1ITBB

Type-1 interleukin-1 receptor complexed with interleukin-1 beta
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
310
structure length
310
Chain Sequence
CKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (immunoglobulin/receptor)
molecule keywords INTERLEUKIN-1 BETA
total genus 49
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 1997-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13895 Ig_2 Immunoglobulin domain
B PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB01
2CLZA 1ZTXH 3OF6A 3BJ91 3RQ3A 2IH3B 1K3ZA 3LKRA 2AAVA 3EYFA 4OD3H 3G5ZB 4N0FA 3WN5A 3BQUB 4ODHL 2DJUA 4XPHL 2VABB 1K5NB 2A77L 4Z7UB 3QJHA 5IBTL 3WJLC 4OAWB 4J6RL 3FB8A 1N26A 2XNAA 5JW5A 1BIHA 2C3HA 1ZSDB 4Z9KB 2NXZC 4HLZG 2V7NB 4WU7A 2I5YH 2DS4A 1N0LA 3B2UD 2Q6WB 2IFFH 1MFAH 3RKDC 3TM6A 4Z78B 1KJ3H 1YNTA 4BFIB 5BRZD 5B38G 4GKNB 1J88A 1A1NA 4KTDH 4Z77A 3VFRA 5HHOE 1NL0H 5MENA 3O6KH 3LRSA 4LEOA 3BKYH 4HDIA 4ZNCD 1II4E 2GSGB 3ZL4L 3PIQA 2DYPD 2D7TH 4ONOA 4LP4A 4YUEH 4O9HH 4RWYH 4XAWH 3VWJD 1NCAL 3IDGB 5IG7A 4HIEA 2GTWB 4ZFOL 3L5XH 1YC8A 4HS8L 5BZWA 2O26U 4N5EC 3MCLL 3K1KC 4GG6B 5DMKA 4MJ5A 1JFQH 1S7UB 1J10A 1OM3L 5IW6B 2R2HA 3BKMH 3WN5C 1HSBA 4X5XB 1LDSA 4QEGA 4JVWA 2BXYA 3GBNH 4Y88A 2FLRT 4NDMA 1B88A 2CUIA 4KJPD 4NQEA 1YEDA 3UYRH 4G42A 5LJYH 2FR4A 5CBEB 4FNLL 5D7IF 2VH5H 5DJ8A 3M45A 2E27H 4XXDA 4Q6IB 2VXVH 2IANA 4GSDL 3EYQD 3LKNA 1HXYB 5E5RB 4WHYH 4OLVL 4XP5H 3RDTC 3LV3A 1CE6A 3D3VA 1K85A 3IF1B 4GH7B 3UYRL 1WGOA 1HDMA 2CLRA 2E6JA 1IKFL 1AD0B 1YJDH 4MVBD 3O4OC 4PYHA 5F71A 5E9DB 2VUYA 4JFDA 2QSCL 5EIQA 2QHLA 4CRPA 4LRNH 4FXGB 1FLRL 1NCBL 3VFUA 2CDGA 1OP5H 3PL6D 3QUZC 4TSAL 1T7ZA 1MIMH 4NQCA 1YECL 1TVHA 4U1LB 4JQIL 1QLFB 1YEIL 1GGBH 1SYSB 3P11L 2OJEA 4GAYA 2WANA 3QCTH 3RX8A 3STLB 4WJ5A 4V2CB 4UV4H 3VXRD 4LCIH 2ESVD 3KJ6L 1MRCH 1Q0XH 2EDYA 3OKMB 5IIEA 2ICWB 2EXWC 1XF2B 3FAXA 4HWEL 1HH6A 4NP4H 4MS8D 5I73C 2X9WA 1P4IL 1MAJA 3GSVB 5T1KD 3ROOA 4GRLB 5GS1A 3VXOB 4MAUH 3JVGA 3VXQB 5GGUA 4KPHH 2P8MB 3QQ4A 5ICXA 5TQ0L 1AO7B 3HE7B 5KN5B 4OZHA 1UWGH 5FDYA 4DN4L 1XT5A 2YS4A 3TJEL 1JUFB 5CJOH 4OZIB 5DJCB 3PE9A 3PWUA 2BY2A 5HGHA 1ORSB 5I1EH 5EFIB 3REWA 2EE6A 3KPRD 2XT1B 3OHXA 1F00I 2R1WA 1S9WA 3IFOB 3P4MB 3V0WH 2OCFD 4XPTL 2OZ4H 3C6LA 4D9QD 3ARDC 5FEBA 3V6FA 1NGWA 2X05A 4OGAC 2VC2L 5I17A 5IB1A 4G8FA 5EBGA 3QO1A 1FNSL 1ZT1B 5CEZE 2O5XH 4R8WL 5LQBH 1UM4L 3BHBA 1RK1B 3RVUC 1G0XA 4XH2B 4FQCH 1CFQA 4JFHD 1MCDA 4M7KH 4U3XA 4KKBD 4LP5A 4LSQH 5I30H 1HHKA 1I3UA 1ROWA 2GUOB 2JJWA 3MOAH 4XNYL 2E7MA 2FDBP 4ESKA 5E6ID 1HI6A 2O5ZH 3MXVH 1D5ZA 3NIDE 4IOSD 1U8KA 1PG7X 1UYWH 3B9KB 1J8KA 3BT2L 4D9LL 3TBYB 3WJJC 4Q74A 1YMMD 5E8OA 2Z91A 1F3RB 3NIDF 2YPVL 3FB8B 3AC0A 3BN3B 4OZ4B 1A4JA 1T04B 5DS8A 1QLRA 1TCRA 4PRPD 2C4FU 3F12A 3B2UC 2VL4A 2DTML 4FFVC 4S0TD 3S88H 4ERSH 4AIXA 5IF0A 1PG7L 4K3EL 3S37X 4OM1L 1G7IA 3S36L 5JZ7D 4MLSA 3DNKA 4MCZA 3V2AR 1FNHA 4QRPB 3O2VL 1HXMA 4PJ5E 3IDGA 4J23A 1QSEB 4PGDB 3EYOB 4OV5A 4HMCA 2H8PA 4QOKE 3BKCL 4JRWA 5IB4B 4LLQA 1QSFD 1CD1A 4NRZB 3MRFA 2BSSA 5GGVL 4IRSC 1QKZH 5F3HB 1J1XH 5JIIA 3ISWA 3WNMA 2ZUQB 1U36A 5T1LA 4G6AC 4OD3L 5J6GA 3MOAL 3F5WB 2B1AL 4NDMB 5EU7C 3JUZA 1EEQA 5HYFA 3HUJB 2HT4D 1L0XA 2PO6A 1F2QA 4KJPC 2IBBA 1FG2A 2Z9TA 4DZ8B 5L88H 2Q7YA 5J1AA 1LK3H 1L7TH 2GQHA 2JJVA 3LS5L 4HUXB 4D0CB 5IT2H 2VDLL 3OF6D 3QUYA 3MGTA 4FTVE 1JRHI 4JN2B 3QULB 15C8L 1KXQE 3DURB 2B1AH 3IFLH 3ESVF 4ODWA 3IU3B 5F7DB 1HDMB 1T1ZA 1Z0NA 1WZ1L 4Z78A 3CXHJ 3GSNL 3AFLA 3FHAA 3ARXA 1ZXQA 4JFDB 4M5ZL 3HZYA 5AZ2H 4NM4H 5MENB 3PWLB 4BZYA 4IJ3C 4HDIB 5J3HD 3S96A 3WLWD 2R56H 4UAOC 2ZSWB 3C2AL 4XP1L 2QADD 3TT3L 2BRRH 2XA8L 2ATPA 4KRMB 2IAMD 4TRPH 3U0PB 3MRHA 1I7UA 5LKNA 4S1QL 3QNXB 3THMH 5IEHA 4Y2DB 4BKLB 2C4FT 1JPSL 1L4IA 4N1EA 1WFTA 2VE6B 4RRPG 3V6ZB 1TETH 1QR4A 5CEXA 3VXQA 5ADPH 3GMQA 2DMCA 1S9XB 5I18L 5C0IB 4GKSA 1G1CA 4NQEB 5KOMC 1W72L 2E27L 3RWCB 5E1AB 1EAPB 1MCPH 3G08A 1QHPA 3MV9D 1QKZL 3VH8G 4ERSL 4MDJA 5DA0B 4F37F 4NQCD 1YYLH 5DR5H 3WEXB 1YJDL 3DUSB 2AGJL 3HAEG 2MSPA 3MOBL 3O3AA 1KGCE 4JDZA 3GBNL 3UTTD 2WBJD 3D3VB 4OKVB 4Y19A 3H8NA 1S78C 1AD0A 2XY2A 2VXVL 2NTSP 3CSBA 5DJXB 1K4CA 3QG6B 1BAFH 3DX9B 2CGRL 4KTEH 2FWOB 1DBAL 43CAB 1MPAL 4OQTL 5HDQL 5JW4M 3BH8B 5FYKU 1RUKH 4PJEF 3MROA 1T0NB 5FCSH 2DN7A 1I8MA 4CDGC 4ZD3L 4NC1E 2WIIB 1HIML 1MI5E 3AM8C 1O5DT 5JR1L 5JQ6L 4G8GE 5I75C 2VXQH 4FQ2L 5J8OA 1EMTL 1I85A 4W4NA 2B7DT 3DYOA 2RCSL 2NY1B 4OZGF 4YBLB 1GC1L 4HS6A 5SV4A 3RL1B 3VXOA 1FFPA 3ARTA 1YY8A 3TA3D 2Z35B 4LCUA 5I1IH 2C3GA 5ETUB 5IHLB 1KIQB 4NNXA 2FX7H 4NQVB 5KSVB 2ADJA 1EUTA 2H32B 3FAWA 2IPKA 5EZLA 4DKFH 2IBZX 4ISVB 3CPLB 3VWJA 5HGGS 5E00A 3HFML 4WWKD 3T1FA 1C7TA 4JZJB 4HWEH 4PREB 5E03A 1BQLH 3RZCC 1XIWD 2OS7A 2AK4B 3DXAB 3TYGH 4X7FC 3UCRA 1CGUA 4RBPH 4DN4H 5C2UB 1OAUH 3C60C 5JZ7C 1F97A 5GJSH 3HCVA 5ITFB 3RTQA 3AM8A 4I9WE 5B21A 4GXUM 1NEZA 1MJ7L 3VXUD 2QBWA 15C8H 3CFDA 1BIIA 4LVOC 3HZKB 1MHHA 3KR3L 5C6PB 5ALBH 2FX8H 4PJFE 3QWRD 4QRQA 1CFVH 5HGDB 1GH7A 5C09B 1AR2A 1YMME 2CR6A 4KZDL 3B9DA 4L4VE 2BMKA 1KULA 4DKAA 3KPNB 2WV3A 4YFDB 1W8NA 3IDUA 4H8WC 