1ISRA

Crystal structure of metabotropic glutamate receptor subtype 1 complexed with glutamate and gadolinium ion
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
477
structure length
448
Chain Sequence
RSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural views of the ligand-binding cores of a metabotropic glutamate receptor complexed with an antagonist and both glutamate and Gd3+.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Metabotropic Glutamate Receptor subtype 1
total genus 144
structure length 448
sequence length 477
ec nomenclature
pdb deposition date 2001-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1isrA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1isrA01
1GCGA 2A9PA 1APBA 3H1GA 1QQAA 4HYEA 1DBWA 1VRVA 1TM2A 1RZRD 1URPA 3JPYA 3C3KA 4MQEB 4E7PA 4RY9A 1K66A 4F8JA 1YK0A 3FFWA 2ID7A 2AYZA 2O20A 4JB0A 3B2NA 3CNBA 3FFTA 4L4UA 3CFYA 1YS7A 4RDCA 1NXTA 1Y1LA 1BVHA 2PE5A 4P98A 1CEYA 4RK6A 3LKVA 2IDMA 2QSJA 3D02A 3OLXA 2LUOA 3JS5A 4G0PA 1SXIA 5EWJB 3O1JC 4KQ9A 4Q6BA 2PJUA 1RNLA 4MGEA 4PZ0A 4CBVA 5IBQA 2FEKA 1E6MA 5EWMB 1PUXA 5JS1A 3I45A 4W5RA 1DCKA 1LBIA 3HEBA 2NZVG 3T8YA 1J56A 1PNRA 1R8JA 4LZLA 1T34A 2WWVD 1W9HA 1QMPA 3CTPA 3LKBA 4W5TA 5CNMA 3QLVC 2QVGA 2FEPA 2IKSA 1GCAA 1JLKA 2DRIA 3CS3A 4WUTA 4PYRA 3JTEA 3GT7A 3R0JA 4MRMA 4JAVC 2A9OA 3JVIA 1A0OA 2IPMA 2YHAA 3N75A 4RXTA 4EYQA 1DBPA 4WXMA 5KC9A 1JX6A 4DADA 1ZY2A 2WJWA 3O2JA 2LPMA 4NV3A 3F7NA 3KHTA 4GPAA 3HM9A 1NXOA 1SRRA 4MPTA 1PEAA 3CKMA 1USGA 1DG9A 1SXGA 4KV7A 4KQCA 2QZJA 1A04A 4Z4IA 1VKRA 3C6QA 3N53A 3QX9A 3OLYA 4LRQA 1QP0A 3Q9SA 2E4ZA 4IMJB 3NNNA 4Z4EA 3KTOA 4EVSA 4MQFA 1C0EA 3T38A 1L5YA 2MYUA 1PHRA 2LBPA 3MYYA 1Z26A 5KI6A 4MQEA 2CHEA 1RZRA 3GWGA 4MQFB 3CRNA 3TD9A 1IIBA 2FMIA 4H3HB 4HNRA 3H5TA 7ABPA 1F51E 5JNVA 3LUDA 1NXXA 4EGSA 3RVJA 1AB5A 4NICA 4Z9BA 5EWJA 4IILA 1GUDA 2FEWB 2HQBA 3TO5A 1KRWA 3G85A 3BREA 2AYXA 2R25B 3A0RB 4IGAA 1D1PA 4IMIB 4RK0A 5TQ0A 3OQNA 3EQ2A 1ISRA 4S04A 2QXYA 3HCWA 3HJFA 4E7OA 4W5QA 1L5ZA 8ABPA 2PUBA 4EVRA 5TPZD 1JDNA 1ISSA 3NHZA 4OATA 5KWSA 1RPJA 2J48A 2NT3A 5IEBA 1E6KA 4MRMB 1YVUA 5EWLB 1NXPA 3HO1A 3H5WA 2FMKA 4Z4FA 1LJLA 4IF4A 1TJYA 3N8IA 1TLFA 4WT7A 4Z4CA 5TPWA 1Z17A 5JNTA 3T6KA 3HSYA 5JNRA 4JASB 4RV5A 4WWHA 1JDPA 2IYNA 3F6PA 2V0NA 1GUBA 4MR8A 1WETA 5EWMA 2N9UA 5TQ0B 3C97A 2FXIA 1Z15A 3I5AA 3Q41A 3QLUC 4KVFA 4MR9A 5F64A 1YIOA 1A2OA 1CYEA 1PNTA 2NT4A 3A10A 5TQ2A 1ZDMA 4MYRA 2R48A 3Q7RA 3H5LA 6ABPA 3MMNA 2FQWA 2M1ZA 4YS6A 1QNLA 1DRJA 2IPLA 3OLVA 1Z2DA 4JB2A 1FFSA 1KGSA 4MR7B 1BDIA 1LJUA 3O1IC 3TB6A 5B3JA 2FMFA 2HJ9A 2HPHA 2PL9A 3P9YA 4RK4A 3HS3A 1B00A 2KYRA 5IX8A 4WZZA 5HQJA 2P9HA 2FKAA 1Z18A 3JVDA 3NNDA 1XHFA 4GNRA 4F3TA 2PUGA 2JBAA 4KK3A 3CHYA 1M2FA 1NXSA 2FTKE 4WXEA 4LE0A 1D5WA 1K68A 1ZHHA 1S8NA 3A3KA 1JFVA 3IP9A 4RZSA 3D8UA 5TQ2B 3OM0A 1YMUA 3OLWA 1P2FA 3M9WA 3DLHA 4H60A 4ZMSA 4B09A 3LFTA 4LX8A 3Q15C 4W5OA 3DGEC 1ZN2A 2CHFA 1I3CA 1ZVVA 3IP7A 4MS3B 4RK7A 2JVKA 1EWKA 3NNSA 2FN8A 2B4AA 2L18A 2RDMA 3H6GA 3HDVA 2IPAB 3KLNA 2L19A 5DTEA 3K9CA 3RQIA 1CHNA 4Z4HA 1DC8A 5KQMA 4EYOA 3OO1A 4YGXB 3MA0A 4D6XA 1W25A 2PUCA 2F8SA 4YWHA 3UKJA 3I09A 3OMXA 3LUCA 3TMYA 2QVCA 4MR8B 4O1HA 4FE4A 3LUHA 3BBLA 3GL9A 3ILYA 4MS1B 3JY6A 5PNTA 1H9CA 4KZKA 2I6FA 1OXBB 2ZWMA 3MQ4A 1ZH4A 3QEMA 5DGCA 4DN6A 3VNAA 4QPJC 4KPYA 2ID9A 5BR1A 3IDOA 2E4YA 2R47A 3K4HA 4OBBA 3QLTA 1Z13A 2OQRA 3LOPA 1QP7A 3IP6A 2MYTA 5KQGA 1NXWA 5FBHA 3RVOA 4G86A 5DLEA 4EY3A 1U2PA 4XARA 3LUAA 3LUFA 4RK5A 5D2CA 5ABPA 5C5CA 3CZ5A 4D74A 3Q7SA 4JOQA 1DC7A 2VYCA 4HNSA 3RVMA 5JS2A 5KC8A 4N41A 2CD7A 3ILHA 3H75A 3HV2A 2MYPA 3KSMA 2PUAA 2PUFA 1QPZA 3RVPA 4ETNA 4N0QA 2NZUG 3SG0A 2MSKA 4ZJPA 2HQRA 4ZMRA 1ZGZA 1BAPA 3CU5A 1JFSA 4YR7A 3S99A 2JRLA 1QO0D 4QYMA 3DZDA 3MF4A 4OLAA 1XHEA 3EQZA 3F6CA 3HDGA 2XDYA 4RXUA 2QW1A 3EDCA 4FE7A 1YS6A 1USKA 1ABEA 4O1IA 1NY5A 1U8TA 3HXMA 2FLWA 1HEYA 3OO0A 3NBMA 1GLGA 2PL1A 3QELA 4HNQA 2PLNA 4RKRA 4FB4A 3EGCA 4KRFA 2JVJA 4G0MA 4OG2A 3CZCA 4ZYLA 1MB0A 5IUNC 1ZITA 5JNWA 4YO7A 1QKKA 4G0OA 4N47A 1DCMA 4NCAA 4MLCA 2VK2A 3O1HB 3EJWA 2JK1A 1ZH2A 4YCSA 1FFGA 2E4UA 5IUKC 3T95A 4EYKA 2OENG 4N03A 4P1ZA 4LDZA 2R4QA 3E61A 2JVIA 5B3JC 4N0PA 1F4VA 2FLKA 3IPAA 2FQYA 2E4VA 4MS4B 5CNKA 4RXMA 2LP4Y 3RVRA 2RJNA 3Q7TA 4Z99A 1M5TA 5KQLA 3KLOA 3MM4A 2FVYA 3KG2A 4IRXA 4YV7A 4RY0A 5BRAA 3TX6A 5C5EA 4D6YA 4F12A 5FWXB 1RXEA 2JCGA 1NXVA 3LUGA 2X7XA 3FDFA 3LUKA 3DGFC 3O2QB 4RY8A 3UK0A 3GBVA 2PKXA 4RSMA 4RS3A 4YLEA 3URMA 1MIHA 3LUJA 1USIA 1FSPA 4F06A 1EWVA 3JPWA 5BQ3A 1JYFA 1RXIA 4XLTA 1JHZA 2JB9A 3C3MA 3QELB 4ETIA 3L49A 3KS9A 1U04A 2L17A 2WB4A 2GWRA 5TQJA 5FWXA 1D4ZA 3H6HA 5EWLA 4RK1A 3DLBA 3BRSA 2L2QA 1M5UA 3GRCA 4ML3A 1QQBA 3L6UA 4MR7A 3GBPA 2FMHA 3G1WA 3H1EA 3ROTA 3GA5A 2VUIB 1DP4A 4O5AA 4NQRA 2A9QA 1MB3A 9ABPA 5HM6A 4MS3A 1M2EA 5FWYB 1DCFA 4H3KB 3O21A 3O75A 4NCBA 1EWTA 5IEJA 4MR9B 1Z25A 3M6MD 2WMYA 4MAAA 4OTZA 1PEYA 2RJOA 1JL3A 2YHBA 3RVQA 2FSPA 3N0RA 4G0YA 4Z4GA 2FQXA 1LBHA 5TPZA 3F73A 5DCLA 4EUKA 4RWEA 1SD5A 5HKOA 1Z16A 4G0ZA 4MLDA 2H0AA 3DBIA 4XAQA 3M9XA 3SM9A 4YRZA 2MSLA 2E4WA 1ZAYA 5CNIA 3N0WA 