1ISRA

Crystal structure of metabotropic glutamate receptor subtype 1 complexed with glutamate and gadolinium ion
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
477
structure length
448
Chain Sequence
RSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metabotropic Glutamate Receptor subtype 1
publication title Structural views of the ligand-binding cores of a metabotropic glutamate receptor complexed with an antagonist and both glutamate and Gd3+.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 144
structure length 448
sequence length 477
ec nomenclature
pdb deposition date 2001-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1isrA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1isrA01
1Z18A 3FGZA 3L49A 2N9UA 1LBHA 2RJNA 3KHTA 4Z99A 4RV5A 3UUGA 1TVMA 4EVSA 2A9QA 3DBIA 1AB5A 3QELA 4LE0A 5BQ3A 4Q6BA 1BDJA 4RY0A 4EYOA 2FXIA 2OENG 3QELB 1YIOA 2LPMA 3QLVC 4NQRA 1QQBA 1YMUA 3R0JA 1NXWA 5DCLA 1DC7A 4LDZA 4D6XA 4FB4A 1M2FA 3TO5A 4MQEB 2FQXA 3LOPA 4LE1A 5BRJA 7ABPA 3JVDA 3EGCA 5CNMA 1PNTA 2PMCA 1NXVA 3MQ4A 2HQOA 1ISSA 2FEWB 4JB0A 5TQ2B 2FN8A 3GA5A 3EQ2A 3RQIA 2IOYA 4S04A 3LKVA 1DRJA 3EDCA 4Q7EA 1DBQA 2PL9A 2P4UA 5B3JA 1JH9A 4KK3A 3Q9SA 4LZLA 3Q7SA 5JNRA 3URMA 1JYEA 2PLNA 3JTEA 4H3KB 3QEMB 4JA2A 3HEBA 1D5WA 1M2EA 4WZZA 2NT3A 1JHZA 4H60A 3QK7A 5KC8A 1RNLA 2QW1A 2R4QA 3A0UA 1H9CA 1E2BA 4EVRA 3MA0A 2WMYA 2IYNA 3CTPA 3OM1A 5JNVA 1P6UA 1KRWA 3HS3A 1BDIA 3ROTA 5DKFA 1DG9A 1MB0A 1ZDMA 2GI4A 2CWDA 3A3KA 3F6PA 3JY6A 4MR8A 1SD5A 2RGYA 3DGEC 3QLUA 5JNWA 3O2JA 5JNUA 1U2PA 3LUAA 3LUKA 4RXUA 4WXEA 4Z9AA 4MR8B 2PE5A 1L5YA 1LBIA 3I45A 3CS3A 3GT7A 5HSGA 3H75A 1P6QA 4KZKA 4RS3A 4MS1B 1D1QA 1NXOA 5FBHA 4RDCA 5FWXA 2E4WA 3CZ5A 3H1EA 2MSKA 5PNTA 1RPJA 2JVJA 4RK1A 2TMYA 4QICA 1M5UA 2VYCA 4ZMRA 5ABPA 5FWXB 4P1ZA 2MSLA 1APBA 2PUEA 1CYEA 1BA2A 3O75A 1U2QA 3JPWA 3N53A 4H3HB 2HQRA 3SNKA 3H5WA 3EULA 3OLXA 3KYIB 4GPAA 1RXIA 5KQPA 3O1IC 4KPYA 3HUTA 4IMIB 3GBPA 5T7BA 4NCBA 3EJWA 4RKQA 5TE9A 1NY5A 3Q7TA 1OXKB 1VKRA 1QO0D 3CNBA 2NUBA 4MLCA 4EYKA 3FMVA 1JBEA 1DCKA 4D6YA 1QNLA 2CHEA 3KSMA 5KC9A 3EODA 4MRMA 3QX9A 5BRAA 4LDAA 3SG0A 3E61A 3LUJA 4N03A 3OMXA 1EWKA 5IC5A 3S99A 4XARA 1HEYA 5CNJA 3KS9A 4YCSA 1QP0A 4RZSA 4RK0A 2PUAA 5EWMA 1KMIY 2OQRA 1NXSA 1JDNA 1MB3A 4IF4A 3BILA 1AB6A 2VUIB 4QYWA 3DZDA 2FLWA 2RDMA 3HDGA 2ID7A 3I42A 5B3JC 1KRXA 2QR3A 1D1PA 4TLLB 4F12A 4N76A 3CLKA 3HCWA 3O21A 1MVOA 1C0EA 8ABPA 6ABPA 5JNTA 4YS6A 1JYFA 4O1HA 3TD9A 1ZVVA 2BGGA 2MYUA 3T95A 2HPHA 2WJWA 2M98A 2DRIA 4KVFA 4RXMA 4D74A 2PUGA 4IMJB 3BRSA 4RWEA 4WT7A 3C3MA 1QP4A 4Z4HA 2ZAYA 3MIZA 4OTZA 5HM6A 2JB9A 1LJLA 3IDOA 3IP6A 2L2QA 3RVSA 4IILA 3KTOA 4UHJA 5DGCA 4YV7A 5DLEA 1L5ZA 2A9PA 3L6UA 3QEKA 4MS4A 3OM0A 3H5OA 3RVJA 2IKSA 4MR7A 4B09A 3GL9A 2HJ9A 4YGXB 2B1JA 5KQLA 3RVLA 3HM9A 4MQEA 4MS4B 1EHCA 3HO1A 4MR7B 4RY9A 2B4AA 2QSJA 3Q15C 4G0MA 4RK7A 3OO1A 4EYQA 5I4CA 1PNRA 5KWSA 3GWGA 4OLAA 3GBVA 3D8UA 5TQ2A 3GRCA 1RZRD 2PUFA 1EWVA 1ZESA 2MYNA 2YHBA 4XXHA 3OQMA 3RVKA 2IPAB 3F6CA 2GX6A 1TM2A 1ZGZA 4PICA 2E4VA 4KREA 2A9RA 3N8IA 3O2QB 4JAVC 4W5RA 2FKAA 4FE4A 3P9YA 2CHFA 2FQYA 3QEMA 4G0ZA 3BREA 1J56A 2MYPA 2IPNA 3C3KA 4N0PA 1DJMA 1P8AA 1PEAA 1UDRA 1Z25A 3H5LA 2AYXA 2A9OA 3DLBA 4G86A 4QYMA 1E6MA 2WY2D 5IUKC 3RVMA 2E4XA 3NHZA 4RY8A 3HK2A 3DGFC 1IIBA 1D2AA 1EWTA 1E6KA 3ILHA 3IPAA 3IPCA 3M6MD 4W5TA 4Z4IA 4ZYLA 3SQNA 1YMVA 4RK6A 1T34A 5TQJA 1PUXA 2F8TA 4MQFA 1Y1LA 1R8JA 2XDYA 4KK4A 3G1WA 3G85A 3KLNA 3OLVA 4MQFB 1Z15A 3JPYA 1JWLA 4LX8A 4YO7A 1NXTA 2VUHB 2JVKA 3F7NA 2R25B 1DRKA 2J48A 4S05A 4MS1A 2Q5CA 4DN6A 4IRXA 2F8SA 2HSGA 2O20A 3HV2A 1GCAA 3C97A 1PHRA 5FWYB 1JFVA 5GOTA 4EYGA 2ZWMA 3NHMA 2QU7A 3HDVA 4JB2A 4Z0NA 3C3WA 3KCNA 4F3TA 4ML3A 1Z2DA 2I6FA 1BDHA 3VNBA 3LUCA 1D4ZA 1A04A 3EQZA 2FMIA 3IP9A 1YVUA 1NATA 3JS5A 2JVIA 4G0XA 4EUKA 3RVRA 4JOQA 3GV0A 5TQ0A 1ZH4A 2FSPA 1DC8A 4EY3A 1SXGA 3B2NA 3VNAA 1C4WA 2PUDA 2KYRA 5KQMA 2QV0A 3EAFA 5TQ0B 4LRQA 3RVQA 4N41A 5HQJA 1Z16A 3CU5A 2CD7A 1QPZA 3RVNA 4Y9TA 4L85A 3SM9A 4UHKA 3LFTA 4RSMA 4XASA 4YLEA 3QX8A 5TPZD 2R48A 4L4UA 4YRZA 1U04A 2QVGA 1ZGGA 4ETNA 1FFWA 3H6GA 4Z4GA 4G0YA 4HYEA 3H5TA 1I3CA 1K66A 4HNRA 1DZ3A 2QXYA 2PUCA 3CRNA 9ABPA 2L18A 4WXMA 3W9SA 4Z4CA 4N0QA 1Z17A 1NXPA 1XWWA 1RXEA 3TMYA 1XHFA 2FEPA 5IEJA 2LUOA 1DCFA 3BRQA 1KGSA 3CZCA 3T6KA 4ZJPA 4NCAA 1QO0A 4IGAA 2JRLA 3IP5A 1ISRA 5ED4A 1Z26A 3N6VA 2E4YA 3K9CA 3F73A 1MAVA 3JVIA 2NZUG 4YWHA 1LJUA 3H1FA 4ZMSA 2LIVA 4RU1A 5F64A 3HJFA 4W5NA 5IX8A 3LMKA 1U8TA 1TMYA 1GUBA 4XFKA 1JL3A 1QQAA 3QLUC 1TLFA 4JASB 1USGA 3A0RB 2IPMA 1URPA 1GCGA 4MS3A 2R47A 4LE2A 5E3JA 3RVPA 4F8JA 1XHEA 3LKBA 4ETIA 4MAAA 4MS3B 2FMKA 1PEYA 2L19A 2QVCA 3CG0A 1U0SY 3N75A 3NNSA 3MM4A 4CBVA 3OQOA 3CKMA 1GLGA 4P98A 2WB4A 4KRFA 2LBPA 1YS7A 1JX6A 2RJOA 5IULC 4G97A 2H0AA 5BR1A 3C6QA 1JFTA 3LUGA 3O1JC 1E6LA 4WWHA 4TLMB 1QMPA 4OATA 2VK2A 2V0NA 3OLYA 4Z9BA 1A0OA 3KG2A 5IEBA 1ZITA 3FFWA 1F4VA 3HZHA 3T8YA 5GQSA 2M1ZA 4HNQA 1VLZA 3LUDA 5IBQA 1SXIA 3HUUA 1YS6A 1QP7A 3D02A 4XLTA 2GBPA 3TB6A 3HXMA 3MYYA 4FE7A 4O1IA 3E3MA 2MSWA 3H5VA 2FMFA 3KJXA 2PUBA 2L17A 2GKGA 3O2SB 