4G6AD 4KVNH 4ODTL 4I0PB 5FYLD 3KG5A 4GW5A 4CUCA 2GAZA 4JLRB 4KRPD 5DVNA 5IKCA 1G7MA 3KXFD 1ZKAA 3FT3B 2JJUA 4JFQA 4HPOH 2NY6C 2Z0BA 3D2UB 1V05A 3MA7A 4XCEA 3P40A 2RR3A 3SQOH 1MRFL 3WKML 3PJSB 2W0LA 1GOGA 3SEPA 1PKQA 4XHJD 3BGMA 1KB5A 5EPMB 4Q0XH 1ZAGA 2DI8A 2IMNA 3UP1A 5E70A 3QUKB 4YHMH 3C60A 3EHBD 3MRIB 4PP2B 2DBLH 2D7MA 1FAIH 1X5LA 3SDAA 1CE1H 1UM5H 1YNKH 1B4JH 3VW3L 4S2SB 2XZQL 3P73B 3MJ7B 5EO1A 4ZD3H 1MHPH 4UOJA 5HHOA 2CUMA 4P9ML 4MQ7B 2Q86A 3QYCA 1TENA 5DUBB 1MVUA 1AC0A 2B4CL 1AE6L 4M48L 4ZUWA 2AJXH 1P9MA 1YMHB 5CEYA 5JNYA 2Q6WA 2GSIA 4D0BB 2CKNA 3QNXA 4NQDE 3QUYC 1YNTB 3UPCA 1JFQL 2HJFB 1A1NB 1I8KA 5DLML 3VG0L 2VKWA 3SDXE 1XF3A 2J12B 5DK2A 1QSFB 5BRZB 3ZT5A 2VDRL 4JM4L 2VERN 4R8WH 2EE2A 3EZ8A 4FQHA 2VDMH 1YEEH 4K8RC 3C5SB 1I1CA 1IC4H 3HRPA 2NW3A 2VDPL 3G6DL 3FQNB 5DRXA 3TBTA 2VWEE 5BMFH 1G6RH 4OFKA 4F15C 4OF8A 4J2XA 5CSZB 1TNMA 3QAZB 1WTLA 4MQXC 3MGTB 3C5ZC 4JN2A 4KUZH 1U95B 2R8SL 3M1BB 2QQLL 3DURA 1SEQL 2MQ0A 3FO2A 1MQKH 4Y19B 1MRFH 2EDRA 5HDLA 1BZ7B 1JMZA 3MV7E 4RX4A 1IGJA 3I3DA 5D6DA 1PVHA 4JO4L 5IVXE 4WI3A 4JM2C 4HXAL 2Q76A 4X9BA 2R0ZH 3HNSH 4M5YH 3QPXL 1RVFH 2VISA 3UYPA 2VZUA 5CGYD 4Z7NF 2PYED 4C83A 4D9RD 3MRHB 5D7KD 1I3VA 4B7IA 5I1IL 4QHMB 5DK0A 5IEHB 3T1WA 4BKLA 2DIAA 7FABL 3WO4C 1G9MC 1QBLL 3MTRA 1NUGA 3FRPG 4E41A 5L8JB 1KN4L 1C5DB 1KEMH 5IEKB 3O3BB 3U7WH 1H0DB 1TVHB 4JY5H 4MNQD 2P47B 1N0XL 1I8LC 5I1CL 5F21B 3ARGD 4JFFD 3C5ZA 3LKQA 2IPKB 2V2XB 5L6YH 1YUHB 2NY2D 3STLA 4ISVA 3P4NA 4P5TC 3H7LA 3MRNB 3CPLA 3F8UB 2B1HL 5KSBB 4FMFA 3GZKA 3IKCB 4M7JL 5LXGH 2C7UB 5BW7A 4P23D 3F58H 3H3KA 4Z76A 4JAMB 1G9NH 2IC2A 4OIIL 5GGUB 4JZJA 2WBJA 5T5FL 3EO9H 1MJ8H 2VO5A 5KN5A 3Q6FB 4NFDA 3X3FH 3VFGH 2V5RA 4OZIA 5DJCA 1IAKB 1MWAB 3QXAB 1QHOA 2AQ3A 4U1JB 3TPUA 1I9EA 3RUGF 4FABL 4YR6A 1XZ0B 4J3SA 5HVHC 1HWHB 3Q3GA 3MROB 2RCSH 3VDBA 3I75B 1IZJA 1KLGA 4H20L 1KCRH 4PLOB 2DBLL 3SY0A 4HCRA 1VESA 4HF5H 1KTDA 1TDQA 2VLKE 4WHDA 3VXRB 2YC1B 3MOBH 3PHSA 3MNVB 2J5LC 1A6PA 5EZJB 4LSSL 3GGWA 1MCHA 1U8MA 2A83A 2C1OA 4J3TA 1CGSL 5FGRA 1AGFA 2JK5B 5C86A 4AEIL 3QQ3B 3U7YH 4XVUC 1PLGH 1TJHL 2ICEA 1UZ6E 4NQCE 5IMLA 5D7IB 1I7TA 4EZMA 1JZ2A 5TPWH 2PXYD 1B3JA 4X0KA 1XGRB 1K6QL 2CSPA 4PB0H 5EN2B 1U8HA 4FZEL 2X9XA 5I1JH 2XFXB 1OARL 3MBXH 2I9LB 3CFKB 2MPAH 3N9GH 3X12A 5CFHA 3HPJA 4ZYKA 2I9TB 1NCAH 3GSOA 4OF6A 5AEAA 2HWZH 3FFDB 3T1FB 4M9PA 5JIHA 1SEBB 4LSDA 3OXSA 4PPTA 4Y5XB 5C0BD 4MQ7A 3K74B 4EBQL 1WAAA 2VXTL 4YO0B 1NEUA 3D25B 4IRSB 4JFOB 4OLWL 4K9EC 3NMEA 5ESAA 4HPYL 4GS7B 1H3UA 3KPOA 1DANT 1CF8L 1BM3L 3WNOA 2NCMA 4NKOB 4UT9H 1P9MC 2A0LD 1BZQK 1T6VN 4YK4B 3SE4C 5DVMA 4MZ3A 5DUML 4WI5A 1JHKH 4UB0H 5CZKA 3SCMA 1SY6A 2A9NL 1OVZA 4S0SD 1Y6KR 4YGVA 4PGDA 4ETQB 2B8OT 5HI4C 4DKFL 4X8XA 3MV8E 3ZE0E 3C5SA 4XTRC 3QA3B 2DB8A 2X7LA 1S7TA 2GITA 1LK3L 3FQNA 1QG3A 4JFQB 1JPFB 4B53A 5BV7C 5HHQB 4XWOD 1C5BH 5DMIH 3BZFB 2V5MA 5ENWA 4A6YA 3OR6A 3SJVA 3T77B 4HFWB 5B3JE 1BVKA 4O51A 4PRHE 4M1CD 3NPSC 5GGTH 4E5XB 1ZA6A 4I3GA 4M6NL 1FORH 1KTLB 2PO6B 2VRAA 4LIQE 5DC0A 1MFBH 1JTTA 4JKWA 2FZ3B 1BZ9B 4NO5B 4R7DA 4WFGE 1X5IA 4IRZH 3MJ7A 4GMTL 4JM2D 4HV8A 1DFBH 2O5YH 1OARH 2GJ6D 3MGAA 3O0RL 1A6AB 1P7QD 1GAFL 1YDPA 1CFSA 4OCLC 2JE8A 1FIEA 1INDH 3JV4A 3U83A 2XWBB 3H9HA 1IC7H 3KNBB 1B2WL 1Z5LB 5B3NA 3ZE2F 2NXZD 2DJSA 3MLWL 3V0AC 4DFHA 3NPSB 3EO1A 4JPIB 1CU4L 3SKOB 2W07A 3AUVA 2XZQH 1NAMH 4JRYB 3BYYA 4L9LA 1YNKL 3HA0A 5CEZD 2V2XA 1W72H 1C8PA 2V6HA 4FQHB 5TDOA 4BFBD 1G9NL 4OM1H 3BT2H 3MRNA 1U8PA 4PJ9A 1JF6A 3O6FD 4Y16A 5F7UA 3IKCA 2Y36L 5ACLA 3TBTB 3JWOC 4KC3B 5B38A 1WFUA 2AP2A 1KENL 2DL9A 1CFTA 1FVDB 2E3VA 2J88L 3SJVD 3L95B 3SDYL 3CVHA 4G3YH 5L8KB 4JQVC 1AR1D 2DAVA 1CDGA 2R69L 2QSQA 1ZOXA 4PLJC 1KCVH 4GKSB 4J3UA 4XVTH 4HW6A 3MJ9H 2R0WL 4HXBL 4QOKB 4JANB 4XPTH 1RZFH 3O6MH 3BKJL 2IFFL 1HKLL 1A64A 3MRQA 2NTFB 4WEMB 5FM4A 5F9WC 5H94B 1BBDL 2HRPH 4NFCA 1U6AL 4LPCA 3OXRB 3WUZA 3L7FB 3ETBF 1J0HA 3QISA 1ZWIB 2OI9B 4Y4KC 1A21A 4WVRA 4DCQB 1KEML 4XRCB 3GGWB 1DQQA 3UZVB 1P4BL 2XG5A 43C9A 3S4SA 3QUXB 2ESVA 3DSFH 4NO2B 3QEUA 1UQSA 5IV2A 3TC9A 4PG9B 4MVBC 4XVUD 5HHMD 1W72B 4JRXE 4RAVA 5ISZA 1CDHA 4HKBA 1XGRA 3D69B 4XVSH 1CLZH 1CG9A 5FYKD 3RWHB 4JO2H 1OAQL 5KSUA 4QRPE 4N68A 5FYJU 1LP9A 3RHWF 3U7AA 2NY4B 1I1AB 7FABH 4BH7B 4YHKH 3VI3E 2VXSL 3A67H 1NMAL 3NCCB 2C3XA 4MA1C 4Y2DC 1LQSR 1Q0XL 4PJ8A 4RFEB 1KC5L 3J8F7 1J0IA 3P11H 4LKXB 4X7DC 4JPKL 4I0KA 2A6DA 5HY9A 2EDOA 4HWNA 1H9VA 3PXHA 4LSPL 1WIPA 2QLVB 1TPXB 3CX5J 4R96A 4FQIH 1INQA 1VACB 4KZEH 1A2YB 1SJHA 5DT1L 2HT3D 4U1JA 3DX8B 1LEKB 4HBCH 3CUPA 4ZFZA 1MLCA 3Q3GB 2WP3O 1NANH 3KWWA 1CI5A 3JWOL 5T3ZL 3MRBA 4MD5B 5JXEA 2BVQB 2BOBA 1KTKE 1JYXA 2ADGA 4HCRH 2ZCKH 2EDEA 4BM7A 4ELMF 2ED8A 5IB2A 3U9UB 3U4BH 1GC1H 1K2DB 4N1CA 1IEBA 3OGCA 1CE1L 2MKLC 3QQ3A 2E7LA 4F9PC 4IIQA 7CGTA 4GSDH 5CIPH 2P7TB 4R4NC 5IMLB 3Q6GL 3IXAA 4U31A 2Z8VC 4XTRD 4I0PC 2APTA 1KN2H 4RMQA 4Y4HA 5BV7H 4PJGA 1RJLB 3CMOH 1A9EA 4QRQB 5KANI 5FO8B 2HLAA 4QYOA 5IFJB 5DHYB 1LP9F 1BVKB 4O51B 5DO2D 1RY7B 3OWEA 1JZ4A 1FYTB 1OB1A 4A6YL 3HPJB 1WBZA 1J8HE 1GHFH 2I9TA 1MHEA 3ZZ1A 2PTUA 4ZOCA 1PYWA 1UM5L 