2WY2D 4KMRA 3GV0A 4MS4A 2M98A 1AB6A 2GI4A 4EYGA 2W42A 3NHMA 1QP4A 3HUUA 1VLZA 5CNJA 2VUHB 2PMCA 1Z12A 3CG4A 2QR3A 3EODA 2IPNA 3OMWA 4Z9AA 1JH9A 4KFCA 4N76A 3O74A 3H5IA 3SQNA 3HUTA 4ETMA 3QEKA 3FMVA 2MYNA 3OQOA 2H3HA 4M88A 3A0UA 1Z2EA 4Q7EA 4RKQA 4S05A 1BA2A 1DRKA 1NTRA 2PUDA 1TVMA 4QICA 2PUEA 5GQSA 5ED4A 5DKFA 2FW0A 5T7BA 3KKEA 4LE2A 3SY8A 4G0XA 4EVQA 4OLBA 5JNUA 1MVOA 3FGZA 5TPWB 3I42A 1ZGGA 2ZAYA 1EFAA 4PEVA 2CWDA 2PAFA 4JA2A 2F8TA 1FFWA 2HSGA 2Q5CA 1TMYA 4F11A 1P6UA 4TN5A 4TLMB 3MIZA 2A9RA 3ROFA 5KQPA 1YTUA 1DBQA 2GBPA 3HZHA 6CHYA 4W5NA 1QO0A 5CHYA 3RVLA 3UUGA 5IUJC 3HK2A 1P6QA 5E3JA 1NATA 2WJAA 4KK4A 4UHKA 4G0QA 4KNYA 3H1FA 4L85A 1JBEA 5HSGA 3SAJA 5JNSA 4LE1A 1KRXA 4G97A 3QLVA 5IC5A 3HVRA 2LIVA 1EHCA 3H5VA 3E3MA 3QK7A 2HQOA 3IP5A 2P4UA 1ABFA 4JP1A 1BDJA 3KJXA 5I4CA 2MSWA 5FBKA 3OLZA 4DQDA 4UHJA 2QV0A 5IULC 3N0XA 1MAVA 2B1JA 2NUBA 3RVNA 1P8AA 1YK1A 1U2QA 3LTEA 3O2SB 1JFTA 2BGGA 4RU1A 4XXHA 1KMIY 2IOYA 3C3WA 1VPWA 3KYIB 1U0SY 1E2BA 1UDRA 1JF8A 1XWWA 4PICA 4TMYA 3CG0A 3EULA 2JBAB 1EAYA 3RH0A 4TLLB 1FQWA 1JWLA 3FFXA 1OXKB 4XASA 5T3YA 4Z0NA 3QX8A 1SXHA 3KYJB 4Y9TA 1DJMA 3N6VA 4MS1A 2FN9A 2E4XA 1DZ3A 3IPCA 2GKGA 3RVKA 2TMYA 3VNBA 3OQMA 3QEMB 3GYBA 4ZPJA 1D2AA 4QYWA 3QLUA 4Q6WA 4LDAA 4PE5B 3SNKA 1YMVA 3KCNA 3OM1A 1E6LA 1JYEA 1BDHA 2GX6A 5GOTA 5TE9A 2RGYA 1C4WA 2QU7A 3EAFA 3H5OA 4YP9A 5FWYA 3BILA 3RVSA 1ZESA 3CLKA 5BRJA 2WRZA 3BRQA 1LK0A 4XFKA 3LMKA 4KREA 3W9SA 1D1QA
chains in the Genus database with same CATH superfamily
3D2LA 2ARKA 1XAJA 1KE2A 1HEIA 1RZ3A 1Z5NA 3D6UA 3H1GA 3QXSA 4K6FA 4TVKA 1I3KA 1JNYA 1ONBA 3KR9A 4ZYYA 4BLRA 1YZGA 1G64A 2XRFA 4FYWA 3WHLA 1Z4PX 1EQAA 2B7BA 3FIUA 3PB3A 1PJTA 3CNBA 4LOLA 3EISA 4QEKA 2JAWA 2XQKA 1D0SA 4J7CA 4QU9A 3N2KB 4B7ZA 2BFFB 2WU1A 3QM1A 2ONKA 2HT6A 2AOXA 3IRVA 2WYHA 1P3Y1 4Q4JB 4INPA 3E27A 3TSYA 1N2BA 2QSJA 5EWJB 4FXPA 3IR6A 2J1LA 1L7QA 2H7YA 5U1PA 1M1YE 3T7CA 1C81A 3GUHA 2JZCA 2PJUA 4Q6BA 4CL3A 3AR4A 4ER0A 1Y1TA 1AKYA 1Y5NA 2ZATA 3JAWA 2GAIA 4KYIB 4OSOA 4XDYA 5LBIA 1QIHA 3RTBA 3B48A 4JK3A 5MN4A 5J2TA 2W6OA 2H7VA 3IDAA 3NEJA 4XVCA 1PFWA 5HBRA 4V0NA 7MHTA 1HGXA 1N3YA 1JDJA 2WYOA 2H06A 1NV9A 3U9TA 1V9CA 1H6AA 1SCBA 2Q8QA 3SBOA 1IXSB 4DARA 1ZXLA 2E3JA 3LQFA 3BB1A 1BFKA 5J3JA 5IJ9B 2KBFA 4MB2A 5JPIA 2XWJI 1PNRA 2HJVA 3QVLA 1J9ZA 4IIFA 2V5VA 4MQMA 3CX6A 3UKDA 1XRQA 1EUDB 3MCUA 3T9AA 2FG6C 1ZGAA 5EJEA 1MQAA 4P53A 2PANA 5LA6F 3ENVA 4YRGA 4GF5A 5FUWA 2J5BA 4NBWA 1JHMA 4WXMA 3LCMA 4HR7A 1E77A 1A69A 1K2VN 1W0JA 4YMVA 4ODIA 4HUTA 4AJNA 3M4NA 3A3PA 1OBVA 2EOAA 4R5MA 2RHMA 4ND8B 1ZGBA 2CLMB 4OAPA 2I5PO 4ZVSA 4ARZA 1VB5A 1YAJA 3AR8A 2NTEA 1FSFA 3CKMA 1M1NB 2QROA 3MERA 4Q1BA 3B3GA 3WG9A 2A3RA 2QZJA 2RHLA 2VBCA 2VFAA 2XB8A 2ZQZA 3PC7A 3ZDQA 4BCCA 3LA6A 4I9NA 5IVHA 4LSWA 1R8QA 3BD6A 3VC7A 1SCNE 1LRLA 3WI7A 4DR3B 3D5TA 4HOYA 3Q9SA 3WB1A 2V3CC 3G2MA 3GUVA 4ARBA 4Z4EA 2PRYA 3PWTA 5EQJB 2JBWA 3E35A 3HPRA 2DBZA 2HWUA 4UXIA 3MWDA 1ZK0A 1L5YA 3S2SA 3U60B 5ALMA 3C41J 4U7PB 1GCOA 1WMFA 4LTDA 4D92A 2OKGA 3J81k 3T9EA 1OFTA 3PHIA 2G6TA 4S1WA 2NV0A 3FTNA 1XNGA 1X1EA 2G28A 4BNTA 4UREA 3ZHSA 4YONB 3H5TA 3KL4A 2HNBA 1AQIA 1NXXA 1LY1A 1YZ3A 1N5IA 4ZOLA 2IV2X 5AJHA 2QMUA 1SK8A 3DBRA 4Q9AA 4RVOA 3L7KA 4R84A 3I6IA 1L7OA 3TO5A 1VMKA 2ZSFA 4JC4A 4BBAA 3A6PC 2CVOA 4C3ZA 5HP4A 1I6LA 3MGAA 4GYWA 3HJFA 3VR0A 1DG1G 2FNAA 4YIKA 5C1DA 3PEWA 3INYA 5EFZA 3N2LA 4HEA1 5BN4B 3PGMA 4AIRA 5CXUA 2PVCA 3NHZA 3I1JA 1WOMA 4AO6A 3UWDA 5EY5B 1S01A 3CPHA 3QWHA 4IQ4A 5TVGA 3Q5GA 2C8VA 1N8KA 2LIPA 2C8KA 4QQFA 1IUOA 2B7LA 4S1NA 4W5JA 5DHTA 1R27A 2ES4A 4RYDA 3TQRA 4YI3A 2HUNA 3I76A 3R1IA 3QJGA 1TLFA 4E12A 3FOCA 2RGXA 1J90A 2XDQA 1UIMA 1XCJA 3R5XA 4GYJA 5DI3B 5JD6A 1OWPA 3E9RA 4LY6A 4OYHA 4ZCQA 3VR3A 1N34B 1AUPA 1ZGHA 3B1YA 3PA6A 1CS0B 1D6NA 2C1XA 1N3IA 1DX6A 1KQ3A 2B36A 2BUCA 3FVWA 4CLEA 1S4MA 2ICAA 5HK9A 4XQ9A 5ICFA 3LVBA 4TWBA 4OM8A 3HB7A 3RRZA 3CZPA 4HWSA 3ADBA 4NI5A 3VPGA 4UAVA 2NP7A 2DU8A 4DWVA 4G5XA 3BXGA 3R23A 3ITNA 1EP3B 5G4KB 1SBHA 4DV0B 2H9IA 2C96A 4RMGA 5EXDA 4EMBA 1QHGA 4JB2A 4MR7B 5BYAA 1BDIA 5BQ5A 4MGIR 3RUHA 3VYWA 4AJJA 2Z2JA 3CVJA 3I01M 3NHRA 1UFQA 3FB1A 5B3JA 5KTYA 4EY8A 4WJLA 2C8JA 1X9IA 4YLGA 2ZE8A 2P2CA 3B6KA 2OZLA 3AY7A 5IAKA 3ZN2A 5BV2P 4IZOA 1OC2A 3WLKX 2ZUWA 3LW7A 1E64A 2R85A 3I6YA 3DDCA 1JXMA 2PS1A 2I0FA 1QVZA 3COSA 1RKBA 4IOMA 4OB8A 3HVUA 4AYWA 3HKEA 3ZKAA 4IXWA 2HWWA 4OCZA 2DPHA 3AVTA 1WRBA 2Z6VA 3WGVA 3RLIA 1HE1C 3AEUB 4YTEA 2Z2XA 4NE2A 1NKTA 1V8BA 2YMPA 3EC2A 3K05A 4GMXA 3SU8A 5JNLA 3RAJA 1SBYA 2PX2A 2Q9BA 2BMDA 3HGMA 4X1KB 2BM0A 1JE1A 2NU8B 2BDEA 3GLHB 1ZHFA 2ZK7A 4O8CA 4R2MA 3U7RA 4GKJB 3NTXA 3QXJA 4EHJA 3OQVA 1V71A 3ER8A 2PKRA 1QH8B 2NTYC 4AP9A 1CSEE 1EUZA 1V39A 4ITUA 3VXKA 1QFSA 4MWCA 1KO7A 4A8JB 2PKWA 3CX4A 3C4QA 3B2QA 3M6IA 3UKJA 3V1LA 4DSOA 4H3SA 2QAGB 1CF9A 2ORIA 3N7UA 5H82A 4YRNA 4BYMA 2E0IA 2C97A 4EWLA 3CLSC 4OGGA 2F1IA 3OESA 4GRAA 4FBMA 3O3MB 3QXXA 4LV5B 3Q88A 3ZG6A 5DEIA 4AUEA 1EDZA 3KELA 1MPXA 2QE7D 3GFFA 4RJIA 4US0R 4YCJA 3TOCA 1RYDA 3KTAB 2OTCA 4HTFA 4NDZA 1X7HA 3PTZA 3JARA 2HPVA 3PNVA 2NW6A 2Q49A 2ODEA 3GJ8A 3R9XB 5TARA 2YY7A 1V95A 