3Q41A 4PYRA 2PKXA 3OLZA 1B00A 3H5IA 3M9WA 4GNRA 1YK1A 2IPLA 1VPWA 5FBKA 3CHYA 4N47A 3CG4A 5CNKA 1SRRA 5JS2A 4ETMA 2WRZA 3HVRA 2FEKA 1RZRA 2QZJA 3LUFA 1ZAYA 2FTKE 3UKJA 3Q7RA 4TN5A 2HQBA 4YR7A 5TPWA 3IP7A 5FWYA 3NNDA 1Z2EA 1W9HA 1WETA 2P9HA 5TPWB 1ABEA 4NICA 1JFSA 4KNYA 1FFGA 1OXBB 1A2OA 1EAYA 1YK0A 3A10A 3NBMA 3OLWA 2PL1A 3FFXA 4O5AA 1USKA 2E4ZA 2E4UA 4NV3A 3FFTA 4Q6WA 1EFAA 5HKOA 1QKKA 1NXXA 1USIA 4EVQA 3QLTA 2FN9A 1SXHA 3ROFA 2JK1A 3BBLA 3KYJB 3K4HA 1M5TA 1LK0A 1FQWA 1ZY2A 4EGSA 1K68A 1ZH2A 4F11A 1GUDA 1FFSA 1MIHA 3QLVA 4MLDA 3OQNA 4JP1A 3OMWA 4Z4FA 3MF4A 4MYRA 4XAQA 4F06A 2FVYA 1JF8A 2JBAA 1DCMA 3I09A 4E7PA 1W25A 1DBPA 2YHAA 4G0QA 2GWRA 4OLBA 3SAJA 2JBAB 1ABFA 4Z4EA 4KFCA 5T3YA 3HSYA 6CHYA 4PE5B 2W42A 5JS1A 1DBWA 1DP4A 1VRVA 1ZN2A 3H1GA 2ID9A 3M9XA 4OBBA 4ZPJA 1NTRA 3TX6A 3O1HB 1S8NA 3FDFA 5IUNC 4KQCA 2H3HA 5D2CA 1TJYA 4G0OA 5CHYA 3T38A 4W5OA 5CNIA 5EWJA 1CEYA 5EWLA 4MRMB 1F51E 3RVOA 4RKRA 2PJUA 3O74A 4RK5A 5C5EA 2X7XA 5EWJB 3UK0A 5EWLB 4RK4A 1ZHHA 3LUHA 3MMNA 1FSPA 4PZ0A 2NZVG 4KMRA 4PEVA 5TPZA 4MR9A 4MGEA 5EWMB 2PAFA 2FQWA 1JDPA 3ILYA 3SY8A 4WUTA 1YTUA 3H6HA 3LTEA 5DTEA 4E7OA 4MR9B 3RH0A 3KKEA 4HNSA 1Z13A 4DADA 1JLKA 2LP4Y 4OG2A 3NNNA 4MPTA 5IUJC 4TMYA 3OO0A 5JNSA 4G0PA 4KQ9A 4M88A 1P2FA 2JCGA 1BVHA 2FW0A 1CHNA 3DLHA 4KV7A 2MYTA 5KQGA 2AYZA 3N0RA 4DQDA 2FMHA 5C5CA 1Z12A 3N0WA 2FLKA 3KLOA 1BAPA 3N0XA 4QPJC 2WWVD 2WJAA 2IDMA 4RXTA 3I5AA 4YP9A 5KI6A 2NT4A 3GYBA 4W5QA 3CFYA
chains in the Genus database with same CATH superfamily
4K8OA 4M87A 1F38A 1YVDA 2OLKA 3GVPA 4MKHA 1V6AA 1XYYA 1JG3A 2P75A 4CLDA 1UPFA 5HOQA 3FNFA 2XB9A 4RDXA 1T6XA 4NKRA 1TVEA 2GH1A 1C8BA 3C5HA 1IMOA 2XLCA 2ZATA 3DQQA 3JATA 3QELA 4V0MA 5BVGB 4CF7A 4HLUA 4UD2A 1RVDA 2Y1XA 3WHIA 2I2CA 2YZMA 4EVIA 3ICEA 1TMGE 1SVUA 2W00A 2V9PA 3CSUA 3OP4A 4MRRA 1DG3A 1QQBA 5CW1A 1NMXA 3AINA 4LTNA 2YIVX 3IAS1 3S81A 1X8JA 4L76A 1YR8A 2EW2A 4Q34A 4RHFA 3IFSA 4EJMA 1UT8A 5LCXA 1HT1E 2GESA 3LOPA 3SS8A 1KNXA 2ADFA 5G1OA 2H4HA 3G5TA 5JASA 5AVXA 2R87A 2BE7A 3WQHA 3OF3A 2AI2A 1RPTA 4CG2A 4Q47A 1TU4A 1OTYA 3NHAA 4IYRA 4S1VA 3FVRA 3KTFA 2H2AA 2GEKA 1EUDA 1AK2A 3MWKA 1N8KA 2C97A 2CXSA 1GKLA 2X2FA 4PQRA 1JYEA 1X7HA 4AX8A 4ZGWA 1FSFA 2B82A 1WXXA 2XVAA 3ZDAA 1IRIA 1MXFA 3I2HA 1Y7TA 5J5AA 3URKA 4AN4A 5TMPA 3FCYA 1Y3AA 3E6AA 4MWTA 3KZCA 1G7SA 1JR3D 1EB8A 1PGOA 2QW1A 4K86A 2NO6A 4ZU1X 3S8MA 4BV3A 2B92A 3L4BC 4BGDA 3NU1A 2HI0A 1L5QA 2BMDA 2VTKA 1N5IA 3C6MA 4U00A 5E0OA 3E81A 4O8CA 5DFAA 4CMEC 2YV4A 1E7YA 3AO0B 4YGYA 5IJ9A 4XPIA 4ZPXA 5JNWA 4AZVA 5C52B 2OKCA 3GGGA 3PXXA 5DYIA 5AJWA 4X66B 2VNHA 1N77A 1BXRA 3KR2A 1PP4A 2AC2A 1CY6A 2C7OA 2UVPA 3CS3A 1RCTE 2AL7A 3PJDA 4IIGA 1QH8A 4RD4A 4B3XA 3ZZTA 1MJGM 4X0EA 2CVZA 3CN9A 2FPUA 4MJ7A 2GEBA 1RBYA 3D0KA 1M2NA 1BXKA 3JWIA 3PIIA 4P4SA 4PYMA 2DCUA 4LN1A 2CL0X 4W9NC 3KBBA 4RA9B 3A6FA 4QICA 4XCQA 4B6PA 3REGA 2O7NA 2I3GA 5KOHA 4HMPA 5EZQA 1CUSA 2WHXA 4XWOA 4M1KA 4LG1A 3UJ7A 5EJIA 4H3HB 5GJCA 4NV1A 1ZNXA 1U8CB 3KYIB 4JBYA 4NPCA 4X44A 3FJ1A 3TCKA 1L1RA 2EV9A 5CDTA 4U3JB 3JQ7B 2B35A 1Q16A 1SQSA 1VMAA 1U2GA 1YBAA 4HLUC 3KRTA 1MVNA 1X1TA 3RM3A 2O48X 2QZZA 6REQA 5JC8A 1LQTA 4MUFA 4D6YA 1DCKA 1OASA 1QHNA 1XDSA 2HFKA 2WU1A 3LQ1A 1XL0A 3OTQA 5IFKA 3AU9A 1QQTA 1RXUA 1TA4A 4I46A 5EN4A 2YYZA 2OGSA 4J8PA 4J0FA 1XLVA 5DSTA 4DDMA 2J33A 3DTYA 1YQXA 5IU6A 4NDAA 3ZY4A 3PQDA 4BV9A 2HT1A 4EHFA 3FJOA 1FQKA 1NBIA 5L3SA 3RFVA 4D3YA 2OQRA 2PV0A 3JWGA 4H18A 3HJUA 4PX5A 2VUIB 2OXRA 2J5KA 3ADPA 4D92A 2ZRBA 3KALA 5LJLA 9MHTA 2HMUA 2W48A 3EXHB 3VPFA 1TJNA 3EG9A 1YSCA 3V8BA 5MN6A 1TC2A 1LWNA 2AOXA 4GLLA 2AKAB 2HK8A 2WZDA 4XSGA 1VP3A 5EERA 2XKKA 3AW9A 1CS0A 1XMVA 3BB3A 3GLRA 1L1QA 4NBNA 3RUIA 1GDDA 3WX0A 1Q0PA 4Z2AA 4NU8X 1YAHA 4WK0B 3C74A 3K31A 1G3QA 3DMTA 4A0QA 2XD4A 2P0AA 1ZC4A 2DQYA 2XMPA 1JDJA 4KFSA 1JMKC 1E1LA 4FFMA 1OILA 2VT2A 4PVDA 3F71A 4QQ8A 3BK2A 4NV0A 4GUDA 3QEBZ 2BM9A 3HL0A 3H3XA 5DM1A 1Q83A 3PNPA 3UV6A 5M3BA 3MELA 4LFAB 2AN3A 5AHRA 4ZGBA 4G8CA 5TARA 3ZZ0A 2IXAA 4FC7A 1UMCA 5HM6A 1LXCA 5A5DA 3K5HA 1KP9A 3U7IA 4HDNA 1U6IA 4AMGA 2WILA 4JJ7A 5AWFC 3FHOA 4NZYA 3OCYA 4OFZA 2VHUA 4MI6A 4RF2A 2HEIA 4RF4A 4RESA 2XMGA 5BSMA 1I4LD 4OGGA 5BN4B 1E2DA 4MJ3A 2AJLI 4D9BA 3MJ4A 4B09A 2IKSA 1XPUA 2QMQA 1BMFA 1U9IA 1PJCA 3GLUA 4RQTA 3TNFA 2B1JA 3W2EA 5M34A 3F5QA 1PW5A 2DQSA 1NQOA 3ZWDA 5ILOA 1DXOA 5AO9A 4NR0A 2NSJA 1UJ5A 2J0EA 2QXTA 4ESVA 3H8VA 4FB5A 3PUXA 1N34B 3ZDRA 2B6HA 5HM8A 3BXPA 1JS1X 4ZT5A 1YRAA 2JLQA 3D4IA 4ID9A 3K8YA 1B74A 5FR2A 5GIPE 2VPIA 3KYCB 2OLJA 1TUIA 2DFKB 4GR4A 2XHEA 2ZB7A 1Q77A 4IR7A 2NYAA 1U2GC 4JA0A 5DNDA 5KKNB 2FKAA 2OZLA 4V0OA 3Q9UA 1VJ5A 2WAYA 3WLJA 5B30A 3ETLA 1L5HA 1P1BA 1GQSA 4K3VA 1NW9B 2QAIA 1UDRA 3RAJA 3DLBA 1E1CB 1AKQA 4AKIA 1NF9A 1KWGA 4P7GA 3I34X 3DNFA 2WY2D 5IUKC 2BCEA 1Y1PA 4YRRA 1AUOA 1XNQB 3UEOA 5AOBA 3BB4A 3DMPA 1T9DA 3DO8A 4J7CA 1LUAA 5UKDA 1QIJA 3IAS6 4NJEA 1ACLA 1GPJA 4LHYA 3SSAA 2B1IA 3G6KA 4PCVA 3MWDA 4I8DA 2BCJQ 2PZ8A 1ZHFA 3X1YA 4N6OA 4B4KA 1PE0A 4WN9A 1CVLA 4POOA 4UTPA 4OHFA 1NPDA 4TKVB 4AKGA 2QORA 3A6LA 2G9RA 1KKLA 3EIQA 3W6UA 3WGTA 5EP1A 3GU3A 5EUCA 1VJCA 1UL1X 2ZUDA 