5B4MC 3FFDA 5EOCJ 4WI2A 2R4RL 1ITCA 1FFRA 2YPLB 5EOTB 5IESH 3BO8A 5DQJA 3OKNA 3H9ZA 1SBSL 1K9TA 5CBAB 1NBZA 2ZCHL 4KGLA 5ICZA 4MJ6A 1EHAA 4PB9L 4QHNA 3HE6C 3LN4B 1S7QA 4F8QA 4NZRH 1RIUL 1NC4B 2WNGA 1WISA 5A1AA 5KVGL 3V8OA 3TNMA 4CN6A 2XPGA 2QHRL 3CVHH 1KFAH 5EC1A 3MC0A 5D9SA 2R2BB 1RUQL 4MJID 2GSGA 1DR9A 4Y16D 2EZ0D 1OHQA 3JV5A 4O9HL 4FFVD 4RWYL 4AEFA 4P2YA 1KJVB 1XF5A 1TZIA 2IADB 1H3VA 2IGFL 3CX5K 4U1KB 5DJ6B 5FUCC 3E3QE 4QNPE 4H0HB 1AHWA 2Y6SC 5FO9B 1IQDA 3BGFB 3HNSL 3I9GH 1L0QA 3P3YA 3ZT6A 5IVNA 1F4XH 1DBJL 5I9QC 1FVDA 4Y7MA 2PTTB 4YDKL 2P8LA 5F1IA 2H2SD 3L95A 5BRZA 5MP6H 5K9OA 2NY0D 5AD0A 4KZDH 4R3SB 4QXWA 2GJ6E 3VFOA 2AVGA 4YAQA 4LLUB 5K59E 4L29B 2MQCA 4PLJD 3EYVB 1AFVL 3KYNA 5ERWA 1KTLA 3VRIB 1R3JB 2DBJA 1EFXD 3G04B 3U4EB 1LEGA 2OSLA 5I66A 3IFLL 1FE8L 4C56B 1AGBA 1AGEA 4LLWB 3IXTB 1T1XA 3V7AE 1DBML 5IUSA 3TESA 5CSZA 3KPRE 1YQVL 5I16A 2IMMA 2R1YB 2NNAB 3SO3B 4PGBB 5DDHB 1D6VH 5EBMA 1CFSB 3P2TA 3VDAA 4PS4L 4PJDE 2C9AA 1N5YL 5I74C 4D3CL 2PR4H 1YEJH 1QD0A 5L7XH 3OKEB 3NZHL 5E9DA 1RZJL 5K9QI 2Q1EA 3LQAL 5HHVL 1MIML 4KI1A 4X7SH 3SKOA 4QXTA 4R90L 4XBEH 4L9LB 3SJVE 5JIPA 4HK0A 4PJHB 4HKBB 1F4AA 2Y5TA 5HHMB 5FCUL 3JVGC 4C83B 3LEVH 4ZUVA 1M7IA 3GUTB 5CILH 5DZOA 4F37K 2ICWA 3MLZL 4GRLC 1RI8A 5D8JH 5SWZE 2IAMC 5HPOA 3D39D 3LKSB 3NTCH 4UINH 5T5NF 4LIQL 1GSMA 4CMHC 5EU6E 3DTXA 3MMEB 3VMPA 1WWAX 3WIHA 1NBQA 3UO1L 1A7NL 1XR8B 2XTJE 4X80L 4YHML 3O2WL 4GMTH 5JHDA 3P4NB 1OD7A 2QEJA 5I1HH 4ZXBB 3ARGB 2BY0A 4JFFB 4PP1D 3NCYP 2C7UA 4N90D 2HT3C 3GJFA 3TT1L 4I77H 4XC3H 1ZGLM 3ULUL 1WUNT 4JVUA 1RFDH 2R23A 4HUMB 3KS0J 5E8EA 1SQ2N 2YD4A 2LQRA 4WHCA 4P57A 3CC5B 5KSAD 2QQNL 1MWAA 1G7HA 4HKZB 4BA8A 3DLQR 2YD7A 4J6RH 4PJ7A 2WBJC 4M43L 2XKSA 3HC0A 5BVPH 4DFIA 1HILA 4YR6B 1NANI 2IAND 1R5VA 3MRPB 3FONA 4H26A 4R4ND 2YR3A 1MH5A 3DX6B 3KYMA 3HN3A 3ET9F 5D96B 4PRHB 4LHQB 1EO7A 1U91A 1A4KA 4M61B 5DHYA 1YQ2A 1EH9A 1BJ8A 3RWHA 2H32H 5EU6B 3UTSA 1DDHA 5ACZA 2ZCLL 3S3JA 1KOAA 4L3AA 2UZYB 1VFBA 3LS4L 1U8KB 5IVOA 1IL1B 2CPCA 5AZ2L 5IOPB 3QWOA 1KJ2H 4W68A 4BH7A 2EIDA 2CD0A 4OSUL 4PJ8B 5B4MD 4NPYB 2ARJB 3DUUA 4OD2A 4R26H 4X0KB 3BWUC 5ID0B 2NY3B 5EN2A 4HX1B 3TA3C 5TH2B 5MHSE 1NBZB 2Y72A 1QR1B 1EXUB 1QRNE 3V5HB 4MJ6B 5LGHL 1QLRB 1TCRB 4KHTH 2VDOH 1LEKA 3ZDZE 5J11C 4JQXC 2LU3A 3T8XB 3UBXB 5MEPA 3MJ8A 2W60B 4JHZA 4ZUUA 2EDFA 5FB8B 3WDJA 1S3KL 3DUHA 4JRYE 2BK8A 4QTHB 2GT9B 3BE1L 3PDOA 4Y16C 3OR7A 1F45A 4F7MB 4UMGA 1P7QA 4HUUB 3GBLA 3RZCD 1DZBA 1LMKA 1MQKL 3IS0X 3ARBC 1D5XA 4ZOAA 3ZKND 4KK8D 4KI5F 4Y4HB 3MLUL 2MKWA 5KAQF 3T08A 2BSSB 4PB0L 1IGYB 1UH4A 5T1LB 4LFHG 4C58B 2NY0C 3BW9A 3DRQA 3HAEH 1SBBA 3OSKA 4X4YA 5F93C 3U36B 1N64L 1NGQH 1J5OH 1RUKL 4MAYD 1JPFA 2I60L 2YPLA 1LO4L 3IXTA 5C0ND 5GS1C 1U8OB 4ZNEE 4MZ2A 1ZANH 4XI5D 4J3WA 3OR6B 5ICZB 3QIUC 5EBMB 4P2RD 2R29L 3RIFF 2R0LL 1QNZH 1T2JA 2R1XB 5E2VH 1NC4A 2FBJH 3H3PL 4UBDD 2NZ9D 5LQBL 2J8UE 3RBGA 1KTRL 1FGVH 5EU3B 5ID1A 4OV6F 3QH3A 3OJDB 5KVFL 4LPXA 3DXAE 1X4XA 4P2OA 3F7YB 4KRLB 3QHFL 5IVZA 5D5ME 3VFVB 1QBMH 3LD8C 4DOHB 2W9DH 1DUYA 1A6AA 1XGQB 3BVNA 3L9RA 1KN4H 1UWEL 3K2UL 4MJ2A 2RAMA 3QCUL 3V0WL 1WZLA 3OKDA 4YHOL 3EO0A 1BX2A 1U8IB 3P4OB 4BQ9A 5C6TH 5IBUG 1Z0MA 1GZPA 5ILTL 5C9JA 1FPTH 2EXYD 2VE6A 3QIWC 4JHWL 5DJDB 1IFHL 4HQQL 4LHJB 2VAAB 4X98B 3QUYD 2X4UB 3AAZB 1CICD 3KYOA 3HR5A 4TRPL 1GPOH 1HEZA 4NHUB 5T33H 1FE8H 2K7PA 2H1PH 2NX5A 4YQXL 3MRGB 1KELH 4MLIA 1MCBA 4H5SB 5DMYA 1NSNH 3MREB 3G08B 3WD5H 3G04A 4XNZB 1LEGB 2OSLB 3TLRA 3RVWD 2FYYB 4NCDA 4UV4L 4F7TB 1U8LB 2CIIA 3HC4H 4M62H 2R23B 1AH1A 5EWIH 2A6JB 1FDLH 3NFSL 1BOGB 3QPQC 2W65B 1A5FH 2H45A 1D5IH 1IAIM 2ESVE 5LBSH 3D85B 3ULVH 4KPHL 4TSAH 2F19H 3PGCA 4JN1L 4WFHE 4POZC 1T5XA 1WBXB 4XAKD 2ITDB 2B5IB 2E6PA 5GRUH 3MRPA 2J8HA 1WC7A 5E2UH 2BNQE 4NQDD 1T0NA 5C0FA 3VWKA 1NAKH 3UROR 4ZODA 2IG2L 4YXLH 4IRJD 5CLTA 1XGUA 3ALWA 4ZG1A 3Q0HA 1U91B 3CVHL 4HZLA 4JQIH 2D9CA 1OGAA 3PGFH 1ZLWK 1M7IB 3QIBB 1ZWIA 4LVNB 2EO1A 1RIUH 2KKQA 43C9B 1HHJB 2GK2A 3EDFA 1NC2A 2VDPH 5CD5D 1DQML 2AJXL 3KJ6H 3VXNB 12E8H 4TUJB 2ZUYA 5EUKA 3MUJA 1MWAL 4YPJA 5K9JL 4CU6A 2MPAL 3N9GL 1IGTA 4NNXB 3LB6C 5DJZB 1MCWM 5ANMB 4MXQD 3D18A 1PZ5A 3Q5OA 1DL7H 4W6YB 1D9KC 4NRYB 3ARGA 4JFFA 4OI8A 3FQWB 4V1DA 5ELIA 1IKNC 1I1AA 1YYML 3FN0H 3VE0B 4QY8B 5IB3A 4ZO9A 3BZEA 4LVNC 4ZUUB 1K8DB 4LOUD 2J4WL 3RWDA 2O61A 1JVKA 2EICA 5FYJD 4LASL 4LKXA 4P9MH 5DD6A 4QTHA 5J13C 2A6DB 4PRAB 5HY9B 5EH1A 5CJQH 2DM4A 3PDOB 3LZFH 3OR7B 1P7HL 1O0VA 1NQBA 4N9GB 5EORH 1ZS8A 1ETZA 3U48A 4OGYH 4JJHA 5EA0H 1G1YA 2ORBH 4Y5VB 5IMOB 4S1DC 3HMXL 1BIIB 4FQCL 1L6ZA 4M7KL 3TA3A 3BFOA 5DFVD 1A0QL 1RULL 1IAOA 5DI8A 4NN7C 1L9NA 3DV4B 4BH8A 1IGYA 4XAWL 4QRRA 3HNTL 4OB5L 3ZSTA 2XWJB 2EYSB 2IPTL 2NXYB 1XMWA 3U9UA 1JK8B 5I73B 5K9KA 3FB6A 3SDAC 4Z7VB 1VFAB 3BD4A 3WFCH 3O11B 4P3CL 1UKTA 3S6CA 3AB0C 4RCAA 2ZUTA 4PY7B 1DLFL 1MI5A 2C3VA 1DEEA 5KVMC 4W81A 3ORJA 2E7LC 4FG6C 5C0NC 5CJOL 1ZLWH 3D85D 5HJ3B 5EPMA 5TDNA 5F8RC 3WXWL 3I02A 5F6IC 1IT9L 1KIPB 3TCLA 3UTTA 5A3IC 1WBZB 3HHRB 1MHEB 2XWTA 3T3PE 4L1HA 1PYWB 5EC2A 2R4SL 3MJ8B 4KDWA 5J1TC 2NZ9C 5FB8A 3OJDA 