1CPYA 2ZXEA 2I87A 1XQ1A 4MUNA 1XZCA 1CVRA 1KAQA 3QE2A 4F3NA 1T6ZA 1NAHA 1VLJA 3AJRA 3EOBI 4YK7A 3D3EA 2C0QA 5D7BA 4KDEA 1M2OB 4X1OA 5ADVA 2HR1A 3U37A 4KX3A 1JIXA 4E32A 5JH7B 4QWWA 1Q0TA 2ZI9A 4NPHA 4CMEA 1E5DA 1OYOA 1WW3A 1BYUA 1LNZA 1W94A 3DR5A 1R66A 3LUFA 3CEPB 1EM6A 3H9JA 4IFBA 4W99A 1C30B 3UXMA 3D1VA 3L05A 3Q7SA 4HNSA 4RDXA 2XCRB 1KXJA 4J0IA 2YS6A 3JZAA 5DPMA 7REQB 2ECQA 1BCSB 3BL5A 2MSKA 1B43A 2VNIA 3EFOA 3ZIUA 1XXHE 4EDHA 5K0FA 2NUAA 4RL6A 1NBWB 2JNWA 4EH1A 4WDQA 3ZHQA 1QYWA 1ZN9A 2HA6A 2J0UA 4BZXA 1UH5A 3EBPA 3UH1A 5HVNA 1H4VB 2AXNA 1IXKA 2EFCB 4Q02A 2DETA 1DOZA 5FRDA 2PR2A 1U1EA 1SBZA 2LNDA 1T2UA 4GBGA 4RPCA 2HI0A 2ZSEA 2ZAMA 3PPWA 4DY4A 3T3EA 4FQ7A 2GESA 3EE6A 2NGRA 2HK7A 3I9NA 1TM4E 5CH5A 1XYYA 3NIGB 2R4TA 4RTRA 1PWXA 4FB4A 3EGCA 3HCFA 4BP3A 4PZDA 1KYTA 2W2QA 4KRFA 1NXQA 3I04A 4S3MA 2EL7A 4TT3A 2R6JA 1B93A 4PR3A 3PHHA 2LTAA 4WVFA 3F5QA 2XKKA 3DV0B 5T4EA 4FYXA 4P7JA 3WQSB 5IABA 4OSEA 1DFIA 3ZDFA 1R16A 4CRWB 1FDRA 2JJ1D 2ON6A 3F0TA 1SZJG 3FPJA 2B35A 5IJ0B 2IOHA 1FP6A 3SC6A 1NR5A 1QV9A 3KSUA 4O8ZA 5DBIA 2WQ6A 4P1ZA 4GPTA 1KDRA 4RCZA 4BMSA 2J5KA 1Y89A 2FRVA 1QFJA 2WUWE 3BEDA 4FEEA 4KITB 1G38A 3IPAA 4RNDB 3NS7A 3TXXA 3MJCA 3ST7A 2D54A 4PU0A 4ZVVA 3ESAA 4ZDJA 4IDEA 4NONA 2COUA 2FVYA 2HK9A 3IH5A 1C7JA 3OE4A 3ICCA 1JHRA 2VKTA 2ZIVB 4Q3AA 4H08A 5BRAA 5LKAA 1Z22A 4HGPA 4Z7OB 1V8OA 4GBED 3KPVA 4XI9A 4F84A 2ZYHA 4TKVA 2XBUA 4HNUA 1CQIB 3RUAA 3U62A 1VQ1A 4DV5B 4I1PA 1ND5A 2WSIA 3M5PA 2IYXA 4UMEA 2XAUA 1V16B 1XTBA 3IT2A 4ZOCA 2PKXA 3SX2A 4BRZA 3E81A 5JG7A 4YMTA 4XIGS 3ADOA 4S1OA 4CKZA 3SVLA 5EIEA 2RB5A 5FI1B 1O97D 3MJTA 4DJJA 3GT4A 1RXIA 4QREA 2G9RA 1U8CB 1NF8A 3L8MA 2LW7A 1R9MA 2YQ4A 3N8NA 4PCVA 3VHQA 1FDUA 5HZHA 4M53A 1PR6A 3CUKA 3H6HA 3QKTA 4C3OB 4Y2XA 3O7MA 1H94A 3DLBA 2GSWA 3L82B 3T7DA 1M5UA 2QG6A 3JATB 3KBOA 4C6TA 3SNHA 1VHWA 1IVNA 3P19A 3N39C 4IFTA 4A0FA 1VJ5A 2HA2A 2BF7A 4IHKA 4U02A 4OFXA 2EIHA 2XMBA 3OT4A 1L7AA 4MIEA 3IUBA 3DWFA 4K86A 4ZT5A 1ZWLA 3RYFB 2LGJA 1R1DA 1SA0A 1FYVA 1FVFA 2QD4A 3ISVA 6Q21A 1OBCA 2WA2A 1VKZA 3GJSA 3HYRA 5ILQA 4CEJA 5GY7A 5KOYA 3DE0X 1W4ZA 3ONDA 3GZNA 4ZIRB 5HUJA 3B7PA 3UTDA 1X80B 5JRZA 3PHBE 1UFOA 1I24A 1GEGA 2I34A 3L79A 4HDNA 4JI8B 4DR6B 4CT0A 3DHWC 5HZKA 1U2ZA 2R68A 3GRRA 5KTPA 2LD4A 4LBWA 4MUFA 4AF7A 4TYPA 2W2VA 2E1PA 4POAA 5KNBD 1F0NA 3CNOA 1A76A 2E4WA 2QLFA 1IL0A 3WGNA 5KTTA 2ZSJA 4OMCA 2JIDA 3M3HA 3P1JA 3GMSA 1NFFA 1CZUA 1NW4A 1KNQA 4BJ3A 1KP3A 2E87A 2QX7A 3NHMA 1A5TA 1YB1A 3ZIAA 4Q4HB 5IG2A 4KFCA 1A8IA 1K8XB 3ORSA 4J43A 3KKQA 3O8OA 3Q3IA 2EKPA 4BO3A 2OD2A 3O8RA 1YQUA 4MEAA 2BZ1A 3DLCA 4Z49A 1P80A 1LVGA 3BHIA 1OI3A 3NAGA 3TTUA 4BNYA 1GTG1 2AG5A 4HD8A 1WPQA 2TS1A 5IM5A 1VA4A 2AJDA 3L40A 2OBYA 5FNVF 4F60A 3ROXA 3EY4A 2GEVA 3WP0A 1XKXA 3WLFA 3K5HA 1EVIA 1UDAA 3QXHA 4OQXA 1IVSA 5E1MA 13PKA 4NYJQ 5BSMA 1J21A 3FTDA 3IC5A 4KUGA 4RKEA 5AVZA 4JLPA 1YTUA 1I0LA 3PGA1 2A9RA 4G2TA 4GP7A 4BB5A 2RARA 1ML4A 3M1YA 2PBRA 5THXA 1A4IA 1NN5A 1P6QA 4IS2A 2C3MA 3R6DA 1JUDA 1AGPA 2GO7A 2XT0A 1L7DA 2WICA 3ZU4A 4JT4A 1SKUA 1DBIA 5JNSA 1RJEA 2JCYA 2W7TA 5SYMA 5JSQA 3ANSA 5JZBA 1NQ5A 3PLRA 1RI3A 3QLVA 1TU3A 3T3NA 3CUTA 4BAZA 4ROSA 4A4DA 1CJMA 4W5WA 3PZBA 4AG6A 1IY9A 1V37A 2HQOA 5BR8B 4Q3DA 4KR0A 3SS7X 2YZ7A 1ATZA 5EJ8A 2V3VA 1BVYF 2C3YA 1TVEA 2AOUA 1K0UA 5BWLA 2IOQA 2YWBA 1CNEA 2WG0A 3FSRA 4RA6A 3MS4A 2XLBA 4JODA 5IULC 2B1JA 9LDBA 1KZ4A 1WD5A 2OBXA 3A1SA 3GCGA 1GV0A 1DBRA 4K8OA 3NKLA 1T8WA 4P4GA 4WFKA 4LQLA 3ZV7A 3AESA 4BMYA 4BJ6A 5EIBC 4ECEA 4MKZA 2BPOA 3V2HA 4BO2A 1KORA 1ZNYA 3AV0B 5F9MA 5T6BA 5DYWA 4D4MA 2FPOA 2M6SA 2P0EA 2PZLA 5CR9A 1VBFA 1JTEA 2GCPA 5AKZA 5CAEA 2E6UX 2DTEA 3BERA 3TQIA 2W6JA 2P4HX 1QQ6A 3CSUA 4X6XA 2GKGA 3LL4A 1ODLA 5EZYB 5CBKA 2JGRA 3OQMA 3NRCA 4PYMA 3PGJA 5BPHA 2QNBA 4ISCA 4D7AA 3C87A 1NBEA 4E4TA 2DFNA 1I3LA 5IWCA 2O7NA 4ISBA 3KNZA 4CMHA 3RSLA 1GGNA 1M3SA 1YMVA 2OUIA 2V0GA 4ZEVA 2CCGA 1U90A 3FMPB 5GOTA 4MQBA 2C5FA 1C4WA 4URFA 1C7EA 1W19A 1Y1KE 3BILA 3TAUA 3PPXA 2B4QA 4Z3DA 3EJ6A 4DSAA 3NCHA 5LR6A 3L3BA 2BR4A 2ERXA 3NASA 2DJ5A 1CIVA 1F4LA 3K9BA 3W9SA 3JD1A 2GOYA 1GRCA 1US8B 3QVTA 1G41A 3I28A 3O8CA 3FYUA 1GYQA 4R3NA 1FQOA 1P5HA 5DHSA 1RI4A 4BTEA 3B2NA 1GAJA 5LMCA 4DDMA 5AM4A 1AK9A 4P98A 1ZM7A 1UJNA 1ZQ1A 2Z3ZA 3KHKA 3N70A 3ZNOA 3OLXA 2AVNA 1XNRB 1OSNA 2C07A 4YAKA 5CLFA 3DBLA 1Z4JA 5ALKA 2W6ZA 2JLQA 2EHDA 4B3HA 4NZNA 4HDRA 4N9WA 1IPHA 4YAUA 2HEIA 5GJVC 3D7RA 1FTSA 1C1HA 1NVUQ 3CN7A 1DCKA 1Z88A 3ZU3A 3KQKA 2EP7A 3LDUA 3K20A 3R0VA 3T8YA 3TEMA 5D8DA 4C22A 2O0MA 4MAFA 3VZBA 1SB8A 1EGHA 4PYLA 4R2KA 3I53A 2RK3A 2JKZA 3V00A 3NOVA 1XZJA 1M0WA 1VP9A 2EG9A 3KQTA 3LQ4A 5L40A 1YA6A 1B8OA 1C9MA 1W1IA 1C8KA 4P7GA 1N5OX 1F0KA 1G5QA 1O2DA 1R0YA 1E61A 1QORA 2JA1A 3BSFA 3IERA 2DMRA 3IOBA 4JAVC 4KXVA 2R86A 4K1XA 4NU5A 1WZNA 1NFQA 2V7TA 4IV5A 2A1UB 2FK7A 2ZEJA 3IP1A 2DF8A 3HCAA 3R3YA 1U31A 5LB4A 1QE5A 1RACA 4MKRA 5GVSA 4ZKEA 1M2VB 3CR3C 3R3ZA 1H8HA 5EHQA 2QX8A 4RZIA 1J00A 1G63A 3MRVA 1NUHA 3BWVA 4HUQB 5C32A 1RJFA 2VRCA 1E96A 2REXB 1U2GC 2HSWA 2JHGA 1EUYA 3BM5A 3BXPA 5COAA 3CVVA 4NZPA 1W4LA 4KBYA 4EQ6B 2CXXA 2GK7A 2OV8A 4MVYA 2VHWA 4IHJB 