1ITBB

Type-1 interleukin-1 receptor complexed with interleukin-1 beta
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
310
structure length
310
Chain Sequence
b'CKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-1 BETA
publication title Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (immunoglobulin/receptor)
total genus 49
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 1997-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13895 Ig_2 Immunoglobulin domain
B PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB01
1ZTXH 2C7UB 5GRVK 3DUSA 2J3SA 5A2JH 5DEZA 5IHZB 3BEVA 4YHYB 5I1LA 1BLNB 1BQUA 4L8DA 3WNKA 2XRAH 5AAWA 1T80A 5DQDH 5T3ZE 3SE3A 5GGSA 3KYKH 3I85A 4O2FB 3VFWB 1FVCA 5HDQL 2CR3A 1L4IA 3BISA 3RL1A 3Q2CA 4J3SA 2WMPA 2K7PA 4FQXA 4Z9KB 5C0BA 3ZE2E 5KG9A 5ALCH 3FQUA 2X4RA 1G7PB 3ZKXC 4Y4KB 3C60D 2ZOLA 2VZUA 1NCAL 1MH5B 3F12A 1S5HA 3WFBL 5L2KD 1J8HE 5J13B 4XNZB 2R2HA 1YPZF 5D2LB 5CEZL 3UTZB 2JIXA 4QHLB 1UQSA 5IW6A 1LO3H 4Q74A 1T2JA 1KCKA 4UIKH 4S1DD 1XGUA 3LN5B 5I1EH 1F5WA 1UVQA 3NIDF 1UACH 5F7HA 5IMLA 2IADA 2VABB 4QO1A 4R4FL 2X09A 3HLAB 1CQKA 3O45A 5M7QA 5FUZL 4JQVA 2CDFA 3IFOB 5D2NE 1FRGH 2DQFA 3H42H 1D5XA 5F6IB 4DFIA 1ZOXA 3U46B 3EGSA 1CD1B 4LHUG 4X5WB 5BV7C 1J1XL 5DYOB 2D7QA 4DCQA 3ULUE 1T3FB 1C5CH 1MFCH 5JDSB 3QPXH 3IAPA 3ZHDA 5M94B 5DRWA 4G42B 3IDGA 4ISVB 2VR5A 4M6MH 5I2IB 3D9AL 3ECBA 4ACPA 2NTFA 4OZGB 4UB0L 3UAJC 3O6ML 5I9QB 3QIWA 4Z7QF 1TJIH 3GHBH 1BVLA 1DQJA 1C5DA 2LTQC 3FCTB 5I1AA 1CL7L 4AJ0A 3DX6A 4GQ9L 5EBMB 5ILTL 3SKMB 3S88L 1G7LA 5IHLB 5D93C 4GS7C 3CFDB 1JNHB 4NO2A 1RZGA 1JL8A 3ARPA 3RJDA 1ONQA 4JFOA 1OT2A 4R7DA 1DL7L 3T3MF 4ZFGL 3CFEB 1OSPL 5CGYC 2OR7A 4LOUD 3LB6C 2I9TB 2EH7L 2EEDA 3MJ9A 4HPOH 3FRPG 2AJ3A 4LSSL 5HJ3A 4Z78A 1BFVH 4PG9A 2WW8A 1RPQA 1FZMB 4K3DH 1L7TH 5GGRB 4X6FB 2HFFB 5DA4A 2A6IB 4HJ0D 3RY6C 3F7RA 5GISH 4BJLA 4G9FE 4AH2B 3MOBL 5T1KB 3O8XA 1B4JL 1GZQA 5E03A 5HPOA 3OKKA 2VC2H 3PQYD 2KDGA 1IGTB 1Q9OB 2QQLL 5DMJB 5I66B 1BZQK 1FGNH 3QCTH 4MCYB 4XVTL 3QRFM 4OF3A 5KSVA 4IRSB 4HGKC 4L4VE 1WBYB 2EDOA 4PJCA 1F4XH 4WDIB 2ADGB 1XF3B 4HK3N 4QYOB 2ED7A 2AEPL 4L9DA 4LGPB 3TA3C 5D2NC 2MKLC 1IGML 1IEBA 1OT1A 4U1LA 2PETA 3VRIA 2L0DA 3TO4D 5IP4A 2VAAB 4R0LB 2OK0H 3OAYK 3OKMB 2OTUA 3MLYH 2DJSA 4IOFD 1H3UA 4Y2DC 3O3UN 3FFCE 5T5FH 4PRIB 4PTTA 4RGND 4YHML 4CMHC 3HPJA 2V7NB 5LG1A 3LKRA 4MHHI 2HFTA 2G5BB 3HAEB 1HXMB 1SBBA 3WNNA 4BQBA 2E7BA 4O4YL 4WUUD 1MJJB 1F2QA 1UCBL 1U8HA 1CWVA 3AY4A 5CBAB 4I8DA 1OCWH 4Z5RA 2IH3B 2EXYD 3MO1A 3UTTA 4QHNA 5DD1L 2E7MA 1MFAH 2FBJL 4R96A 3WDJA 4ZQKA 2WUBH 5EFIB 1U3HD 4WI2A 35C8L 3NFSL 4K7PY 2LQRA 5DVMA 1EFXB 3MNWA 1HXYB 4OCYH 3L6FB 3O2DH 4JRYD 1ZLUH 1DQDL 1KLGA 5EIIA 1RZJC 3ZT7A 4PRHE 5K59E 3NIFF 1CYGA 3E1F1 4OUUB 3NA9L 1K3IA 4HS6B 5MEPB 5ERWB 4G8GD 3CVIL 4KTYA 1J9CT 3OXRA 2V9QA 2VN4A 3K4ZA 1XGRA 1DVFC 1V3JA 1VCAA 5CWSA 4WCYL 1XCTB 2BNQE 3K81A 1OAZL 1ZV5A 4HXBH 1JHTA 2NXYC 4P5MA 5FM8A 2VXQH 4H25A 4HMCA 1WZMA 5FV2A 3LSOB 1I9IH 3C6LA 4MX7A 5KW9L 2VB5A 2FGWL 4CW1B 3QJHB 4ZO6A 1C7SA 4P3WA 5HI3D 3EYQD 3QUXA 5L0QC 1J12A 2EE3A 5ISZD 1MQKL 4JFED 1DQML 5IHBA 4G8FA 1CVRA 3C5ZC 5IFAH 1MJ8L 1TDQA 5D93B 3LQZA 4GS7B 4XXCC 4P9ML 1IZKA 1SEQH 3EDJA 2ZG2A 3H0TB 3QWRD 3X14A 3DBXA 1CDHA 3CSYB 5C6PB 1QFWM 3IDUA 3WHXB 2CKNA 3JWNC 1A0QL 3CZFB 4CBPA 2Y72A 4LSDA 4GKSA 4FABH 1XGPB 2CUIA 4G8EB 1BVKB 4LU5H 4X98B 2ICWA 4O5LL 3R06A 4WEBH 3GSQB 4POZC 1OOAA 4OB5L 3VXUD 5C0GB 2LU7A 1I1YB 4WEMB 3RWDA 5FXCH 4PB9L 3MGOA 4DW2L 5C0JB 3O2VH 5KVDL 1IAKA 1J8HB 1NANI 3F58L 4KKBD 4WJ5B 4Z76B 4M02A 3IFPB 3MUGB 1INDL 4WHTB 2ZCLH 2C1OB 3WHE0 5D7IB 5EZJB 2ATPB 3O3DA 2VDPL 4LCWA 3O9WC 4MD0A 3O3AB 4MZ3A 4G80A 3Q5OA 3VWJA 3GEWB 3W39B 3WSQL 3TNMB 4M1DL 1IM9B 3SO3B 2WBKA 4GRWH 4NOBA 5D2NB 1KCRH 3T65A 5BS0A 4PJ5D 4M8QA 5D7SH 3QDMA 5EU3B 3DTXB 1C16A 2VQ1B 4KH2A 3Q5YA 4KQ4H 2OYPA 2OTWA 1U8IA 3MBEC 4D3CL 1A1OB 1FNLA 4ALAL 2AK1H 3OMZA 4A2LA 2JB6A 4P2CG 1XAUA 2UZIH 1NFIA 4YBHA 4YO0B 3G6AB 2B39A 2P5EE 2K9UA 4HCRA 1ROWA 2CDGB 4XBPA 5CINL 1FH5H 3SGEI 3SOBL 4K94C 5J1AB 1TCRB 5T3XL 5JQ6H 3I3BA 1VADB 4GH7B 3QQ3B 4I2XE 4YDVA 1CICA 5C2UB 4H8WL 5A3ID 3L1OH 2YRPA 1KCSL 5DRZA 4QT5B 4TRPL 2D7MA 3MR9B 2ZZUT 3PJSA 1KIRA 1QSVA 4FQJH 1ZEAL 4LASH 3V95A 4IJ3C 4X4XA 3WNPA 5BVJB 3MV9A 4IRZL 5EO9A 2AKRB 2PR4L 3NZHL 1TVDA 3Q6FA 5CGTA 1JNJA 3ARFB 1K5NB 3MROA 1IKNA 4EEEA 1WISA 2J4WH 3QQ4B 4LVHC 2JELH 3WIFB 1MREL 4TPRH 2C3XA 3MRGB 5J12C 4IMLB 4LSPH 1B6DA 3WUWB 3WDIA 5E5RB 3ARDA 4W81A 1QFWH 2EYTA 1UM6H 1MPAL 4PLJD 2D3VA 1X5LA 2ENSA 1NCCL 2Y07H 3DHMA 3FMGL 1KN2L 3P3YA 3UYOD 5GS0H 3BIAX 3ES6B 5LCVL 2IMNA 1KJ2A 4S1RH 5IWLC 2GTZA 2W60B 3GGWA 3SKUD 2ZUWA 3C2SA 4G9FB 3MA7B 3UTQB 4H1LA 3L3GB 5JW4Q 3ZYOA 3ARGA 5K9KB 4KUZL 3GSUB 1RZKC 3RVTC 1PY4A 1OW0A 3ZHLA 3BDBA 5MEND 5GSRB 4L4VB 5D72H 5IBTL 3CFBB 4WO4C 1CE6B 3GK8H 3HCVA 5FYJU 3WJJC 1JF6A 2X4TA 3S3JA 3V0AC 4H5SA 2EYRB 4OJFH 4PB0L 5L0QB 4MHHG 4WFHD 1QR1A 2PW2A 4E42A 1CFVH 2VXTL 1JWSB 3UJJH 5HY9A 3O6FA 4J8RB 4UIMA 5DRNB 5EPMA 1DP0A 4LARL 4BH8B 3HI5L 2J7LA 1KUMA 1U8QB 