5ISZD 3H7BB 1AJ7H 5IVZB 1IGIL 1HE7A 4IJ3B 1GGUA 2P5EA 4YBQC 3AY4A 1MVUB 2GCYA 1YMHA 5CEYB 5JNYB 4X99B 3RA7L 5C0CB 3DVGB 2GSIB 5CIPA 1FZKB 3L6FB 3QRFM 4OFDA 1X7QB 5DJ0A 3UBXI 3QUZA 3VGEA 4NBZB 1WLHA 4IMKA 4FXKB 5CSGA 5FGCB 3HE6A 3QIWD 1M7XA 3T0DA 3PF2A 2FX7L 2MFNA 3KPSD 2RJMA 1E6JL 3BW9B 1ZVSB 3HR5B 4PV9B 4B0MM 5SX5K 4HIHA 3RKPA 4G43A 3S3SA 1A7OH 3NACH 3MREA 3SKJL 1ONQB 5HVHB 4X8JA 4XCYB 4HXBH 3GMRA 3AS3A 4OCWH 3W11C 2X70A 5ADOL 4MA3A 2PTTA 1ZVHA 2NY0B 1A7RL 1VEOA 3DXAD 4OUUA 5DRWB 5J9PB 3EW3B 2DRUA 4LLUA 1KJMA 2X40A 2ZSVB 1U41A 5FK9B 4U1NB 5KZCB 5DEFB 1ZHKA 3QRGH 1BHGA 2Z4QB 3BKML 2E7HA 2VZVA 3UTQB 3VFWA 4OBSA 4FXLA 5EU3A 1RZKC 5ID1B 4IDJH 3QHZL 2ZUVA 2AJVH 2GJJA 1WC7B 1X5JA 3BAEL 4Y5YA 3VWKB 1BGXH 4OTXL 4AZ8A 5DDHA 4BJLA 4JY4A 2BNRE 1FN4B 4NN6B 3UPRB 4QHMA 5DK0B 1Z9LA 3P9MB 4FP8L 4LSVL 3TN0D 3ZTNL 3O3EB 2DQGL 2G5BB 3KLHD 5J57B 3L5IA 3FB7B 2FATH 4OCSH 5INDA 3SBWA 3QR2A 4YBHA 5IEKA 4X98A 2W0KA 1UACH 3GSXB 3FCTB 4Z8FL 4XP4L 2X41A 3BPOC 2XICA 3ZDXE 2NX5B 4HEME 4N0YH 5B39G 1BWMA 4PJ8C 4Y4FB 4QTIH 3MV8B 4MXQC 3GUTA 4PYGA 3O81A 3IETB 4G5ZL 2H26A 5DJAA 2X44D 3TIEA 3PV6A 3HNVH 4GXUN 4QY8A 1TJIL 3BZEB 6FABL 2HJLA 1Q9WA 5I30L 1BFVH 2AV1B 3BPNC 1FAKT 3MA9H 4U1MA 3Q6FA 4LOUC 4KMLB 2YXMA 1KB5H 3MV11 3CSGA 4BFEA 3T4YB 4HK3N 3B2VL 2B5IC 5INCA 1I8IB 3A6CH 5HVGB 5JLZA 1JCKA 1PSKL 4CNIA 4C55A 4MCYA 4CW1A 1JF1B 3O9WC 5AZEL 3RKDD 4NQXA 3WFDL 1CZ8L 2ADIB 4I48A 5C07E 1KPUB 4O5LL 4P57B 2LE9A 3CCHA 2B0SH 4D9QE 3QXUA 5K9KB 1QOKA 2A83B 3S98A 3QFDB 3RX5A 3HG1B 4XNMA 5EZOL 3NIGF 1S9VB 2XI9A 2Z31B 1V7ML 4WWID 5E0QA 1MH5B 1WJ3A 3S36H 3IRPX 4FFWC 4DK6A 1TTUA 4CVZA 2KZ1B 3SGKA 4M61A 4KK6D 5C07A 3UTSB 4NUGH 5TE4H 3TIDB 3QDGE 3HAEB 4V1DB 3ZYZA 4WFHD 2G60L 1JZ8A 3VE0A 5F1SA 3RWDB 1X6NA 3VD7A 2HFTA 2YBRB 3GMPB 3F6IA 4P3WA 4ZXBD 3WFHB 4EIZC 3VXPA 5BXFA 2A1WL 3IRZA 4QXGL 4OGXL 3DI2B 4TUKL 1ZLVH 1N6QL 3S88L 1ORQB 1FL5A 2D03H 4LU5H 2JCCF 1BOYA 4OQTH 5HDQH 3T8XA 2P48B 3SOBL 3UBXA 1OCWL 2F74A 3K1DA 2HMID 1LO0H 4UTBL 1IC5L 2ZNWA 3QRGL 4DEPB 1ZLUK 4NSKA 4JQXA 1ACYH 4LSQL 1OGAE 3B9AA 1EVTC 5EULV 3VGAB 4F9PA 1V3JA 1FNEA 5F97E 1J0KA 2YUWA 3GSQA 3JSSA 4QRUB 2X7LB 3KJ4B 5IHZB 3DO3A 1KBGH 1R3LB 3GSNB 1V3MA 1CLOL 5M7QA 4OFYA 1ZHBB 4P49A 3S8WA 1A3RL 3TV3L 3BISA 3BJLA 2DYPA 4MS8C 4M6MH 3WSQH 3BDYL 1KV3A 4QOKD 1H3PH 2BVTA 2F53D 4WCYH 5D71L 5HJ3A 4AL8H 5I6XB 2CKBB 2D7QA 4K7PH 5AWNL 3NAAH 1DUZA 3B2VH 3I02B 3D39E 4IM8A 3E8UH 1R3HA 2XYCA 4NO0B 3RPIB 4OFPA 3FFCD 1JBJA 4XPFL 3O8XB 5DFTA 5I2IB 1MIEL 2G75B 1LEIB 1C08B 3MUGA 3RIFK 4R7NB 2OQJB 3Q1SL 3OX8A 4Y4KB 4IOFD 5K33A 3R1GL 5F9OL 3UTSE 1RZ7H 4X99A 4UIKH 5C0CA 4AJ0A 1IILE 2Q7NA 4MXWH 32C2A 4OF0A 5T1DL 4DVRL 4CGTA 2HLFD 3RI5K 3TN0C 1PW3A 5INDB 3KLHC 2V5YA 3QCTL 2VLRD 2DKMA 4JPIA 1R24A 3HE6B 5E6IB 1CK0H 3RVUD 3T0ED 4CMMB 1ZGLA 2F54B 4IS6B 5F1OB 1E4JA 4PJHE 3O45B 4QCIB 4FQXB 1CT8B 5E6IC 4XVJH 1MUJA 4Y16B 4GS7C 2CXKA 1IKFH 3GMRB 5L2KA 4XMKL 5I8OL 1RUPH 1MFCL 1AXSA 4LF3B 2UWEB 4PJXF 5CGTA 4I2XB 1CFTB 3MQIA 3EJYD 3IDJA 3I6KA 1Q9WB 5FOBB 3LRHA 4DQOH 2FX9L 1L7IL 1OF2A 2E9WA 2X4QA 4ZPVB 4PJFB 4FQLL 3UXFA 1YECH 2GTZA 4U3CA 3W0WA 3T3MF 2BERA 4NHUA 4OLUL 4GKZA 3CDGB 5CINL 3S35H 1NCDH 3BGAA 1NBYA 3VXMD 3WS6A 1MCIA 3X14B 1JP5A 1UH3A 4G8GA 1PBYA 4H0IA 3WIIH 4L3CA 1P7KA 2VLMD 4NQXB 1FBIH 3IDNA 5E2WH 3V0VA 3HPLB 4OCWL 1G9ML 3O9WD 1CL7I 3QFJA 4CVXA 2AK4E 4JDVB 4EN3A 3SGJC 3KPSE 2IQ9L 4EI5B 3LPFA 2F5AL 3QDMD 3P9MA 4DCQA 5GS0L 1G7QA 3RWEA 4TQEL 1PEZA 4XMKH 2PKDA 3TO4C 3V95A 4ACPA 3HS0A 2V5TA 1LO2H 3HG1E 1YN6B 5LAXA 2ZG3A 1J87A 2W0PA 2F54D 1BLNB 1CXIA 1INEH 1J12A 1ZK9A 3MRRA 5C0BB 3MRJB 5JDJA 2VLRB 4IRSD 1CDBA 4WUUA 3BH9B 1OW0A 5IM7B 4KK6C 1OTTC 3B6SA 4XVJL 3PV6B 4HMDA 4I18A 1JZ6A 2ICWI 5A2LH 1FZOB 4F8TA 5HPMA 4PUBH 1CTOA 3GIZL 35C8H 2JELH 3UC0L 3GMLB 4LCWD 2D7TL 1T3FA 4P4KA 1CLZL 1XGPA 5BS0D 1INQB 5HYIA 1LD9A 4NO0D 5C0CE 1VADB 3VFPB 4M6OH 4NRYA 5D2NA 3FB5B 2PCPB 4CNIB 3MRKA 3EZJB 5JPMB 3MLRH 4YDIL 3TZVD 3CUPB 1ADQH 5DHVB 2D7PA 1F42A 4LSUL 3IJYB 4GBXD 5FKAA 5F9AC 3ECBB 2HMIC 3T4AB 1UB5A 3Q1SH 1NBVH 4RQQA 2W91A 2WUBH 1JIBA 2WP3T 4L8DA 3VXSD 1UWXH 3KYAA 4YPGA 1ZS8B 1RU9H 2M26A 1K4DA 3ES6B 3PNWB 5BVJA 4RFNB 1R0AL 1T0PB 5IHZA 5HTSA 5IMOA 1AQDA 1QYGL 4U1SA 3TJHC 2W59A 2ZUWA 4YDJB 1ZHBA 1A0QH 2YSSA 1F4YL 3MODH 4LDLB 1NDMA 4CADB 1YEKL 4RMRA 2WWMC 4LVOB 5HGBA 1QRNB 4L8BB 5TQ0H 3ZT7A 4FP8H 2OMBA 5GRYA 2CRYA 4G3YL 3ARVA 4TOYL 1AI1L 3LKOB 3KPLA 3LRGA 1FNGA 4EDWH 2J4WH 4Z7WA 1I7RA 4ZQKA 3O11A 1J1PH 2FBJL 4LNRA 3RZCB 4KJYA 1DE4B 5MI0B 5ESVA 3VXPB 3OX8B 4ONFL 4XX1E 4KV5E 1N5AA 1RV6X 1DL7L 4K23L 3WO3B 4PJBA 1QO3B 5CKGA 1GJIA 3BP5A 1CIDA 2C5DC 4XNXL 1LDPL 2PTVA 4X6DB 1CQYA 1FLRH 3U6RA 5I1GH 5EC1B 4BZ2H 4RGND 4DGVL 4Q97A 4XZUA 1JNHA 2AJSH 3ZKQD 3O6FB 3QEQA 3NBNA 4U6TA 1KIRB 3OJ2C 1OAXL 4D2NA 3G6AB 1AC6A 3N1GC 4U33A 2D2OA 2F53E 3O45A 2IQ9H 3ZLQC 5ICYB 1CT8A 2R2EB 2ZPKL 2Z8WC 4I2XE 2J8OA 4ZAKD 2FX9H 4M3KB 2DLIA 5FO9A 2XN9E 2ZUXA 1LK2A 3RUGB 2UWEA 4EIGB 3S9DB 1OL0A 4FXKA 4LARL 2AJSL 1T20A 5HDOA 3WFBL 3KVQA 1OTSD 3EJYC 3GSRA 1HHGA 3DVIA 1JTPA 3ZE2E 4DJMA 5AUMA 