5AKKA 3GJ0A 1RBMA 2ZE6A 1TNDA 3P2IA 5L4SA 2WPDA 5DMXA 3UHPA 2BHLA 3IAS6 1BZYA 1E3IA 5F9FA 1A8UA 3IQGX 4F38A 4UJ5A 1M8PA 1PHRA 3KKPA 2KHZA 1Z26A 1ZL0A 3RABA 2FFAA 4HVLA 4E09A 3JQDA 4GX5A 4N0MA 3CTMA 1DFGA 2R8XA 2ZPUA 3EHDA 3VR6H 1N2CB 3NGLA 5K4HA 1G0NA 1GNSA 2IYSA 4HDSB 1YS9A 2ZRJA 4GWKA 4HRVA 3QU4A 4PYQA 4YP7A 4HYYA 3LUDA 3ME5A 2E48A 4UZSA 4HZGA 4S1PA 3LUBA 1TPZA 2WUEA 4UATA 1ID1A 2HMTA 3GGGA 3V8QA 2YY6A 1A7KA 2PX3A 4IMIB 2AYXA 1D1PA 2JEZA 3G0BA 2OCBA 3T52A 2J08A 3TX2A 4BLOA 4DUPA 1X86B 3KTDA 1E18A 3FR8A 4HHEA 4X20A 2AEMA 3P9KA 4IFEA 1T15A 5BSEA 4FDTA 1L5ZA 1DL5A 1VSUA 2ODWA 2V7WA 5JAOA 3UGJA 2K7FA 4ZO6A 1K6MA 2X8BA 2YICA 3AUXA 3U4HA 1RPJA 2R1UA 3UCFA 1E8DA 1K88A 4DY6A 1CNMA 1VKJA 3AEKA 2CLKB 3OQBA 3MT8A 4HNAA 4V2UA 4CCYA 5HX7A 3H5WA 5JLJA 3BYZA 4RTNA 4WZAE 2JHPA 1E9DA 1VJCA 2IUSA 3OZEA 4ZHSA 4FYKA 1W0JD 4FR2A 4LFBB 1M6YA 3HL4A 1JR3D 4WT7A 1MA0A 2IEAA 4JJ4A 3ZV4A 5ALRA 1T8RA 1T3TA 5LIPA 3L0ZA 3F6PA 1FX1A 3ZEIA 4TTQA 4DQLA 2AI1A 3OIYA 2PX4A 3T3MB 2ZIZA 4P4UA 3IE2A 2N3ZA 3LT0A 4GYKA 3REFA 4FOSA 1KOGA 2DX7A 1AA9A 5ALUA 5GONA 2G5TA 3GXOA 1S8AA 4PSAA 1J8QA 1TAGA 2B7CA 2VHCA 1VJ0A 3EDMA 4D4IA 4YRQA 2FQWA 3TKAA 4QFCA 1WXIA 9ATCA 1TIKA 3ECAA 2E4AA 2YWXA 1X7XB 3GZ4A 1TVCA 2VDLB 1Q7RA 2RKOA 1T5BA 1LI4A 1MEEA 2CKDA 2YZ2A 2QVZX 1UM8A 3PXDA 4TZ0A 3HH8A 1G7TA 4X24A 1W0CA 3L9WA 2HPHA 2G9QA 1OLXA 1GZ5A 1MG5A 4OSPA 4XB1A 1JGTA 1OF1A 4H0NA 5GM2A 4BNZA 4CLRA 1O1YA 3B89A 3AY6A 2EBFX 1UBCA 2EGHA 2FWRA 5IS2A 4F3TA 2H9YA 3PT9A 1XZQA 1K92A 2XV1A 1JJ7A 1NR7A 3N5CA 5ADUS 4ND2A 5IVPA 1FMFA 4I4LA 3AEQA 3ITEA 4NQZA 4TVSA 3GJZA 3RYIB 1VIAA 1XNHA 4ZAFA 1YJAA 2X76A 4A5SA 5BSKA 5HW0A 2Y6VA 3IHWA 3DULA 3VHLB 4CM4B 1EDBA 1D7OA 2RHJA 4DM4A 4YMHA 1PJQA 1PKXA 4PWZA 3LBFA 1KAHA 2AFRA 3ELUA 4WUVA 5FFFA 5FTMA 1R9NA 1WDLA 4KHZA 3A7DA 4LX8A 5LP6B 1UPBA 2YZKA 5JAIA 1YU9A 4R6XA 1CR1A 2WIKA 2IA5A 2OWDA 2XNDA 3WFJA 1GXSB 1YBAA 4LJ8A 3DHNA 4AXBA 2PSHA 3ZXIA 1M5RA 4C7JA 1WV0A 1VG1A 2A57A 1HV8A 2L18A 2I2CA 2Q3MA 4TMWA 1DWUA 2VH2A 2O8BA 2R65A 4WLOA 2R8ZA 4KQFA 4ZDWA 3F9CA 4W8OA 1R6BX 1O57A 2NTJA 3IVRA 4MWBA 3TIFA 1J2RA 2VTBA 1Q3KA 5KOJB 1LJ8A 1OFIA 3F3YA 1EE1A 4D4LA 5JMWA 3ZHVA 5DN9A 3AUFA 3MQ2A 4FYIA 1FA9A 2J85A 4ZOEA 1I9GA 3Q3CA 3JZFA 1ZM2A 2CMGA 4HDAA 5DGHA 2OY0A 3D3KA 1RWKA 2DH6A 2XZDA 4NS1A 4WASA 5E9JA 1WZEA 2G36A 5AJZA 4BYGA 1QRAA 1OZFA 3Q3HA 5DIFA 3RJ9A 1E20A 5EMNA 3PGVA 1BXRB 3KDSE 1GVNB 2ZITA 2I62A 5DGCA 4F92B 4RIGA 2CMKA 4KAXA 2V4MA 3ZE7A 4E5KA 1LZKA 1NAIA 4P5DA 5JVDF 3NCTA 3HB4X 4M54A 4B3CA 2Q46A 1SVUA 1XLVA 4MI3A 3PWKA 1P9OA 4R16A 5HDQA 4QYSA 5B1IA 3NC1C 5IDVA 5DNWA 3HJHA 1DARA 1CFZA 2O7QA 3H8WA 4NENA 5HM8A 5C0OE 5KQGA 1ISGA 3N2EA 3TINA 2BCEA 3R77A 5IP5A 2QS9A 2W6JD 3D8SA 4FGKA 4JI7B 3CJQA 3KTFA 2KM1A 3LF2A 4NMWA 4PHTA 5JDIA 2AFHA 4NEQA 5DTMA 1Z6ZA 4FE3A 4N41A 3ADKA 4KR9A 1JKJA 5THKA 2QL9A 3I9OA 4Y2RA 3AGQA 3KT8A 2QX9A 3FSEA 5K6AA 1O0CA 2WHQA 3PYXA 3I5MA 3GRYA 4BQFA 5K8LA 2XUKA 4NXNB 4HDQB 3WKDA 4QFBA 3DLHA 1U65A 2Y68A 3I30X 3E82A 2WWYA 2YMMA 4ICIA 1X9HA 3VYTB 4Y2YA 1W47A 5JDCC 1RAGA 4FE7A 2NPIA 4RW0A 4TV8B 2Q28A 1HORA 1ABEA 1CUXA 3SSOA 3ZK9A 5JMOA 4GXRA 3JR3A 4O4HB 4LSGA 4RQBA 1R7RA 3DL2A 1QIFA 3PI7A 1NZFA 3CNLA 2HLDD 1BG6A 1JTVA 1OX4A 5LB2A 4ZI3A 1Z29A 1AQYA 3GQBA 2FETA 5FWNA 1T9BA 1IZ7A 1YRLA 3JVUA 4TX1A 4G1BA 3CBGA 4LUCA 2ZR0A 4EG7A 3F4KA 1QH1B 2VRBA 2A67A 3QRWA 3C1UA 3EXAA 1ZH2A 4JVMA 4XCXA 4DS3A 5AW2A 3WGYA 1XJ0A 3WWYA 1J0EA 1GU7A 1Y8RB 3B6MA 4R2XA 3N0VA 3GDGA 5IK2D 1VP3A 4IJMA 2FCRA 2R4QA 5AKYA 3UEOA 2X2OA 4NS4A 1MZPA 4CFZA 1LS1A 1FVXA 3F97A 3OX1A 4BO4A 1Y6GA 2JFNA 2ZJ4A 1UEIA 1PL6A 1ZNWA 5DO9A 5A3JA 5KQLA 1K7FB 3AFOA 1YCFA 1PP4A 3JQRA 3NBYC 1D09A 2GNOA 3F8WA 1XMOB 1M8GA 5D01A 4C0WA 1VRCA 3PYLA 3VPXA 4KNVA 3DXYA 1F12A 1ARZA 1N8NA 4EB0A 2X40A 3H99A 3C7KA 3KXLA 5BSTA 2P9GA 2KX7A 3OD1A 4FFPA 4FTWA 4OU5A 3RRXA 3FUUA 4D02A 4R8LA 4DR7B 4B8YA 5JXWA 1VLMA 1FFAA 2NG1A 4OFBA 1IQUA 1M2KA 4G5OA 1Z75A 4QYIA 1M1UA 3T61A 4Q3LA 1SCJA 3GZTB 2KE5A 3INTA 3K30A 1L4EA 4UDYX 2XTJA 5LC1A 4PN7A 5A3RA 3LPNA 1GL7A 3KS9A 4KSYA 4KUEA 4W1QA 1L5HB 4ZOQI 3IJRA 4GGPA 4PSUA 4WVLA 1NVFA 3GLIE 3QVMA 1OLUB 4LCEA 2H5JA 4MV0A 1MD9A 1W4AA 3IQWA 3F8TA 3TVTA 2WINI 4MK4A 4ZARA 1GA4A 3WHIA 3G8BA 2ERYA 1NKVA 1AK2A 1LI7A 1XXHA 3G1WA 4R1UA 1R0RE 4AW9A 4Y9SA 2A9QA 4WKOA 4CIAA 2DOKA 2XW6A 3QEJA 1KYIA 1KJJA 3OJXA 1DCFA 4MQ5A 2C20A 2X2EA 1E9FA 4H9GA 3BIFA 3GVPA 5LQCA 1FNDA 1O77A 4CIBA 4P32A 4V0LA 2HX1A 2WMYA 4L4RA 2PEZA 3IFSA 5HPYB 4OXQA 4F9EA 3ZW9A 1FQKA 1E2KA 1TFRA 4QG7A 2YC2C 4ENRA 1S8OA 1DTWB 2X3FA 4C03A 2Z6QA 1N78A 4F4IA 3UOWA 2I99A 4ITVA 1XHLA 2PG3A 2QTVA 2YUTA 3HJCA 4GICA 4UBLA 4M6WB 3M9XA 1QU3A 3T4UA 2H4WA 2ZJ5A 1H2YA 2WPDD 4P35A 3DDUA 3GF4A 1XZNA 1DIBA 5F3RA 3ZDZB 3KE8A 3DH0A 1LI5A 2ISQA 3FHCB 4Y2HA 4ALJA 4LFCB 1YJXA 1E1QA 4MEJA 4RPGA 1YL6A 2WSLA 3DFUA 1K0FA 1NGSA 4FKZA 5DHPA 3R7SA 3ORYA 3NO4A 5LUAA 1I5OA 1Y1QA 3SFVA 3VGPA 4CDMA 1N7IA 2FWAA 1H8HD 3D4OA 4ETMA 2H31A 4EL0A 3UJPA 5FLYA 3LP8A 2H3HA 2DT5A 5B6IA 1E2HA 1VYTA 2RGNC 3H1AA 5E2IA 1Z74A 3KZOA 3GVHA 3RC2A 4D4HA 4QICA 3VUEA 2IOFK 1C1DA 4RH0A 4EPXA 2DPXA 4XFJA 5T7BA 