3FFCB 2FZ3A 2HVKA 3SE4A 3PGCA 4PRPD 3DX7B 1AFVL 1R5WB 3KLDA 4JN2B 1RJCA 4E5XB 2EEBA 5D1ZA 4YHLL 1XH3B 2DQGL 4JR9H 4JG0L 1F3DJ 1NL0H 3HMXH 3HPLA 1JZ8A 5KJRH 4YFDB 3HG1D 4JO1H 3ETBF 2P7TA 2WWKT 5BXFB 4JB9H 1EEYA 4OQ1A 3VH8A 1R3LA 4ZTPL 1MQ8A 1XCQB 2NNAA 2XTJE 2ZCHL 3W0WE 4XBGA 1T5WA 2B1HH 3HB3C 2LFGA 2GITA 5LGHL 1UKTA 3O9WB 5EBWA 1OD9A 4EUPA 5EDXA 4MAUL 1Z9OA 3VRLE 2CQVA 3QEHB 4PRHB 2BOCB 3TNNB 1YY9D 3V7AE 5FDWB 4UINL 1D5ZA 5IF0B 3TESA 1WV7T 5DJ6B 1J88A 2X4UA 4X0KB 4KPHL 2W1NA 4UBDD 2EO9A 1ZS8A 1UH3A 1Q94B 2VSCA 5DGRA 3RWFA 3KGRA 2VLKE 3Q5TA 2YUZA 3WHE1 4Q2ZB 2BNQB 4ZFOB 2D0GA 4OGZA 2P8PB 4ZNEA 1FC2D 5E2UH 1JWMA 2CMRL 1RMFH 1R5VA 1PKQE 5CEYA 1QNZL 4PJFA 4JAMB 1BAFL 2NYYD 3LRHA 4PJXE 4PR5B 3WFHB 1NLDL 3QQ9D 2GYSA 2YD9A 5C0AD 5DFWH 2E7LC 1FNFA 1U92B 2WIMA 3I9GL 1BIIB 2Z35A 3R0MA 5DK2B 3TCLA 5EZLB 2EDDA 5L2JB 4NGHL 4OLWL 1ITBB 5F89A 1FFPA 1X5ZA 3ARXA 4S11A 4XWGH 2DJ4A 2VXUL 3DARA 4G7YH 3TPKA 3FO2A 1H3GA 1QYGH 3S35H 4LVHB 5J12B 1NBYA 4NQVA 3QUZA 4AG4H 4U1IB 4GW5A 1S7VB 1LE9B 3NPZB 3X12A 5CJOL 2GEEA 1RHFA 2ZSVA 4YAQB 2BVTA 1QRNA 1U8LB 3TO2A 4ZYKA 2CDEB 2DQHH 4H20H 2CRMA 5JOEA 2KBGA 3TYFB 1MFEL 1X7QA 1HH6A 5C07D 1OGAA 4PJHF 3SPVA 4GW4B 5JMRA 1G6VK 1QBBA 3KPMB 4JEGB 5H35A 2VH5L 2BDNH 3QUYD 1I1AC 2ZSWB 1T03L 4U0RB 3QHZL 3GZKA 3G5VA 3X3GL 4NQXB 4I4WA 5CILH 2R0KL 4P9HC 2LU3A 3D2UB 4U6VH 5T1DL 4NQDE 2FWOA 3KXFD 3PP3K 4P46A 5D6CB 1OTSD 2B1AL 3EOTL 1JK8B 4MD5B 4GMTL 3MODL 4MLSA 4S0SD 3VW3L 4XCNB 4FOMA 3S96B 2WUCH 4PRBB 3HZKA 4P4KD 4UTBL 4QY8B 2P5EB 1SEBB 2DLGA 2A74A 5HTSA 5JXAL 4OGYH 1B0RB 3GMMA 5EO0A 5JXEA 5DJDA 1QR4A 1T0MA 1MCJA 4XPAL 4HZLA 2Q6WB 2W0FA 4G8IA 2CKBB 1UA6L 2Z92A 4WU5B 3X11B 2UWEA 2F74A 4X99A 4YHPA 1RZIA 1MIML 3U0WL 1DLFL 5C1MB 1VSCA 2X2YA 1GOFA 5E8OA 5KSUB 4GMSH 5KS9B 2NZ9D 5F44A 3SE9L 1JWUA 2BNRE 4FXKB 4R90H 2PCPB 3OZ9H 1IBGH 3EFFA 4NJ9L 4RX4D 4NQCD 2UVFA 3U9PH 2W65A 4D9LH 1M7XA 4P2OD 3VCLA 3MLXH 4BZ1H 4GRLA 3AAZB 4M62L 2R1XB 4ZUSB 3VFPB 4I0PB 4OLUL 3WIIH 4ERSL 4QLRA 5DK0B 3ELAT 4P2RA 1WUNT 1F6AB 4PRNA 1T0NB 2HG5B 2DYPD 1TPXC 2ORBH 4N9GB 4NUGL 5DS8A 2APFA 4BELD 1A6VH 3FQTB 1CD8A 3QCUL 3UEZA 4N0CC 4F15C 2H8PA 1MFDH 4HWUA 4M6OH 4QRQB 3HS0A 1NEUA 5EWIL 1CFTA 1RIVH 3GMRB 1TNMA 2LV4A 3WIHH 1HHIA 4JDTL 4PJ8A 2Z91B 3UZVB 4MNQA 1PZ5B 3QJFA 1NCBL 5HHOE 1T20A 2IJ0C 3ALXA 2F8OA 5DK3A 1CDCA 2YD8A 32C2B 3LN4A 3A67H 1QKZH 4MAYB 1X4ZA 1I8KB 4BZ2H 1INEH 4KKAD 4OLZL 1EJ6A 3L3JB 4JO4L 1WQVT 2EIBA 5F88B 4RQQA 1HZHL 3IXTA 1IM3A 4DN4L 3GJFA 1RFDL 3RHWK 1CGXA 3BGAA 4WWKD 1TVHA 5CJ5A 5C0EA 1PYWB 5B39B 3HR5A 4KRLB 4WW2A 4ONHA 4U1KA 1HQRA 2AJXL 1U95B 1MHCB 4YDKH 3E3QE 3UYRH 3BW9B 3EJZC 1HHGA 3IDMA 3PWVB 1NGXA 5DMGD 4OLVL 1FGVL 2ZJSL 3PL6A 4WTWA 3PWPE 1ACYL 1OTUD 3H7BB 4WUKL 1JYVA 3AM8C 3STLA 1UJTA 5CEZD 2GK2A 5AAMA 2BHUA 2AP2A 1IC5H 2XTJB 3U4AA 3V5DB 1DANU 5IGXL 3W0WB 3JV4B 3LEYH 4ZXBA 5DJZA 3V2AR 3SGJA 5D7JD 3D85A 4QNPF 3GSOB 3KPQA 1F4YH 4RAVB 3EYVB 4P3DA 2W9EL 4ETYA 3GM8A 3RUGE 4M7KL 2F58L 2IQ9L 1MWAA 2WQ8A 4F7CB 4X7DC 4KRPD 2VXVL 1AR1C 5JUEL 3T0EE 1YN6A 4S2SA 2HT3C 1WWCA 1CF8L 3B3IB 5FKAA 4XTRC 5C09E 4PY8J 2P24B 2X4OA 5IV2A 4ZFZB 4OSUH 4M4PA 2DL2A 4KI5E 5D7IF 1M6OB 5I75C 3LQAH 5DA0B 1IQDA 1NH6A 1T89C 5FYJD 4PJGE 1KPRB 2G60H 4UQ3B 3ARBC 1AXTL 1YPZA 1PKQB 3CGTA 1FL5A 1FG2A 3QYCA 1UENA 4NM8L 3RVXC 1P2CB 1QEWB 1JI1A 5HI4D 2NZIA 2I27N 1IGCH 4Z7UE 2DQEH 2JJVA 5HDOA 3HNSH 2Y25A 1CXIA 1D9KD 4JM2C 3D25B 3PDDA 5EIVA 3QG7L 3U6RA 3THML 1ZSDA 1N64L 1N59A 3S8WA 3UO1L 5AG8A 4DGYH 3GRWL 4K2UH 3FOMA 4Y5XB 5MERB 3HE7C 4L3ED 1G6RB 4K71B 4W70A 4Z6AT 2DTMH 4E41E 3ARYA 4HFWB 5DJ0B 3ZZ1A 1EO7A 2IPUK 4X5XB 4RFEA 4CNIA 2Z8SA 2NY4B 3AXLA 3NAAL 4PYGA 4P2QD 1KCUL 3TVMC 2NY1C 4WFED 1QSFE 2CJUL 1SM3H 3GI8L 2VWEC 3U7WL 2NY3D 3ULVL 4F15B 2QBWA 4I3RL 3FRPA 4KXZI 4LDEB 3FONA 2GJZA 5E6YA 3TT3L 2PF6A 4IIQC 4N8VA 1KIPB 5IW3A 4ELKA 3JUZA 3QXAA 4U7MA 4H88L 3H9SD 3VGEA 1KJMB 5IB5B 2E3VA 2H2PC 2VL5B 4XMLL 3B9VA 3QO0A 1K9TA 5ALBH 5I8CA 3IJSA 4P5TC 3FHQA 4U1NA 5INCB 4MJIA 1KJ3L 4NQDB 2QSCL 1KTKE 1C7TA 1FN4B 3T0EC 1NC2D 2IBZY 4NUJA 4APQA 1CXFA 4QOKD 1A02N 4XNUH 5J9PA 4KTDL 4KI5C 5FECB 1A6AB 1DSFH 2VDLL 5CMAB 4UT9L 1AHWC 1QSED 3DSFH 4XP5L 2DQTL 2G75A 4DZ8B 5EO1A 5JORB 4KK5C 4CVXB 3FN0H 3PDOB 1GC1C 1TMCB 3VG0H 1S7SB 3KLSA 5E2WL 4N0RA 3HRZB 4QRPA 4MNGE 4R3SB 4CDHA 2DKMA 4W4OC 1WFTA 2ZUXA 4FFWC 3E0GA 4XPTL 1ZHLA 4J2XA 5LGJA 5IBUB 5I73B 4HC1L 3BESR 5F1SA 3DRQA 3WLWD 4YUEL 5E6ID 2YKLH 3MJ8B 4QRTA 1NGYA 4HIEB 2I24N 3CC5A 2BNRB 1KPVA 5EH1A 1ACZA 3BZFA 3HUJF 2D7OA 3PF2A 3TYGL 1KEGH 2J6EL 5SX4H 3MYJB 3OPZH 1FZJB 3I6GB 2XZQL 3U4EB 3EDKA 2VZVA 5FOBB 5DT1H 5IROC 3PHQA 1KXVC 1OB1A 1MRFH 3QULB 3ZE1E 4LPVA 3KYMB 3HE6A 3LKNB 4EXKA 1T7WA 2XZZA 5KSBA 1A9BB 1Q0YH 5ANME 1U91B 5I75B 4ZD3L 3SBWA 1T1YB 3GNMH 2GJ6A 2P45B 2PO6D 3UCRA 3QZWG 1T6WA 2OCFD 2XWBA 4KJPD 4N0UA 1NGPL 1FJ1B 4AIZB 3ZTJH 4L9LA 5L2KE 4OGXL 4MNHA 2J8UE 3K4DA 5HHOB 2BC4B 3V9FA 5L8KB 1J86A 4JM2B 4B50A 5KVFL 2IALA 1IZJA 1NEZG 15C8H 3QIBA 5AZ2H 2ERJC 5E8EA 3IF1A 3FFDB 3M8OH 3QFDA 3OAZK 3KPRD 5B38A 2HN7B 