 2B1GA 3DF7A 3T1HB 4HXGA 4DR6B 4OK3A 3JQ9A 4JLUA 4HNQA 1V16A 1JX6A 2FHPA 3UWPA 1GQ2A 3U44B 1T26A 3TLKA 4A6EA 3AF3A 1U8TA 2A86A 1XTBA 5H16A 4TLEA 5DHUA 3BMOB 4O4LA 4G1CA 3U19A 4NCNA 1Q12A 5DCWA 4OA8A 4IDCA 1NRIA 1CUJA 1AK1A 1E6LA 2Q0HA 1M34E 2QLJA 2YV2A 4DIUA 2HLDD 3FFAA 4FP9A 4S2EA 4BP3A 1ZGJA 1RFGE 5ICFA 2G82A 1QKJA 1U28A 3FMVA 1REQB 3IAHA 3BMNB 2QW1A 2CDNA 2A5GA 1I8TA 1R0YA 4P86A 2OGZA 4BNJA 4D79A 1R6DA 3KQQA 2EL9A 3C8MA 5IAEA 3F7OA 1WE2A 1I51A 1KJZA 2BMEA 3DYIA 4G4JA 4PPYA 2OPHA 1HI9A 1LTHR 3TL2A 3J7AC 1FMTA 1H2FA 3R4CA 5BN4A 3QE3A 5CA0A 1U0NA 1GFZA 1JMVA 4O1MA 4OCZA 1VL6A 1NG1A 2WUDA 4JLVA 2B5VA 4I1OA 4OU5A 3C3DA 2O2ZA 1OT5A 3B2NA 4MR8B 1Z18A 4MUBA 2J41A 4R8MA 1K8ZB 5K99A 3KAPA 4HV4A 1ZH2A 1AXRA 1P0IA 1XDWA 2WU3A 2AI3A 2A5DA 3PJEA 1JBQA 3H97A 4R3NA 2RGCA 4R9UC 3WWPA 3NMUF 1OHHA 2Q8NA 3KC2A 3HZOA 2QN8A 1DC7A 4BQSA 3S1AB 3IAM6 3C8HA 2XZDA 3MIZA 4JBHA 2FWMX 3LE8A 1AZTA 5DK4A 3GFVA 2ZRIA 4JBXA 7ADHA 1QX4A 3IP9A 4MVJA 1L7RA 5HIKA 1KXZA 4ZVUA 1MDFA 2YW2A 2QRVA 4L2IA 2B36A 3FNRA 4CCAA 1Z4PX 5IAAA 4NU6A 2PNJA 4KUEA 5JLAA 3JTMA 1MKYA 4RFSA 3LX8A 3Q3JB 3SEZA 4QLBA 1MV8A 1NJ5A 1TK2A 4LF4B 1GRQA 5LNK1 4JT4A 1LX6A 4ZJZA 2IF0A 7AT1A 5AVSA 4CE6A 3IVMA 1J0CA 3I5UA 2O1XA 2Z5FA 3LBIA 3VVCA 4CQMB 3T4UA 3V8PA 4MIEA 1TPYA 4AJHA 1CQIA 1KETA 3KL2A 4AJOA 2Y8EA 3KSRA 5AW3A 1QHEA 1NN5A 2QAGB 4C1NA 2GAFA 4GPZA 4JLWA 1DUVG 3CRZA 4HTFA 3U3KA 1WKBA 1KWKA 2ABWA 2I2WA 2OP1A 4JP8A 2GA8A 2PMDA 3ANYB 3P94A 5L3SA 4U7TB 3WGZA 4F91B 5K0NA 1NI5A 4NFHA 4TUYF 4AO8A 1KVUA 3K2EA 1B23P 1Q0ZA 2IOHA 5KVCA 3VUEA 4PV7A 3SWWA 2JJ2A 5K8VA 3OEHD 5I8PA 2HRBA 4ZTZB 1ZIDA 3IPAA 1PWEA 4KE9A 1P1RA 4MWCA 4MWEA 1GT6A 3GGSA 1H2AS 1XXLA 5G2OA 3OLVA 3P8ZA 3CWCA 5TMBA 3ZZNA 3EXEA 2KB0A 3E5HA 5CVEA 4R2IA 1E6CA 4H7IA 3DE5X 2BGLA 1M2HA 3LT0A 2ZCVA 4J3FA 2R44A 3D02A 4MI9A 1WA5A 3RCBA 3T35A 4PN7A 3FUXA 1AVTA 2NLOA 3ROMA 2XW6A 1AZLA 2Y99A 