3AVWA 2O1WA 3TIVA 2C7PA 4F9TA 1XG5A 1XNJA 5KYWA 1MVOA 3ONVA 3SYRA 3VMMA 3MSCA 1JQEA 1RTTA 1SR8A 1V3VA 3NP7A 3PEUA 4JVOA 3SC2B 3WSVA 5HWSA 3ZWQA 1KY4A 3RVDA 3WY9A 2HA3A 5JAPA 1RHQA 3GJ5A 2ZYSA 5BSRA 2JAHA 4LSZA 1KIAA 3W6NA 2GKSA 1VJ1A 5FLEX 4KRGA 4DLUA 1B8UA 3MFYA 1JKFA 1DC5A 1UJCA 4O29A 4AC9A 4RZHA 2GYWA 1K9VF 2VP5A 1EXDA 3LW8A 2WNHA 3H2IA 2I2WA 3PQ7A 3K6SB 3GLFE 5FWDA 1H2WA 4D45A 2WVAA 3V8MA 4H59A 4WH0A 4LQDA 4JP1A 3SC3A 1HLFA 5AIAA 3WJ7A 1UBLS 3AZOA 3MSXA 4XWGA 2W8BB 3E9ZA 3KRTA 1FDOA 3WK6A 1GGFA 1WX1A 4UHJA 1S2OA 2IZ0A 5C53B 2QV0A 2AK3A 1ONOA 2NN3C 2H8GA 3FCYA 4BLPA 1HURA 1UMDA 4L57A 1K5DA 4MARA 4N8DA 2GN8A 2FUNB 1KDVA 5B64A 1VPWA 1PV1A 4OHOA 1VKNA 3CG0A 3VSDA 3WYNA 1XLTA 1X7WA 1ULAA 2BGNA 2G25A 2HTEA 1E9AA 3UUWA 3V46A 2BFDB 3LX8A 2QZZA 2RH8A 4TYMA 4BEWA 1E2FA 2J3DA 4ZO4A 1N36B 3KXPA 1JHPA 5TF4A 5IM4A 4LF9B 4KMOA 1CNFA 1PWEA 2CW5A 4Y98A 4XUDA 1OFHA 5F33A 3WLHA 1YRWA 1OH8A 2OHFA 4JLAA 1KQFA 2XXAA 4LDAA 3TSWA 2A59A 2VJNA 4X63A 5B1HA 1H2FA 2F67A 4W5HA 4AMGA 3ZCSA 5C2JB 4D1YA 1EXNA 4Q3EA 3VGJA 4D6PA 5L3SA 3ZS9A 2YQ5A 3IHKA 4NE7A 3VYRB 4JNKA 4FINA 2XMZA 4WD3A 3KQPA 3UMBA 2JLXA 2JIRA 2IH5A 3RTAA 2ZBQA 1TJNA 4KHPB 7MDHA 3VDMA 1KJWA 2X9NA 3AJAA 4DA8A 1O6ZA 1Q1GA 2EP5A 3BE8A 3PVSA 4PAGA 1I51A 1L0BA 3WRWA 3G5LA 4TRRA 5A7GA 4X00A 2FRDA 1RZVA 3L5KA 5E4JA 4AN4A 3DW1X 3TK1A 3FDIA 5SZHB 1D1QA 1H2EA 1MEJA 4MOWA 5BT9A 4HFRA 4CV1A 2SBTA 1QVAA 1VRVA 3JPYA 1LWNA 3C7CB 3NR2A 3OTIA 3WLTA 2Z2ZA 1TT7A 4G36A 3VR6D 2JGFA 3B82A 3HKDB 3NPMA 1NQOA 1CIJA 2YZNA 2BEJA 3CX8A 3ZDXB 5CB4F 4IWNA 3V8PA 4YRKA 5IZCA 1RYMA 3A6FA 3Q5DA 1K7XB 1CEYA 2VDWB 4DLNA 1J7KA 2PJZA 3WP1B 4I5IA 3GIDA 3FPGA 3O1JC 1QLHA 1KYYA 1WSWA 4LFAB 4AJ4A 1RNLA 2WM2A 4PZ0A 4RSRA 4NTZA 1VDMA 3VYUB 5E6SA 1DKNA 1T5SA 5JJIA 3OBIA 2BBOA 5KWEA 3LQ2A 1PUXA 2WHYA 1OX6A 4WDRA 1WP9A 1UFVA 2IIPA 4X8HA 1EK1A 1A9QA 1TGVA 3KLMX 2GDZA 2GMWA 2VR1A 3STVA 1ESCA 2QMEA 5LMUB 4B6FA 3H18A 3VR5A 1TJ3A 2XECA 3IEXA 4J9UE 3GR6A 2QVGA 2VF2A 1TECE 2V9CA 3QLVC 4BWYA 2DRIA 5CXQA 3CS3A 1TT5A 1U3FA 1LC0A 1W29A 4GC5A 5DE3A 3V6MA 3S28A 3ZWMA 1J2TA 3TMKA 1ADCA 3OE7D 4D9KA 2IPMA 3RRFA 4YAIA 3ESYA 4R1TA 4FLFA 3SDBA 2VJLA 2ZUCA 2O8FB 2WE8A 3ONWA 4ZT6A 5AW1A 4ZZIA 1EGAA 2IYFA 3EVTA 2A0KA 4NX2A 5EIBD 3LXMA 1VCOA 1RC0A 1FC0A 1GVHA 1VPDA 2A5FA 3BQ9A 4FNMA 3ZGXA 4DMUB 2QLNA 2D7JA 3QBEA 4CM3A 4LCBA 2R8BA 3G2PA 5CDFA 4FMPA 4CM5A 1N6LA 1D2GA 4KO2S 2ZJYA 4G23A 5CX1B 1QIMA 2QRLA 3G0GA 2CJYA 2GYVA 1IHXA 1L7NA 1FE8A 4JVNA 5DULA 1MB9A 3E3AA 5TRTA 3H5AA 3HVJA 4JHLA 2BFMA 3R0ZA 2OFWA 3AI1A 3H5NA 2PGIA 5C34B 4FKMA 5EXSA 4QM7A 1A8HA 4NCHA 1PNOA 1P4JA 2NPFA 2G80A 3D8RA 1NJ2A 1TW3A 3KOZA 4I0WB 2J3HA 2I4OA 4KRXA 3O2NA 2D2IA 3TAXA 3KJEA 1XZAA 1F51E 1OBOA 4DJDC 2HIGA 3P9PA 3VPBA 3KPWA 3RVJA 3ZV6A 2H63A 3RQSA 5KNBH 1GUDA 2O5VA 2P62A 1TLTA 1FOEB 1U6IA 4TMZA 2GEFA 4R68A 2QRUA 4B2LA 2FX5A 4F6RB 1U5BA 1WU7A 3OQNA 4DR4B 4M8LA 1ISRA 1V11A 1YGPA 4PX2A 3JR7A 1RLUA 1WBDA 5KSPA 1E59A 1RFLA 5JSZA 2PUBA 3DVAA 4IIGA 5TLSA 2RK6A 4X9XA 3CLTD 4MIOA 2HA7A 2NT3A 3BWXA 4HEHA 1Q95A 3GUCA 1W30A 3IJEB 4MPPA 5EWLB 4E07A 2WU0A 4LWQA 4RLFA 3IXQA 1UQTA 1N8SA 1A4UA 3TRFA 5J63A 3L18A 2R84A 4BNDA 2CNNA 4Q0MA 4R7GA 3HU1A 4MUGA 5GONF 4Z4CA 1B3RA 5I51A 4AZ3B 2P4QA 1KJ8A 2VYND 4OX9Y 3I23A 1IN6A 1MQ9A 3VM6A 2AQIA 3ZIDA 2C3OA 2GZRA 5JPCA 2BJWA 4DV7B 4YRSA 1W2GA 2I7VA 3M70A 5EWMA 5C4GB 5FH9A 4ARVA 4OHMA 2NUPB 5DX0A 2KQUA 1ZDMA 2VPQA 4BU1A 4KL8S 1QAMA 2IHBA 3JYNA 4RMJA 3LXUX 5F2EA 4Y30A 4C5AA 1OVGA 3OSZA 3NTLA 1MHTA 3O0TA 3O1IC 2FMFA 1L3BA 2HJ9A 3DEZA 1QIJA 2UYQA 3REOA 1QFXA 1QK4A 1C5KA 3QPDA 2QP9X 5FO0A 1L5KA 4E5VA 1UK9A 5C7OO 3L7MA 3JQCA 4EKGA 2XB4A 3H05A 1Q50A 3DL7A 4GNRA 2I67A 1NOKA 1Z5OA 4QFDA 3AF0A 1GZSA 5AIBA 1XTKA 3C45A 1KMHB 2VSYA 1Z28A 1PDOA 3VOTA 2O3SA 4UBIA 1LBSA 1JHVA 1X87A 1K68A 5CFNA 4DFDA 1ECFA 1ZHHA 1D0VA 1MLDA 5KYXB 3HWWA 5AJUA 1VCMA 1CQWA 3GX1A 3OLWA 4OU4A 2B8NA 3KKLA 3L7YA 1JDUA 4UTPA 1A2KC 4GXQA 3QWBA 3RSSA 2ZRAA 3H86A 2P3QA 1NSFA 3LC2O 2ATVA 2F4NA 1Y5MA 1YQEA 4W9NA 5A05A 3N1UA 4DSNA 1RAAA 3VJKA 4EEZA 2CE7A 3ULKA 4AS2A 4D97A 1SQ5A 4DUZB 3WNCA 1E92A 4Y9RA 4YACA 4DTIA 1JBQA 3F6EX 3P0IA 5DTEA 1ZOSA 1K89A 4FR5A 2NVOA 2W0SA 2WOJA 3T3IA 4B34A 4EYOA 3VBEA 3LE8A 1KC1A 1M8KA 1NBHA 2CF6A 1SOUA 4RVGA 2CLSA 2IYRA 1NVAA 2YH2A 1ZK2A 4TV8A 4WXRA 1P18A 5K1ZA 3BFJA 3K35A 4JLNA 4BUZA 4CTJA 4MPJA 1A9XA 1KI6A 3INNA 4H7KA 4KR2A 1COWA 3FA2A 3H04A 3MGCA 5AM1A 2HRRA 5AW5A 2QVCA 4ZGGA 3AOGA 5TQVA 3L4KA 3NGXA 2IZ5A 1C3OA 1IULA 5E6RB 1JHAA 2DYKA 3I6ZA 1M7BA 4IM7A 1F38A 4URUR 4WZBB 1Q7CA 4Q4AA 1Z2NX 2WJYA 4ENQA 1RC1A 4P86A 2RH5A 3CT6A 3EXHC 4O3FA 2W8ZA 2EZUA 5EXXA 5CXSA 5NLLA 3MT0A 4FZVA 4DN6A 3QUAA 3EYAA 1E6UA 3AHCA 2V1UA 4ZZ2A 1QX4A 2B25A 3HV0A 3DAGA 4E46A 2FZWA 1JAYA 5CVUA 5JXGA 5LKRA 1Z13A 1QFMA 1YWGO 2AE2A 4XGRA 2HSZA 4DLXA 1UT5A 3CZRA 3KOWA 1TA9A 3BTOA 2R6HA 3OWXA 3EVFA 1OWMA 1WTCA 4LEIA 3RVOA 2P5SA 4XGIA 4CQLB 1U2PA 4EY3A 2RMKA 3ZCTA 2ZJ7A 3LPLA 1FRQA 2YJ5A 4UCXA 4UUOA 3WGUA 3P0EA 5IDXA 2GA8A 4WNAA 3DFIA 3S2YA 4QYTA 1TO1E 3OZTA 2GJ8A 4XM0A 2CXUA 4F3YA 1Z33A 2JFGA 1PBTA 1XQXA 3QU5A 4QVKA 4MW4A 1NWCA 2XVYA 