1EDQA 1SY6H 5T1MA 5KANG 3MV9A 2DQCL 1NBYB 1T66C 4FQQA 3U4EA 4YHIA 4PR5B 1Q1JL 3O8XA 4WFFD 3T0WA 3UYOD 3MODL 1Q72H 4HMEA 1C08A 4L3CB 2WIMA 2BY1A 3A0OA 5H37H 3WS6C 3FMGL 2ZKHL 4MHHI 1I1YB 1TZHA 3A6BL 1PQZA 4H0GA 1AI1H 3D39A 2LAAA 4PGEA 1KJMB 4PJXE 4WDIA 4RMWA 1ZHKB 3VGBA 4GAJH 2CR3A 3IDIB 3C60D 3FQUB 3WUWG 2IAMA 2ZG2A 3TO4D 3RU8H 4QXTB 3TT3H 1MNUL 2F54A 1XGYH 2KDGA 1OGTA 3MRJA 2X4SA 3EDDA 4QCIA 2DLEA 4JY4B 4WFEE 4H1LB 2ZOKB 3AS1A 2NY4C 3GKWL 5FM8A 1RZGA 3W5NA 3FFCE 1Z9OA 4TTDC 4M4PA 5E7BA 2N7AA 4I8DA 2KUTA 5J1SC 4PRNA 1FFNA 3HI5H 4P0DA 4L8CB 1N2RA 3GMLA 3VGGA 4MA8H 4MQTB 5K9QG 4ODVL 5JUEH 5FDWB 2G2RA 4I5BB 4H8WH 1X5XA 4YHZH 2GEEA 3H42H 4Q2ZB 4LMQI 3X14A 4IDJL 3ABZA 4WENB 3QXDB 1ZLUH 4XC3L 1CICB 4KUCF 1LO3H 3HC3H 2VLRE 5IWLC 1WICA 1NUFA 1QPXA 5D7JD 3BIKA 4GW1B 1NGQL 3QSKB 1RJYA 1MSPA 4S10A 2FJGB 1I9IL 4RGOL 3V79C 5HYSB 3FN0L 4EUPG 4WWKA 2FBOJ 4JFZL 4ZFGL 3T4YA 5C09D 1T22A 1I8IA 1G7QB 3RWEB 4ONGH 3QPQD 1KPVB 2VABA 4HAGA 3U4BL 4Q58C 3KPSB 3IJSA 1VEPA 4WW2C 5CJQL 1RIHL 3DMMA 1FHGA 3LEVL 3FOMB 3DX6A 4G8EA 4YC2C 1KPUA 4WV1B 3WMSA 2AEWA 2WW8A 3BZ4A 1FGNH 3LPWA 1NJ9A 3I84A 1WQVT 1J1PL 3MZTA 5EIVA 1VPOH 4ODUB 2WWMD 5C0CD 4RGNB 4EJ1C 2V2TA 3LQAH 5HHVH 3HG1A 5L9DH 3KPLB 4LEOB 4GT7A 1HKFA 1C5CL 3LSOA 5JOEA 4LSPH 4K23H 3RZCA 3MV8D 1G6RA 5JMRA 3FFCA 4RMUA 12E8L 4MA8L 1IVLA 4MQXD 2VQTA 1IKNA 3C5ZD 3I85A 2F9BT 4OZFH 5KW9H 2VB5A 5F7LB 2PF6A 3MNZB 3WFDH 2FRGP 3PG2A 4OCNC 1W0VA 4OSUH 2FECI 1TVDA 3I6GA 1AKJA 2F54E 5F1NA 1IMHC 1P2CB 1TQBC 3LKPA 4NNPL 1CTNA 5J4MA 2HKHH 2ZZUT 4HUUA 4JE4B 3T2NL 5D7LE 3UTPE 4NQDA 5CGYC 3TEUA 3NFNA 3WYRA 1JPTL 1JRHH 5BS0A 5FUZL 3DIFB 3ULVL 5DQDL 2VN7A 1H3TA 3TYFA 4FRWA 2J7LA 3D0VA 1NUNB 1H5BC 4RX4D 3IF1A 3RX7A 4DKDC 4DUVA 2MTPA 5D7SH 3FQXB 5HI3D 1HHGB 2ZG1A 3HKFA 4L8BA 1UB6A 3TPKA 3H9SD 4BYHA 5CGMA 2APBA 2CDGB 3U36A 1ZA3B 2D0GA 2NY2C 3FOLA 3EOTL 1U8NA 5EO0A 1CVRA 4UZGA 4QHLB 3WIHH 1A3RH 5E4EB 3TV3H 3DO7B 4CDHA 4N5ED 4LCYA 5KSAA 2HFEA 4HKXA 4P4RA 2JF1A 5TDPA 4PGEB 3OKMA 4WUKH 1E6OL 2OM5A 2R1XA 3JWDH 35C8L 4X6CB 1UXWA 2MCG1 4NQSA 4FFZL 3BAEH 3AXLA 2QHRH 3TFKC 2NLJA 4ZOEA 3QEQB 1RSFA 3GJFK 1AE6H 4M48H 1WEJH 4MAYB 3ARDA 4TNVK 1BX2B 1NGYA 1HQRA 4RAUB 3R8BB 2FLBT 5FYLE 5EG6C 3I3BA 3QIBD 3KPPB 4YBQD 3RDTD 3KPQA 1DQMH 3MCKA 4KI5D 4NBYB 5I8EB 3VRJB 5IVXB 4KMTH 4XP9L 1W0WB 2FEDC 5DJ2A 4JO3L 4U1HA 3RWFB 1FNAA 4ONGL 5SX4H 4YXLL 4Z7WE 2AK1H 3QUMH 4YC2B 3KLAA 3PL6C 4ZTOL 2FIKB 2B39A 2P5EE 3NA9H 3SQOL 5T1MB 3W9EA 4PJXB 5TQ2H 1ZV5A 4TSCH 5EU5A 2QJDA 3TVMA 2NQCA 2YD9A 5CD3B 1RD6A 1XCQA 2YOCA 4PJAB 3O2DH 2Q8BL 3K80A 4D8PA 1T7XA 3TO4B 5MERA 1KLUA 1OF2B 5DURB 2Z8RA 3ARFB 1L7IH 2NXYD 4Z7QF 5D7JC 1EHLL 3ZDYF 1IAIL 3B5TA 4P9HC 4KQ4L 1QSFE 2HFFA 2MOVA 1PEWA 3IDIA 5MEOA 4UDTA 1XGTB 1KG0B 1RPQA 2Z91B 4P5MA 1A14H 4HLJA 3BRFA 2VL5A 4Y1AB 3HPLA 1RZKH 4NZUH 4AQ1B 4QKXB 4B41A 1Q9KB 3H9YA 4GUPB 5CAYB 5BQ7B 3KHOA 1NJ9B 4K3HA 1Q9OB 2VQ1A 2ZOKA 4HH9B 4HJ0D 1LE5B 3F12B 4PLKD 1RUPL 4X5WA 4L3EE 4ZSOB 4LSUH 5IF0B 1EJ6A 2BSED 4WI8A 5EUKB 4F7PB 2DOCA 1MHCB 2DQIH 4K7PL 2K1MA 2GW5A 3RNQA 1UCTA 4DZBB 2XQBH 3PP4H 3KYKL 3WL9A 4JO2L 3WE6A 5FXCH 3NZ8A 3C09C 1EFXB 2CIKB 1R3IL 2ZJSH 4HIIA 1DQLH 4E42B 1LILA 3FQWA 4KUCD 3UTZB 5ILTH 4LLQB 4M1CC 2HTKD 4OZFA 2RBLA 2L7UA 3BIBX 2HKHL 1KXTB 1UACL 2XTLA 1RZFL 2JKXA 3RAJL 3I6GB 3MXWL 3BIKB 5BZDB 1XR9B 3DX7A 5DD6B 4H88H 1DTUA 4PRAA 5I19H 2F53B 4I18C 4X6CE 4U05A 1NCCH 2GJ6B 1TZGH 4UTAL 1CFNB 1NGXB 2V2WB 3SE4A 3SPVB 2NPLX 4ODXA 4W4OC 5JPMA 2QQNH 4XNZC 2ZUSA 5LCVH 2BNRD 3BWAA 5DHVA 2OK0H 3E8UL 3IJSB 1S7RA 4WV1C 1QNZL 5DI8B 4ZTPH 1QQDB 1IAIH 4HLZH 3DV4A 4G8EB 2EC8A 4MNQE 3MACL 4XXCA 3HI1A 1C16B 4UINL 2XWJA 1EHNA 3C8DA 2APWA 4OCYL 2YWYA 2BJML 3CFJB 4AH2A 2JCCA 1U8JA 3OPZL 4NM8L 2AV7A 5DD0L 4Z0XA 9CGTA 3IT8D 1KENH 3VFTB 1L9MA 1KGCD 3R06A 4NZDA 1KSRA 1B2WH 5J89A 3O6FC 1BGXL 4R0LC 1WCBB 4RMSA 5KG9A 2C1PA 5F7KC 1FCCA 3O2WH 5CINH 1A3LL 1NDMB 1WBYB 4AG4H 1LO3L 3QI9D 1RIHH 1QVOB 1Y18B 1I7UB 3RNKA 1XCTB 1VENA 3CU1A 4P48A 5TDPB 2CDEB 2O5YL 3RY6A 3ELAT 4G9FD 3W82A 3VXSB 5E2WL 4DEPC 2P4AB 4EEEA 2LAGB 1JV5A 4W4OA 5GRUL 3CAFA 1ZEAH 2V7HB 2WINA 1KPRB 2W1NA 2Y5EA 4NO3A 4OD1L 2BNUB 3LQZB 4L4VB 4KJYB 3BIAX 1C12B 1I1FB 3RWIA 2EDBA 1UA6L 2XKNB 5FGCE 3G5YA 1IM9D 3JV6A 1S5HB 4DW2L 2BCKB 1XFPA 4YWGL 1IM9A 2AJUL 2BVEA 3OG6B 5C6WH 2Z92A 5D1XB 4ELKB 3ARDB 3DVGA 5CIPB 1NGYB 4OLYH 2VLME 2FCBA 5EWIL 4ZXBC 3PGDB 5BS0B 4P9HL 3ZYJA 4YHLH 2LU7A 3BP5B 3KPPA 1UCBH 4KHTL 5I8EA 4LCWB 5J6HB 3GM8A 1LVEA 2OK0L 3D0VB 3HLAA 5J12C 3WV0A 5FA3B 4GRWB 4WW1A 5SWSB 3WHE0 2UVEA 5C70A 3I2CH 5F96L 5FECA 1S7SA 3FO9B 3WLWC 1FVCA 3UZQA 4YHNA 5F9WB 4X8JB 1JPTH 3BH8A 5KS9F 1CF8H 3QXWA 3EOBB 1Q94A 4RA0C 5E8NB 4QHLA 1XCQB 5L88L 4WO4B 3IU4L 2R8SH 3QXVA 1RAMA 1BF2A 1NDGB 1BFOA 3W0WD 2OJZH 2VLKB 4U2ZA 3SDXF 1FFOB 1ZLSH 4O2FA 5AUMB 2NXYC 1XF4A 4OZGA 1NFDA 4FTVB 4OF7A 8CGTA 2XQBL 3PP4L 4YNYB 1PSKH 3UTPD 3VFWB 5E4EC 1CLOH 3SGEH 5C0AB 4YDLC 5F9JA 4Z7WF 1CBVL 4LLYA 4U6XA 1DANU 2VL5B 5SWZA 1U2HA 4BQ6A 4HSQA 3MA9L 5C6TL 4JKKA 4JFEA 3SDDC 1VA9A 4PJFF 1F3DJ 1HQRB 2HKFL 3LN9A 4K94H 4WDIB 3OB0H 