5TGDA 2XE6A 2O1WA 2BT4A 1MOSA 2EBWA 2FUCA 2WKQA 2YIJA 3DMTC 4IIXA 4IRXA 3I39X 1I14A 4J0DA 4XVQA 3AM1A 4JLSA 3ESDA 2GPWA 4Y0NA 1CEEA 1XT6A 3MJTA 4H08A 3H2IA 5HFAA 3BDIA 1X3SA 1ULTA 1LF5A 3OFNA 4CMIA 3IR5A 4Y2VA 3LUCA 2CL5A 1ISGA 3FUVA 5ENDA 2X4DA 3TIFA 1PZEA 3GV0A 3PFCA 3RSFA 1XQXA 1ZIYA 3WAJA 3WLTA 1SXGA 3E7DA 3QPVA 1X1CA 3EQ8A 2X0EA 3AYZB 3VAZA 4GLOA 4K9SA 4BQEA 2QLBA 3RF7A 5ALIA 1VPTA 3QKRA 4Q7JB 1QLWA 2PXCA 1G55A 1CVIA 4WCFB 5ALQA 2E55A 4REMA 4GIBA 1F06A 1E1NA 3LFTA 5AUPB 1MN6A 4O0LA 2H9YA 4YLEA 3RTGA 2R48A 4HUQB 4L4UA 4ALNA 1ZW6A 4Q39A 1EYZA 3EXIB 4TMXA 1KI6B 1UBLS 1BXGA 3WLNA 1M2GA 1W581 5C8YB 1Q3KA 2RB4A 3HJBA 1P4HA 1R0XA 1XNGA 1WPGA 1T36B 1RJ9B 2VATA 3DE6X 3EJ6A 3A4NA 3INGA 4U7FA 5SZHB 3WO1A 3TGPA 4J4TA 2PT7A 1JKMA 3AFHA 3KQYA 4M37A 1WCYA 1BHO1 1JEQA 4R8MA 4MINA 1XCLA 4FZVA 4J1SA 1U0GA 3D0QA 2W43A 2XUFA 5TC4A 4IUBS 3L07A 2DFTA 1ECGA 2LUOA 2G36A 2NXWA 2ZBVA 1DCFA 2UZ3A 3BRQA 3ND8A 2H63A 4KBFA 4OLFA 1BYUA 4FOOA 4HATA 1UKAA 2ZRQA 5AJVB 4MA5A 3RNLA 4AICA 3OKFA 2H85A 1OROA 4EY6A 3P8ZA 5EJGA 2EYUA 4RVFA 3F73A 2JZOA 1MJGA 4L5AA 2O3QA 1TM4E 4EWLA 1EWQA 4UCFA 1GSIA 4TS4A 1OI4A 4B3MB 1OB5A 3O2NA 4I99A 4IXMA 4DOMA 1DLIA 5IKXA 4J76A 3TDKA 1X1EA 4U7TB 2XE4A 2NIPA 1OLUA 4XWWA 3CRVA 4EI7A 3LYLA 1GTL1 3JVUA 4JASB 4LK2A 1N7JA 1V41E 4U2BA 5HJEA 3O8OA 5J47A 3PQ6A 2YZ7A 1JHOA 2B83A 3HL4A 3M9LA 4YTEA 4F21A 5C8XA 2AFHA 1GEEA 4FX5A 3R9IA 5FPTA 2QX6A 1CJTC 1O94C 3LPCA 4ZYWA 2JFUA 1DHTA 4LF7B 2BVNA 3P2KA 1VTKA 4DRXA 2PKWA 4UDXX 3WE7A 2GCNA 5AXBA 1YF3A 3DOFA 2GEJA 5EIXA 2R8OA 1V1RB 4O2BB 4S2UA 5EZYF 1E6WA 4A0HA 1YS7A 5HQTA 5COBA 3EQ6A 2B8EA 3EW7A 4BECA 3KFLA 2VR1A 4EDHA 4O2AF 1AGNA 5BR1A 1Y7PA 3WGNA 1O89A 5AVQA 4PHHA 3VVMA 1JDVA 1HMYA 3O95A 1KY2A 2GN4A 1XV5A 2QTBA 2Q9UA 1NJ1A 3GEBA 4QQFA 3WL6A 2PKCA 4C6RA 5HYVA 4EECA 3RKUA 1TW3A 2PH1A 3L8GA 3HY3A 3I76A 4G1UC 3QQPA 5D3KA 2RGUA 3FUCA 3DLAA 4JI7B 1QFXA 5MN5A 2IZ0A 2IYVA 3R23A 1Z62A 2QN1A 1HK7A 1L4NA 2C5BA 2UZ1A 5TEWA 4KO3S 2AEMA 4L51A 3UHJA 3VYWA 2I7TA 3PF8A 1CNMA 1P0FA 3B3FA 2QM3A 3PFHA 1W96A 3K0FA 4FE7A 1TD1A 4TV9A 3ZU5A 2YW9A 4AFNA 1EP3B 1VMDA 4Q1AA 3QEJA 1C3OA 2I8AA 1SUEA 3D4NA 2QRNA 3GGDA 4BWVA 3LCRA 1ZUNA 1PGJA 2CFCA 4YV2A 3O73A 4GXRA 4UXHA 2BEUB 3CV3A 5CNKA 3ZW9A 3ZKAA 2VEDA 2WM9B 3AT1A 5HS4A 1DKMA 2PBLA 3K0KA 3RBXA 3LUFA 3W8DA 1EA5A 3G1UA 1UEXC 5K3FB 4D9FA 1P3JA 4A1OA 1I4WA 1T24A 3B53X 3GH1A 3OT4A 4D41A 1RM5A 4EELA 5CBPB 3L9XA 3IMFA 2ABWA 4CLOA 5HEKA 1QFJA 2NU7A 2R6AA 1W19A 4NICA 2J3DA 4KNYA 4NULA 2XH8A 1HTTA 3BH0A 3IEKA 2BPOA 3HFRA 2AJDA 3NBMA 2PGIA 1P7VA 3SIPA 1ZX1A 4AP5A 5DGXA 1F5NA 1PGNA 8ADHA 3HRHA 4OMUA 1WAMA 3CF4A 4NZPA 3FY4A 2XQGA 2YJZA 4QNRA 5DX1A 5HS6A 2QTCA 2XRZA 3B5JA 3T54A 1LBSA 2C5GA 4NDZA 3HRKA 1N92A 1SXHA 5D5QA 1K5DA 1RBZA 3BBLA 1B76A 1HFEL 1OWMA 1XVAA 1Y1QA 3THOA 1KR2A 4BCBA 3MNFA 2OZKA 3HXLA 1FP2A 3OZBA 2JCBA 3PGXA 4JVOA 2HSZA 3TJRA 2ZUEA 1KU0A 1DXYA 3T4EA 2ZU6A 2ZS7A 1GUDA 3GLHB 2V0CA 3V8MA 4ICIA 3CLSD 3O26A 4CR7A 2E7ZA 5D6OA 5TV2A 4E1AA 1DX6A 3V3TA 3ZX4A 3GFPA 3CJTA 4F06A 3IIMA 3AI1A 5DGDA 3QVWA 1GKIA 1Z8FA 5HXAA 4LXXA 2BI8A 2OM6A 2JLUA 5F5NA 3T9EA 3O8QA 1INLA 4ZOLF 2O1EA 2ZW9A 1V3VA 4WZBA 2CJFA 4Z4EA 4B3GA 6CHYA 4KWCA 4V0NA 3QPAA 1IBRA 3MINA 4NARA 3EZNA 4NBKA 4CL8A 1KO4A 1YASA 1V3TA 1RMQA 2OBNA 2NZWA 2OCXA 3CW9A 3H1GA 3KOUA 5H7XA 3TWOA 3GELA 3U44A 2YNMD 4X9XA 4YX9A 1KOGA 3TQOA 4C2TA 2VAPA 4HFJA 3D6AA 3PUWA 3WLMA 4L5YA 3NV9A 3LK7A 2MSEB 5K0NA 1QAOA 1DRWA 4HDRB 4RQUA 4CV2A 1IZYA 4OHBA 3QM1A 4E3WA 1T5OA 1NVVR 3WGMA 2ZIEA 1YJAA 3EF1A 4OH1A 1DTWA 1VE3A 2DBRA 5JJIA 3ANNA 4WZ6A 4P5EA 5LDGA 4JT2A 2KE5A 4KMMA 2V45A 4MR9B 3L7DA 4EX7A 5L6LB 3HKEA 4OYRA 4U0KA 4S2EA 4B46A 1KJ9A 2ORYA 5EXEA 2HXGA 3WFZA 3ZPXA 1RQXA 3G79A 4DCVA 1ZD1A 1DV2A 1RZUA 2J3EA 4RVGA 4HDCA 1ULAA 4ZTBA 1GG5A 1CY0A 2JCGA 1AN0A 1NUQA 2OZEA 4GO1A 3S27A 3DLHA 3BCSA 1TQ6A 4CEHB 4JEIA 5DWDA 3GVCA 1S4MA 4PBTA 5F9HA 1GGNA 1G16A 3OZGA 1VSUA 4FZJA 1WZEA 3OQHA 5ELLA 4C1NA 5F2NA 4WJKB 4YCAA 1AHHA 1I1NA 1QVRA 2OCGA 5BN5A 1XMIA 5A02A 3CO5A 1TYZA 7MHTA 4Q02A 2J45A 1F20A 1FVXA 3ZY5A 4G36A 1GQRA 4X7PA 4LF6B 3G0DA 3IT3A 4F96A 2ZRIA 3DE7X 4QU5A 1SXJA 1TVMA 3C6BA 1XRJA 3NBZC 1X0XA 5A05A 3ZWPA 3S2IA 1N36B 4OX9B 3BSFA 3Q7TA 4TWIA 3WIVA 3NOOA 2QMEA 5EFOA 1WP9A 4BNZA 1IWOA 1JYSA 3HA5A 1TCAA 3CMMA 2CLMB 4MO9A 2IU3A 2QG4A 2HJHA 4N3AA 1IULA 1LLQA 2ISQA 1E5TA 5JSZA 1MC1A 2EJCA 1FBNA 1N5DA 1MW9X 2YXBA 3CA8A 3OEHA 3D31A 4YHBA 1VCIA 2VNIA 2ETVA 4I9UA 4DHWA 1E0KA 1HT0A 4MQEB 2YWJA 5DW0A 4EGQA 4LVCA 3AM3A 5C3MA 5FTLA 5JUWA 3L4KA 2XNJA 3TLZA 1G18A 4QPPA 1X74A 4CM9D 2R751 3AHFA 3ESZA 4TSKA 3JVDA 3U1TA 3PHLA 3HKDA 5AM2A 3SR3A 4TWBA 2EKPA 1V9CA 3ZU4A 2FDRA 1R18A 1U3WA 4F1JA 4DV2B 2QZSA 3EQ2A 2JFNA 4GQAA 2B94A 2VPZA 2VLIA 3E5HA 1E18A 4J7UA 3S44A 3LBIA 3AVXA 2QX9A 4BP3A 3V7UA 1FYWA 3I1IA 1LPSA 2RHLA 3SSMA 2AMLA 4D3DA 2P79A 1C1XB 2WTBA 2H08A 3W3AD 3AR4A 1GUAA 3HY6A 3HDJA 2NPFA 2BHRA 3H2SA 1UT6A 2ERCA 5L3ZA 1T3HA 2J4CA 4JYPA 1YZHA 4OJMX 2JLZA 3KLPX 2NPOA 5JY6A 1ST2A 3O8LA 4KGVA 2DUNA 4HGRA 1H6CA 3I8SA 3UW1A 5L8VA 3R4CA 4I1SA 1MRZA 3P2IA 2I6UA 4M9UA 5JJLA 1G20E 3WGQA 4H1HA 2GXSA 