2YWHA 3CO0S 3HQ4O 1DTSA 3MEQA 4ZMRA 3EMDA 2E37A 4XWYA 4KH1A 2PN1A 3LY8A 4OUDA 1PZGA 1RRGA 2DUUA 2OFPA 3RBXA 3L4SO 4L6IA 1TQHA 1UPTA 4NJMA 5K8JB 1Z8DA 2I65A 3K94A 4EL5A 1H05A 1JR3E 2GYUA 4I1OA 3VOSA 5HJ7A 5K0CA 5KNDD 2P3LA 2ZUDA 3O84A 2OZEA 2PMWB 2EWVA 1X7ZB 3I52A 3HXTA 1IUKA 3O4HA 1HNNA 1PAUA 4CXMA 2BRUA 2OCLA 4O1IA 2V6JA 4K26A 1HTWA 1BX1A 2ZS9A 3Q2OA 5TGZA 2HO5A 3GZJA 4MMXB 1GARA 3NBXX 3NFYA 4QLAA 4TQAA 2V4ZA 5LQKA 2WDPA 1SCUB 4NR0A 5T4HA 3BMOB 3OCUA 1HG1A 4M8NE 2GRAA 5C31A 4OG2A 4LXTA 4CMBA 2FWNA 1PZFA 1A72A 1N2JA 4S24A 2JFVA 2WTUA 2B6NA 4UE6A 1R6UA 2H2FA 4QIHA 4YO7A 3TXAA 3ZNPA 5A02A 2JF0A 1I4LD 3LIPA 4MLCA 4OB7A 4OREX 2JK1A 4FNOA 5K0JA 1AKQA 1CR4A 1GPUA 1I4WA 3HPQA 3VZRA 3T95A 7AT1A 3QPUA 3KV3O 2IZ7A 4L74A 1YR8A 3B1WA 3NRBA 1W46A 4KQMA 4B4WA 1QANA 3T1VA 4BE4A 1Z82A 4IXDA 1DINA 1UM9A 3HN2A 3EGDB 4R01A 5AW0A 4W6ZA 1UKAA 1PJ2A 4A27A 2I22A 1EE2A 3NQ41 2QX4A 1WZUA 1XZKA 2QM3A 3OQ1A 3PNPA 2NO6A 4J6EA 4XYMA 2JG3A 2UUBB 3TOXA 3CF4G 1NMQA 5BSWA 3LRPA 3ZJYA 2XB2A 2W6IA 1XYVA 1X3LA 2R751 3PP8A 3PKIA 1QKIA 3OF2A 4CLRB 4RMHA 1IZYA 3CGWA 1H0SA 3U4MA 1KJZA 2IPXA 5JEDA 4X62B 2J87A 2CLCX 3UN1A 5KVCA 2C2ZA 1IHUA 1MH1A 1GSIA 2C5LA 3NWBA 5FWXB 5HHTA 4L2IB 2Y6UA 3P0RA 4D9JA 2CV0A 1CQJA 2XQFA 3FB4A 4A8JC 4CL8A 2OCKA 3DGFC 3PKZA 4TTVA 2P11A 1T9GR 4K6HA 4YEDA 4BCBA 3QBDA 1SUPA 4N6NA 3CURA 4P3PA 2OE2A 2GEUA 2QAGC 3BJZA 2LV8A 1B16A 3L8HA 3BWCA 1X0VA 2E7ZA 4ZMBA 1II8B 2HU8A 5A9TA 3KQLA 4I5EA 4PVDA 4UHCA 4R05A 4G1MB 4JUBA 1MX1A 3R7LA 1UPXA 4NZYA 1HK7A 4LI3X 1X1BA 4CKWA 4G5RA 2BSXA 2J9FB 4BO6A 4RK1A 2ZDQA 2HEGA 5HS4A 2JIMA 4G4SO 4ZI7A 2I1LA 3CEMA 2ZR8A 5TF0A 1GPYA 4I9HA 2V59A 3GBPA 1L5NA 5AUNB 2E18A 2FZLA 3OLQA 2CNLA 4HLNA 3GA5A 5E9AA 1ODJA 2QUJA 4BLQA 5F23A 4YT2A 1SUBA 1FTYA 3L8YA 1UKEA 3MAAC 2HUPA 3TTYA 4D41A 3O38A 4DZTA 5I6DA 1KO5A 2PBLA 6LDHA 1AKRA 1H93A 1SVOA 3DD1A 3M6MD 4KQKA 4X20B 3ZGYA 5JZOA 5J5CA 2J31A 4HDMA 1XZFA 1I7NA 3WJ2A 1NRJB 3FN4A 3KLBA 4KMMA 5F77A 3CT4A 1QB7A 2ADFA 1DAOA 4Z4GA 1AH2A 5TPZA 1F5NA 5DTJA 2ACEA 2VTKA 1DJQA 4Y2JA 4EUKA 3T1OA 5ARCA 3O7WA 4WKCA 4LYEA 4OJTA 5BOSA 1GZDA 3A1FA 3NJ8A 4J2TA 1YRAA 3A36A 1SHJA 3M4JA 4I50B 4LQCA 3S2IA 3U16A 1DBVO 2RIRA 4MS4A 5D6NA 2HQ1A 1YVEI 1J24A 4IH4A 4UU0A 3EODA 4UDOA 1OGIA 5LD2B 3BX1A 1NIJA 1MB4A 2BEKA 4JI0B 1GT6A 3PC3A 3QXGA 1NBMD 3DMGA 3LQYA 3H5IA 5AK0A 3SZOA 3BQMB 4DG8A 1GFWA 5KSWB 4B71A 1C2YA 3HB1A 2BONA 3L1UA 4F3CA 4H4CA 1E6EA 4NP6A 1E66A 4TUYA 3JZDA 5DXFA 1JPNA 3C3AA 2Q1XA 3CBQA 3EGVA 4JVSB 4BLVA 1N2SA 3U3JA 3UHAA 1GZHB 1XQYA 2X7JA 4MRAA 2W0MA 2IVZA 2CKMA 2PWAA 2WF9A 2G4LA 1ZRNA 1O08A 2IHVA 3G59A 3JQFC 4HLQB 4YV2A 1J5EB 2D5LA 1O5IA 1OIWA 4AO7A 1NVVR 4J4BA 3LPCA 4DOMA 2FDCA 3G8YA 3F7TA 2F3UA 4RKWA 5FOXA 3MIZA 4B2IA 4K5QA 1YSCA 4OBXA 3MXOA 1TEVA 4NYMR 3RJTA 1DO8A 4PG4A 1Y7LA 4IUDS 2GXSA 1UMBA 4XLZA 2DLNA 3RNLA 3LYUA 4KNYA 3MD0A 3U7GA 3PFFA 4Y0NA 1NG1A 1W1UA 1Y9ZA 1ZUIA 3FAKA 1W36C 3FOWA 4LXIA 1E0JA 1P1IA 2ZIXB 4QBFA 5F5XA 4D0GA 3KB1A 5BNZA 5C3MA 3IP5A 3LV8A 4I2VA 1U2GA 4EF6A 5JSZB 4H7EA 1XD2A 4WK6A 3L1HA 3KJXA 3MW8A 5EP3A 5TXGA 2VSQA 3UMJA 4XR4A 4U7TB 3HE3A 4JEIA 1GYRA 5I4CA 1DRWA 5KDOA 3DQPA 2OD9A 4A8HA 3MCTA 1YB2A 1ZCJA 3L0CA 5H16A 3U4DA 3I9MA 4PYIA 1U0NA 1Q1AA 1MAVA 2X14A 2XUHA 3BVPA 3AQ4A 1WMEA 1N0WA 1TCUA 3OT1B 3PUKA 3V7YA 3L1KA 1OU0A 2H2IA 2H29A 3MUNA 1NM5A 4J3JA 4M9ZA 3HXPA 3W5JA 2AE1A 1BE6A 2QG9A 3QWFA 2M6KA 1EYZA 1AKEA 3L7JA 4MV8A 3S8YA 2IHJA 4BO8A 1LTKA 5DB4A 1WVIA 2PLRA 3LNTA 4MVJM 1EAYA 4OLHA 1VI2A 2NVUB 1ZPDA 4NYJR 3KEGA 2F17A 1MQSA 1EVQA 1VFNA 3NDRA 1Z35A 4IVQA 1WVGA 1MDBA 5CCEA 3THYA 4OI4A 2Q1UA 1US8A 1F8YA 4J94A 1JVSA 2FA9A 1SUSA 1OWOA 4A9AA 1JT9A 4WA7A 1KEPA 2HU2A 4EHKA 3GYBA 1F06A 1S0UA 3OPYB 4C1NA 2D4HA 2JAOA 3E05A 1F2TB 4MUHA 5CX1A 2XUOA 2XE6A 3DPUA 3X2SA 2GAJA 3OQHA 2ZRMA 3C5WP 2Q4EA 3HZRA 1AUOA 1GNLA 4M0KA 3LK6A 4GECA 4YP9A 3EAFA 2OBFA 4Q1VA 1ZEJA 3CLKA 2WJ6A 3L04A 4E88A 4TZTA 1H9AA 2W43A 1NYQA 4YA6A 1L1FA 3UA3A 4WBNB 1G7SA 1JQ5A 1YL5A 4XCQA 3BGVA 2F6RA 4Z9FA 2CY0A 2KMLA 4H1UA 2XHEA 4YC7A 5MHTA 2GFIA 4D9CA 1JQ3A 1RWWA 4UUAA 4DLTA 3I9V6 4P36A 3CO5A 1RZRD 4WCVA 4MQEB 1MNQA 4W82A 3WMXA 4QXRA 1MP0A 4UMFA 3C5EA 2ZROA 3S2ZA 3UJ3X 4QWMA 4JWKA 3UOGA 1DEXA 5B55A 1PVOA 4E51A 5CD9A 2D13A 1P45A 1V0JA 1W0KA 3C1TA 2WIGA 2COKA 4U7FA 5B1YA 3I2KA 4MMZB 3UK6A 3OZDA 1SOWA 1YR2A 3Q1KA 1UWVA 2HMWA 2X8JA 4R1NA 2P65A 2DQYA 5AXDA 4BVBA 4TWIA 2WU3A 1Y9EA 5K4AA 4ZXFA 4BX2A 1NFRA 3EXEA 4Y7DA 3I6MA 1XKTA 2OSBA 1H8EA 3K9LA 4KE6A 4N8EA 4YRLA 4QDKA 4OAQA 1WQ4A 2R5WA 3H3FA 4QDXA 1CJKC 2CT8A 1UBMS 1UL1X 4OB6A 3QOWA 4LNHA 4F5WA 1SBQA 3H9CA 2NZVG 4UVGA 1IQ0A 2ZTSA 3DTTA 3HWRA 3KXKA 3SYMA 5IPFA 1E1RA 1QMPA 4UC0A 4BNIA 3DB1A 1G8PA 1QDLB 4W9MC 2I91A 4NOLA 2GK4A 3MB8A 3SOZA 3M5CA 3NYRA 1JFFA 3MT9A 4KVZA 3SZ3A 2GRJA 3E9QA 4LMPA 1UZUA 2HA0A 1CUBA 1ZD9A 4YRPA 4H1VA 4A2PA 4YDHB 1JX6A 4HDKA 3KP1A 3WKCA 3SLKA 2BT4A 2LPMA 3RODA 1KI3A 3T5BA 9MHTA 5JZVA 3DEFA 1GITA 1EKXA 3TF5A 4O4LF 1GAXA 1OI4A 1WUTA 1TVKB 4KVAA 3FHLA 3WRXA 4PC1A 2ZGVA 3O91A 4LVCA 3WO1A 4ND6A 1DZIA 3OUUA 1NJGA 1MRNA 2YJGA 3BMCB 1FMTA 3PUVA 5YASA 3C4VA 2AVDA 1GL9B 2BE7A 1KKUA 