1RI8A 1UADC 4BQCA 2YD2A 3MRLA 4CVWA 2NY5L 2W0LA 3RPIA 1E6JL 5JNYB 2IFGA 3ET9F 4MGXA 3GUTB 4OLXH 5IB1B 2P5WE 4BKLB 3DXAA 4FQCL 3PWPB 3VFTB 4PGBA 3UJIL 1K6QL 5GS0D 5GGUB 4LRNH 2FNBA 3KLAA 2VDMH 5HGDA 3UXFA 1T1ZA 2EIZA 3F7PC 4EN3C 3VFRB 3D39A 4XZUB 4HG4J 4KVNL 1OARL 1ZLWH 4X6EB 2BHYA 3T3PE 4F7EA 1J5OH 3LH2L 3RUGB 2EE9A 3SCMA 3BDYL 4HIJB 1KLUB 3MGTA 5CP7A 4EIGB 5IEHB 2F53A 3QA3B 3T0EB 3QCVL 1Q72H 3Q3GA 5C09B 1DQQA 1I3RA 3ROLB 4A6YA 3BZ4B 1S78D 3IDNA 4Y5YB 1IEHA 5JW4M 5D5ME 4PJIA 3OAYH 4PJGB 5HYJD 1NGWA 3C60C 4ELMA 1HHKB 4HGWB 1K2DB 1RIUL 5T3XD 4KHXL 1UWEH 1CFSA 4XB8A 3TJHD 2O26U 4Z7UB 3PQYE 4HUUB 2BNUB 3IU4H 2NMSA 2NY7L 1NMAL 1CGSH 5F70A 4CU7A 1SVCP 3SGEH 2XPGA 3RBGA 5IQ9B 3WS6A 2BSRB 3G5XB 3VG9C 3JV6A 1YEDA 3RWCA 4JO2H 2OJZL 2FEDD 4KAQH 3LZFH 5TF1L 4ZFFB 1PX3A 3O6LL 4XCYA 1T66C 1CGUA 1U3YA 1ORQB 5GIRA 3A6BH 4E41B 3D0VA 1XIWD 1LNUB 3G6JF 4CN6A 5HYQB 3UZQA 4QRSB 5KN5B 4XNMA 2FIKB 4JJHA 3GSVA 3NACL 3BGMA 4LBEA 3HI6H 5FGBC 5CZVH 3GMPB 1ZT4B 4JZOA 5KS9F 5GRJH 1QSFB 1VENA 4RGNE 5GRWA 5AWNH 5C7XL 1JGLL 1Z9SA 1EZVX 2ZPKH 4UILL 4WUUE 4PJEA 1GRWA 5B3JE 5CJQL 1WEJL 1A14L 5BVPH 4U6TA 1QQDB 1K4CA 1WAAE 1UXSA 5CIPB 3WN5B 2HTLC 3PIQA 3BKCL 1KELH 1ETZA 2WINB 2IGFL 1MJ7L 1G0DA 4AEHH 4NCC1 1I1RA 1XF1A 2AJUL 4QXTB 4YR6B 1Y6KR 2H1PL 4FTVD 3HNTH 1OAKL 1E6OH 1KPUA 3H8NA 4JRYE 4M7JH 1A7PH 4HIIB 4CADA 4NC1C 4KMQA 3UTOA 3ZT6A 4NO0A 1KCVL 5L9DL 4HUWA 4OD2B 2VLJE 2XY2A 2AJYL 1TETH 4J7RA 3TN0D 4G8GE 5MEOA 5T3ZL 2YPKB 4YX2L 1DN0A 1LP9A 3VXNB 4LHUD 1DANT 3K8LA 4MNGB 5EUKB 1NUNB 2QLVB 3ZYZA 4L29B 5JR1L 2KL6A 4BM7A 1T4KB 4ZO7A 3S34H 1GGCL 2CK0H 5J6HA 2EYSA 4Y5VA 3KHQA 4HFUL 2X4PA 2Y6SD 4Q9RL 5E8NB 4OZIF 5J7CC 3ZDXF 2N4IA 5DC0A 4YXHH 3RDTA 5ISZE 1I4FB 4JFEE 4C56B 2ZUTA 1JTTA 4M9PA 3PXHA 3GBNH 3K2UL 1YNTB 1YYML 1KTLA 2R29L 2W38A 3G08A 3TO4C 3REVB 2YN5A 4V2CB 4QRRB 1HK6A 5F3BB 5IMKA 1KENH 1IAOA 1NBVL 4OF0A 5C0DB 3RWHB 1YUHB 1B2WH 2P8LB 3IETB 3MUJA 3LIZL 3OXSA 4MJ4A 3T8XB 1NCAH 3DYMA 4Q6YA 4XB7A 5I18H 3VXUE 5DHYB 4AEEA 2IPUG 2YBRB 3C60B 4GG8B 1EHXA 2NXZD 1D7FA 3BPNC 3NN8B 3LKPA 5L2KB 5EU6E 4RAUA 1NAMH 2J8UB 5CD3A 2A38A 2HA1A 2AV1A 3BRGC 5EU4A 4Q6IB 3V6OE 1F13A 4L4TA 4ZAKD 3VFGH 4R4FH 2QR0B 4KK6D 3E8UL 1KN4L 1QA9A 1EGJA 1TVBA 4D8PA 2PXYC 1NDMA 5FUZH 4GAFB 1EV2E 3BRDA 3F7QA 2CO6B 1BQHB 1RIHL 3FZUD 2BCKB 1PLGL 5JOPD 3RNKB 4PJ5E 1JF5A 3BP4A 3CUPA 1NDGB 3SKNB 3B9KA 2BSTB 4I3SL 4Z7VE 4RSVA 3UDWC 2NQCA 4KROD 2P5WB 5EZIL 3HN3A 5DRXB 5DZOA 1J11A 4LLDB 4QTHB 3TFKC 2AV7A 2VZTA 4G9DB 5T1LD 5F9JB 1DBMH 4W6XB 2B4CH 3TPUA 1SBSL 3CDCA 1CDYA 1BFSA 3TBYA 4Q9QL 5D70H 3UPCA 3O6MH 1ZA3A 4MJ5A 1T5XA 1UB5A 1KBGH 1G9NL 2FB4H 3TBWB 5LJYH 4H0HB 4OI9A 2UVEA 1AIFA 1CGVA 2JF1A 1RSFA 1CL7H 1IC4L 4GQ9H 2I07B 5ILTH 1ZANL 2NW2B 3MRIB 1QFPA 1SYVB 5LXGL 5D7LA 4YQXL 1U9KA 3SDXF 4XAWL 4XNQB 2ICES 1YMMD 4ZFGH 5GZNC 1JZ3A 5C07A 2NR6C 5EN2B 1SY6A 3FB8B 4EDXA 4EVNB 2EH7H 4IEFB 4K8RH 1MI5D 3D18B 3UTSA 4YBLB 2D31B 3KPLA 4EQ2A 1V3KA 1BM3H 3C6SB 1ULVA 4Y1AA 2E27H 3BQUA 1OD7A 3OKNB 3TBTB 5D5MB 1RURL 3E6FB 2FATH 5E94B 4EI5D 1B4JH 5TPWL 4YGVB 2PW1A 3H3PH 1WSST 5MHSD 4KKBC 2L7JA 5CFHA 2IPTH 1J1OL 2YXFA 4O2EA 4XVTH 5TDPB 3PQYB 4P4KA 3SDCD 1ED3B 3MRMA 3O81A 4XCFL 3V6OC 1WIPA 4MXWH 5MENE 3FT2B 3D69A 3L3OB 1Y18A 4BFGA 4NOFA 3RRQA 4NZUL 3WLBB 2A6DB 2OXGA 3U7YH 2AEPH 3V4VL 4RMSA 5C8JB 2GSGA 4TOYH 5JW4N 4CL7A 3BO8A 4NT6A 4HKXA 5BZDB 4HPYH 4WFHE 3MRPB 4RISL 3O3BB 5C0IB 2NX5B 4HIHA 3VXRD 1RZJH 3WNMA 4MDIB 1FSKC 1X4XA 3JTSB 3TO4B 2ARJQ 3MXWL 3QPQD 1XF5A 3VFVA 1JMZA 2VDKL 1XGQB 4QTIH 3MLRH 2W0KA 4NQCA 5GJSH 4PRPE 4RGNB 2WBJD 3UPRB 1JRHL 3KNBA 1S9YA 5HGHB 1A7NL 1OAUL 1NKOA 3IU3A 3P9MB 4LCIH 1OP5K 4PP1D 4WUUB 1OAQH 3M17A 5IESL 5SWZB 5A3IC 5AYUH 1NC4D 1T7XA 1K4DA 3L9RB 4PJBE 4GG6E 4ZFOL 3HG1E 4G43A 3DNKA 1MHHB 1YECH 2BZDA 4XP4L 5IHUH 4F57L 5IT2H 3MRDA 4NNYA 4CKVX 4X6CE 4K94L 1U3HB 3QUMH 2R0ZL 5C71A 5EG6C 3KPPA 2F9BT 5TE6L 3SE3C 5TDOA 2FD6L 3IJYB 3FKUS 1E4XI 1D5BB 2ADFH 2ZOKB 1FNEB 4AM0B 5FO9B 1VPOL 1Q38A 1DEEA 2VLJB 4BFIA 4ONFL 3HZMA 4PLJC 5TJWK 1CE1H 2Y9RT 4G8GB 3MREA 1C08B 4UNTA 3G5YA 4MCZA 1WZLA 1RZ8B 3CFJB 3ARTA 1OAZH 5DMKA 4YZFF 4OF7A 4X6DF 5BQ7B 4G3YH 3HC4L 4RBPK 3SGKA 1PG7H 1GPOH 3FRUA 3P30L 3QEQA 3KHOA 2FGWH 5HGAA 2DDQL 3E2HC 1EHLL 2Q3AA 3D3VD 1JHLL 2O5XL 1EEZB 4WU7B 1V7NL 2NTSP 4J4PD 1YEEL 1NFDF 1T22B 5DJ8B 5C0AE 4JQVC 2WAHA 5CUSL 5ISZB 1RZKL 3ARWA 3VXSA 5GGSY 2AXFA 4JN1H 3ZTNH 5ACZA 4OF5A 4F33B 3ILPB 2BSED 3MRFA 1AC0A 4JM4L 4ESKA 1UKQA 5E08L 2CH8A 1PQZB 3H2WA 4Y7MA 3B5TA 1CR9H 1RUAL 4XXDB 2DBJA 5IR1B 4TSAL 3PP3H 4OQTH 3B6SB 2GI7A 4O5LH 2W0PA 3TIDB 1LD9A 3BKYL 3L5WA 1TQCB 5KVDH 2VDNH 3WFCH 5I76A 3F58H 2NLJB 1NMCB 3K0WA 3QWOA 3QIWC 4ZPTA 3EW3B 4GKNB 1INDH 1JPSL 5EU6B 9CGTA 2HFGH 5EUOE 2R56L 4HXAH 5AYQA 3U2SA 1ZT7A 4NWTL 1AC6A 4ZDHA 2YPLD 1VFOA 2VYRE 4R8WL 4JGUA 4X7TB 1S7WB 2CKBL 3WSQH 3UTPD 3I6LD 4M1DH 4ZNCD 1P4IL 4LVOC 1FVEB 4ODXA 5EA0L 1T1WB 4YFEA 4ZOEA 2BVYA 5MP6L 1YY9C 1ZAGA 2FX8L 4I5BB 4LKCA 2XQYK 4OV6F 3KXFE 3BH8A 5IVZA 4PJ5B 5JPNB 3B9EA 4LFHG 3VE0A 1F00I 2QHRH 2VZ3A 4XHJD 