3SYTA 3W5BA 5ER9A 2BI8A 1E7WA 4YA6A 4AY5A 5BVGB 5C31A 1M2FA 4K9LA 3F8SA 3Q6IA 5JVDB 1MQAA 4O08A 5T4BA 2XB2A 3LRPA 4B8YA 4RTSA 2P91A 3GZTB 3IQZA 3LFUA 4PYLA 1ZUNB 4ZAYA 4Z99A 4F6RA 4ENVA 3TE7A 2OFWA 1PR3A 1OYOA 2EZTA 3AR6A 4GP9A 1JDZA 4A10A 4D5GA 3WB2A 3HCNA 4GKVA 4EKGA 5CIYA 1BH2A 3AHCA 4Z86A 3RHSA 3KJZA 1IZZA 1I13A 1Y6QA 1PK9A 4YONB 2FV8A 4A03A 1E0DA 5JATA 2DXIA 3VBEA 2H7XA 1LK0A 4AG6A 5CFZA 2OMKA 4OSEA 4NECA 2V7XA 4E2YA 3ETGA 4X7RA 1A4IA 1BNCA 3P52A 4MR8A 4BLRA 2RJOA 1D4OA 4HS4A 4RSGA 1KDYA 5FF9A 1ZJWA 2GPJA 1TMGE 4HXEB 2QRZA 5FI1B 1EG7A 3SBEA 4Q7EA 4ZALA 1ZNXA 3L0CA 3FI0A 2XOKA 3H2KA 1HT0A 4PS0A 3QU7A 2MYUA 1CP2A 2C54A 1M0TA 1M6VB 1SBNE 1P1CA 2H63A 1NTOA 2Y1KA 3EEYA 3GLUA 4B73A 2JJQA 8ADHA 5LCXA 2HHHB 3AL0C 3IMGA 4OP3A 3NVAA 3DAPA 5ALYA 4MYDA 1Y9JA 3R0IA 4LS3A 4XVRA 2OWDA 1G6Q1 2P78A 3FPCA 1TJ4A 3VSEA 2FDXA 2LP4Y 1OXMA 2QXYA 1QXSA 1Z8HA 3BWBA 1WBDA 1C81A 4UCWA 5EQFA 3BA1A 5DM4A 4R40A 4B71A 2V45A 4TVOA 5DXFA 1JG7A 4CKEA 3GCDA 2R751 5CFLA 4G8BA 1BGXT 2PGLA 3ADOA 1YVRA 5JAZA 1P9OA 4LTMA 2VP9A 1GILA 2OAEA 2Q0XA 1EP1B 3PWTA 2BZ1A 2ZS7A 5EUMA 2GJKA 4FN5A 4HQLA 4B5KA 1LZLA 3QF7A 2BFPA 5I9SA 3EAQA 2OV4A 1JN0A 5D3MB 3JALA 5A4IS 5BOVA 1NYLA 1OT3A 2DUNA 5DK6A 3K92A 1LCIA 4IXWA 3W6NA 2C2XA 4G86A 2O8FA 5DYGA 1NYRA 1Z6TA 3FB4A 2AC4A 2C5HA 4QNMA 3FB1A 2PUGA 1Q14A 1G8JA 1YCDA 3KJFA 4JC5A 2NUPA 3BERA 3DHNA 2GSDA 3W2TA 4IHJB 1R5NA 2FUG6 2WVAA 1AQUA 3LXMA 2FMKA 2H0QA 2PWZA 1W8IA 1XK6A 1G18A 2EU8A 4B7UA 2AN9A 5CJPA 1I24A 4HZUA 2XQFA 3FPAA 4DA4A 1QUFA 4ID3A 1MJFA 5JS7A 5C5CA 2GYUA 1XHFA 2AV6A 2FW7A 2D5CA 4KDFA 4KH0A 4MTLA 4LZPA 1P4SA 3QFCA 3H2BA 3QBDA 1MA0A 1EDBA 1L4FA 1S2GA 3STWA 2ZTUA 1KRWA 4GM1A 4BX9A 3K5WA 3JWPA 2IODA 4KRXA 3DAFA 1ODCA 1V8ZA 1VHJA 2CSUA 1MFPA 1EAYA 1UBSB 1IH8A 2RONA 3A58B 3ID6C 3P0FA 3Q5DA 3EHDA 3ZE0B 3TRKA 5GZ3A 3S68A 2HIGA 5TF0A 4M1QA 2PSDA 5KYWA 1IOWA 4JK3A 1UBTS 3JWGA 