4H18A 4XZ3A 4EPRA 4CU5A 1CP2A 2AEJA 1HDEA 1F2VA 2W5UA 1KFKB 1VL8A 3CM0A 3KTOA 4HDKB 3SYTA 4EVSA 1FYFA 2MINA 1UP4A 4WY2A 2QRQA 3AG5A 4NNJA 3W6UA 4UE2A 2X13A 2ZT7A 1ULBA 5DXJA 1NMXA 2IBMA 4B73A 4BV9A 4KPGA 5D3KA 2OBMA 4Z54A 2XVXA 3L8EA 1QWOA 4OHWA 2MJLA 3DXXA 2CV2A 4XVHA 4DXDA 4JYPA 3FUTA 4GXNA 4IUCS 3ZIAD 4G89A 3K2BA 1EU1A 2AV6A 2JJYA 3NIBA 5F1KA 1YJCA 1X7DA 2QEQA 3BGSA 1E32A 4UM7A 3EXEB 5FCDA 3ZEAA 3PWZA 1MIOA 5TJ9A 2EERA 2QRGA 3RROA 1U0HC 4M60A 3HCWA 1YTLA 3DEHA 2SKCA 4HDNB 4G1CA 5SY9A 4QA9A 1W2HA 3DZKA 5K3BA 1PFVA 1YQDA 1D2NA 3L06A 4L72A 2X9QA 3ZHCA 3UWOA 4D2IA 3AM3A 2I3AA 3ESQA 1J8VA 3E84A 2O8CA 1SA0B 2Q2QA 1T6XA 2J9FA 4W1SA 4MH0R 4DIMA 4Z7QB 3A2KA 4WJKB 1N2IA 1TC1A 1CRQA 5I7AA 3QFTA 1QF9A 1DDGA 3GN1A 1Y81A 2NSLA 2X6TA 1RYHA 4LX0A 5ALIA 1DNPA 1NUUA 2BD0A 4IGIA 1S6YA 4UHHA 1CR0A 4LXUA 4CTMA 5JNTA 2QTWB 1W5BA 3LBIA 3M6FA 1XMJA 3OE7A 3S8MA 2GF2A 5D5PA 1E5LA 1YMQA 3AZPA 3HFSA 3IAHA 3N2GB 3U4GA 5C8YB 1B8NA 1WETA 1G55A 1QO9A 2PRZA 3MJEA 5KVQA 1YIOA 1E4OA 4MNTA 4DREA 5J9FA 1YFLA 3SEQA 3BMQB 3IKMB 1RYNA 1XSEA 1YJBA 2NYUA 2EZTA 4F1KA 5E3IA 4YS6A 2CFRA 1NY6A 1MORA 1X77A 1KTVA 2P78A 2IYAA 1ZJ6A 2QJOA 4TOIA 1N1GA 1GO2A 3S2UA 4AJOA 4ZJUA 3MHPA 3IBYA 2Y1LA 3IAXA 1DKUA 3G2QA 3U13A 3ZWOA 4Y1EA 5HTOA 3EZNA 2VQDA 1S3SA 5A4IS 4HLUC 5CVCA 1GQQA 3OIFA 5DSTA 1MA3A 5HQJA 2FKAA 4OQEA 3FKJA 4LYHA 4C5BA 2WKWA 4BNUA 4MVJP 2C7BA 3OX3A 3OJOA 2QRJA 1N6OA 1OIVA 1B6TA 1XRRA 3ERCA 1QQ5A 4F91B 3A3KA 1Z07A 3T0IA 3BF7A 2ZT6A 3M9WA 1EFHA 5IJ0A 2F9MA 4DKXA 3TOVA 3Q7QA 3S7ZA 4V02A 4FCVA 4ZYUA 1W4BA 2BJVA 2GLTA 5IDYA 2AA3A 1NP3A 2C3UA 2H0QA 3RPEA 1NNI1 2GVDC 3KT0A 1EVJA 1YL7A 4UEOA 1VHTA 5EQDA 3UGKA 4RV4A 3SX4A 4HK4A 4Z1OA 4QQNA 3RAGA 4CG3A 5KNCA 1P2TA 2MDTA 1M2GA 1PCXA 2XRMA 3IKJA 4K46A 2B4AA 3WB2A 1Y1SA 3KLNA 4WHMA 5ALYA 4D3YA 3ZVRA 3LZDA 1CHNA 2GHIA 1HFKA 1P7PA 4EY4A 2XE4A 4LVOA 5IFLA 1GADO 3N58A 2ZSBA 1PYDA 3GAZA 1KFJB 2FDXA 2YYYA 1UK6A 1EP1B 3PC8A 1PK7A 4N9QA 5DT2A 2GM5A 3SHOA 4EUNA 1XF1A 3RS0A 3Q8MA 3V1TC 3HXOA 1KH3A 2FVXA 2ZVDA 2NUAB 3CXUA 1FNBA 4FHFA 1U5AA 1BCSA 5GPBA 1T5LA 3TZQA 1U8EA 2J7PD 2QYTA 3B1FA 3GRVA 3COPA 4UTVA 4GKVA 1FRVA 1BJRE 5F5NA 3AI7A 5IT9A 1IN5A 1RD4A 1KI1A 4ZRMA 1WXQA 2DPYA 5HIIA 4LWOA 3BZUA 2FW7A 4F4UA 3QW2A 1PS0A 1YCHA 2AFIA 2QQGA 2R2GA 4IH9A 3NBZC 1T2DA 1L4NA 3FSGA 5IAGA 2INGX 1J20A 3OX2A 4MJ7A 4UQPA 2RHRA 1X1SA 1M2JA 4HL6A 1C80A 1WKBA 5EC8A 3LWZA 2ODNA 1A4RA 4ZCTA 3SR0A 2XDWA 3QVVA 5C80A 1Q0QA 1U7TA 4A91A 1E2GA 1ZGCA 3JARB 4WINA 3EA0A 4H7PA 3P32A 4DYDA 2EKZA 3D3JA 3INRA 4MO9A 3GJ6A 3ZD7A 1YS2X 3AFMA 1SPXA 4RGBA 1QX3A 1QTNA 3FKSA 4US2R 4MHOA 1WZ2A 5EIXA 1Y63A 4RXUA 2XDYA 5FIUA 4D0SA 2QW1A 1Z0KA 1MX3A 3IPXA 3V3TA 4P54A 1YQXA 2CBZA 3A1CA 4G0VA 1CUFA 2CLIB 2NZJA 4NEGA 2IUTA 4J4HA 4XQCA 5I8WA 3CKLA 2VJDA 2ZTMA 2X5KO 4Y1FA 5ESRA 4HNQA 4ZICA 4BL5A 5EE5B 5E2BA 3GW8A 1SB9A 5U9CA 3PFNA 4ZVPA 4WOKA 2QRZA 4KQIA 4CEIA 4US1R 3K9GA 3KFVA 3QNWA 1SQSA 1M73E 1VMDA 4UU7A 4JJ7A 3EASA 4GU5A 4A10A 1VI6A 3B3FA 4L7QA 1ESZA 2AOTA 2COEA 3DE4X 1CUDA 3OCWA 4M1OA 4Q21A 4FMCB 3IR5A 3TLKA 4XX0A 2X3YA 2B1RA 4IIHA 3IDQA 2RGGA 1A2QA 4LHZA 4AIIA 3SJCA 4AP5A 2VJCA 4LDZA 4QOIA 3A27A 1CQJB 1LDYA 2IS2A 2VDUE 4LK2A 4AWXA 2HT1A 1TQ4A 2VHVA 2GF9A 2GDJA 3QW4B 4CMEC 3K6RA 4EY7A 4JQYA 3CYFA 4B43A 1ES9A 2HHAA 2VNHA 4TKZA 3ZYCA 2OZLB 4GL4A 1SPBS 4EZIA 3R6LA 2BZSA 1HX7A 2ZTUA 1SC6A 2DAPA 4K9QA 3GRUA 3CCBA 4DB4A 2O2JA 4LOIA 5HKLA 3SOPA 4B8WA 3G89A 2FEXA 1ZOLA 4F12A 4L3WA 3T5DA 3D59A 2KI5A 1ISHA 2JH3A 4FDVA 4AX8A 2X7XA 1DAMA 5FOTA 5AW9A 4ZK2A 1G5RA 1ZOPA 2IIVA 3ZJ4A 1DGQA 2G0AA 3K8YA 4OHUA 1DXYA 1G8FA 2ABWA 4TVBA 2V7EA 4J1TC 2Q3HA 1X8LA 3BWBA 5HMLA 4KLRA 4V1CB 1S3GA 3RVBA 2VI5A 1WXDA 1ZSYA 1RWXA 4B6SA 5I8PA 3GLIA 1IONA 2BI4A 3KVVA 3C3MA 1H1TA 5KOJA 3VOBA 1AURA 3SR4A 1JXAA 2H00A 4MB0A 5EWLA 3QY0A 4Q9JA 2BFAA 5DI3A 3BRSA 5JH7F 4EZEA 2V96A 4M55A 1SCUA 2RCNA 3WYAA 3R7AA 2P40A 1RXVA 3ZDBA 2WKRA 5EZ6B 4C0BA 3FBWA 3WNZA 4Y6LA 2O2XA 2ZIGA 5K0GA 3N2YA 3RIGA 4B40A 5MGBA 2AEEA 4CFYA 4L4ZA 4AWBA 2Q9UA 5A03A 1XB2A 4TL9A 4NYIQ 1LH0A 3E8MA 4KOEC 1UBFA 3T41A 4CF3A 4UZFA 1MZVA 3AHFA 4OTZA 1IBMB 4LBVA 3ZUGA 1JZQA 1D1SA 1NPTO 2J7KA 1YZKA 3MMPA 1JL3A 2YHBA 3KB6A 4Z8YA 3A9TA 1G6HA 2O7RA 5AVQA 3NYWA 2EJBA 1KE1A 3O8LA 1OI7A 5DCLA 1A2BA 4L8YA 1N7JA 3EW7A 1ZW6A 2Q50A 2IEBA 1QR2A 2R7MA 1SZDA 1SHKA 3DP9A 4Q1CA 3WAJA 2NTVA 3GAFA 4FCWA 4MDHA 1VLHA 4E6EA 4F2GA 5AW6A 1KL7A 1FZQA 1P2SA 2FPSA 3FJYA 4OLFA 3EQ8A 3QQ5A 5ALQA 2YXNA 4YASA 4EYGA 4YCLA 3AI2A 1JBKA 3HUUA 3V2UA 4CPDA 3IL2A 3A9SA 3VVCA 5KNCD 1AM4D 1QHYA 5H70A 1PS9A 4UFNA 4L22A 2HMVA 3HUTA 4NJEA 4S12A 4Y2PA 3SQNA 2C7GA 2BMJA 4EHDA 4RUKA 4QU0A 5KIAA 2PRKA 1A7AA 1BRTA 3MTBA 3A0UA 4GX1A 2IFTA 4PY2A 1L1RA 4WPGA 2UUOA 1OFGA 2H59A 3MWKA 1JU9A 4DDUA 3A8TA 4R9NA 5AVRA 4V39A 1BKSB 1YBVA 2PWBA 4KXNA 4TXMA 4UHEA 4E2YA 2YWEA 4HAIA 3NKFA 4K9KA 5K01A 3VV2A 1AC5A 2IY9A 2PAFA 4BGEA 3ND5A 1OLSA 1OAOC 2Q5CA 2C9MA 1V7QA 1AGYA 2YV4A 4D0RA 4MW5A 5C4MA 1UJ5A 3PITA 2GBPA 1RAFA 2VAMA 3IA2A 3KYCA 1AXRA 3BHMA 3E9MA 5KQSA 4KK4A 3ER9A 3RAEC 2BOVA 2GERA 1INLA 3H1FA 3MLAA 4MQUA 3WGLA 1Q7BA 2FPUA 1ZQ9A 2GD6A 