3OKOA 5F9WC 4GOSA 2R2CA 3S4SA 2Z93A 4C83A 4UZGA 5FK9A 2AXGB 1XR9B 4Z7VB 3UJTH 4RZCB 5CINH 4HUVB 4Y4HD 1DLHA 3O8XC 1TJGH 2HH0L 4F3FA 2HWZL 1ZWIB 3NZ8A 3QUKB 2OS7A 4NQUA 5BRZA 4UT6L 3PGFH 2KPNA 3W81A 4GAYA 2DIJA 2GCYB 3NCYP 5INDA 3TGXA 5D4QA 5HYSG 1XGTA 2BVQA 4KMLB 1IJ9A 2EDEA 2BOBA 4NM4H 3IFLL 5TE7L 1ZEAH 2Z31C 3P9LB 3DHJA 4IBLT 3ZKQD 1RVFH 1KJVA 4WHCA 2PR4H 2X89D 1FCCA 2I60H 4U1SB 4L8DB 3GMOA 4JPKL 2R2EA 3HRPA 3LKOB 2DKUA 1H3VA 1N0XL 4LSUL 1S7XB 1WC7A 2HFEA 1FVCB 3E6HB 3RL1B 3V5HB 4ZUTA 1UZ8A 5LCVH 4OF8A 4AL8L 4ODUB 1WIUA 2A6KB 1INQA 4OFYA 1FV1A 3V79C 1ZHKA 4ZUVA 3UC0L 3V6FB 1BGXL 4AEIL 2JB5L 3WFDL 1CBVL 1U41A 5CLWA 1IVLA 3B2VL 4NRXB 1CLCA 5IBTH 2JIXB 2D0FA 5A16B 1Q1JL 4RMRA 3VI4F 5MENB 5ITBL 1AI1H 1XGUB 3S37L 4X7SL 5IB3B 1KIUA 4GLRH 2FLBT 2G9HA 3Q6GH 4K7FA 5GGTH 3OKDA 1G7HA 2AI0L 1HHJA 4N0YL 1DBJL 2VE6B 3DMMD 1KEML 3O45B 4EJ1C 3MLTA 4DUVA 2FJGB 1W2KT 2AEIT 3QDGD 2DQFB 4RFOH 5E5MB 4LVNC 1UH4A 1LK3H 3HI5H 1IGIL 1YY8A 3EGSB 1YJDH 3QXDB 4HKBA 5E6IA 2RAMA 5HVGB 5F7DA 3NCJH 4LKXB 1UZ6E 3F6IA 3QUMA 1JHKL 2EKSA 4P9HL 5B22A 5IK3A 3L3DA 4Y2OA 5I8EA 3IDGB 4YHLH 5FAAA 1K8IB 4OM1H 2PYED 4M5ZL 3STZA 3DJ9A 4PJBB 5ID0A 4GG6B 1RK1B 5DUPL 3HG1B 3M45A 1MFNA 4WI5A 4D0BB 3DV6A 1G7MB 5GSVA 5FKPB 4NDMA 3VGAC 4X6CB 1BZ9A 3V6BR 5LGHH 4U05A 5DMYA 2Z0BA 1RZGB 4PUBL 5F1OB 1UM4L 3MJ6A 4R7DB 1T2XA 3P4OA 4X9GA 2XWTB 1T21B 4O2CA 2O61A 1FFOB 1JPFB 3NCMA 1X6NA 4KPHH 3G5ZB 4YNYA 4JY4B 4P2OC 3OKLB 2GTWA 1EIBA 2AJ3B 3IRZA 2O5ZL 1G7QA 5I19L 3N06B 4HAFA 1G9ML 1QACA 4I18A 5FA4A 1EZVY 1HDMB 3AMKA 1G6RL 4OZ4A 4ONOA 3VXQA 1R3HB 4HK0A 5IVXF 1HN1A 1MCWM 1MRCH 1QPPA 1QNZH 4LLUB 5EOTB 2BSSB 3U7AA 2A1WL 2IAMA 5FYJE 2FX7L 3LD8C 1NUFA 1RJLB 3GIZH 1NSNH 3I9GH 1LO5B 4X7EC 1P7QD 3NFPB 2Z31B 3OKYA 4JFZL 3X17A 5C0AB 3F7YA 4FQIH 1WWBX 1GAFH 1QBLL 2X5PA 1N8ZA 4RMTA 5IOPA 2FDBP 1QLEL 4LRIA 5IB4A 2MHAB 2V17H 4TUKH 4IRSD 4JLRB 3ZKMC 5FUOH 5F7EL 3W9EA 5E9DD 4YFLI 4J3UA 1NGZB 1TZIA 5AZEL 5I16A 4L3EE 3EYSL 4KK9D 3QFJA 4LLQB 4ODHL 5HSFA 4M93C 1M05A 4PTTB 3MCKA 4EI6B 2BMKB 3GMNA 4L5FH 4O02L 4MWFB 4U0QB 2OR9L 1AO7A 4JREB 4M6NH 3WO3B 4HKZA 1CICC 3S7GA 3RWIA 4P2QE 4GO6B 3RQ3A 5DR5L 4WFEE 1W72H 4PRID 2V9TA 2LABA 5IIEA 1KOAA 2VH5H 4L1DA 2H45A 3TBSA 1YEFL 1W0YT 3MNWB 1I85A 1XR8B 2Q76A 1A6ZA 1U58A 3H9SE 3HMWL 2B2XL 3MRQB 5D71H 3OTTA 3J8F7 4Z7WE 2YPVH 5T1DH 3CXDH 2XACC 4HBCH 2W07A 2FJHA 3ARDC 3VWKA 3L3KA 3R8BB 4UU9B 5HGBA 3KXFB 3MODH 4JFXB 2I5YL 3HNVL 1EFXD 4LVNB 4QOKE 1RU9H 2BVPA 3BH9A 4W4NA 4DAGL 2BRQA 3OXRB 4M61A 3MACH 1RV6X 4DK6A 1IQWL 1FIGH 4NRYA 2BRRL 1EO5A 4IRJA 1F3JB 2WIIA 3GFUA 4LLMB 2W91A 5CWSB 2CGRL 1QSEE 3M1BB 2OQJA 3IB4A 5IW1A 4NQED 2DD8H 1OW0C 2GIYA 4FQLL 3I02A 3CDGA 3PHOB 1YEHH 4TVPH 3J7HA 4D0DA 3QISA 1T1XA 3IFNH 3O0RH 4GUPB 1MIMH 1A9EB 8FABA 1VKXB 4AMKL 4K9EH 4PD4K 1YNKL 4PJ9A 2DQJL 4FFZL 3VFNB 2X70A 4TUJA 2IF7A 1HOCA 3VGAB 3K80A 3O6FC 1V3MA 1G7IA 4XPBH 3BD4A 1ZT1B 1CDGA 4CVZA 3MLVH 5FHAH 1I8MA 3UAJD 4NBYB 4YPJA 4BK5A 3F62A 3QNXA 4M62H 3SE4C 5BOZG 3L7FA 2V7HA 2NCMA 1KB5H 2E9IA 1OM3H 4P2OB 4KJWC 4MA3A 5GGTA 2UUDK 3MLWH 1MCWW 3VFSB 3A0OA 1Q9KA 1WZ1L 3OAZH 1M7DB 5D1ZC 3FB6A 1YEIH 3RWDB 4GRWE 1OPGL 3OKEB 2DYPB 3OWEA 3BAEL 1P4BH 4QF1B 1BF8A 1X5HA 3OJVC 5CGYD 3GBLA 3LB6D 4OM0H 1XGYL 5FO8B 5EWIH 1B88A 2R0WL 3BJ91 1AXSA 4MA8L 3KYOA 4LLVB 4OTXL 1O0VA 3LD8B 1YMHA 3FQRA 2VDRH 2JCCA 4OD3H 1SJVA 2M8XA 3RNQA 3R4DA 5JTWA 3GI9L 4G80B 1J8HD 3PWUA 2R8SH 5H8DA 2HKHL 4NKIH 2Q7YA 1S9VA 2DN7A 2OLDA 1DQLL 3BHBA 1QO3B 3QI9C 3ULUF 5C6TH 1ZGLB 1UB6A 1DJSA 3QRGL 4UDUB 4WWKB 2AJXH 4JY6B 7FABL 3KPRE 1NFIB 1A2YB 1UGNA 3TA3D 4M93B 2XQYG 4LLYA 1FGVH 2D2OA 3AS1A 4K8RD 2ZJSH 4K23H 3AC0A 5I17B 3KS0H 4OD1L 1YQVH 4OCSL 1J1PH 3VXMA 4G6FD 4W68A 3UROR 3SKJL 3K7UA 4Y2DD 1DE4A 4HDIA 3CU7A 1E4WL 5FCUH 1TQBC 2XA8L 5IGXH 2VLRD 5EO9B 3DUUB 1P53A 3Q6FB 3PABA 2WZPD 3DRTB 2YD7A 2KQMA 3N1QC 6FABL 4M3JA 1QTYT 4GFTB 4OZFB 4OZHA 2VXSH 4TSBL 2W9EH 1MHPH 4GAJH 4KZDH 1F58L 4OV5A 2DLFH 3QEGL 2QSVA 3RIFF 3QUZC 4LPUA 1J0ZA 3B9DA 5CKGA 4YFLF 2VXVH 3MA9L 4FNLL 1I3GH 1CF8H 2CIIA 1R3JB 1U93B 3MV8D 4DEPC 2HLAA 3AU1B 4FS0A 3DI2B 1MIEL 1P7KB 1JF1A 2PKDA 1ES0B 2YN3A 1LE5B 1HYSC 3SDDA 5F8RC 5JW3H 4PJDA 4M5YL 1AXTH 4DKFL 3VI3E 1HH9B 1MCDA 2R0LH 3KVQA 2R4SL 3SJVA 5HYJE 1ZMYA 4P23C 2R69H 1ITCA 1FZOA 4U6XB 4MS8C 3HCVB 6CGTA 1NJ9A 5JA8B 4MNQE 1S9WB 1DVFD 1RAMA 4LNRB 4PJAE 3GBML 3EO1A 3U48A 1QR1B 1D9KB 4W6YB 1N64H 3S6CA 1G1CA 2ENYA 2NXYD 3S36X 3GRWH 4L4VD 3O6FB 4Q97A 3MNVB 4ZO9A 5FYLH 4HQQH 1TCMA 3BKJH 4L3EB 4U1MB 3FO1A 5IKCB 3VFMB 3AGVA 3RGHA 1IE5A 4HHAA 4GKOA 1P1ZB 1X5XA 3C5ZD 3DIFB 5DMIL 4N0FA 4J6RH 4MXVE 1JYWA 1KCUH 4TQEL 3QEUB 5D1ZB 1MI5A 4P2QB 3H9HB 1SJXA 1TTGA 3MSPA 4BSWA 4NJAH 2BVEA 5GS0C 1U8NA 5D8JL 2NY3B 1YA5A 3PV6B 3CLFL 1VERA 3VH8B 3CK0L 5BJTA 1MFBH 4XMLH 4ODTH 4POZD 3T4AB 1RZFL 4XBGB 1A6UL 5DI8B 5DJ2B 3H9SB 2EDWA 4JG1L 3P0GB 3UBXB 12E8H 4Z7WB 1KJ3H 1A4JA 2QSCH 1DFBH 2P8MA 1A7QH 4JRXA 4P3CL 1JNNH 1PFCA 5DUBB 5MEQB 4GRLC 1WCQA 2VO5A 4X4YA 4Y4FA 1NC2B 3EYOA 2BVOB 4FTVE 4KTDH 3QI9B 4U6YA 1ADQH 3ALPA 3O9WD 