1Y1RA 1LSJA 2C4HA 2X9LA 1ZOSA 3CNNA 3NUQA 3PX3A 5LSAA 2GB4A 3B3AA 1C8LA 3Q40A 4OJNA 2HA3A 1K1EA 3OPYB 1AOXA 4ZHSA 1VIMA 4V1CB 1KYIA 4CMAA 1BA3A 2GTIA 4IEEA 5CLQA 2H1OA 3QHQA 1L8LA 3AM4A 1PJ3A 4NU6A 2OESA 3GJ3A 3R7BA 4AC9A 2O0LA 3PDHA 3F98A 1JWBB 4RDCA 3WGHA 1VOTA 3OZDA 4H59A 3TZCA 2VWQA 1YULA 2QPAA 1QDEA 1PYGA 4A8PA 1BCSB 3HN2A 1VLJA 3KJEA 5INTA 3TUJC 3PUIA 1VJGA 4U9IS 3SE7A 1DOZA 1P9OA 2WLTA 4GXTA 4YJGB 4AU1A 1FS5A 5DO9A 2OTCA 1SXJC 5KQPA 2ZBEA 1SVLA 2QJTA 3HUTA 1EFVB 1SQFA 4D9JA 3FGOA 1NDQA 4DUGD 1VKOA 1Z0DA 4QGSA 4RKQA 4X6XA 4LYDA 4V0QA 4DIEA 2B8TA 2G76A 1SQ0A 2X6TA 4EHAA 1GZUA 2YJ3A 1NZJA 1Z4QA 4FSHA 4R51A 3DYIA 2Y27A 1WG8A 2NUTB 2X8LA 4ZZ2A 3ILSA 1GTVA 2GUWA 4FLMA 1ELOA 4KDFA 1DQSA 2BEKA 2VC2B 2RAPA 2EX0A 3QUAA 1ADFA 4LX0A 5LP1A 4DM7A 3LPDA 1L6RA 2A5YB 3HJRA 4ZZ1A 1IDOA 3BMQB 2H65A 4FINA 1SVNA 4KOEC 1JNYA 3FSEA 2AGVA 3H4VA 3U1BA 3RSSA 1I1OA 3COVA 2H11A 3KELA 1P0CA 1I51A 5DCYA 3VYUB 4XVHA 3B9QA 3EVCA 5EJ8A 1AA6A 2AOVA 4G5SA 4OXQA 4WX2B 5J58A 1SBNE 4G1VA 4G5GA 3RBAA 2FEAA 2ZSFA 9LDTA 1SBIA 4ARUA 1I4EB 1JYFA 1LPNA 1TVCA 1SCDA 3X2EA 2NXJA 3NOXA 1XZIA 1FMLA 3GJ5A 1IG0A 2CBGA 5JH7F 1RDFA 1D9ZA 3Q3EA 4U5QA 3TMKA 1A98A 1UJ4A 1QH1B 3CZ9A 3KUUA 4URXR 1NVAA 3WBKA 4KQIA 2XMZA 3TQSA 4BO6A 1T6BY 4E2YA 2BLLA 1X15A 4NYMQ 1PX0A 1P1JA 2OYCA 4XM1A 3TZKA 4PWZA 1SUFA 3V8NA 2NZXA 2A0YA 3PLRA 4HEQA 4Q9JA 3NI2A 3CEAA 2QT0A 4B3DA 2Y1OA 4CE6A 3DAOA 1H2YA 3DL0A 5LQKA 1GARA 1R0BA 3DTTA 1LDYA 3VJKA 4L5BA 3MCWA 4R83A 1R66A 3OM0A 1C1HA 2GZRA 3BX1A 4WHMA 3PTZA 5TMEA 4BC0A 3PXEA 5DXFA 4BMYA 4NSNA 4RVNA 2AUTA 5ESRA 4KV9A 3BD9A 1NW8A 4CKWB 3E9QA 5FHQA 2WQZA 2O0HA 1LQUA 5PGMA 3W06A 1U7ZA 3DDZX 4N54A 1M8PA 4K6OA 5C5DA 1JE0A 4NBSA 2BWJA 1P62B 1LPMA 3RFCA 3U26A 4ER7A 1KEEA 3NBKA 3H05A 3J7TA 1XYGA 3LKDA 3M33A 4UQPA 3TDMA 4EHHA 2EXXA 4ATNA 1ZESA 1JJBA 2POQX 3OQMA 3GEPA 2J8ZA 1T4CA 3IVRA 1UFRA 2GX6A 4KN8A 1D3AA 2ANCA 2E4VA 3VI4B 1KBQA 3AQ4A 2Z2YA 2WFZA 4H4DA 1IPFA 1JIKA 3RAGA 3V1TC 4NYJQ 4ZXFA 4BFSA 3W5BA 1HDRA 2MYPA 5AHWA 5BWBA 4A0RA 4PLTA 4ZARA 5DBOA 1Z25A 3MTEA 2JEOA 4YAKA 4I8IA 1VMIA 5ALGA 3VPHA 4O8ZA 2FWAA 2HRCA 4GYJA 4L0CA 1QR6A 3BRWA 4PPFA 1KQ3A 2TYSB 1GFIA 3SHWA 1W1IA 3ZNOA 1BOFA 5ELMA 1YC5A 3ZXUB 4DA0A 1NJSA 2BL4A 3IPAA 1B8NA 3M4NA 4D9HA 3RUCA 3H1TA 1W9MA 2JGMA 2WSIA 2WYOA 3DE1X 3NGMA 4AJ9A 4NXNB 2J9RA 3ZQ4A 1CP2A 3T1HB 1SFRA 1HFWA 1IOLA 4F2WA 3Q9NA 1UJ2A 4D79A 4C07A 3H5RA 4S0ZA 3ZWMA 3K1ZA 4YO7A 5E9AA 1QCDA 4OHZA 2HHHB 1CW2B 1N8SA 1Z4MA 2JVKA 3FD8A 3K8ZA 3NH6A 4F1WA 2VYFA 4YUWA 1M7HA 5B2FA 5A3RA 4DV4B 1UQRA 3HCPA 2QEQA 4KSYA 3ZWYA 4KYIB 2ECKA 3QUTA 3U6BA 3QMVA 4A4DA 3WRYA 4EKEA 1RYNA 1U7UA 3W79A 4LY6A 3NHMA 4C88A 1PRYA 2IVFA 2ZSDA 1W59A 3HDVA 1T3LA 2V5AA 4MUJA 4AZ0B 4UTNA 5A0TA 1KC1A 3OPQA 3Q5DA 5JSFA 5F1KA 1L4HA 1RXYA 2KWIA 3G0IA 4MUMA 3AF4A 4NBTA 1LI4A 2IY8A 4XEUA 3CX4A 5CXXA 2JCVA 5IHXA 1IC6A 2O3UA 2R1VA 5EZYA 4AY2A 5F9FA 5BXYA 2BFEA 5DCWA 2VJAA 2HFJA 1UBMS 1ZO8A 4RL6A 2ZYGA 2I66A 4C4ZA 2JIZA 4Y2GA 1FSGA 1YCGA 4K2HA 1QYWA 3HBNA 2XTMA 4YAGA 5KJCA 5HQJA 1E4OA 4BNTA 3IAXA 4GSKA 1KK3A 1OX6A 1ZOOA 3TVYA 3HKBA 1KSGA 4I19A 1IB0A 1NU8A 4EQ6A 3AUUA 1O97D 2ZQ5A 4BMXA 2FF7A 5EMLA 4HWTA 3ETJA 5ED0A 3KKNA 3OUTA 3ZCSA 3D3JA 5BUCA 2SKCA 1Y5LA 2G77B 4ZOCA 4EFNA 2K6GA 2ECPA 4YONB 2PCJA 1Z0IA 3ESBA 2QXYA 3FSJX 4E94A 3LOUA 4J2TA 2JFGA 4LSWA 3HB0A 2BMJA 4IFTA 4NCIA 3G7UA 4Z4CA 4KZPA 2H1SA 2XF2A 1XJ0A 2XVXA 2YMPA 5EP2A 3UAGA 1W6UA 1NXPA 4GMDA 5KYVA 2FFJA 1EXDA 1FDTA 1Y33E 1Z6GA 1JQ5A 2Q6LA 2VH1A 3PT9A 2Q9CA 1QIIA 4KIGA 3TMYA 2O8BB 1R4MA 1ORTA 4JITA 3EVDA 5D00A 3R7AA 5AHOA 4QU8A 4ENUA 1UM9B 3HSKA 5IT5A 1FFCA 1QO0A 4RVUA 5BNFA 1D8TA 1ZYUA 4I5GA 1DUSA 1Z26A 4ONEA 4IVRA 3T1OA 1EFDN 2O8EA 3K5IA 1KNQA 3RIXA 3O47A 1MAVA 2P9EA 1IZ7A 2C2XA 2VBIA 1FS6A 3HCBA 1TFUA 2CCGA 4YVFA 3A36A 1QRSA 4O33A 1V8ZA 2FW7A 2XYHA 3T9CA 2LDBA 3OTHA 3U17A 2O6LA 3LMKA 1TMYA 4Z9XA 3UXEA 3BA1A 5M5BA 1QZUA 3VRHA 5LFAA 1KYZA 5BMVB 5EP3A 1G42A 1USGA 2AN4A 4EA6A 3ND6A 1S3GA 3PPXA 3R75A 4D7AA 3IUJA 2Q8NA 3V80A 2REQA 1TZBA 3PFWO 1OX4B 3JAKA 5JCZA 2UV8A 4QYIB 3NTQA 4ZVMA 4EF6A 2P8JA 3A6JA 2X4LA 3HP1A 4MKZA 3WRYC 3OUZA 4KITB 4GWKA 1ULZA 2RKWA 2W0MA 2XRYA 4GI2A 3UMRA 4KQEA 1U2TA 2QRVB 4DLRA 1W47A 2RIPA 3SC2B 1NUHA 1AZLA 1YH3A 5KVQA 2DECA 3MTBA 1Z0AA 2P9YA 3PEYA 3IALA 3STXA 3DBOB 2FVXA 2HJWA 4O4LF 1FRVA 1QGOA 3QF4A 4PAGA 1CQIB 4IJKA 4ZAGA 3PPVA 1T5IA 4F1KA 3GUUA 1BEEA 1NFQA 2VAWA 3O90A 1W1UA 3VYTB 1F60A 4HYYA 1G5QA 2A30A 4OATA 3OLYA 4WZAB 4ZOLA 2RGEA 4Z9BA 3X1ZA 4YIHA 4FYXA 3IQEA 1U4OA 1X7YA 4D6PA 2M1ZA 1NNSA 1B8PA 2GBGA 2R8ZA 2BGUA 1T2NA 3QOXA 2GBPA 4IVPA 2VF4X 2C2MA 5GONF 2QGZA 1XZAA 3MUFA 1AT1A 2C58A 1V96A 3F7TA 5KX5B 1GT91 3UBMA 3T3MB 3MYYA 2UZ4A 4L8YA 3E3MA 3A6GA 4MQ4A 1OA0A 3TW4A 3U19A 4HHEA 3DEIA 4B79A 1RYHA 1HURA 3VAAA 4BX0A 3V9AA 3M6IA 5D8DA 3O83A 1MQAA 3C2QA 4X20A 3ZHXA 4L72A 3I9V6 3SX0A 2F43B 1LD3A 1GWNA 3ZGYA 4WBNF 1FXWF 3FR7A 4KE8A 4JJAA 2JJMA 1N6HA 4TUYB 5G1PA 3ZK7A 1A9XA 3LC0A 5IKMA 1Z83A 5H8WA 5HGXA 1PTJA 1M1NB 1MT0A 2JAXA 1M1YB 2VYQA 4R3WA 2VRWA 1MO4A 3S2FA 3M34A 2AB0A 4A5SA 5ITZB 3ZYCA 5G0SA 1GO2A 4P38A 4RHTA 4PZYA 