1PG2A 1ZU5A 3S3TA 3KKNA 4HNAB 4G97A 4GR5A 1CZNA 4A0RA 4CCYB 2CLHB 3L0OA 4QZVA 4KN9S 4YT4A 1MIOB 2QXTA 2EC5A 3OG9A 3OQIB 3G8DA 4KU4A 4YALA 2VIIA 4YMSA 4YXWA 3E5HA 4EJSB 2VH5R 5H5JA 4B5KA 1GKIA 3BFXA 3WGHA 3M6XA 4ARUA 2CLEB 2ATXA 1KTIA 1CUEA 4O33A 1UKVY 4MKXA 2MSWA 1AUVA 4L15A 1I30A 5FBKA 2WLSA 1ZWKA 5F2KA 5KNDA 4AUNA 5J2TB 2VYNA 1YZTA 4RVFA 4F5DA 3RBVA 5AESA 3H8JA 1NR1A 4EHIA 1NT2A 2BGGA 1XZDA 3HKDA 2IT1A 4RF5A 4DA7A 3KYIB 1GUZA 1U0GA 4DCMA 2CNWA 2OGZA 1P91A 3N28A 3ZQ6A 1DQZA 4LISA 2F48A 5HILA 3GCDA 2R1VB 4YCMA 3FFXA 1PUJA 4ACAA 5JCZA 1TKAA 2DTXA 3QPVA 2RKWA 3PJDA 2OYCA 3S55A 3UA4A 3V4LA 3WTCA 3W5HA 1GTRA 3BMCA 5GZ6A 4XD7A 3ICVA 4HBZA 1FFEA 2WT8A 4TTRA 4KSBA 1NW9B 3NVMB 5AK4A 2EJVA 4RQUA 3E23A 3FRHA 2ZQ5A 4AMUA 3NHFA 1KY2A 2B1IA 3HVRA 3PA8A 4EHBA 4HGRA 4EB8A 2X58A 5CYFA 1O94C 5T4FA 1SUIA 3Q9UA 1O95A 3AB8A 3GLFA 1H69A 2FK8A 1BWRA 1O96A 4R9SA 3EZFA 2RGYA 5DYGA 3RRNA 3WL4A 1VBNA 2AG0A 3WAKA 3RC8A 3N7TA 3KU1A 4EA7A 2CXQA 3WWEA 2PNFA 3CIFA 3EWSA 4IH1A 4QQKA 2WW8A 5JRJA 3HA3A 3IPLA 5FYDA 1N77A 2XUZA 4TPKA 3LL7A 1P1HA 3RFXA 4B4OA 2IHTA 5ECWA 1FXWF 1LGYA 3TQHA 4D3ZA 5KHOC 1WP4A 1YB6A 2P69A 1XFDA 1ZU4A 2V6BA 2X41A 1OBFO 1RSZA 4PV7A 2CCKA 5HJEA 3G0CA 2Y92A 2W6PA 1JIQA 1P39A 2Q3DA 5FL7D 4ANFA 3CSDA 3DTYA 4KH0A 2YXEA 3E3LA 4XD7D 1KAEA 1HT2E 2RGBA 4ZAYA 3F6YA 1Y4ZA 5TV2A 1PO7A 2EKLA 2PE5A 3DO5A 5K6TA 1J5XA 2DWOA 3EDYA 4G0PA 2ZSHA 5ISMA 1SHLA 3VBCA 4JYAB 4CT5A 1NI4B 1D5CA 4HWGA 2PU5A 5CFOA 4HDRB 2D74A 3FX2A 4U2CA 2QR2A 4KWTA 1EIZA 2HF9A 1TZKA 3G9UA 4KFRA 5E95A 2VNKA 3F2IA 5TT1A 4CL2A 1VTKA 2IF2A 4GWGA 4AZVA 1Z0SA 3LWBA 3T54A 3D0KA 2CJPA 3EEFA 3DAFA 4FT2A 4G67A 1I1NA 2CJWB 2D0IA 3PIRA 4WBNF 4WEOA 3EEOA 2QIOA 4TMKA 2OQ2A 2X8AA 2FEPA 3OP4A 3PL1A 1AUXA 4WAUA 4YMUA 3MXTA 2BGRA 3TE6A 4ERNA 5LQUA 5CVTA 3A6LA 1K5HA 3ZTTA 2EF1A 3FBGA 2VCHA 2GJ9A 1U8XX 1IZ0A 1EZZA 4HN9A 2B30A 3F5MA 4EJ6A 4WCDA 4YQFA 1ZY2A 4JU8A 5C9ZA 3G2OA 3KM0A 3STHA 2V6FA 2I1QA 2ZJ8A 1GP2A 1Y8ZA 4FNGA 3DKRA 4M0PA 2ANCA 4EHAA 1B0ZA 4M76B 3V97A 3WWPA 4DJFC 1ZNQO 1CY7A 4HH0A 4UUPA 3C7DB 4IDBA 1QYIA 4DEVA 3DM9B 4Z4IA 2Y1WA 4HAOA 3MILA 1IPEA 2QTLA 5B1EA 2C7RA 3RARA 4LRQA 3RS7A 2XBLA 4DRXA 4PPFA 4U4AA 2JI4A 2QUHA 3WDKA 3FW1A 5THQA 1F14A 1JPJA 2HCBA 3GQVA 3GGSA 1CUVA 1TZ2A 5T5QA 1MT0A 4XYGA 3Q1LA 1EWYA 4MQFA 3WDSA 1C9DB 1P9NA 2LBPA 1ORIA 1M34A 3Q11A 4KODA 4NYIR 3OPQA 3T5PA 1YS4A 2Y2VA 4N5NA 5JV5A 1RZRA 2XWQA 4KRYA 3UWKA 1GA6A 2QSUA 4H3HB 4R0NA 5JZ9A 3W5VA 1WPRA 1Y6FA 2R97A 3FYSA 3B36A 3LKDA 3BRWA 4K6KA 4D4JA 2QQFA 2Z3VA 1NHWA 1RXCA 4FQ8A 1GU0A 1DQYA 1AVTA 3K6JA 5K3SA 1CU1A 4BAUA 1XIVA 1O95C 1YNOA 2CHGA 1HRKA 4Q9DA 5AO9A 4WFQA 1SBNE 2JJ2A 2XYGA 5DHAA 2C98A 2WFLA 4XUEA 4RGVA 3GVCA 3OZAA 3ZWPA 1E7WA 4BEBA 1W6UA 4OYYA 3OIDA 3VSCA 1IRXA 1ECGA 3LVFO 1J0AA 3BMNB 2WV9A 4QUJA 4RLQA 8ABPA 2VDWA 3FMIA 1IN4A 3PRYA 1K6EA 4N3NA 1UMBB 2HDHA 2RGWA 3OIVA 1O6GA 3AY3A 4JJ8A 4UNSA 2J48A 5DYTA 4Z1MD 5LJIA 5HBGA 1BOOA 1KEZA 1LW7A 2VWHA 2K2QB 4OXYA 1U1DA 2DQ4A 4UARA 3RS5A 3VQTA 3R7WB 1N5KA 1RRPA 3V7UA 2L42A 4NBUA 2FP4A 5E4FA 4XWOA 1QHIA 2K7ZA 4KO3S 2VQ6A 3LSTA 5J2UA 1PLKA 1PYOA 3ZX4A 2Q3LA 3NVKI 4RV5A 1HG0A 1L5MA 1RWMA 5KYUA 1IMJA 1STOA 2IEZA 1PVVA 3PQ6A 5TQ0B 5JAZA 2YS7A 2FXIA 3F7MA 3KZCA 3MMXA 4I7EA 1NVXQ 5EZ5A 4TTIA 3O93A 1R0BA 2OESA 3OAAA 4AY2A 2NT4A 4IIDA 2W6ID 3HI4A 3ESDA 3V48A 5C37A 3IUJA 3H5LA 2X1MA 1H0RA 3PBKA 6ABPA 2QR5A 5GADl 1PT6A 2JJ8A 2PHZA 2ZYTX 1QS0A 2VK8A 3K09C 4P58A 1P7VA 3QLJA 4YAFA 4CM8B 5IF9A 5KHLB 3NFRA 1J2UA 2D1YA 2BJHA 3ZDYB 5FTWA 1XU4A 3T3GA 4I66A 1T8PA 2PD6A 4I50A 1U8YA 4OQZA 1MABB 2TMDA 5LQMA 1DV2A 1JSZA 2CZCA 2AR0A 3JVDA 3BJIC 4LGMA 2JDIA 3TRHA 1XMVA 1FVHA 3TDNA 4RYLA 3C3DA 2G0TA 1PFGA 5HXAA 2VDOB 3AR5A 4BN0A 2B4TO 1JEYA 4DUYB 2Y05A 4FDAA 2PCLA 1RCUA 1WCWA 2NWQA 3GEGA 3OFKA 4GUDA 5D3ZA 2GN1A 3B1XA 4LZWA 3O4IA 3RF6A 4BKOA 4E13A 2HJGA 4LF7B 1GDHA 4K0KB 1G3IA 2HL6A 5K0TA 3GMIA 4OV6B 2B37A 5UKDA 2VSXA 2GR9A 3DGEC 3ZJVA 5FUQA 3OZ7A 2YVQA 1ST3A 4LYDA 4IVRA 4L8LA 4RK7A 4YMIA 1NBMA 1PQYA 3MAJA 1SH7A 2WILA 3EIQA 3O9MA 2OXFA 4NCKA 2YTZA 1OLSB 2ZSUA 3RNOA 1G18A 3RFCA 4PIPA 5KOIA 1ZR4A 1PGNA 2JEYA 2VJMB 1R64A 2QTTA 1W25A 2NACA 1V1JA 3MOGA 4BC0A 4EO7A 4OYLA 5EHZA 1U3GA 2RH4A 4PNEA 3N87A 5FPPA 2HXSA 3E7WA 2GZMA 4B6GA 1JKJB 1OH5A 4YNBA 3PX7A 1G3MA 1G59A 5FPKA 1SKQA 3R9WA 1HFEL 4XFDA 1J9EA 4BVGA 1CZRA 3K5IA 3AERB 4PZAA 5CB4B 2D7CA 5LN1A 3L7CA 3ILYA 1UBGA 1VPVA 1GTL1 2C5BA 2WHEA 2W58A 2VCYA 2W6QA 3MQ4A 1LDMA 1ST2A 4XOIA 1E1LA 4M8SA 3NUZA 1Z6XA 4GIBA 4DEXA 2C7OA 1LKZA 1OYVA 2ID9A 2P6OA 3EVZA 3ROMA 3UPDA 3VR3D 1ZMTA 2YJZA 4AY5A 1G8HA 1P0IA 1WPXA 3AEYA 4DJEC 4ZYWA 1P3JA 1XZ8A 3GGCA 2DHRA 5LOVF 1E60A 3MJRA 3THSA 3OI7A 4P5PA 3WXBA 4LF6B 3C6ZA 1XOIA 3BOSA 2M2IA 3G0IA 3LFHA 4IKPA 2KPOA 1E99A 4XARA 1QDEA 1KOFA 4ZDIA 2F1RA 3LCJA 1E98A 2YWDA 3BEOA 3RVMA 2O8EA 1TIPA 1F8GA 2K4MA 4FMCF 2PUAA 2Q3BA 2MYPA 3HB9A 2XYPA 4O3MA 3IA7A 4FLEA 4RLSA 5CA1F 4OH1A 1ZO8A 4KAAA 4MLPA 2RIPA 3UB2A 4DCNA 5HOEA 4QT0A 4EJ2A 1NRIA 1U2RA 1DPGA 2DHCA 3CU5A 3DM5A 3ZQUA 4JGIA 5AKJA 3WLLA 2OHJA 3NAMA 3DZDA 3IEVA 1JMKC 4A36A 3OZVA 1RADA 1OHHA 3GT3A 4GC9A 4OL9A