1TZGL 4XP5H 2DQTH 1N2RA 4WV1A 5DEFB 2YRZA 3KR3H 1QSEB 2I9LB 1U8OA 4YWGH 4TTDC 5KSAC 1H0DB 3RY5A 4PBVC 3QSKB 5CEYB 4XCEB 4EOWH 5HHXH 4KDTA 4V1DD 4ZPVB 4PJ8C 4PJ7F 3TJHC 4XPTH 3RTQD 3U30C 3MBED 4NYLB 4FQ2H 3MRJB 1CIDA 3NIDE 3MV7D 5IMMA 4JQIH 3O6KL 5ITFB 1B9ZA 2V6HA 3BE1L 2HJLB 3PWJB 3WEXA 5KANI 5E8PA 1FFPB 1YEKH 2AJSH 1J0JA 3H3BC 2ICWI 3GSXA 3ZDYF 2EH8H 4IOSD 2A83B 2FEDC 1C1EH 2Y5TB 4GBXA 4OFPA 4CMMA 2ESVD 1EPFA 2J6EH 1HSBB 5SWSD 1CFQA 4WW2C 4WGWB 4JPVL 5L88L 1A7OL 5EC1A 3MLUH 3QHTC 1GGIL 1OAXH 2FL5A 2HMIC 3TZVA 4DEPB 1X5KA 5IFJB 3P73B 1FFNB 4GRWB 4ZD3H 2CLZA 3PL6C 4GW1A 1BFOA 1FVDB 4LPYA 3S5LA 4Q0XH 5DDHB 2A77H 4Z7QE 4F2MA 5KVGH 2VITA 2YA2A 1CLOL 3LY6A 4X9IA 4XNXH 1A1MB 3DSNA 4P23B 5L7XL 4DGIH 5D96C 1FPTH 2CPCA 1LEGA 3IKCB 1B0GB 5GHWL 1PSKL 4YGAB 2IG2L 3CVHL 5EZOH 2HRPL 1CG9B 1Z9MA 3OJDB 4U1GB 4EBQH 2ZKHL 3IDXL 3GJEB 3T3ME 1LVEA 3GHEL 2FWOB 1O5DT 2GT9B 5ICYA 1U3ZA 4XGZA 2HT2D 5FYKL 2OX5A 2W9DL 4MA7L 3RVTD 3FB5A 4WO4D 3V4PH 1J18A 5ESQA 1QBMH 5D1XA 3KPRB 4J4PA 1VHPA 1NLBL 3GB7A 5JOPE 4PJCF 4PRDB 3D2UD 5K9OA 4EKXA 3GMQA 3BEWB 1U42A 4ENED 4TUOA 2RCSL 2FSEB 1A3LH 3C08H 2Z92B 1VEOA 4FXGA 2F74B 4X99B 1WLHA 5GJTL 5DJYA 5KBNC 2RBLA 4I48A 5DLML 2X4QA 3C5JB 5JHDA 2Y6SC 1OARH 2WANA 4N5UA 1KT2B 2EDYA 4LLWA 2XNAA 5IMOB 2ADJB 5EORL 1D5IL 5EOCH 1FYHB 1RUPL 4JY5L 1S8DA 4NKDB 1YMME 3QCVH 5DJCA 3HR6A 4TNWF 1I7UA 3FB7B 3VXTA 1JNLL 1W0WB 5GS3A 3HB3D 1X3DA 4JDVA 4FP8H 4AY0A 3TP4A 4Z95L 3O4LE 4LHJB 1C12A 3LVEA 5JMOC 2OI9B 1T04A 3CCHB 4ONGL 3GRWA 3QQNA 1LILA 2OSLA 1AGBB 3MXVH 1RIUH 5HYJB 3HS0B 1IAII 3NTCL 2J8HA 1G7JA 2NXZC 2PTTB 5KSAB 1X44A 5LGKA 2CSPA 1IGJB 4WY7H 3L3HA 4NFCA 5FGSA 4PJ8B 5MHSE 2X7LB 1WBZB 3VGDA 1FNSL 5C08A 3U30B 1I75A 4RWYL 4MNQB 5I1CL 1U36A 1XF4A 4P5KA 2GSIB 1OP5H 3KYNB 3LN4B 2E9WA 4ZAKC 3MCG1 2O5YL 4KK6C 3WXWL 1IGYB 3TJEH 5T1MB 4XC1L 2OJZH 3TH2T 5IM7A 3NIFE 4APQC 2X9WA 1P84K 5C2BH 3IXTB 3K8MA 1AQDA 4FQQA 4KTEH 1TVHB 1AKJA 3HR5B 1TZHB 1PEZA 4WW2B 1XIWB 4RNRB 3VXRE 3FJTA 3QHFH 3NACH 3KG5A 4PGDB 3VGGA 1E4KC 4Z7NF 2BJMH 4ODSH 4DVRH 4WHYG 2HT4C 1QLFB 4UNVA 4PP2B 3FQWA 3RZCA 3NPSC 4RIRB 5HYIA 5C7XH 3BPOC 2C7UA 3UBXI 3W2DH 5IHZA 4UILH 5HVHC 1QZ1A 1BLNA 1BWWA 1QSZA 4L1HA 4KV5F 5CBEB 3BKCH 5D96B 3C2AL 3JTTA 3RX8A 2ZWLT 5JOFB 1OP9A 4RBPH 5I1KH 2DM7A 2IGFH 5C70A 2QKIB 1MJ7H 3G04B 2V5YA 4GXVH 4QHKJ 3T0VA 4O2FA 1XF2B 1FC1A 4Q9BA 3VFWA 3S9DB 1DCLA 2AEQL 1WFNA 3QNYA 5ESVB 3JSSA 1JV5B 1G7PA 3KJ6L 4FTVB 4Y4KA 1X4YA 4XCCH 3HE6C 4JCLA 1KCVH 4OGAD 1MH5A 2AQ1A 1I1AD 4LSTH 4PS4H 4HWBH 1R0AL 2AJYH 3OL2A 5KANG 3JUYA 3SBWC 5D2LA 1IRAY 3UTZA 2OL3H 4QHLA 4JCMA 5AEAA 3TN0B 4EI5C 2J6EA 4AQOA 3OV6A 1YPZB 3LN5A 2WQRA 3MOAL 2MCPL 5IJKA 1FG2B 4S0TD 4YHKL 4L3CA 5JR1H 4YBQC 5FIEA 4LHUB 5FDYA 1AY1L 1FE8H 2GHWB 3HLAA 3SDCC 3BVNB 4K3HA 3IFOA 2F8VA 4X5LA 3OSKA 3EFDL 3GJFK 3D3VE 1QBAA 3U46A 5ADPL 3K1DA 4X5WA 2XWJB 2Y06L 1LK2B 1IT9H 1MCOH 5DYOA 2APXA 3DX9B 1T3FA 1YYMH 2XY1A 5JDSA 1YZZA 4IDJL 2DQUL 5DQJB 1P69B 2WWMC 4JRWA 1Q9WB 3T4YB 5I2IA 1AGEB 2CUHA 4G6JL 4YK4C 4OZGA 1A6WL 5IQ7H 5LAXB 2WBJC 4Z77B 2XA3A 3FCTA 5F21B 3I50L 4HULB 5EBMA 5ADOL 3ULUH 3SKMA 1URLA 4DTGL 2LU4A 3FONB 3CFDA 3RAJL 1JNHA 2NXZB 2AJVH 1N5AB 2A9ML 3LQAC 3PG2A 4XC3L 3CFEA 2Q8BH 2I9TA 4TVPD 4HX1B 1CTOA 4U1NB 4N0CD 3SCMC 4MJIB 5CJXA 4ZAKB 2YPLE 3EUUA 4X80L 1KLFA 4L3AA 3UTPE 1RIHH 3MMEB 1FZMA 3I6LE 4IMKA 1VFAB 2HFFA 1WWAX 2A6IA 4AH2A 4R26L 5T1KA 1YEJL 3BD5A 1V7MH 1IGTA 2A9NL 3ROOA 5I66A 4XPHH 5EO1B 4MCYA 3ARQA 2JLLA 4GXUN 4HH9A 5DHVB 3RGVC 1WBYA 1FFQA 3INUH 5IG7B 1XFPA 1ZA6B 2X1QA 4KROB 4H1LG 4XRCB 3NPSB 4WDIA 2ADGA 1XF3A 5T1LB 3UX9B 3BPOB 4X4ZA 3SDYH 5JQHC 2Q8AL 2J12B 4LEXL 3S3SA 2CUMA 3WS6C 5JPMB 2QADD 3EJZD 5DUMH 2VAAA 4R0LA 1GOGA 5E2VL 3OKMA 1U8MB 5EC2B 4MD4B 4LQFH 5ID1B 4PRIA 1NPUA 1TITA 1YMMB 2VQTA 2WV3A 2V7NA 4XBEL 5D1QD 1S3KH 1OB1B 2G5BA 3HAEA 1HXMA 3EDFA 1MJJA 43C9B 1Q0XH 4W6WB 5DJXB 1IL1B 3O4LB 5FYKU 5GPRA 5C0CD 4F9LA 2IH3A 1D5MB 4NZRH 2COQA 1FZKB 4TULL 4EI5B 4HGMA 1K85A 1AR1D 4C54A 2AK4D 4G6ML 4XTRD 3WJLA 1HEZB 5BMFL 3L6FA 4X6BA 3SDCB 4OUUA 3L5HA 5MEPA 5ERWA 3DVFA 3ARBD 4EUPG 4PV9B 1H8SA 2FHCA 4TSCL 1BQLL 1N3NA 4OCWH 3RVXD 4JFDD 4JGMA 4FZ8H 5HHOD 3MLZL 2FR4B 1A7RL 4PJFF 1XCTA 5C0RL 1R6VA 5I1DB 2IH1A 1CLZL 1CU4H 3VXRB 3MXWH 3QDGE 3C8HA 1U8JB 4JZJB 5I1GL 2VDKH 4OCXL 2YZ1A 3LSOA 4Y4HC 4MQXC 1F97A 3QJHA 1FYTD 1C5BL 3VU2A 4ODWA 4YK4B 1A7NH 1OAUH 2EIDA 3ARRA 4PY7B 3HE7D 2ARWA 3RWJB 2V2WB 4HIXL 2WBJB 2VTFA 1NCWH 3C5SA 1MRDH 5IESH 5B3NA 4Y5VC 3TT1H 1H3PH 4YH6A 5C3LD 2PYEE 1SJHB 5BW7A 4Z0BH 3O41A 1HKLH 1NC4B 2EIZB 3MBXL 2V5RA 3H0TA 43CAB 3CSYA 3LPGA 1I7ZB 3WHXA 3BIKB 2CLRB 1EBPA 2E8YA 2YD1A 5DD3H 4U6HA 3TVMD 2NY1D 3T77B 3CZFA 1NMBH 2ITDB 1XGPA 3QH3B 4G8EA 2F19L 1GH7A 3GIVB 4FFYH 4HF5L 5FV1L 2OTPA 2FECL 2CLVB 5C0GA 2AEWA 1QRKA 3T2OA 1I1YA 3WO4C 4LNVA 3RY6A 3BPLB 3MCLH 1X5JA 1J8HA 2H2PD 3U1SL 4Z76A 5KAQF 4PLKC 1A4KB 4XPGL 5T33L 3MUGA 4JPWL 1DUZA 4WHTA 4P5TD 5FYLD 2H41A 2IAND 3RI5K 3CFCL 1NGWB 2F5BL 4LFHD 2C1OA 4NZTL 5CSZA 3T0BA 2ATKB 5HPMA 5EZJA 3O4OB 2ATPA 3RGVB 