4Z7UE 2MMXA 1UWEH 2Q87A 3RUGE 2GJZB 4DVBA 4X5WB 2FATL 4OCSL 3TNNB 3STZB 4PLKC 3V5DB 2NY5H 5TE6H 3BN9C 3K81A 4YWGH 2IWGA 3VCLB 3OZ9L 1S78D 3PXJA 5EUOF 1MOEA 1IEAA 2L4OA 4XMLL 5TF0A 2ICCA 5CJ8A 2X4SB 3HMXH 5E99L 1D9KB 5KSBF 2CRZA 3T0EC 3T0EB 3N1QC 3OAYH 2QKIB 3WNPA 5IJVB 1G9NC 1LWRA 3C87A 5DSCA 2H26B 1F4WL 2PYFA 4WIQA 4A6YH 1EEZB 3K8LA 4WFGD 2HTKC 4UIMB 4ZFFA 3GMNB 4YX2L 4AENB 1FFNB 1WT5C 5KZCD 3WFBH 1FZJA 4PTTB 1D6VL 5D2LE 1A6TA 1FORL 3X11B 3MXVL 4QXGH 2P24A 4F3FB 1RIVH 5F88A 1MCNA 5IKCB 1QA9B 2EYTB 2CRMA 3SPVA 5JORB 5H35B 1HH9A 3BP6B 5D2LF 5JOPD 3DECA 1NKRA 5IROC 5E2UL 5FYKL 4L4TA 3FT4B 5F6HJ 1D7FA 5LGHH 4WWKC 2BSTA 3ULVE 2W0FA 3QIWB 5HGAA 4ELMB 4GMSH 1MRDH 3LAFA 1U92A 4PBXA 4UU9A 1HQ4B 5ITBH 4L9DA 1SM3H 4CJ0A 5IMKB 1I3RB 2HVJA 3N50A 2Z31A 4BK5A 4KDTC 3NCJH 2UY6A 2Q86B 5FOJA 2EDDA 5F9DC 3J7HA 3RJQB 2ZCLH 5TGBB 2GTWA 5DWUH 3DRTA 2H2SC 5E7FA 4LLAA 1N6VA 4G9DA 4BQ8A 1NSNL 2X6MA 3FQTB 3AROA 5B8CB 1UJ3B 4Y5XC 3UTZA 5I1LA 3CFEB 2AW2A 1QBAA 2R2HB 5J11B 1GIGL 4P2RA 4PJDF 1FCGA 3RDTA 3ZSSA 1MIEH 1DBBH 3C8KA 4F9LA 2WINB 2PYEE 1XR9A 4KAQH 4HWZB 2DKSA 4C56E 5B3JF 5D2NC 1UZ6F 1T80A 2YPKB 3MGOB 4NBXB 2WWKO 4ELKA 1ORQA 4N8VB 1AO7E 5TF1L 3S36X 1FYTD 3BDBA 3ME0A 4NJAH 4NT6A 4LRIA 4Q6IA 3BP7B 3BXNB 3TF7C 2FO4A 1KT2A 4XHJC 5CZXD 1SY6L 1I1AC 2CRIA 4JGMA 4M93B 1EZVX 4NKDB 1SMAA 3EYUH 5C0EB 1JNLH 1P2CA 1J7VR 3TZVC 1S8DB 5H2BB 3MFFA 5EU4B 5HYJE 3WFCL 1BD2D 4KUZL 4GBXC 2DDQH 5E2VL 2JCCB 5E8PA 2OYPA 1S7SB 3OL2A 3FO9A 3ARBB 1RURH 4KV5F 4QRTB 4XB8A 3PL6B 5CJ5A 2I27N 2BDNL 3QHFH 3G6DH 5L0QB 5SWSD 1AXTL 3F7RA 4HS3A 4XCCL 2DL2A 1C7SA 1BQHG 1EO8H 1V7NL 4I3SH 2IBZY 3FQXA 2P45B 1H3GA 3GIVB 5DEGB 1VGKB 5JW4Q 3CIQA 3O4LE 2JJTC 4LARH 4OFIA 5D1XD 1ZHNA 4ODSH 5I1KL 1WIOA 1C5DA 4X7TB 1QPPA 3O3BA 4LRIC 4GW4B 1C5CH 5EO0B 4I1NB 2HAZA 5ABDE 2VLLA 4DQOL 3NZHH 3DO7A 3PWPE 3JUYA 3AU1A 1IM9B 1O7SA 3LMJL 4P4RB 4FZ8L 3ZDYE 4PJAF 2H2PC 5D1XA 5T3ZH 4OQTA 4KKNA 4X6BA 2YEZA 2AK4D 3SDDD 2UYLA 4LPYA 3WXVH 4ZO6A 3OKOB 3QXTA 4YDVA 3L3DA 3STBA 1DSFH 3GSWB 5KSAC 4JFHE 5CUSH 3AGVA 1E4XI 1R3KA 2OTWA 1JYNA 1NLDL 4RMVA 3PDDA 2JJSA 5EOQH 3HLAB 4OLEA 2BOCB 5JW3H 1ZLVK 1QBLH 1A7OL 3L3HA 1RZJC 3L3OA 1YEFH 1AJ7L 1CLYH 1YA5A 3TPUB 4LSTL 3HMXA 2K7QA 4RAUA 1I9IH 4RGOH 5D5MB 3QQ9C 1JWUB 3CSYA 2JJTA 5DSCB 1P4LB 3MCKB 1JNLL 3S5LA 4TOYH 2VDQH 2XY1A 1WFOA 4YHYC 4RNRB 1SMOA 3G5VA 4ZAKC 4U1HB 3FO0L 3V6OC 3X17A 4M62L 4LDOB 5IW3A 5DMIL 4PTTA 3RI5F 3UAJD 3W0WB 4HULB 1JPST 3X11A 4GKZB 4OZGE 2X4OB 4C4KT 5IBLD 1MCKA 1F4YH 1XF4B 3QCVH 1DN2A 1RUML 1NFIA 4OZGB 3TGXA 3VWKD 1FPTL 4G7VL 1QA9A 2ICEB 4PRPE 3QDJD 3ZE1F 5FKPA 3ARGC 5D7IA 2VXTH 4NN5B 1IGCH 3F62A 5F9JB 2MHAA 5FF6A 4PJAA 5EZIL 5L8LB 1N6UA 3TO4A 4PLNC 1QBML 3MJ9A 4XVSL 4Z7QE 3B5GA 3B9KC 1KB9J 4J1UB 4FQ1L 4F7EA 3JWDC 4ZS7H 1Z6JT 4JHAL 4LGRB 1YEEL 4EI5A 2R0KL 3MV7B 2OL3L 3MBEA 4H25A 4UT9L 3K8MA 5DTFB 5F89A 3TNNA 2EIZB 1FIGL 3C5JB 4I9WD 3MLRL 3HS0B 3O2VH 1B0WA 3QJHB 2R0WH 5I15L 4OAWA 1CGTA 3ZKNC 1VGEH 3U0TB 4MCZB 4ENEC 3R8QA 1X9QA 4KDVA 4PTUB 2OZ4A 4HQQH 2V17L 5CMAB 4EUPB 4Q9QH 4ZS6C 3PABA 1LE5A 3FQTA 3AREB 1QSZA 3SDXA 4ZSOA 4K7PY 3NAAL 5EU7E 4NZTH 2XZCH 3CXDL 3T2QA 1EHLH 1AGDB 1T3FB 4P4KB 5TFSL 4K94C 3HUJA 2BC4B 1GVIA 4UOW0 3IFPA 3NCMA 3ULVD 5EUOE 3LH2L 2DM7A 2PCPA 3UZEA 2FSEB 4HC1A 2PXYC 3OAUL 1AY1L 2VJXA 1VDGA 4YIQB 3NA9L 2HH0L 3N0PB 2EH8H 2VSCA 1MCQA 1BF8A 2G9HA 4RQQB 3NOIA 3T04D 3F58L 2BSTB 5I9QB 4B5EA 5HGAB 5J12B 3P77B 3QIUB 4KMTL 4MWFA 5E8PB 1K4DB 3EYFB 1HQ4A 4PJBE 1ED3A 1KC5H 3PNWA 1ND0B 2RB8A 1YYLL 5DR5L 2Y4SA 4BK4A 1K5NA 2VDOL 1I9RL 2NY2B 3O3UN 3VFGL 2WQ8A 2A1WH 4ZFOA 4BZ2L 5F7NC 1FLTX 3CD4A 1UFUA 4S1SL 1MJUL 3D9AL 5E6YA 2CK0L 3EFDH 4HD9A 4CU8A 1OAQH 1YPZF 3HI1B 5IQ9A 4OF3A 2DQHL 2CLRB 2XWBA 3H9HB 2ICWJ 4G9DB 3NACL 3ZHKA 4WO4D 1U3HD 2XRAH 3WDHA 4KQ3H 3FRUA 3EO1B 2LFGA 1YY9C 2NW2B 5KS9E 4N0UE 3RDTB 1WTGT 4Z7WB 1FO0A 5CSBA 3PIQB 2P46B 2NY5C 1S9XA 2XQYK 3Q48A 4QNPF 2MJWA 2UUDK 3L5WB 1JNJA 4XBGB 5D2LA 2DIJA 1TQBB 5LBSL 1A6ZB 1Y18A 3B43A 2OTPA 1X4YA 4PJBB 1BD2A 2A9ML 2OR9L 4NJ9L 1BD2E 3L3IA 2NY7L 2FO4B 4K2UH 4GRLA 3MNWA 4HIXL 4HPYH 3GSWA 2UVFA 2OTWB 4PG2C 2QR0A 3IU4H 3QQ4B 4MXWL 1KPRA 4L4VA 5C0EA 4LLVB 3GI8L 4O2CB 4P5TB 3IGAA 5IGXL 3JV6B 1EEYB 5GGQH 4AT6A 2WUCL 5D1ZC 2A6KB 2Y9RT 5DJXA 1NCBH 5BVPL 4UV7L 5F96H 2CLVA 4JO4H 5DEZA 5C08D 2X1PA 3VG9B 4BFGA 5KVDH 1CL7H 3GO1H 3CSYB 1J18A 3QQ9D 4JJ5B 2ITCA 5I8KH 3S5LB 5IJKC 1J9CT 4WY7L 2DQDH 4YDIH 4L8SB 1NGWB 2YMXL 1C1EH 1KJ2A 4HG4J 1MREL 4XRCA 5FYLL 5MHSD 1GC1C 5EO9B 5FECB 1CDCA 3S4SB 1EJOL 4G7YH 3QBTB 1FFPB 3VFSA 5F1KC 4YHIB 4CKVX 3W2DL 5L0QC 2XIDA 3TT1H 3NGBB 5ETUA 1W2KT 3MO1A 5E8NA 3ROLB 3MLWH 2ADJB 5EZLB 1YYMH 5AG8A 4JM4H 1MCJA 4PJHF 1BQUA 3RGVD 1B0GB 4NKQB 2YRZA 3NVQA 4U6VL 3C6LC 1MAML 1HH6B 4H25B 5BJTA 1IC5H 1JF5A 3GSVA 1TNNA 3WFEH 3NTCL 4ORZC 2Q20A 1OCWH 2VDNL 1X4ZA 2A73B 5GS3A 3FN3A 1FL3A 3NCYS 4TQEH 3D2UD 3F6LA 2EEDA 4XCNB 3HCVB 5ITFA 2YN5A 4J8RA 5D6CA 4JFEB 5GGTL 5AYQA 3DX8A 4OUOA 2GHWB 3REWB 4H1LA 3ARRA 1HZHL 4DK3A 3LCYA 1GOFA 5D8JL 3QZWG 1LE9B 3DBXB 3P4MA 1G9MH 4Z18A 1NCTA 5DRNA 2I5YL 