4JBIA 2G0TA 4M8KA 2IGTA 2QL5A 5F7OA 3ZD7A 2ZUEA 3WA7A 2MJLA 1W0KD 4R68A 1MX1A 1GU0A 4JJ8A 4QPNA 2H2IA 3K0KA 1NN0A 2A6PA 2C78A 2NU9B 1HR0B 4CQLA 4MPDA 1AZWA 5BRAA 2WILA 5DIZA 3LPCA 5G1PA 1PQPA 2H1SA 3R9XA 2PZJA 5KBYA 4G5OA 1FUIA 2R11A 4TTSA 4C6RA 3TKAA 1HEYA 2HU2A 4RH0A 4RM2A 3HV0A 1QHYA 2KE5A 5IVDA 4YAFA 4DLWA 6REQB 3MM4A 1EXDA 1ISPA 3GEHA 4WK0B 1UAAA 2QN7A 1FTWA 4FWIB 2BYTA 3GAFA 4KQWA 4P4TA 5DNDA 2EX1A 3K94A 4W6ZA 1ZEJA 3AH8A 1NVBA 4MYRA 1WKCA 3ZX4A 2BFOA 4RZXA 2EFYA 3RSCA 3QVGA 1YRYE 2RIRA 2Z57A 1P9WA 1GZ6A 2ZU0C 3JD1A 1C0KA 4A0FA 3DULA 3LV8A 5CDUA 5LQRA 5AQEA 2ZRNA 1I7LA 2I4OA 5I01A 1VMEA 4B6JA 4RTQA 4XGRA 3WIVA 3QVUA 4PZEA 3Q88A 3V3KA 3ECAA 3L6BA 2CNWD 3LX4A 1KY5A 1U0JA 2V98A 3O82A 1SQSA 1QCCA 1MB0A 2QU8A 2GKSA 1KBZA 4ZVPA 4OL9A 1WUKS 1IY2A 1GARA 1NBHA 1SXGA 1G7SA 1SQ5A 3C7DB 3L7JA 3MRSA 3OBIA 1ODIA 3A6DA 3EFEA 4MKXA 4OBWA 4PZLA 4BO4A 4EFDA 1ZOOA 2TRSB 3SKYA 3YASA 5FLYA 4KOEC 1VDZA 4BQPA 2HX1A 2PGAA 1EXNA 5AKKA 3CSDA 2OHXA 1AQ6A 2ODPA 4R2WA 2O0HA 5ECGC 4Z6KA 5LD2B 1ONOA 1AQJA 4QVGA 3FPGA 4NENA 3KJGA 1XZBA 3HI4A 5HF9A 4J2HA 4MRAA 5ELLA 2HD4A 1G59A 4DMRA 3GVIA 1DINA 5CX1A 1LEHA 1JF8A 3F6YA 4KQHA 1FNMA 5AI5A 4P4SB 3L5OA 2FZEA 3SBOA 3IHTA 1VJ5A 3DZGA 4MR9A 8ATCA 1P1BA 1CZUA 2WM8A 3E1GA 3O7MA 1GDTA 3RGWS 2WT9A 3S2EA 2JI9A 5KMGA 3K0SA 1CRWG 3BD9A 4U7GA 1P5ZB 1C3LA 4I9GA 4EHIA 5B57C 2F3QA 1QS0A 2PR7A 2W6IA 1EVEA 4MVYA 4RA9B 1Z6YA 4HQ6A 4DDTA 3RAFC 1JQBA 5K3DA 1E1RA 2OILA 2PL5A 2YFHA 1GKYA 2OCXA 4UNNA 1BVUA 1KJ9A 2XLCA 4I50B 2WWHA 4AS3A 4EW3A 1GZ5A 2EG9A 3ZLVA 4LF5B 2WG1A 4WQMA 4EL5A 3I92A 4MUKA 4JUIA 4NWIA 1B74A 1SQFA 1RPZA 2XCIA 2YXLA 3QXXA 4EGFA 2Y2VA 1ML4A 2EOAA 3CW9A 2FDRA 4FJ2A 4HHEA 3AP3A 3SR3A 4FM9A 1P39A 2M6SA 2ZTHA 2WAYA 4REQB 2GHRA 4G8DA 3RYFB 1XELA 1EX6A 3G7UA 2GWHA 3ND6A 3VPDA 3EMDA 1BW9B 1WIWA 2YWHA 3KB8A 2IWHA 5AUOB 2HL6A 4C1BA 1TL7C 5ALRA 1R0WA 4FCWA 2VT3A 4I5E