1KB9K 2X4SB 1CFNB 3O3AA 4KC3B 4PJHE 4FN0A 1BEYL 3W39A 4KI5D 3TNMA 3BKML 5E4EC 1IM9A 1BHGA 5D2NA 5KAQG 5EU3A 1V7NH 3DTXA 3D3VB 3QXTA 1P9MA 4KK5D 5I1IL 1TTUA 4FMKA 3DMMC 3DYPA 1A1OA 1EH9A 4NWUH 5HGGS 3G6AA 3O3EB 5E08H 4FFWD 1C8PA 4JKKA 2CDGA 3D0VB 4OAWB 4M1GH 1DN2A 2UWEF 1IC7L 2XV6B 4LF3A 4MYWB 1KYOK 2PYFB 4RGOL 1TCRA 3O11B 1MJUH 5E9DE 4BH7B 4QXUL 1RHHB 3CJJA 3D0LB 3D87B 3RWGA 3QQ3A 4CJ1A 3FT3A 4QT5A 3MR9A 1KC5H 2DQCH 4Y8AA 1CK0L 5KZCD 1ZTXL 3HTLX 3IDYC 2UZYB 2AKRA 3L95B 4PJEB 4X7FC 3HI1B 2C1PB 3ARFA 1K5NA 1S7TA 2XRAL 3WIFA 1NBQA 3I84A 4IMLA 5DQDL 4QHMB 3WUWA 2CKBH 3KYKL 1L6ZA 2YPLB 1LDSA 1JCKA 3U4BH 4NZJA 3QO1B 3ES6A 1AJ7L 2FX8H 2W60A 1EHNA 2ZG3A 1NGQH 3MA7A 1ERNA 3CIQA 2P44B 4G9FA 3UTQA 4JFQB 4KKNA 4DKEL 3L3GA 1KGCD 4Y16D 5K9KA 5DF0A 1RUMH 3GSUA 3ZDZF 5GSRA 1I9JL 1JGEA 3NCFB 5EOCJ 1CE6A 1DN0B 4QXGH 2R2BA 1LO3L 4Y4HB 4XP1H 4UIKL 4UT6H 4ZG1A 4F37K 1WT5C 2UUDH 3L5XH 1UACL 4U4BA 2EYRA 2P1YA 3CX2A 5TE4H 2VISB 3EJYD 4I9WE 2C3VB 4NQEE 4M7LH 3SQOH 2LVEA 4D9RD 5TE7H 4WENB 3NH7H 1JWSA 3X3FH 2VDOH 5DRNA 4WW2F 1FRGL 3IJHB 1RZ7H 4XXCA 3H42L 2AJZA 4BH8A 1GXEA 2X4NB 1U8QA 3P4NB 2VLLB 3FFCA 1JPTH 2PUQT 4RAHA 3ZKSD 3DX7A 3MX0A 1R5WA 1C5CL 1HSAB 3LMJH 3BP6B 4E5XA 4KVCH 3QPXL 1JN6B 4NN5C 4EN3D 1XH3A 3WO4B 2X05A 4KJQC 4KK9C 2ICEB 2DM2A 4WHYH 4C56D 4YDJB 4X8JB 1TJIL 1BGXH 3GHBL 2DI9A 2MOVA 4K3EH 4OKVB 1CBVH 3RWEB 1XCQA 1KIQA 5K9JH 3H7LA 1LO2H 3VD3A 3O9WA 4QRRD 5B21A 3MC0A 2DQDH 2V2XB 3QEHA 4Y19E 4PRHA 2BOCA 5M95B 1AR2A 5E4EB 3TNNA 5FDWA 4QNPE 2YD3A 1IARB 3GMLB 5DJ6A 4N0YH 4X0KA 2CR6A 4JO3H 3TH3T 3PP4H 4X4ME 5E95B 1NDMB 1WCBB 1ZVYA 3BP7B 4LSRL 1Q94A 3DMMB 5K93A 1EERB 5GGQH 1L7TL 4Q2ZA 4HS8L 4OT1H 5AG9A 2BNQA 5GISL 4ZFOA 3BT2H 2VKWA 4JPIB 3QDGB 3CH8A 4QHUB 5D7IE 1N4XL 1V05A 4PFEA 3RL2A 4JDZB 4PGEA 4GRMB 3B43A 1FGNL 3QCTL 4JAMA 4YPGA 4JFFD 3WFHA 4PR5A 1OQXA 3TCXA 3ESUF 5JHLL 4PJ7A 1F4XL 2R9HC 1T66D 1U92A 2MPAH 4M5ZH 1BIIA 5DK2A 2WNGA 5EZLA 5L2JA 5F1IB 2CXGA 3IDYB 1OGTB 2PYEB 3HC3H 5J3HC 1U6AL 2H26B 2R39A 3VJ6B 2P5WD 4GAGL 3U82B 3PGDA 1IAIM 5FYJL 1JFQH 3C9NB 2OK0L 4PUBH 2VLRE 1S7VA 3G9VA 3MLYL 1LE9A 3DVIA 5T5FL 4J1UB 5FYKD 4YAQA 1U8LA 2NY2C 2CDEA 2HTLD 1EXUA 3VFOB 3TYFA 2VZOA 3VDCA 2AABH 1GIGH 1SJEB 1OCWL 3MV8E 4HCRH 1IAMA 4GW4A 3VGBA 5A2IH 4KMTH 3WL9B 3KPMA 3AB0B 2WUBL 3KPSD 1IC1A 2ZSWA 3WJJA 4PJHB 5HDLA 2FX7H 4NQXA 2D9QB 2GAZB 3FQNB 3SKOB 3O2DL 3D2UA 1UEYA 1E27B 4N8VG 1CZ8H 5D6CA 3W5MA 1JK8A 4MD5A 5H94B 2B4CC 5DTFA 3KWWB 1BJ1H 1P7QB 1HHHB 4XCNA 1LO0H 1F90H 3S96A 3QIUC 4LMQI 3ISWA 4PRBA 5DSCB 3LS5L 2QEJA 4QY8A 2P5EA 5F7EH 1SEBA 1B0RA 3Q1SH 1ZVSB 2MSPA 2Q6WA 3EOAB 1N5YH 3FQXB 4HXBL 5E9DB 2BFVL 4LIQE 2YRLA 2VXQL 2GFBB 1PKOA 1RUKL 2C5DC 2CKBA 4I2XA 4XT1C 5TH2A 3X11A 1KJ2H 5FF6B 1UWGH 3TV3H 1I9IL 4FQHB 4M4RA 3CPLB 3MRHB 4H1LH 2DQIH 2NX5D 4K8RC 4X7CC 3A6CH 2EDHA 2XN9D 5KSUA 1FL6B 1I8IB 2APTA 1JGDB 1EO8H 1MCEA 4FXKA 4M1CC 5HVFB 2PCPA 4RA0C 3UZEA 4LDOB 3V0WH 1SEQL 4ZTOL 5J89A 4R2GC 3HUJE 4M9OA 3ZKXB 1A3RH 2X40A 1IAIH 3AAZA 5KSBF 2R1XA 4ZUSA 3VFPA 4I0PA 3TIEB 4RMVA 5SWZD 4FABL 5DK0A 3CSPA 3CFIC 4M03A 1F6AA 4MQ7B 4QRUB 1T0NA 2HG5A 4N9GA 4WEBL 3HNVH 5SX4I 1DDHA 3DVNA 3BYTA 2XG5A 3FQTA 3ZSTA 2YSSB 1BD2D 3O2VL 4CGTA 1BBDL 3T0AA 3OQ3B 4H0GA 4QRQA 5ACMA 3MREB 3H9YA 2RHEA 2EC9U 1BZ7B 1RJZB 3GMRA 2D03L 2PXYD 5I15H 2ZCLL 2Z91A 3BSZH 4OUOA 4FQLH 1PZ5A 2YA0A 3X13B 1KNOB 4YHZL 2F54D 3EYUH 3DURB 4NQEB 2FIRT 2VLJD 32C2A 2YK1H 1I3VA 4MAYA 4KRNA 3G9AB 1I8KA 4AMKH 4K3JH 1F02I 3L3JA 4V1DE 4O9HL 3DX8B 4WRLA 5BV7B 5DWUH 5D7SL 2EO1A 3MV7E 1T7VA 5B39A 3TFKD 2MJWA 4EUPH 1KV3A 4S10A 2UZIL 1U95A 4LPCA 1MHCA 3U36B 2UV3A 3P4MB 3N50A 1AGDB 1FH5L 5DFVD 4U31A 1NAMB 2ESVE 5ICZB 5SWSE 1EVUA 5B38G 2NY2B 3AREC 1MLCB 3PWLB 4DZBB 2YZ8A 5JQ6L 2IMMA 3SY0B 2LTQB 1H8NA 3H7BA 4F9PA 2PTVA 3R1GL 5KVEH 1QFUH 2E6PA 1QLRB 4PLOB 5GZND 5I76B 2NR6D 3U9UA 3V5DA 5IUSA 5K9QG 3W0WA 1AP2A 1XGYH 1XZ0B 1HINH 2R0WH 4G5ZH 3V52L 5ETUB 3GSOA 4RAVA 4Y19B 3EYVA 4UQ2B 4RGMC 1IKFH 1MHEA 2J4WL 3TH4T 1YC8A 1K8DB 4TPRL 3KPOB 4PGCB 3MUZ1 1H3WM 4LSPL 3GI9H 4F7CA 3ARVA 3CAFA 3S98A 5CHNB 2HKHH 1QFWL 3B3IA 1UM6L 1MAMH 3FOLB 4PJIF 2P24A 2Y07L 5EU6D 5GS0L 2VLKA 1DQLH 4ZFZA 4ELMF 2XFXA 3QIUB 1FNGB 1M6OA 2YD5A 3V5KB 1FAIH 4YDIL 5ENWB 5IVZB 1HQ4B 1P4LB 2N56A 1UM5L 3JWDL 1P5VA 3K74B 4RMQA 4UQ3A 4CVUA 1GJIA 3QDJD 4MMZC 4I18C 2Z93B 1D6EB 1KFAH 4N9OB 4F37F 4Y89A 4D2NA 1P2CA 1QEWA 1DLHB 3MFGB 4PJXA 4R97C 5D72L 3TEUA 3B8YA 4LCYA 5F8QC 3TA3B 3QR2A 4GAYB 4OCSH 3D25A 4OJFL 1HKFA 3ZT5A 5F9OH 4U33A 3RTQC 1J87A 1SMAA 4UV7L 2Z8WC 1CFVL 3PNWB 4G6FB 3UJJL 4TTGA 3SO5A 2CD0A 4Y2DB 5MERA 4Y5XA 3BP5B 1G6RA 1CDBA 3DGCR 4UV4H 4LEOA 2VLRB 4CMHB 4HFWA 5KOVC 5DJ0A 4R2GB 3DROB 4HMEA 4TSBH 1J0HA 3HC0A 4X5XA 3T1FB 1DBKH 1OQOA 2H32B 1CDIA 3G6JE 2D4DA 3H9ZA 4FNLH 4XH2B 2ITCB 1UG9A 2CRZA 4PJEF 2D7TH 5LVEA 4PLNC 4U2YA 2VIRB 1NL0L 3HMXL 1MIEH 5KJRL 2RJMA 3MV8B 2EDXA 2EDJA 4JO1L 4C4KO 5KS9E 4HWEL 1P7HL 2VERN 2YD6A 3DV4A 4JB9L 4M5YH 3MJ7B 1KJMA 3RVVD 1UKSA 5IB5A 2VL5A 5I1HL 2B1HL 2J88H 1Z3GH 4UNUA 5C0BD 3RVWD 1QHOA 4OCLC 5INCA 