1IM3A 3UMTA 2WLYA 3SDAD 3NPZB 2BMKB 4O5LH 3PDGA 1NMCC 1J0ZA 2EDNA 3E6FA 5MP6L 3IKKA 5CJXC 4WU5B 2X4OA 2DI7A 3S5LG 1D9KA 1V8HA 4FQLH 4IIQC 3CDCA 5TE7L 2V9QA 4Q2ZA 2AQ1A 4PJIB 1BQHA 1LO5B 2VTFA 5CP7B 3CZFB 4X5LA 4NQED 1AFVH 4LLDA 3NCBB 5I19L 3MLPA 3KXFA 1B0RB 3GSUA 5F3HA 3DHJA 5I1DA 1OAKL 5E2JA 1X5GA 4QXUH 1PD6A 3AB0B 3F5WA 1D5ZB 4R4FL 5GS2D 1I75A 4JZOB 4PP2A 1DEDA 4Y2DD 3GMMB 5KJRL 5F89B 4PRPA 5TE7H 3GJFH 3P0YH 5CEZL 3QEHA 2NMSA 5AZEH 4GG6F 5BMFL 3LPGA 2D4DA 1ND0A 3AREC 5H35A 1HH9B 3G6JA 1U0QA 4JFED 4N0UA 3P73A 4UOW1 2H41A 3QULA 2CKBH 1J8HB 4XP4H 5BS0E 4QHNB 3CVIL 3BZ4B 4YK4C 3NIFE 1G9EA 1GOHA 1ADQL 1T1ZB 1UWGL 4S1RL 4KH2A 5FFLA 5D1QB 2F15A 2HJFA 2ADFL 2EDTA 3DGGB 1I8KB 4KWUA 1T03H 2V2TB 3RWJA 5C71A 3O3DB 4K3JL 1QSFA 4PB9H 4GAJL 1I3RA 2HVJB 2X1OA 1AHWC 1E4WL 4KDTA 2J6EL 2OP4H 1JPGA 3NN8B 2QV2A 4AEHH 1KJVA 3L5WA 3GIZH 1FC2D 1CD0A 2R0LH 5FIEA 1BAFL 2H8PB 2Z31C 3M17B 1IQDB 1PKQE 1QSEE 3U9PL 4MNHB 4X4ZA 4WTZG 3OJMB 2OXHA 3ULUH 1EMTH 4XPGL 4P2QB 5K9OB 5DO2C 3MRLB 1BVLA 2BNQD 5F1NB 1LHZA 3V4UL 2EYRA 3HUJE 3G5XA 5D4QA 4WEUD 5I76B 1QZ1A 3S3PA 4KXZH 4XMPL 4D9RE 5E1AA 3MGOA 1F11B 4EOWH 1ED3B 5C0DB 4MDJB 2QQKH 1YEGH 3WS3B 1FG9C 4ZFOB 4LVHC 5GRVL 2GY7B 4M3JA 2R1YA 2VISB 4HCRL 5BRZE 3GJEB 2QSTA 3HE6D 4JO3H 1HYSD 1NAML 5KTEH 3QZWA 2AKRA 3W39A 4I3RH 3RFZC 5FHAH 4ODWB 3EDEA 2P5WA 5F7DA 3EYUL 3MJGX 5A2JH 3ULUC 3DHMA 3JTSB 2B20A 4XPAH 4ZAKB 4GBXA 4L1DA 3QG6A 1J0JA 4HBCL 1IC7L 4QWWD 1T89A 2AXFA 3TZVA 4KROB 1I7ZA 4JFDE 4UILL 3O0RH 3RA7H 2GYSA 4BSJA 2P5WE 2Y5TB 1E4XL 2IG2H 1P84K 2Y6SD 2FGZA 5I8CA 2HYMA 4ZUVB 4LHUA 4K2UL 4U1IA 1F90H 5FUCE 3B9EA 3C6LD 4NQSB 3L3IB 4WNQA 5KS9A 1QLEL 4AMKH 2GKIA 1GIGH 3KDMB 1VB9A 5GS0D 1UZ8A 1E4KA 5GGSY 4HXAH 5JW4R 3ALPA 3SGEI 2VLLB 2H32A 1NAKL 4LLVA 1CK0L 1U6AH 4R9HA 4AT6B 3RWCA 5D6CB 5HDBF 2FGWL 4ZXBA 4OZHE 3S34H 4NHCL 3FHQA 3LQAC 4IMLB 3BEVB 2EC9T 4NCC2 3DBXA 4JG1L 1UVQB 4PRID 4Q9RL 5ESQA 5HDBE 4JDTL 1W0YT 4G8IA 4HT1H 4XVTL 3NFSH 1J1XL 4CVUA 4IOIB 1QRND 2J8UF 1BBDH 2OBGA 3EDJA 3EJZC 1TPXC 3Q5TA 3ZMRA 2C26A 1FGVL 1G7HB 3BOVA 4J3VA 2C1OB 1ERNA 1OAKH 4PJXA 4R2GC 1BJ1H 3BZDA 3UDWA 1HILB 3U1SL 1MPAH 3HZKA 3WHXB 3FONB 1MHHB 5E24E 3ROLA 3SKUD 2N56A 4RNRA 1KCVL 2X09A 1NLBL 3MJ9L 4BZ1L 1A4KB 1B0GA 2VH5L 4GRLD 2OR8A 1DDHB 1HINH 2P43B 3CK0L 1AP2B 5FA4A 3UJJL 3BKCH 4GW5B 3E0GA 1NFIB 1X5HA 3RIAK 1G7MB 2AJZA 4UDTB 4OGXH 1XGTA 2DWEA 4YGAB 5FKPB 3G6JB 4XCFH 3OXSB 3K4DA 1KIQA 3B8YA 4P5MB 3ARED 4NQVA 3MA7B 4XCEB 1TFHA 2LABA 5J56B 4P99A 4YO0A 1ZVYA 3BGMB 1WIUA 4NKMA 4D9LH 3T2PA 1YZZA 2FB4H 4D0DB 1LO4H 5IR1A 3NH7H 5E00B 5IFHH 1DN0B 3ARFC 5D7JB 4MJIA 1LO2L 4GKNA 5MEPB 4LSSH 1UH2A 5DF0A 5BV7L 1S9YB 4M6NH 4KFZC 3LRSB 4OI7A 3K4ZA 1N7ML 3VW3H 3QHZH 3DXAA 2HKFH 3MOQA 4K94L 4LGSB 5D72L 1EBAA 3V7AG 1GAFH 2WBKA 1A7PH 2VLJE 2X2YA 4YGVB 5DUBA 2VSDA 3WE6B 3E6FB 1DFBL 4GG6E 1P7QB 1NEZB 1HK6A 3QA3A 2VITA 1LP9E 2RFXB 4P59H 5LWYH 3CFDB 2VIRA 1UYWL 1S7UA 5SWSE 5DUPL 3EJJX 2APXA 1B0RA 2VXUL 3GSUB 3W9DA 2NY3C 5I1DB 2XXCB 4P2QA 3ILPB 5EIIA 1JGDB 3H6JA 2ERJC 3OAZH 5C0BE 1D5IL 3P0YL 1DQDL 3SHSA 2EYRB 4EKXA 2AQ2A 5A2KH 5GRJL 3DVNB 4IOFC 4R7DB 2Y07H 4ODXB 2D7OA 1NCUA 2VXSH 3A67L 1S7RB 3D2UA 3GM0A 2XV6B 4NUJB 3PWVB 2M1KA 2HLFC 3PQYA 2AKRB 3W39B 2G9HB 5JW4N 2PW1A 1Q8MA 1HYSC 5GSVB 2R56L 5SX5H 5BCAA 4D94A 3BUTA 4GBXB 4FQJH 5JXED 4HJJL 4MWFB 1IGFH 3A6CL 2AV7B 5F7MC 1IBGL 1RHHA 1EIBA 3TZVB 3F7YA 4JRYA 1QFUL 1OT1A 3VFVA 1EHXA 1WCBA 2LV4A 2PW2B 4YDKH 3UBXG 1QLFA 2L7JA 3UPAA 3BVNB 1RMFH 1SYSA 3L9RB 4ZUWB 3U46B 1NLDH 2D7NA 1KIUA 4EVNB 5BZWB 3KAAA 1JYVA 1CXHA 3DETD 4NC2B 1XF2A 5DMKB 1B9ZA 8FABB 5CP3A 2CK2A 5IW6A 4PGCB 5IFAL 2Y07L 3BUYB 1P53A 4X5XA 1TITA 5C0JB 2ZWLT 2P8MA 4XB7A 4LCCC 3HRZA 4N8PA 4OCMC 4YDLB 4YH6A 1E4KC 1OPGH 4LAJH 1YEDB 4UILH 3KXFE 2QQKL 3KHQA 1DQTA 1A6ZA 4MAYC 5CBEA 2NW3B 4LVEA 4PJCA 2R15A 2VXUH 2BVPB 5DRXB 3MRQB 3ZTNH 1J05A 2ZP0T 3RVTD 1QACA 4PD4J 4DGYH 5IHBA 2WLZA 3A6OA 5H94A 4PFEA 5GSRB 1A7RH 3K4AA 3EOAB 2NR6D 4XPGH 3W81A 4WHYG 5EOCL 5I17B 2J2ZA 1I1AD 1IGJB 1YEGL 1IAKA 1MREH 2A6KA 4ZAKA 5FYKE 3QO1B 2FJFA 5AAWA 4AEIH 4YXHL 4XMPH 3FT2B 4FABH 4RBPK 3WHXA 3EOBA 4JJ5A 1TETL 4M7ZC 5ISZE 4U7MA 5DMJB 5ISZB 1G7PA 4MNQA 5F7YC 3ULSA 2OJEB 4GAYB 3O4OB 1TTFA 3PHOB 1URLA 3D69A 3QJFB 3L7EA 5HYJA 4HF5L 2OTUB 1CG9B 3UJIL 3QUMA 3PWNB 2D3VA 3S7GA 4JZJC 3CLFL 1CIUA 1YPZB 5IJKA 1BEYH 1BBJB 4ZUSA 1AGFB 2JK5A 3GKZA 4FTVA 3QO0A 5GS1B 3P30L 2DWEB 1T2XA 5C08A 1T2QH 4NHCH 1AO7A 3HE7A 1IGTB 2DTSA 1DQLL 1AO7D 3HE7D 2YXFA 4PS4H 4WTZA 3GEWB 1JTOA 5D1XC 1F5WA 3GSNH 1JUFA 5HHNA 2V9TA 4M00A 4MB4A 1CVSC 4F57H 1VACA 1A4JB 4FTVD 1CFBA 4MD4B 5DS8B 4Y19E 3BPLC 3GHBH 4OJFL 3BPLB 4APQB 2IF7A 5BJTB 1Y6NR 2GJZA 1V5JA 5IB3B 1QFUH 4KY1H 4DTGL 3MRBB 4MD5A 1EV2E 5E8DH 4NWTH 2OL3H 4GQ9L 2VC2H 4QGYA 4XCNA 3TJHD 3KR3H 5DC9B 3BPOB 4S11A 4NZJA 3DMMC 1K2DA 1E0OB 5CEZH 3K7UA 5KVGH 4XH2A 2RFXA 4Y5VA 5IK3B 1TMCB 3OBAA 4NRXB 5GJSL 1ES0B 4M43H 3ZE1E 3MRFB 2A74A 5DRNB 1KLGB 3I6LD 4OZHF 3SY0B 5HYEA 3W9DB 3VA6A 4UIMA 4ZFFB 2DD8L 1KTDB 4QYOB 4TVPH 5FHAL 3MNVA 1SEQH 1FYTA 2R4RH 4ETQA 1OSZB 5F88B 