4G81A 1CR4A 1XBTA 1T5HX 3F1KA 1WETA 4NY1A 4ZVLA 5JZVA 1AGPA 1BMQA 1E2GA 3F9IA 4DM3A 1U9ZA 2BRUA 3O38A 4X1OA 4XJXA 4BVHA 1Y6GA 2PSFA 4XJSA 1GP2A 1SBCA 2HPZA 3M5CA 3AY3A 1YK0A 3OU2A 1MO3A 1DKRA 1FNSA 4X6YA 4GP6A 1FJXA 3A9SA 3LL7A 5AK3A 4WY2A 2C1EA 2PQ2A 1RKQA 3L8ZA 1KE2A 4Q6WA 3SN6A 3ZJ5A 3LWZA 2WIGA 1NI4A 3GNLA 4FYIA 2SHKA 3HA7A 2NO0A 2VP0A 4LYYA 4WAUA 4KX5A 2NN3C 3UCXA 1IY8A 1ULSA 4WKCA 2C54A 2P4HX 2PSSA 3JQCA 5JWHA 1FLDA 1X7XA 1Q2UA 3K4HA 1CQWA 1RM3A 3S1AB 3LIPA 3TTYA 4JVLA 5FBVB 4BZXA 2QTTA 1Y5MA 3KDSE 4D43A 1ZH2A 2C61A 4RLSA 2DTDA 1YZUA 4BZWA 2FPRA 4JP1A 2FQ1A 4A6DA 2H52A 2GZHA 3DXYA 4Z4FA 3OEYA 3PFFA 2IZ6A 3A6EA 2QN8A 3QUQA 2ZBDA 3NGXA 4E7PA 1HG1A 1JWAB 2OFWA 2XUGA 2KLBA 1UEJA 2YHAA 3G7SA 3IDFA 4GKAA 5KMGA 2WTUA 3TI7A 1SKUA 1KY3A 1MCZA 2AS0A 2W4QA 3GJ4A 4LQCA 4UHHA 3RABA 3U1VA 4DLKA 3CF6R 3IIIA 4CQMA 5IKOA 3CNEA 4N4AA 2HTFA 5DN9A 3B1KA 1BJTA 1C1DB 5CD1A 2W2KB 2GEFA 4C0XA 1NBME 2HWYA 4HH0A 1D9XA 1HORA 4JC8A 1E1KA 5IT0A 3WSVA 3LLVA 1JLSA 4L75A 4Z0TA 3KYDA 4DLTA 4KXXA 3W5AA 4DUZB 1QP8A 1Y6QA 2OR3A 3E9CA 4OBWA 3FLBA 3RVOA 1W85B 4GYKA 4LQ4A 1NL3A 3G0GA 3PFIA 1GPWB 5EWJB 1EBFA 2C9DA 3NOVA 4ZXPA 3MMNA 1YI1A 4ZWNA 3JXEA 4GS5A 5A0VA 5JQGA 1KVSA 4L8FA 1WPRA 2W8ZA 4MKGA 1II8B 5EJEA 1BW9B 1YQ9A 4MGEA 2IXTA 2RIRA 3C3CA 3PD1A 4HNAA 1JDPA 1ML4A 5EWMB 3QSYA 3H6HA 5CK5A 4C03A 3LTEA 3KCQA 5J59A 1M1XB 1PTJC 1U7TA 3JZDA 2ZM5A 3EFHA 5I7HA 4BNDB 3T4UA 1JLKA 4F84A 4OG2A 2RHBA 1XCPA 4TMYA 3OO0A 3UWMA 3G2MA 4DIBA 1XPRA 2IOQA 1K5PA 1X80A 1DUIA 2V6BA 3ANSA 2BRUC 2QRQA 2G4LA 3ZVMA 2MYTA 4L9AA 3N0WA 4L0QA 2YFHA 2WSSA 2NZ2A 2B5VA 4UUOA 3EVZA 2BONA 4PZDA 4CEIA 4RXTA 4UOZA 4PYKA 1Q1AA 4HYQA 4DMFA 4NK5A 2VHTA 1PHPA 4XGIA 1CPYA 3QU9A 3X2FA 3HFJA 5IN5A 1C2YA 2C77A 4K1XA 2AMYA 2QLNA 4NH0A 1CR0A 4LZZA 2D7DA 2O06A 3BXZA 4PQFA 4EB0A 1OWPA 1Z5ZA 3QWBA 2Q2QA 3G6WA 3L0OA 1X9HA 1NQUA 3W2IA 4P3NA 5ICCA 1C9MA 1KHHA 1W5SA 1DWUA 2I22A 2VHEA 2Z1NA 3BGOS 4ILKA 5HK9A 4CM3A 4FDLA 3U9LA 1NJGA 1RYEA 6PFKA 1TAQA 2QRPA 1NN0A 3PFKA 4ZOEA 3RODA 3RS2A 4B3HA 3WLPA 3NKLA 4A8TA 1H1LA 2AUNA 4Q7MB 5BRJA 2AFVA 2KB0A 3W5SA 3W2TA 4E33A 5ARCA 2P2NA 3NDPA 3BS4A 3SQLA 1O3YA 1WWKA 2ATEA 2H9AA 3I6QA 4OQEA 4FE3A 4AKEA 4CLOB 5LQJA 1ISSA 1N2CE 4WA7A 3T0FA 2IA5A 1KTVA 3UO8B 4OXKA 4DBZA 3W5VA 2IOYA 2X3YA 1NGSA 5CA0F 3BWYA 3T0GA 5JXIA 3ENVA 4A8JA 3M4XA 2HF2A 1BD4A 1ADBA 1MZPA 4BNLA 4OXXA 5JNRA 2C07A 3PFGA 3FDZA 1XDWA 4FOLA 4JC4A 1G8SA 2ZUVA 4P36A 3BQ9A 3LRTA 1T9GR 2ZXFA 3NRCA 2X5NA 1BQEA 1IONA 1QG6A 2GJKA 4JI2B 4BPRA 5K3CA 2YVUA 1DWOA 3LZCA 2DYKA 4NJOA 5EE5B 3U5ZB 4G5XA 2JIPA 2W6IA 4IHKA 4BMNA 4MHSA 4GP7A 1EA7A 1OVGA 1RHRA 5JH7A 1XP8A 3ZKWA 1J9EA 1A77A 2VJCA 3GFQA 5CR9A 1J5EB 5IASA 2ZI3A 3L8YA 3NFYA 5CYOA 2JI9A 1CY7A 3GJQA 5KDDA 3NP9A 3F6PA 2XUAA 1UIMA 4C22A 4FHGA 5JNUA 2O1SA 3H8JA 2P6NA 2G1JA 2P62A 3CC8A 3V1LA 1FDOA 1GSAA 3AU8A 3I45A 1HTBA 3IB6A 1OIVA 2Q6TA 4PZZA 3ZX5A 3UGKA 4AURA 1WXIA 5ILGA 4BTVA 3M70A 1T2CA 1BQ3A 4O0MA 2QDKA 3CZ5A 4HB3A 4QOGA 2QIOA 3OIFA 1XZJA 1RPJA 4JYBA 2CNNA 4D25A 2W4IA 1LZKA 1H8EA 4KIJA 1TM7E 1E61A 4DG9A 1QDLB 2OAGA 5IC4A 5GP1A 2QPTA 2BF4A 4DE5A 2QN6A 3SVZA 3HXTA 2VQDA 1ZJ5A 3FPCA 5B1IA 1VL1A 1RHKA 4I3HA 1OI2A 2VDNB 3BGDA 1HM5A 4NCBA 1KI2A 2A5DA 2A1TR 4K3UA 2HWXA 4HN4B 4LDQA 3V5NA 2R7LA 4NAHA 1TK9A 3CNBA 3SC6A 4F2DA 3FMVA 5HDQA 1VHTA 2CHEA 5EG5A 1OV6A 1PZFA 5C34B 4L7QA 3KDAA 4MRMA 4DQUA 3REQA 2PHZA 3ELUA 3DAGA 4YT8A 4R7ZA 1XNJA 3O3OB 4HGPA 1M33A 3Q3VA 1YHZA 2COEA 5DT9A 1UC8A 2NO5A 1B8OA 3DTVB 4Z54A 4GQBA 2F17A 1DB3A 5G4LA 1QP0A 4WK4B 4M9CA 4KMSA 2FZ4A 4HBGA 3WZLA 1TC1A 3V4SA 2HSWA 1G5FA 4LSMA 3QMPA 1NLUA 4KDEA 4O3FA 4R1LA 5EKUA 2YWCA 1JDBB 1Y37A 2VK4A 3EVBA 4AYWA 3E22B 3ZHYA 1S6YA 3I42A 4A8JC 2GK4A 2GEUA 2EDAA 2JIRA 3HCWA 4H3VA 4L4XA 4ZAWA 5SV2A 1Q7TA 3FNIA 4YI3A 2Q2OA 2J1LA 4JSYA 2XV1A 2GD6A 4PYIA 4QNNA 3AB3A 3IBYA 1A9ZA 4PX2A 3MTIA 1HE5A 4JXZA 1K92A 2NXCA 4JMLA 1P9NA 2APJA 4ND1A 1UIRA 1HE8B 4JB3A 2BFFB 3EWSA 3FWHA 3PDWA 3W1WA 3IUYA 4C4XA 4RFVA 2W2OA 1Q1QA 4L6AA 1A7UA 4TZ0A 4E07A 2OHFA 4A2QA 3D8HA 2F4NA 4XD2A 2WA2A 1IN4A 1KR5A 2BSXA 2FCRA 2IHZA 2QQEA 4M9XA 4NU5A 4AY3A 1I7QB 1VPDA 3DD5A 4ITVA 2N42A 3BERA 3GXOA 2HW8A 4KPUA 2CV2A 2Q3HA 5B7PA 3RYIA 1YBHA 1K63A 1P2GA 2BH9A 3N2IA 1FMTA 2PO5A 2H17A 4IL5A 1V4BA 2HWWA 1E0DA 4BB9A 3HLKA 3QE9Y 4LQDA 4OQPA 2R96A 4RFSA 1MRNA 1V6CA 4KJZA 1ETUA 1ZU5A 4I36A 4C5BA 2VJDA 4D9IA 3A2NA 2EX4A 1COZA 2JI4A 3ONDA 4OAOA 5IMSA 1NX9A 2HBYA 4FYHA 4BMVA 1BHQ1 1N5KA 1WKCA 1XMXA 4X1KA 4S1TA 1HYBA 4M99A 5CPFA 4BMOB 4YT2A 4AKSA 3AP1A 2C96A 3OHPA 4DR4B 1BX1A 4MUEA 3O82A 2HMSA 3RASA 1R3DA 4RK7A 4RTPA 4EYQA 2YN4A 3PD0A 4YV1A 1Q74A 3TNJA 4PINA 4Q21A 4FQ7A 3VZPA 2AV6A 2Q3CA 3H13A 2H2GA 3QEOA 4FHEA 5HQ3B 3F74A 2MYNA 1TPYA 4FS3A 4QM6A 1ZGZA 5JBQA 3JYNA 3UYKA 2QTAA 1QQ6A 1A8HA 4FGSA 3TLGA 2GJ4A 2VA8A 3DZGA 4FE4A 4ABYA 3EBLA 5KVCA 2K4MA 1G21B 1B1CA 3BREA 1SOAA 3H9BA 4UBOA 3UY4A 1UCFA 3OJOA 3TRFA 1DT3A 3PK0A 4RTQA 1Y89A 4XWYA 3ER8A 4MGHA 4A0FA 3KXLA 3WRXC 5AOVA 3OIGA 10MHA 1XZNA 4JVNA 3TXYA 4FFSA 4JR0A 4JIGA 2UYCA 1RI5A 1I2BA 4HLDA 3WL5A 4G09A 1F4PA 3EYWA 1GPUA 4GYWA 2IGBA 2Q5OA 4IUCS 3O7MA 