3LDBC 4NRZB 4NQDA 1WJ3A 1R3KB 1FL3B 1I85C 2DLHA 3IS0X 1FN4A 4K7FB 5F1NA 3WD5L 3GBMH 3RX5A 4F8TA 4LSVH 1SQ2N 1DVFB 3VWKC 5FECA 1A6AA 1YNLL 5CMAA 4UDTB 1LP9F 2JIXD 2HT2C 3NFNA 2NXYB 5DC9B 4DZ8A 1XEDA 5JORA 4B5EA 3GO1H 4HKBB 4CVXA 3PDOA 4OCRL 3KJ4C 4F7PB 1S7SA 1IMHC 5E2UL 4PD4J 3HRZA 4IRJC 3V7MA 1DBBL 4UAOC 4R3SA 3EOBB 3AREB 4LSQL 3QUMB 3BRFA 2OBGA 4NPYB 1H15A 3VRJB 3CMGA 1G84A 3C5ZB 2YS4A 3BXNA 5I8EB 4AT6B 2X1XR 4ENEC 4MXQD 3WFEH 5IB2B 3MJ8A 4GKZA 2XZCL 1HNGA 4HIEA 2BNRA 5IJVB 4MDJB 4NP4H 4UUJB 3CLFH 2XKUA 3LHPH 5DD6B 4ZS6D 4XWGL 1QPXA 4G7YL 1MNUH 5FOJA 4OZIE 3ZDXE 1QYGL 3MYJA 3S35L 1FZJA 3GKWH 3I6GA 3HUJB 3U4EA 5FOBA 3F65A 4AG4L 3QULA 3QZWB 3KYMA 3QIWD 4OBSA 3QG6B 1NAKH 3GJFH 1A9BA 4HK3J 3CFKA 1U91A 2ZNXA 5I71C 3ZTJG 1VGKB 2DQHL 4H20L 1T1YA 2P49B 3EHBC 4LCCC 4M48H 3T2PA 4XP6H 1M7IB 1A47A 1A1NB 1NEZB 3MRRB 4DWHA 4I18B 1FJ1A 4AIZA 2YUWA 1DUYB 1PW3A 4BQ9A 1YJDC 2BDNL 2YR3A 2BC4A 1RK0B 4JM2A 5E7FA 5CILL 5A43C 4V1DB 4ZUUA 2YMXH 3RTQB 3MBEB 2ZUQC 3MV7B 3O8XD 5BZWB 3F7YB 2HN7A 1NCTA 4N5ED 5TGBA 1F11B 3MNZB 2WUCL 2HKFH 5JNYA 1J8KA 5CEXB 1I9RH 3GUTA 4OGYL 1MWAH 1U0QA 4JPVH 2ESVB 4NCDA 5IB1A 5SWSB 2Z31D 2Z9TA 4DOHB 4NIKB 2V5TA 1F4WH 4B7IA 5BO1H 2BY1A 3PWPA 1M05B 4IJ3B 5GGUA 1W0VB 1YN7B 4KK8C 5A2KH 2VMFA 1UEMA 1HWHB 2QJDA 3VFRA 4XZUA 4GMSL 4LP4A 2H9GB 3GSRB 2ICWJ 4X6EA 1H3TA 4YIQB 4M3KB 1M71B 1FBIH 1PSKH 3OZ9L 2IG2H 1IBGL 3RUGA 1JPGB 2DWEB 4WVRA 4HIJA 1KLUA 3LCYA 3SDXE 3U9PL 1CL7I 5IEHA 2ZKHH 3QA3A 4BSVB 3T0EA 4D9LL 3MLXL 5C09A 4BZ1L 4XVJH 3GHEH 3CMOH 3WIIL 1VB9A 5K33A 3UTTD 3ROLA 4TVPE 4HWZB 3BZ4A 4Z7OF 4Y5YA 2ORBL 1HIMH 4PJGA 1A6VL 2UY7A 5CJ8A 1CXHA 4WO4B 1HHKA 4OGAC 4HGWA 1K2DA 1MFDL 4M6OL 2WK2A 3KJ4B 3EYFB 3OF6A 5D6DC 4IOIB 4Z7UA 5C92A 1RIVL 1B90A 3WIHL 4W4OA 3DVGB 1AD0B 2BNUA 3HHRB 2RCSH 3I02B 5JW5B 3EO0A 1CXLA 5IQ9A 1OLLA 2BSRA 3A67L 3G5XA 3ZHKA 1QKZL 4BZ2L 4OKDA 4ZFFA 5CD5C 5CCKH 3MLSH 5DD0H 4YHIB 4E41A 3PWNA 3VMNA 4ETQB 1D6VH 3A6OA 2IQAB 5HYQA 5KN5A 4M7LT 4QRSA 2FIKA 1YC7A 3G6JB 2EC9T 4CVZB 4QXWA 4HJJL 5DHXB 2HJKB 3QUXD 3UYRL 2WBWB 3GMPA 1ZT4A 1BJ1J 1QSFA 4CDGC 4TVSa 5I71B 3RA7H 2HVJB 4LCCB 2NPLX 4Z95H 2YHGA 4DGVL 3FB6B 3FTGB 1QQDA 5GS2H 5C0CE 5CIPA 1ZGLP 5HHNB 3WN5A 1IC5L 1KF9B 1FHGA 3RZWA 3LEYL 3AFLA 3I2CH 2EEAA 2WINA 4WI6A 1F4YL 1R5IB 4QXTA 4YR6A 1MVUB 4PBWD 1YMHB 2AK4E 3VDAA 5EBLB 2DIAA 2ZUQB 3V6ZB 1JGVL 4C55A 1A7BA 2FO4B 1ND0A 4FMFA 4OD2A 2Y36H 2C3HA 2JE8A 4OFIA 4Y4FC 5JIPA 4OSUL 3MZTA 4K9EC 5CLTA 2YPKA 4JFDE 3VXNA 4WV1C 2G60L 3VWJD 4MNGA 5EUKA 2X1WL 4C57C 1JYNA 4L29A 3NGBC 1T4KA 4HLJA 4LGSB 5BS0D 4YZFE 4X6DE 3QDMD 1IGCL 1BJ8A 2DQEL 4XP9L 4JHAH 3HNSL 3ZKMD 1LDPH 4K55A 3KDMB 1FYTE 5DVLA 5E8NA 2B20A 2XKNB 3EZJB 1I4FA 4K7PX 3SDAC 4OZIB 1YNTA 1NFDE 1CD9B 2BVUA 1IEAB 2QADC 3FN3A 2DTML 4JVPA 3ALWA 2Z4QB 1LWRA 4GBXC 3REVA 5F7WC 1CICD 3EOYG 2EDRA 1VGEH 5F3BA 1MELA 4HG4K 4R9HA 5ANMA 3RWHA 2VWEE 2P8LA 2XT1B 3IETA 2FJFB 2V2TA 3BX7C 3GSNB 3LKSB 2FYYB 3MV9D 5D1QC 3T8XA 2RFXA 3TZVC 1R0AH 1SM3L 5DHYA 3NVQA 1DTUA 1Q9LB 3C60A 4GG8A 3VD9A 3DWTA 3NN8A 1I1AB 5L2KA 4U2ZA 1T6VN 1BIHA 2J8UA 1OF2B 3ARDD 5C9JB 4JKLA 2MCPH 4YHKH 1WWWX 5FYLE 3V8OA 4WFFD 4Q6IA 2IANE 5B8CC 4XWOD 2QR0A 5C9KA 1FZOB 1AY1H 5ALBL 4J12A 1YEGH 1A21A 1GZPB 1BQHA 2M26A 2BCKA 3ARGD 4XNUL 3F6LA 3RNKA 1UJ3A 2RR3A 1DSFL 1NDGA 5HDBF 3SKNA 2X9YA 4AIXA 1N7MH 3MFFB 2RIKA 4JQXA 2BSTA 3DSFL 4OIIH 1W72B 4ZO8A 5D1XC 4L8BA 2P5WA 1SYSA 5DRXA 1JBJA 3FN0L 4LLDA 3FO1B 4QTHA 4FQ1H 4G9DA 3VG0L 5F9JA 5I0ZA 1OLZA 1P6FA 5E4IA 3D1MC 4A6YH 3S4SG 4FG6C 3O6FD 5I6XC 2ADIB 1EJOH 5J0BA 3OAUH 3DECA 2IFFH 3TBWA 2I07A 2YKLL 3MRIA 5DGQA 1S7RB 3CLEL 1SYVA 2B0SH 2W59A 4BFEA 5E24E 5DJAB 1AD9B 2AVGA 3P0YH 4XNQA 4KJWD 4JFYB 5IEKB 1BMGA 2YD4A 4XC3H 4KU1A 1CCZA 1KEGL 3BGFC 5EN2A 3FB8A 3SDXB 3U0TB 4AEFA 5D1ZD 3OPZL 1U8PB 3QAZC 1CGWA 3D18A 5DT1L 2XIDA 1TPXB 1MRFL 2D31A 1A4JB 2VLMD 5L8LB 3C6SA 5KTEH 1JIBA 1CXKA 5A40E 1VACB 2E7CA 3OKNA 3TBTA 5D5MA 5F1KC 4GT7A 4R7NB 3E6FA 1Q0YL 4Y4FB 3CH1B 4AIOA 4ODBD 5E94A 4BSJA 3OBAA 4YGVA 5ICXB 3VFUB 4N8CH 2AQ2A 1RJYB 3SHSA 3P0VL 1RUQH 1KGCE 5TDPA 3PQYA 4JKPH 1UCTA 5JLZB 1U8OB 4NFBA 4MB4A 5FFLA 1DQTA 3FT2A 1BVZA 4HKJB 3L3OA 3QI9D 1P84J 5H2BA 4NHUB 2XXMB 2DM4A 4HSQA 3EAKA 3WLBA 2A6DA 4WW1B 3VI4E 5GS1C 5C8JA 4CN4A 4UT7H 15C8L 1KB5B 4ZUWB 3LEVH 5J6GB 5BZDA 2I25N 5AZ2L 1KG0B 4YXKH 3MRPA 3M8OL 4ODVH 1AE6L 3O3BA 4D9RE 3SDAB 5C0IA 4GLRI 2SEBB 3CXHJ 4WI3A 1EA9C 2QADB 4MDIA 3S36H 3JTSA 3TO4A 1FORH 3TM6A 4K3GA 2DJUA 1VA9A 1F4HA 3RU8L 1XGQA 1UH2A 4OLXL 3IXAB 5EC1B 5HGHA 1LGVA 1ORSB 3BUYB 5D1QB 3P9MA 5SWQB 3T2NH 1MAJA 4WUUA 2OJEB 1QFOA 3RZCC 3IGAB 2YC1B 5E00B 1AGFB 4LRNL 1WAAA 5C0CB 3M07A 4C56E 4JFPA 5HHQB 5DQ9B 2VDML 1MHHA 3QUZD 2JTDA 4TULH 2OP4H 4Y88A 2JJSC 4JZNB 5EU5A 1U3HA 3FO9B 4G6MH 2VOTA 5B8CB 3WV0A 5E1AA 1JGUH 4MZ2A 1J5OL 2AK4B 1QRND 2L4OA 4J3OC 4AENB 4QRRE 1CXEA 3IJYA 4JRYA 1LEKA 5GGVL 4AZ8A 1MY7A 1D5BA 2ZOKA 1HYSD 4P48A 1AQKL 4F58H 1MY5A 1FNEA 4AM0A 2OZ4H 5FO9A 4LPWA 2VLJA 3RIAK 1OGAD 4P23D 4U3CA 3ARBB 5FGRA 4G8GA 1W8OA 1C08A 5E99L 1J0IA 4MS8D 3MLZH 