1CWVA 5DLMH 4L3ED 1KCSH 5KVEL 2GITB 2F8XC 4XT1C 3CZFA 1A6UL 3TBYA 1HN1A 4ORGB 5C0GB 4N0CD 5E8OB 2YHGA 1CQKA 4D0CA 5GGVH 4OZ4A 1D9KD 3UEZA 3PWVA 3CMOL 5JDSB 3HUJF 3PV7A 1RULH 2I9LA 5I1JL 3FQRB 2FL5B 1ZA6B 2IH1B 3UO1H 4ZYKB 5B39B 5D7JA 2XWTB 3QIWA 5A40E 4O4YH 5E1HB 4WUUD 4UU9B 1BZ9A 5KOVC 4IRJB 5D9SB 5DHXB 3R4DA 1EFQA 3PP3H 4Y5XA 5DJYB 4XP6L 4P3DA 1X5ZA 3BP4A 1ZT4B 3E3QC 2ATPB 2NX5D 1FL6A 3OKYA 4DGYL 4XCCH 5IESL 1J8HA 1QSEA 3I50L 2GFBA 2I07B 4Z5RB 2FB4L 1FZKA 1INDL 1OAYL 2VITB 5DFVC 3VFNB 4BZ1H 1Z5LA 4NKOA 3SDCD 8FABA 3DGGA 4PGCA 3ZYIA 2ADFH 4ODSL 3O3DA 2EH7H 2P8LB 5F1IB 1DCLA 4KK9D 4PJIE 3C8KB 2B1HH 1S7WB 1WVZA 3SCMB 5D93B 5C0IA 4M1GL 2DD8H 4HWZA 3V4UH 4JFYA 3WCYA 4E41E 1YQVH 4S1QH 3THML 3VMOA 1R3JA 4JR9L 4PJEB 5HHOD 1IAMA 4UNVA 5I66B 4WI6A 5IQ7L 5L2KE 1FAIL 5B38B 4NT6B 3OQ3B 3RVTC 3BZFA 4KRPB 3QUYB 3FJTA 5GSRA 3ULVC 4MJIE 4NUJA 4QRSB 1BVLB 2EO9A 5F6IB 4M7JH 4OKVA 3RY6C 2ZUQC 1IGFL 1DBKL 2ZSVA 5I8KL 5IHUL 5DEFA 4Z6AT 5H2BA 5GSVA 2CMRL 4G42B 4O02L 5C8JB 3SDDA 5JA8B 4YHKL 3B3IB 4DUXA 5T5NG 1ZE3C 1QP1A 5F72S 2OI9C 4HV8B 1JGEA 3E6HB 1OLZA 4KVNL 1KB9K 3C8HA 3CJJA 3OXRA 2F5BL 1CE6B 3GK8L 1BQLL 1NKOA 4WHTB 2OTUA 2R39A 4MA7H 3JV4B 1FN4A 3TYGL 1UCBL 4L4VD 3QHTC 4RMTA 1RUQH 2F58L 3O3EA 4CAGA 2A38A 4EBQH 1DBBL 4ZUSB 3MPCA 4FXGA 3V6ZA 1B6UA 4P5KB 3GMOB 3PP3K 2EC9U 4GMSL 1I7ZB 4DW2H 1EGJL 1XR8A 5F7EH 4WO4C 4RAVB 2JJSC 2FHFA 3RZWA 5JHDE 3TVMC 3OAZK 5DQ9A 5CJBA 5AG9A 3HE7C 4FQXC 3MV8A 5KSBE 2OLDA 3G9VA 4X6BB 1NCWH 3HFMH 3OKOA 3TIEB 3WEXA 4LPTA 4YDVB 5ITBL 1X5YA 5HXMA 3O3AB 1GHFL 1RIVL 4U6VH 1SVZA 4U1MB 2AK4A 4JR9H 4LRNL 1G7JB 4YZFF 5IB5A 4XPAL 3F7VA 2PYEA 3RTQB 4WW2F 1A2YA 1SJHB 2D9QB 2VDNH 3CH1B 3DX9A 1JHLL 3DMMD 2BX5A 3EBAA 1HKLH 4POYA 4IMLA 3OJVC 3FT2A 2J5LB 4U7SA 1R5VB 1IC1A 2D0HA 1P4LA 3BQUD 3HMWL 5MENE 1U3JA 4F58H 1G7PB 4MNQB 2BOBB 3PHOA 3BDXA 5JR1H 5JQ6H 5C09A 1BJ1J 3IB4A 4AIOA 5EU6A 1GGCL 3L5JA 4NYLB 3WLBB 3JV0A 3UJJH 1BPVA 4XNQB 4HS6B 3B4NA 4JPWL 4YXKH 3RL1A 4HUWA 3B9VA 1CL7L 4HPOL 3FT3A 4ORGA 1NL0L 3ARZA 3VI4F 3C08L 4PJ8D 4N0CC 4JRYD 5ANME 5IFJA 3M8OL 1NH6A 5GHWH 3EDKA 4UT7L 5KSUB 2E8ZA 3QUKA 2Q3ZA 3TIDA 2DLGA 3MV7A 3X13B 2FHCA 5L6YL 3OZ9H 1E27A 4UV7H 1A02N 4PRHD 4JFPA 2IANE 2UZIL 4HT1L 4S2SA 4EN3D 5EO1B 5IMMB 2ERJB 1KCSL 5DJYA 5KVEH 3LY6A 1WV7T 3BP4B 5KJRH 3U0TA 3RY5A 1ACZA 4WI7A 1FL6B 4XXCC 3VDCA 5IT2L 3C2AH 3LN4A 2QADB 5HSFA 4EDXB 4XPBH 1FNSH 4Y1AD 2PO6D 3PABB 2NY7H 4KK5D 5IK3A 1MCRA 4ZFZB 2XPGB 3KWWB 1JJUA 1FNFA 5CHNA 3MYZA 2XKUA 2DF3A 2A2QT 3BEWB 2BVQA 3RRQA 5HGDA 3N85L 2ADGB 2R0ZL 3KLSA 1BQSA 4P2QD 4JB9L 2DQJH 4GFTB 3KPNA 1L0YA 2LVEA 4QRPA 4UDUB 4R0LA 2HRPL 4I0PA 1OSZA 4JPVL 4KHXH 2GAZB 3FMGH 4JLRA 4GAGL 1CLCA 2C4XA 3LS5H 4JKLA 2APVA 4PJEA 5E5MA 3U4AA 5GRJH 3L5HA 4KQ3L 5FYKH 3L3JB 3MBXL 1CD1B 1NMCB 5C0GA 4FFWD 1VKXB 1ZMYA 1A9EB 3PHQB 4HWBA 1F4XL 1U8OA 4Q9CA 2HLAB 4LVHB 1U95A 2PUQT 3QDMA 4QO1A 3UJIH 4L4TE 1OB1B 3C60B 3PQYD 3TFKD 1BZ7A 4RGMB 4L29A 3MRIA 4OM0L 5C1MB 1KNOA 3V4VH 4M1GH 3DVNA 2J88H 5MI0C 3B3IA 3KGRA 3OAUH 5J1AB 2WSKA 4AK1A 1MCEA 1JGEB 4Z0BL 3OKNB 1UKQA 4Y4KA 3EFDL 3E1F1 4XX1G 1U9KA 4K55A 4WHTA 3B5HA 3CMGA 4FQ2H 3EO0B 4POUB 4D0BA 1U8IA 1P84J 2N7BA 3QDAA 4XNUL 5CILL 5GGRA 2HG5B 4OLXH 3LIZL 4JREC 3U7YL 3FRUB 5DJDA 1EO5A 4JM2F 3GMOA 3FTGA 5L2KD 1H8SA 1WEJL 5FM5M 4ZNEA 5E6IA 1HINL 4XP5L 2CGRH 5D72H 4IS6A 4JFYB 4JG0L 5I75B 4H20H 2VWEC 4Y4FC 3K3QA 4Y2DA 3U1SH 3I50H 4JPWH 4YXKL 3D6GA 4C4KO 3V52H 1MFBL 1U8LA 4WGWB 4F7TA 4Z76B 4Q9QL 1CBVH 1VFOA 4F7CA 1P1ZB 5H8DA 5C0JA 1PAMA 3RL2B 3BRGC 3Q6GH 4RIRB 4KKLC 4XNYH 5EBWA 4JY5L 5E94B 2AEPH 4O2CA 3CDGA 5IB5B 4Y5VC 3CXDH 5ERWB 4OZIE 1KJ3L 3QXAA 4XP1H 3MJ6A 1AGEB 1AGBB 1XZ0A 3E6HA 4HIXH 4HJ0C 4RDQG 2FX8L 3DYMA 5HYSG 3H2WA 2NNAA 5BOZG 4JDZB 4AYFA 4TUOA 3EOAA 4MX7A 1S9KC 5I71C 5T5FH 1FJ1A 3HB3C 4QT5A 3O6KL 1PG7W 4HZLB 5GRWA 1SJEB 1NBVL 3QIBA 1BWWA 1EGJH 5F7EL 3RGVB 1FO0H 1WZMA 1MFAL 2X4PB 3C6SB 1R5IB 2FWOA 4OFYD 3T2NH 5JHLH 5JO5B 3CVIH 5IBUB 2E9JA 2BNRB 4F80A 2W9LA 5HD8C 5SWQB 3ULUD 2VLJD 3MO1B 3C2SA 5C0BA 1I8MB 4HK0B 4HJJH 3C5ZB 3LKQB 5FYJE 1Y0LA 1CYGA 3L7EB 5HYJB 4WUUB 5GQBA 3QUMB 5C9KA 3PWNA 2R9HC 1HNGA 1HNFA 1BBJA 1IAII 5BO1L 3D48R 3QWOB 2AXHA 2AABH 4R97C 1Q0YH 5DUPH 4H1LG 1XAUA 4HIJB 5C08B 3WXVL 3D3VD 1T4KB 2KBGA 4P59L 4AEEA 2O61B 2PXYA 1R6VA 2Q8AL 4XPBL 2DICA 5KSVA 4ZDHA 4EN3C 1G7JA 5DVKA 4KROD 4P3CH 1CGVA 4OLWH 4HX1A 2W38A 3F7VB 5GS0C 4HBQA 1QR1A 2X4RB 4LGPB 1VADA 3VFPA 3C08H 3H9SA 4ZUTB 4DAGL 1INEL 4EDXA 2VDQL 3GJFB 2VR4A 1QLEH 5IQ7H 1J11A 1A6WL 5F3BB 2IPTH 1PJ9A 1EK3A 2PO6C 4KKAD 3BPNB 4LSTH 5E9DD 3SO5A 3NH7L 2PNDA 4EQ2A 4LFHD 3VXRA 4G6KL 4H1LH 1TLKA 2DWDA 2MQ3A 2O93L 1BEYL 4RFOL 4WU5A 3IAPA 3MLSH 1NAMB 3O9WA 4PJ7B 3VWJC 1QSVA 2BZDA 3HMWH 2Q8BH 4M7LH 4HUWB 3HC0B 1OM3H 3MACH 3CDFA 4A2LA 3MRDA 4PJIA 5CP7A 1LO5A 4J4PD 3VRLE 5DK3A 2H6PA 2ID5A 2EDJA 1FV1B 1T5WB 3UJTL 1I7TB 5HI5D 4JY6B 2A74B 5GRXG 2JLLA 2EKSB 5C0RL 1U8HB 3T77A 3ZTJG 2XFXA 1KN2L 1MCPL 4E5XA 3X13A 3TN0A 3GSOB 3GMMA 1E27B 5SV3A 5I15H 3QEHB 4IMKC 1OQXA 1MFCH 4N0UB 3U30B 4K9EL 4MDIB 4NPYA 2ARJA 3DUUB 4OD2B 4X9GA