2NYUA 1YMVA 1A96A 1O0BA 1FU8A 5KPDA 3ZWNA 1K9SA 5CGQB 3RD5A 3QBEA 4LNUB 2XDYA 3FCCA 2IODA 3G85A 3RS4A 2Q3EA 1SQGA 1NVEA 2AJBA 1K06A 1UC5B 4LX8A 1Y8RB 2QP3A 2LW7A 2L42A 5EKTA 1RPAA 2J48A 2HNAA 4BNGA 3FUUA 2VP2A 3KB6A 3G8AA 4AWXA 1EHYA 4R98A 4IH1A 2DPXA 3KQUA 5IXYA 4GDMA 3C3PA 1E1RD 1V95A 2IYLD 4AZSA 4ZOQI 3MILA 4JWKA 5EY5B 1JXQA 4PRLA 5KUTA 3OIDA 1NP6A 1E1QD 4Z0NA 3T5AA 1AKUA 3FYUA 2VOJA 3X1KA 3SXUB 3H2JA 5IANA 2B69A 3DVRX 4RD6A 4EMTA 4Z1OA 2JJ8A 5H83A 3SD7A 1QUEA 4P7FA 4W5WA 2R84A 2W5UA 3GHHA 4G0XA 3R7NA 3SSNA 2C92A 1DC8A 1A5TA 3IYLW 2R6HA 3NEPX 4YI5A 4TPKA 2QX4A 3AR9A 3PC8C 2FUEA 1JEYA 1JUDA 4N41A 4YJ2B 1DMSA 2YINC 2TECE 1ONBA 2QN9A 3GNQA 1JVNA 4ZYZA 5BQXA 5L51A 3K9QO 1U2DA 1SUBA 4FILA 1SIWA 3DE4X 3N8GA 4S24A 4ENRA 2DJ5A 2FK8A 4GBED 5THXA 1TZKA 1ZGGA 5GONA 3ZJUA 1ICEA 5IVPA 1EIZA 1C7ZA 4OB7A 3V2GA 3R76A 3EWNA 2ARKA 4GL4A 3UV7A 4NBWA 5A9SB 1KQGA 4MPDA 1JPNA 3ABSB 4OQMA 4B73A 2QRGA 2I76A 1M2KA 5TPWA 4ZKDA 4X61A 5A62A 5KNDA 4TRMA 2OHJA 4WBNA 3RSQA 3U7HB 3ZIUA 1EM8A 1FXWA 3LUBA 4M7WA 3AETB 1T43A 4H17A 5FKJA 4I0WB 3W8NA 2G9VA 1GN8A 2FN4A 3ZVNA 4Z4QA 3CUYA 1TZMA 3WYCA 2HN9A 4IIVA 2HBRA 4D56A 4YV0A 5LQNA 1E32A 4GMFA 5M7EA 1XHLA 1V1MA 3BSYA 3QJGA 4CMCA 3IUBA 2VJMA 3LV8A 4CF5A 4RDHA 2X77A 5B6JA 1BYIA 4F9FA 3NBAA 1KIFA 1Q84A 1WABA 3OETA 3PX2A 5JRZA 3IO3A 1E9EA 3QPUA 5ALJA 2GHTA 3HXOA 1QGDA 1FK8A 2ZSJA 5ERXA 3WIBA 4AUKA 2PCLA 2ZTVA 4X64B 4E08A 3KSBC 4TQAA 3WQQA 1PZMA 3ND7A 4J3NA 2WWGA 3RLIA 2R3SA 2OAEA 4Z1MD 2C82A 4V0LA 1F2VA 5ECYA 3WIDA 1S0UA 3PGKA 3AERB 3LD9A 2BUAA 3B6JA 1DEAA 3BHMA 5BORA 3S1SA 3IBFA 3KAPA 3LGAA 2Q45A 221PA 4NS1A 3AJAA 4UNIA 2GPBA 4N6GA 1TB4A 3PGA1 2GNOA 2L19A 4N48A 3SYLA 5EL0A 4ZEWA 5HRUA 2CJXA 2QUKA 3GP3A 1HDXA 3G17A 3Q6IA 3PBKA 3KJFA 4BZPA 1Z68A 1ZEMA 3FYUC 4NU0A 5JIBA 4JU8A 2WV9A 4OHCA 1T2DA 2PZFA 2QZPA 3GAMA 3W2GA 3ONVA 5C8VA 3OE5A 4HAZA 4KPGA 4ZVKA 3RARA 1SKMA 3N3AC 4BQQA 3V2UA 4TMZA 5HFJA 3KXIA 3PFNA 2PSDA 5DXAA 3VVCA 3GLGA 4CQLA 1LW6E 3ZDFA 1J09A 3RNOA 2CZCA 2IXFA 2JG3A 3C1AA 4XFJA 4HNTA 5E9JA 1NR1A 3FFWA 4ZK2A 2R97A 2CXUA 3FTEA 3LUDA 5I45A 2I6SA 1SXIA 2ZBFA 4DBVO 1OH5A 1G8YA 2P3LA 3UOWA 2BBOA 2QPLA 3W90A 2QMZA 1QQ7A 5HF9A 4B5KA 1G41A 3AMVA 3S2ZA 4O5AA 4O1IA 2VTBA 2IHJA 1QSGA 4XQGA 3KPWA 3ML1A 1CDDA 4ZCQA 4DQVA 5AW8A 3HM2A 3O2SB 1ABBA 1B00A 3OZEA 4D0RA 1LLDA 1YK1A 3VNUA 2FWIA 1BO6A 2IPLA 2ZR9A 4QM7A 4MGIR 3CH6A 1HQYE 2A5GA 4LGMA 4WOCA 4MW6A 4CIDA 2YWRA 4WDRA 4LWPA 2X9QA 4RV9A 1BC5A 1SCUB 3H87A 2QTNA 4BVGA 1HNNA 1LJ8A 3A1DA 4XEHA 1UP6A 4UQLA 3UHPA 2D54A 1KARA 1EX6A 1Z2EA 2PH3A 3GPDG 2I4TA 4KLNA 1EXMA 3GCWA 3OY2A 3SICE 1NVBA 1MX5A 2Y76A 1CQJB 1W88B 4MVCA 5TPWB 4WERA 1BKSB 3VAYA 3NTRA 5JXHA 2I33A 2VDMB 3JU3A 4QXOA 1LS1A 5B1YA 2CGEA 1XC7A 4R2WA 3ZY3A 2Y71A 2QSYA 4LYAA 3V4ZA 5DNVA 3ZHOA 5FUBA 2BJHA 2H4XA 2DFDA 1WUJS 4LWOA 3B12A 5T41A 4B3FX 5F7JA 1CYDA 1JBQA 1R7RA 2P9BA 3L0SA 1BVUA 4OSPA 3V7FA 3UJ8A 1ZJ4A 2QMYA 3VA7A 3C6ZA 4DGSA 2R79A 3LY9A 4X8MA 1AX9A 5DYGA 1RMYA 3ORRA 4C4PA 4YUXA 1X13A 1CUVA 1PJ4A 5A1JA 1W36B 2WJ6A 2X40A 3KVYA 2WMNB 4P7BA 4PBSA 5AKZA 4IHAA 1M5TA 2F48A 1XZCA 1YZVA 4FHFA 3QVXA 3FCSB 1IZZA 2XRMA 3JVVA 3K16A 2I7DA 4W7IA 3KV3O 4MYRA 4QLAA 4X7BA 2GT1A 5H68A 1I3LA 1QX3A 1KWKA 2BF7A 4AX4A 2QTRA 5IM5A 4BMZA 4E88A 3RLFA 1QGZA 1E62A 4G8BA 2JA1A 2Y0PA 1T8UA 3TSCA 1ZRNA 1NQVA 5I5GA 1CUZA 1C9KA 2GSWA 4WE3A 3AUXA 1J39A 4MGZR 2ID9A 4DJFC 4EMSA 2C5LA 2ZYVX 4F97A 5IUNC 3LQ2A 3PCRB 4BATA 3JD3A 3FAZA 1YT5A 3AI2A 3CX7A 4MQMA 3MEQA 4BO0A 5CB4B 2EFYA 2YWXA 3IEXA 5EJ5A 5K0CA 1XQ1A 3K5PA 3WLRA 1V16A 2B8NA 3DL2A 5TB5A 1J07A 3GJRA 4C7KA 5KTSA 3EDMA 4RORA 3DZJA 2BEVB 3LSYA 3FNEA 1PTKA 2V03A 3RW9A 4MYCA 2OOKA 4UBNA 2YCBA 3NM5A 1TKBA 5EE9A 5SYMA 3SMQA 4QPCA 3W2HA 3WAKA 4CIWA 2YOHA 3RH0A 3WMWA 2EKBA 1I2ZA 3EGXA 3VO8A 3CN7A 1JSXA 1OLXA 3QFRA 1M3SA 4Q82A 5IUJC 3EVEA 5JNSA 1CX9B 1TAGA 1ZSVA 2XNHA 2WTMA 3QWAA 3HYCA 1GR0A 3FUTA 2X19A 4MW2A 4ND4A 4EGCB 1FP6A 1XDZA 2XA1A 4Q1BA 1E9FA 3P4YA 3OJLA 1E3JA 1UMBA 2FMHA 3I52A 1Z12A 1SVMA 2YY5A 3NC0C 4GT1A 4Y2YA 3WGYA 5L45A 4DIKA 2I7CA 5CG1A 4EHBA 4A2PA 3TQTA 3FRHA 4YP9A 2QB5A 3V7YA 1UKCA 5JD6A 3URMA 3DA8A 1NG9A 1Q1EA 1V5EA 1A7AA 1ZN8A 4Z99A 4CT4B 2VUSA 3OZVA 3B36A 3KVNA 1AE1A 4AXBA 5LWQA 1PVDA 3DBIA 2PS0A 3LLMA 2J41A 1OLSB 2H0QA 1M75A 1YKFA 3NTUA 4U6QA 4BKRA 5CDFE 2A1UB 4BZQA 1NU6A 1MOZA 2H1LA 1CULC 1MMFB 4CM4B 1WBJB 3FROA 3QE4A 4C7JA 3L77A 1YMUA 1JVBA 3H9UA 4HLQB 5ES4B 2W6MA 2RG7A 4FB4A 1WXGA 1HT2E 1XSEA 5IVDA 1CS4C 1M1ZA 1EGAA 1TAUA 3H2HA 3IBTA 1J99A 4R9SA 3L7IA 2C31A 2ZK7A 2IEGA 3H9JA 5CLHA 3WISA 3RSZA 4EFDA 2PMCA 3MQ4A 1WXHA 1KH3A 3ROGA 1JXAA 1P1KA 4UVHA 2CYAA 4TQ9A 4JI5B 3FG9A 4N12A 3AR2A 1TTHA 3I3SR 3D6HA 4J90A 3PNSA 3FPLA 4L2IB 4L5IA 1ONOA 2PVSA 2REBA 2WJIA 3AV3A 4RADA 4CZ2A 3BSWA 2ZSEA 4IICA 1N9GB 2OYRA 2Z5FA 2JGNA 5KYXB 3HB1A 1R6XA 1TYBE 3A1FA 3ZE0B 2QQ0A 3LFHA 5LQDA 3BD7A 2LTAA 4EVRA 5JFOA 1N0HA 4TZKA 2I6GA 2ZAIA 1CUYA 2H6EA 3Q8WA 4G23A 5FPQA 1FQOA 2YL2A 2HDOA 3EA4A 3TTTA 1B0UA 1IJBA 3T3PB 5KTNA 3JY6A 1KJYA 5FD8A 3DGEC 4TXHA 4FZ3A 5FAXA 2WABA 4EFMA 1KKUA 3L3BA 5FORA 4MSUA 1AU9A 4NYIQ 4PLZA 1P4RA 6AT1A 3RIYA 3BUSA 3OHSX 1UPCA 3SX4A 2ZIXB 1O08A 2H00A 1ZW1A 2Z04A 4U1RA 4C0BA 1J21A 5K3OA 4TXJA 1W48A 2ZSBA 3L0ZA 4XA8A 1BGWA 5FUWA 4HDQB 1G8KA 3AZQA 4DSZA 1RC0A 5FBHA 2QBYA 3OA2A 4B4VA 1YDFA 4UOQA 3OICA 2IHNA 3I0NA 3PRHA 3P5SA 4K9NA 2JIMA 2MSLA 3EA5A 1JMYA 4PS0A 5AVVA 4U3JA 3JQ7A 1NURA 1QUFA 2X8JA 2ZTLA 1ESZA 2OK8A 3OLXA 1N1GA 4IDDA 5JAPA 1SULA 5JZBA 1PW7A 3C3YA 2A7XA 2JFPA 5LZ2A 1JIVA 3CVJA 3FWYA 2X0DA 1L0BA 2R60A 2ZFUA 3OTIA 3D3EA 4EYKA 2GM4A 2QZ9A 5LJIA 1NI3A 4MICA 5ICFA 4AW9A 3QX9A 1ANKA 1B73A 1SGWA 4H4EA 3TLJA 4GI3A 3LT4A 4JXKA 3M7IA 5H5JA 2O0KA 1E2NA 2ZR0A 4M1OA 4E51A 2ZS8A 1AZSC 4CQJA 5ALEA 2HZ7A 3Q7PA 1MDBA 1T0BA 1GNSA 3D2CA 4EW6A 2OO5C 1EZ4A 1KMIY 3C14C 4DA4A 2G1PA 3BILA 1BX3A 1I6WA 2OILA 3MRXA 2IE0A 1MUUA 3RRMA 2FLWA 4FNAA 1J7KA 2PXXA 3UBTA 1Z5WA 4JEHA 3TDNA 2HUNA 5BWOA 1SVKA 4WASA 3IODA 1I3KA 3EZFA 3RT1A 1BMTA 1DAHA 5TF0A 3T15A 2OSVA 3ZE1B 4U6SA 3L84A 5HZHA 2NXNA 3QZUA 3CEJA 2EFGA 3QJYA 2CUZA 1U0HC 3AFIA 4IHJB 5I6DA 4B75A 2GA9A 3HUDA 5CVCA 3TW8A 2PKEA 4I4TB 1OOEA 4JEMA 4RXMA 5GZ1A 3MJSA 2UXBB 3PA8A 3P94A 1KI9A 3U3ZA 2C29D 5TT1A 2PA3A 5FJIA 4DFDA 5DLYA 2ZBRA 4DV0B 4DCGA 2VK8A 1GDTA 5GADl 1UJCA 4KXQA 1JHDA 3EXEB 1N0UA 1NT4A 3GPIA 1XAHA 3IQDB 1LPBB 2ZAYA 1JDTA 2XOKA 4LY3A 2EJUA 5K3EA 3HBAA 1KFBB 3QI2A 4GGOA 1P9LA 2HSDA 3KTOA 3OE7A 2PMBA 1ORHA 4JKIA 2PS9A 3R77A 1SBZA 2QRJA 3W6NA 3MVEA 4JB8A 4K9RA 1Z0JA 4L78A 4E5VA 2B1QA 4CT0A 4JYAB 2KQUA 4ZFNA 2AE2A 4LTMA 3TQIA 2I1VB 2CKDA 4XB6B 4AJPA 5KQLA 3HEAA 1KVQA 2WOJA 3RHTA 3ZLUA 3M2PA 1COWD 2H57A 3DD1A 3KHSA 2XCUA 2OOSA 1KVTA 4C7VA 3A70A 4BNIA 4QODA 4EPWA 1MR3F 4EO7A 5IDXA 4C2UA 4DLXA 1QGYA 1RLMA 3UAOA 2IS1A 3U4IA 3AF6A 3STUA 1T3SA 2LDXA 3C8UA 3A11A 3X1XA 3HMQA 1VKZA 3ZCPA 4GM0A 4LNHA 3UHOA 1TMOA 1T4BA 3A32A 4H1UA 4JAVC 4X8HA 6YASA 2GM5A 3JR7A 4I1PA 4G0ZA 1RKUA 4JFRA 1PFUA 1XRQA 2W2XA 1E1CA 2C83A 3O4JA 1C3LA 3FMIA 2R62A 2JGIA 1M2WA 4P4UA 5AM1A 4DYVA 5K5EA 5KYKA 1P45A 1NUSA 3AR6A 2DQZA 5CAEB 2ESRA 4C0WA 4C14A 4YRFA 2QWXA 4FBMA 4TLAA 3IH5A 3HK2A 4UEOA 4MTCA 1P9WA 1NBOA 3UG7A 1TF5A 1R37A 4H6WA 1M2VA 3HCRA 4LDJA 1QRUA 4Q4CA 1E5DA 2D8AA 2CDAA 1NJ5A 1TW2A 4AMVA 1O4WA 2INGX 3VOBA 2OCBA 3I2IA 5BQ3A 5K05A 1U63A 3UMFA 1R8JA 4MMZB 2Z98A 3IIEA 1QV6A 4GW3A 4HEHA 1IUKA 2PZJA 1NXTA 3AG6A 4TS1A 4DVGA 2GDZA 1K2VN 1T5TA 2NX2A 3BWXA 2FPSA 3G49A 1W76A 2NO7A 5ETJA 2HJGA 1Z7GA 2ZJ4A 3IPXA 4TSRA 1C9DB 1SG6A 5AKIA 3VPSA 3L1UA 1UFKA 2WDPA 3A27A 3E3OA 1UP7A 3LOQA 1NMYA 1P72A 2IW3A 4UAUA 4H0NA 5FWYB 5GOTA 3STVA 3WYFA 3EDRA 4C2AA 1N25A 3SDZA 4I1YA 1ZISA 3OA0A 5EA2A 3CONA 2I6FA 3A4MA 1KSFX 1N9ZA 1ZI9A 3NPMA 1N3IA 4WLVA 4R1NA 2G0NA 5EJ9A 4AZWA 1MOPA 1J8FA 5LR6A 3K1AA 3B2NA 2RC5A 3DVAA 3OE1A 3LC7O 4KHZA 1YQQA 3LO5A 2HGSA 5EJFA 1YGYA 5FYQA 1GAXA 1XRLA 2B1GA 1FUKA 2AOUA 3M4JA 1PL0A 4MCJA 5K3BA 3G0HA 3LXXA 3DBRB 3SF8B 1Z16A 2KW5A 3VYRB 4YAOA 2BBTA 4EY5A 1ZU4A 4HUQA 3T7RA 4EUSA 4Y9TA 4D98A 1BU8A 3PTLA 3TOSA 2CF5A 5HIAA 1Z2NX 4F5ZA 3JYLA 2CN1A 1VHWA 1QORA 4KR9A 1C30A 1A4XA 2OCPA 3RKSA 4OHOA 4I9NA 5CP8A 1RJ9A 2C2YA 1CCWA 1M8FA 5GZ3A 3OOJA 4XWTA 1CUUA 3G9ZA 1WHTB 1TA0A 1N75A 4I2VA 2GKSA 5AI8A 3FPKA 3H9GA 3OM8A 1NV9A 4HK4A 4B7XA 3WLOA 4TRNA 2L18A 1FTNA 3CINA 1E1YA 4WOJA 4UFOA 3TLXA 3SYKA 3IE0A 5CTJA 5A4FS 2R7AA 5IEJA 1ZS9A 3DMFA 1H42A 5GM1A 3A28A 3TM4A 3UHAA 3FHTA 2Q7DA 4CMKA 1U3FA 3NIWA 4QOSA 3FBWA 3G2KA 2Z5VA 3IR6A 4EY4A 4WKBA 3H4MA 3DWGA 3EUAA 1QIFA 2J3IA 4ZT7A 2NTNA 4YAWA 3C3DA 5A6VA 4YQZA 4M9ZA 3V1NA 2LIVA 2FSVC 3ZHZA 1G19A 3CEMA 1ZM9A 7AT1A 3KSUA 2I4IA 1IXYA 2BZGA 3NR2A 1X1DA 2O0JA 1I9CA 4X63A 1QHHA 3ROZA 3I2GA 4E4RA 4B2PA 2O2DA 2XT9A 5AKYA 1ACMA 3U61B 1KFJB 3SSOA 1IZ8A 1PJAA 3MC1A 4TKLA 3RREA 4YRDA 3D7MA 1GPNA 3DEAA 2V6IA 3HNPA 1PFGA 1V1RA 3DEFA 3EF0A 1U3UA 5DM70 3L40A 1SRQA 1UK7A 5GY7A 4HAWA 2YVAA 1ATIA 1JHXA 1OBCA 1VMKA 3WKEA 4B2IA 1R4NA 3KZNA 3KOXA 3L7KA 2EFHB 3PQFA 3N86A 1NV8A 2WWFA 1WVIA 3BGVA 5TR9A 3THXA 3VZSA 2W2MA 3AF2A 2ZYAA 1ZJYA 2BH2A 4I55B 4EX6A 1CRQA 4Y6OA 5FL7D 1F6DA 1PR3A 1GAQA 3EXG2 4KEAA 4YFYA 4QVKA 5CVTA 2I4OA 3I04A 3PHBE 4TM7A 4LI3X 1XKTA 2WF5A 4N0MA 4D1YA 4US2R 1ZGJA 4YAJA 2CDCA 1ODJA 1GD1O 1YZYA 4KQKA 1DINA 2Y1GA 5EVCA 3TB6A 4UEKA 3H04A 1NVFA 1T0JB 1CRWG 1WXWA 1R8XA 1UF9A 2IX9A 3M1LA 4OK5A 5FQOA 2J7PD 3A9RA 3T7AA 1JV2B 3V97A 1CETA 4X1IA 1GPKA 1PNVA 1SCJA 4PM4A 4TGLA 3PJRA 2BEUA 2RE8A 3CUSA 1J97A 4W1PA 2Z6UA 1MO6A 4ZRDA 3F5SA 2B0JA 1E59A 3Q3JB 3Q8XB 3GLSA 2V7VA 2Z08A 3QQ5A 5H9VA 3TKYA 3HVRA 1G6HA 4PCAA 2C0CA 4WH0A 3CIFA 4NPAA 2HQBA 5K3FA 1EUDB 1PU2A 2DCMA 3FAKA 2Q7OE 4M98A 5CBPA 3BAZA 3Q87B 3F6SA 1BMDA 4H7KA 4XR9A 2HT6A 1PV4A 1HF3A 4BKQA 4XCVA 4XX0A 4DDWA 5C2JB 3N87A 2OBFA 4IJ6A 2YUTA 4YMSA 1O87A 2LCQA 3LY7A 4BFUA 5SZIA 3M4ZA 3GRFA 3OLWA 5H4HA 1AG9A 1WF3A 2GBCA 4P5PA 4CTJA 4EHKA 4HB4A 4GVXA 2OYSA 1ZHOA 2IDZA 2EERA 2ZVDA 2H2IA 2WQ7A 2VOEA 3R3YA 2AZXA 3E48A 3H17A 4KXNA 2ZI6A 3TX2A 5E2IA 3W9UA 5IJ9B 1NXXA 4XPIB 1CKEA 5DYNA 3QLTA 1Z88A 4OI0A 3R44A 3OPYI 1YE8A 2BDEA 2PQ0A 1BXRB 4PG7A 4DR6B 2CV0A 2JKVA 1KEWA 4GD3Q 2X15A 3SC4A 2EYQA 1U5AA 1ZY2A 5JARA 2FKNA 3WKDA 1WXDA 1RRCA 2GF2A 2IVZA 1DKLA 5A03A 1IVYA 3CQ9A 1E7QA 4DCMA 2NO4A 1F2TB 2CEAA 4FT2A 5CDHA 2P77A 5CM8B 3ZVRA 4DLYA 5HUHA 4C78A 2G0AA 3LQKA 2WYIA 4NJMA 4P4SB 1J2YA 3HVIA 2IQIA 2CXTA 1FP7A 2Z4TA 2VDQB 2WWTA 5CTAA 1R6AA 5L4NA 4IH4A 1BU5A 1ECLA 4R3NA 1B8VA 1WW2A 4B6EA 2D13A 4GFDA 1X3LA 4YALA 1HKHA 1S89A 3D4BA 4F3KA 3SVTA 1UZAA 2ZOSA 2YN0A 3D0RA 3I1FA 4C08A 4QJBA 1E2HA 1O6CA 4ZPJA 2QAGA 1AZWA 1OFVA 4RHUA 1S8NA 1QONA 4LJYA 1J8DA 3ET5A 5ADVA 3VR5D 2A4KA 3LF1A 2ZUTA 5K4AA 2Q5JA 3ZGNA 4E5NA 4TTTS 4TWZA 1F2UA 3HCDA 3KT3A 3OIUA 4DV7B 1WV0A 2HHLA 3DW3X 3BQMB 2PJUA 1SU7A 2PN1A 3UMCA 1NTOA 3LHIA 2X7XA 4KQHA 5FI0B 1E77A 3THSA 1C7JA 2ZR7A 3HUEA 4KMRA 4RPCA 5JQGF 3B1JA 5TPZA 2PEYA 3OZIA 1R4ZA 3WB0A 3I5XA 4MR9A 3SDBA 3ST7A 5L3SB 1D5CA 4B4WA 3I61A 4ZQEA 1VHJA 2XT0A 3JSAA 3VM6A 1HEUA 3ETEA 4M1MA 1R0YA 2HIMA 4TYQA 4Z9YA 4JP3A 3UN1A 2HHCA 3NNNA 2BTOA 2Q0HA 3UT5B 3ZS8A 4M88A 2YV5A 1CUGA 4QL3A 1CUXA 4XYBA 2PUTA 1NAIA 1CS0B 1FFXA 3VR6D 4I4CA 4GKVA 4AJHA 2EX1A 1XUOA 1VBKA 3U9SA 1J00A 1Q22A 3AOGA 2QGNA 1BAPA 2P2ZA 5C1DA 1A82A 4IHQA 5CFPA 4F91B 5E9QA 1GZDA 2MSNA 3E3LA 4RM3A 5FULA 3WMRA 2AXPA 1X92A 1J1ZA 4MCHA 2ZDHA 1QKIA 2E6KA 1LBHA 4B7AA 3GFBA 5FUQA 2GAFA 2H5EA 2J0SA 1UMCB 1LI5A 1MH9A 2YZ2A 2J3QA 3OQIB 1RRFA 2A0XA 2WM2A 4PRZA 4A0SA 4MB6A 4L9RA 1TEXA 2J9ZB 4FGJA 1NM5A 3BPSA 1JVSA 3DKKA 4IMRA 1CZLA 4KC0A 3VNRA 1VSTA 3SZOA 1MBZA 4MB2A 5AKLA 3T7SA 5LOVF 5GVSA 1X6VA 3B89A 4JVSB 3T06B 4AECA 4KMOA 1O9GA 4TRRA 2PBZA 2HEGA 3EXFA 5KWIA 2AMFA 4CV1A 1PR4A 3VBCA 2YTZA 1VI6A 3L82B 3PPYA 5FOQA 2OVBA 5CEJA 2HX1A 2W58A 4JB0A 3EUWA 2P8SA 1BWSA 2JBWA 4EG4A 1QLJA 1Y1KE 1P31A 1IQPA 3EDCA 3JQBA 2RCYA 2YWDA 4Q7EA 5KOJB 2I71A 2QAGC 3MHPA 3ZH2A 2Z9DA 4YP6A 5ALKA 1CJBA 5B36A 3K0CA 4KNWA 3ER6A 4YA6A 2HA0A 3E7WA 1EG7A 2HMAA 1L5HB 1M2EA 5IFLA 4EITA 1V8DA 1T9BA 3EHDA 3QK7A 4BVLA 1UOPA 1ZIOA 2HDWA 3FWNA 3LLSA 3QYAA 4JLUA 2P9FA 1A5AB 5FBZA 4DXAA 1E2BA 4QG7A 2H7VA 2D1TA 1G7TA 4UASA 4INJA 5JNVA 1DIHA 4Q3BA 3OZ7A 3N8KA 3P0HA 2IS4A 3HCAA 1ZI6A 4V1CA 1HE2A 1RIFA 1DG9A 3A37A 3DLTA 5BSUA 3AL3A 3RFFA 1YBVA 3MWDB 3CUTA 2VI5A 2H1VA 2J9GA 4D9GA 4WN9B 2JGDA 2RMKA 4HH3C 3CURA 3LUKA 3GLIE 1SVWA 2H48A 5ILQA 3OCVA 4MR8B 1QAQA 2JPDA 2Q27A 4YN3A 3W77A 1CIJA 3LW7A 4CMHA 1YAJA 2Z6AA 4TV8F 3CX3A 3HXQA 4ZJUA 2VJYA 4D8VA 2O5CA 1SWVA 2CB9A 1ZOIA 1BCSA 1QTIA 3GIDA 2J4FA 3N2NA 2J3MA 3P27A 1LF0A 5GJVC 1EE2A 4OI1A 4C5CA 4ROSA 3IEPA 3U48A 2VYCA 5L7WA 4YJGA 2PUEA 3B7WA 3IKMB 4RKYA 4UAJA 3WHPA 4B47A 1Y7IA 4PYOA 1G20B 1MGPA 4CMIB 1EFVA 3CIOA 1ECBA 2Y1WA 3SNKA 3NKFA 4CF3A 1SQ5A 1RXIA 4E1BA 4H7JA 1Z73A 5EMJA 2QNBA 3ZWAA 5JT1A 2FPLA 3QKWA 4BFVA 5IXSA 5JXWA 4LF5B 1P91A 3TFQA 4DYHA 5LLDA 3FRJA 1NM5C 1OUMA 1UXHA 4W7HA 5DIZA 3TXXA 3LBFA 1J42A 4IP0A 2ZUCA 3RWMB 2Q4OA 2G09A 4XFDA 4Q1VA 3HUFA 2V0GA 4EA8A 1M0EA 3C4QA 4IIJB 2WTNA 4J0GA 1U0NA 2F9FA 3GBSA 5JPDA 3G8CA 5G4KA 1IAVA 4JOCA 2R4TA 1RQ2A 3DE2X 4K9QA 1YDGA 3RUEA 4MGYR 3ECSA 3Q88A 3U7JA 1WDTA 2O3TA 5JMTA 1NBMD 1MB3A 4BEVA 5K0EA 2R0QC 3VKGA 4R41A 3AB8A 2WAXA 5A6SA 1I30A 1Q0UA 2RDMA 3JQBC 2ID7A 4EI8A 4DDVA 1UKYA 3BD6A 1CUWA 3NIGB 4RH1A 3OLCX 2JGAA 4OMFG 4TLLB 3WKCA 2GZ1A 1FNBA 1KK1A 3K0CC 5LXTF 1JEQB 2PV7A 3UJCA 2PYDA 2UYOA 2Y0EA 3IA2A 3EY9A 4G07A 4GX2A 3INRA 4IDEA 4UUQA 3DFZA 4XQCA 4YS6A 1GT6A 3SGLA 1H9BA 1UWVA 2HD4A 4PQGA 2WMOB 1JHAA 3ABQB 3N7AA 4BLOA 1QH1A 2DR3A 2VHXA 1JILA 4D74A 2HRDA 3LXUX 3MYRA 1GA1A 4ARVA 1V47A 3CUVA 4CYMA 3NMUF 3S2GA 3TH5A 4OX9Y 4Y6QA 3NAQA 4S1PA 4D9NA 3KQOA 4OHRA 4UDNA 5ALDA 2C5EA 4FYMA 3JALB 4KRXA 1C9EA 2B8JA 4RMIA 4M6WB 2IOFA 5DNUA 2OHGA 3RVSA 1MP0A 1OLUB 3OZTA 5BVHA 2B36A 2W2NA 4U2DA 1L5ZA 2NSYA 3LCCA 3O8OB 4CKWA 1HZJA 1NVXQ 4XLLA 4KPFC 2D0PB 2HIGA 1IN5A 4MUYA 2AFHB 5BYBA 1RQPA 2C9OA 3HM9A 5J43A 4QSMA 2H4WA 4J1TC 4DQKA 2Q3JA 1NI5A 1WXFA 2ZQZA 4TWRA 3AGPA 2Q3FA 1LEHA 1UBEA 3PP8A 1XOIA 2I80A 2O2SA 3IPYA 3LHSA 3UAVA 4EZIA 3P7MA 3W5HA 1NR5A 3TE7A 1UZUA 3BHIA 2GGSA 3BMOB 1RU3A 3ITNA 1EVKA 4BL5A 4V2UA 3C3AA 1U1DA 2Z9BA 2ZETA 3IKTA 2Z1DA 3I62A 1TM2A 3LQYA 1ICIA 3AHGA 5GJWC 1YR9A 4GBGA 4PSVA 3SJCA 3WYNA 1J5XA 4DEXA 2VPTA 2VPYA 4ACAA 2N1BA 5JV5A 4HH4A 4Q5IA 2B25A 1KI7A 4YMVA 2Z6QA 1Z28A 2H16A 4FMDB 2VDLB 3P20A 1WB4A 4CIAA 2FSFA 4CI9A 1EBUA 5E38A 2R65A 5AM4A 3RVBA 1HGXA 2V6FA 1EFUA 2ONKA 1SR8A 1EVJA 4G01B 4WGFA 5FFFA 4RY8A 1IIBA 4LXGA 1D2AA 4LV6A 2OLEA 1N6NA 1V5GA 1ODIA 4TV9B 4PAOA 1T9AA 3DULA 4EO4A 2UXCB 1C3OB 3EEBA 2COUA 3FBGA 2AR7A 4V39A 3UJ6A 1JR3E 3KKZA 5GAJA 3PUKA 1P7YA 3KP1A 4E12A 3H42B 1Z06A 4MQFB 1CY2A 1FB5A 3JPYA 1JWLA 2P11A 4QFMA 4CNBA 2D0OB 3CZMA 2HCFA 2BTQA 1YNOA 5AJHA 2XUJA 1SH7A 4S05A 1VFNA 4RQBA 2O2IA 3WOVA 1L7BA 3LT5A 4PFJA 3HV2A 1GCAA 5E3HA 4OP1A 3FZEA 3FOAA 2YY7A 5DBGA 5ESWA 1SUPA 4RV4A 2ZWMA 3ITEA 2AN5A 1KDOA 2WNSA 2P90A 3PV0A 1OGIA 1JQAA 1OBOA 1O6GA 1DOHA 2CVQA 1Q1GA 2NU7B 4M0DA 4RS4A 3GFGA 4UTZA 3UJPA 3K7EA 4JJIA 2ZPTX 2Y2VA 2Z4RA 4X84A 4BWFB 1NATA 2YXLA 2JVIA 5HK8A 2Z3ZA 4B4UA 3AFMA 4QLOA 5DTIA 4DQXA 1PR5A 3HZRA 2ZJ7A 3KAJA 1JU3A 4JHXA 1Q7GA 3LZ6A 4BAUA 3ERCA 3V6MA 1ACJA 2C8KA 5HZGA 3T61A 2C7BA 4G1CA 2Z09A 3CW8X 5ER6A 5GV8A 1XCBA 1ZRSA 5TQ0B 1E3QA 3CLVA 4FEYA 2A9KA 2FEMA 5DNYB 3AUYA 2ETXA 4YT4A 3BIFA 4UMVA 4WLEA 1QBG<