1RZ8A 3MRCB 3CFJA 4JFDB 1A7RH 4U3HA 3VXOB 2E9JA 1IILE 1L9MA 3G6DH 3UDWA 4YHNB 4KI1A 4Y16C 2R1WB 2IPKB 5BQ7A 4DJMA 4KY1H 5JO5B 4F7TB 5HBBA 4OCXH 1MCIA 1UWEL 1DEDA 4P46D 4X6DB 4BZYA 5IJKC 5IVXE 4GQPH 5I6XB 3IU4L 1CGSL 4URTB 2VZ1A 4JFFE 1FYTB 4KHTH 5I8OH 1EEZA 4WU7A 2M1KA 3DGGB 3EJYC 1T22A 5DJ8A 3HE7B 5I8KL 5ISZA 4JFEA 1Y6NR 1L7IL 4PG2C 2APVA 5JXED 5HHPB 4JO2L 4KAQL 3LZFL 1NFDB 2FHFA 4F33A 5F6IC 3RX7A 5F96H 2H3NB 1PQZA 2QQKH 3A6BL 1O7VA 2HRLA 3QWRA 4MJ6B 4U1HA 4ZS7H 4XXDA 3WNOA 1EGJH 3Q48A 4HS3B 5IR1A 5F7MC 3TVMB 2NY1B 2YWZA 3OJ2C 1IFHH 3HI6L 3IDIB 3TIDA 1NCDH 3MRBB 1I7UB 4IIQB 5GRJL 5FYKE 3ULSB 1CLYL 4JFHD 3VXUA 2AGJH 2BX5A 1CVSC 2NLJA 3MJGX 5I9QC 4JPWH 2ZPKL 4GKNA 4Z0XA 5EU6A 5BVPL 3CFCH 1FO0B 4P5TB 5LWYH 3FT4B 2DM3A 3V6OA 2IANB 4GRLD 1G7JB 1KELL 1UWXK 2NY5C 3OG6B 4X7TA 2Q1EA 2HLFC 4LL9A 4AEHL 3KPSE 4RMWA 4WI9A 4YC2C 1FVEA 4E0RB 4NC1E 5GS1B 5FA3B 1T1WA 2BERA 3HNTL 1ZHBB 1AHWB 1E6OL 4S1SH 4I5BA 5CJXC 2B5IC 4M7JL 2V5SA 4O51B 4PJ5A 5JPNA 1MCNA 3IVKB 4TTDD 5E8DH 2ZNWA 5KSAD 5HYSB 1FFRA 4IMKC 4PV8B 3O2WH 4IHOB 4D0CA 1MUJA 3OR7B 3TBVB 4PJ8D 1AQDB 1TETL 1XR9A 2AXGA 3MRNA 4RZCA 4Z7VA 1SY6H 4HUVA 4MNQD 1S5IH 1MCSA 5E6ZA 4F8QA 1ZWIA 5I30L 1EMTH 5LQBL 4QXUH 3UYPA 3DI3B 2VR9A 4EQ3A 5AD0B 4BQ8A 3B4NA 3RHWF 3P9WB 3RZCB 5TQ0L 3REWA 2CXKA 3P9LA 1CK0H 2NW3B 2NX5E 8CGTA 5KZCB 2GK0B 4FFVC 4U1SA 2ZUVA 2XN9E 4QHKI 4YXHL 2HMID 3GBNL 1VDGA 3JTTB 3LKOA 1MLBB 4R0LC 1BOGB 4S1QL 3PL6D 1S7XA 3JWOH 1FLRH 3E6HA 4WIQA 5GGRY 1O7SA 3V5HA 3VA2C 2VN7A 4G7VL 3BWAA 4ODUA 3QNYB 2WLYA 2A6KA 1AJ7H 3BPCB 1KENL 3B2UC 2XICA 2Q86B 1WTGT 5BV7L 1B2WL 5SWZE 2DI8A 4DKEH 4HUXB 4U49A 3BWUC 3V6FA 4ZOAA 4ZXBD 4KJYA 3S37X 3D85D 5DEGB 5AUMB 5I18L 4F9LC 4O58H 2CRYA 2X9XA 3CX5K 4Q7DA 4Y16B 3LS4H 4NRXA 1BD2E 1I9JH 2JCCF 4XVSH 2DBLL 1JZ5A 4NZDA 5A16A 5F6HJ 4P4RB 5MENA 1NAML 5IB3A 3LRSB 4DN3H 4L3CB 1F2XK 5JIKA 2ERJB 3WJLC 2IEPA 3VFGL 2ARJB 2VE6A 2F54E 2D4FA 5FB8B 2H2SC 2X10A 2FJGA 2ED8A 5E5MA 3HFML 2E5EA 3WXVH 3KPNB 3N85H 1MF2H 3VGFA 4KKCC 3QXDA 4OI7A 3V4UH 4WFGE 4ZOBA 3CU1A 4LKXA 3LEXB 2DWDB 1YYLL 4PRPA 3SN6N 4XPFL 1K8IA 1DBML 2B4CL 4HV8B 2UYLB 2JK5B 5FCSH 4EN3B 2YUXA 5D70L 2OZ4A 4PJBA 4GG6A 1RK1A 1HCFX 5DZNA 3HG1A 1KBGL 1KTDB 1Z5LB 2FB4L 4X9BA 4D0BA 4LLAA 1U3JA 3F7VB 1G7MA 1I7TB 4P57B 4OZHF 5FKPA 4X6CA 5HHVL 5BW7C 1PD6A 4OBRA 5ABDE 4NBZB 3IDJA 5HDQH 4DVBB 4K7PL 4B53A 4YC2B 1I8LC 2XWTA 1T21A 2FH8A 1FFOA 1JPFA 1H5BC 1VEPA 3G5ZA 1BBJA 4JY4A 3KPTA 4K8RL 3OKLA 2B5IB 3WFBH 4LSRH 4ZSOE 2J1KA 1BM3L 4FZEL 4PJDF 2E27L 4NQSB 1KB9J 5CEZH 3LV3B 4HS8H 1HDMA 5F3HB 1I1FB 2FATL 3T04D 1R3HA 1N4XH 4OZFH 1FDLL 5CJBA 1A3QA 3H3PL 1DR9A 3L3IA 4LLUA 5EOTA 2BSSA 1UXWB 4MJID 3ROOB 1JYXA 2IPTL 1V3LA 3I75A 4HH9B 3QDJE 5I0DA 5IVXB 4APQD 1RJLA 3VG9B 5JHLH 4WNQA 1S9XA 4MXWL 4KDVA 4JFFB 1U8KB 1LO5A 4EZMA 3NFPA 2Z31A 2AERT 5C0AA 2A73B 3SO3C 5HYFA 3U7YL 3L7EB 1U6AH 1AXIB 1J1XH 4TOYL 2MHAA 3BN3B 4HPYL 1KYOJ 1P9MC 4JLRA 4JVWA 2Z8VC 4GAGH 5GS2D 3D5OF 3AROA 4OLEA 2J5LC 2HT4D 5FYJH 1RZJL 1AGCB 1NGZA 4QRPD 3ULUC 3CVHB 5L6YL 1MCFA 2DKSA 5I74C 4LLQA 1VFMA 3D9AH 4EI6A 4UB0H 4QTIL 2BMKA 3MLRL 4R4NC 5DFVC 4MWFA 5GJSL 2EECA 3RVUD 1OSZB 2EE6A 3HZVB 3S88H 4LCIL 1MVFA 5FO7B 1OAQL 5AYUL 5EUOA 1DL7H 1AH1A 1YECL 1OSPH 4LIQL 3ARFC 5IHUL 5IT2L 3OR6B 1R24B 1XR8A 3KPSB 3QUYA 3QUML 3MRQA 3HE6D 4LSSH 1NKRA 3O4LD 2OR8A 4X6BB 1BWMA 5C0BE 3RIAF 3QNZA 2JJTA 2GJ6D 4UU9A 3KXFA 4JFXA 2ADFL 4NNXA 4PIRF 3MOBH 2G5RA 4BFBD 4M43L 2QQLH 3LS5H 1YDPB 1N3NB 1CE1L 4G6KL 4YBQD 1G9NC 1F3JA 4LLMA 3JV5A 3M1BA 2P46B 2IH1B 1NBZB 4XX1G 3FL7A 4M7ZC 2BFVH 4I0KA 4MMXC 4G3YL 1RUKH 3PHOA 3QIBD 3LKQB 4Y0GA 1PG7L 5IVNA 1GPOL 1G0YR 3BFOA 4GUPA 1A9EA 1GOHA 5ECJE 1VKXA 1JTPA 1IGMH 2GUOB 4ODWB 3AMLA 1T83A 5D7KD 1F4AA 2EDTA 4PJ7E 3VFNA 1FP5A 3C5SB 1CDJA 1K3ZA 3I6KB 2ZCKL 2XN9B 3F5WB 3MUHL 4H26B 3O41B 5DURB 4JN1L 3ZTNL 2WWMD 4UOW0 3WE6B 1ZT1A 4LDLB 4ZTOH 4YHMH 2OL3B 3DXAD 4RX4A 3ZDYE 1CN4A 4U6HB 1CR9L 3Q0HA 4O4YH 4L8SC 1H5BB 3MRKB 2WM0A 2IBZX 1UCBH 4P2OA 4NO5A 4OQTL 2Y23A 5SV3A 3VFSA 3GM0A 1W8NA 1M7DA 3RKPA 5DD1H 3BPNB 3MPCA 2FBJH 3D39D 3OKEA 2DYPA 2CIKB 2VDNL 3WFCL 35C8H 3NFSH 1BBDH 3JXAA 2FLRT 4QF1A 3BMVA 5SV4A 2HJFB 4LHQB 1BD2B 3OGCB 1DUZB 5FO8A 4R4BB 4QEGA 3SCMD 2D03H 4G6AC 4KGLA 4LLVA 1DQDH 5CSZB 5HPMB 5DO2C 2HFGL 2F53D 4HXAL 2PXYB 3DO7B 4YHZH 4NN6C 3RVVC 1PDKA 3NA9H 2BHZA 4QCIB 3KAAA 1CS6A 5I1JL 3S5LG 4FQXC 4MVBC 2F54B 3RVWC 1EDQA 3CVIH 2Y1VA 5F7YC 1LEIB 4O9HH 4PTUB 2YWYA 4HLZG 1QO3A 3C8DA 4F7MB 4WCYH 3RGVD 2H6PB 4MSWB 2J5LB 1ZGLA 2QHRL 4UDUA 4WWKA 1L0QA 3IRPX 3ZO0A 4JY6A 3P11L 3C8KB 5I74B 2C26A 3BDXA 3TC9A 3UJTL 5KW9H 1A2YA 1TJGL 3P2TA 4LF3B 4PJCE 2Y7QB 2R1YA 5I17A 1MQKH 1DQMH 3PGFL 1ZXQA 4J3WA 3RWGB 1FQ9C 3FT3B 3R1GH 1HILB 1PY9A 1MJ8H 4NM4L 4I13B 1S7UB 4NKMB 4WEUD 4P9MH 1HI6B 4WI4A 4MXQC 3QDAA 4NQTA 1RVFL 2EC8A 1CGTA 3DUUA 3V52H 4KFZC 3VXPB 1A0QH 1BQSA 3DRTA 3FO0L 2I60L 2ID5A 4OZFA 1PG7W 5D7JA 1MCLA 1S7TB 4ZS6C 2EDBA 4OB5H 1KTRL 2P48B 4HJGB 1JUFB 4PB9H 4DW2H 2IWGA 3SGDH 4ZSOB 1R3JA 1U93A 2DMCA 4XVUC 3AU1A 2WP3O 2XTLA 5D9SB 3B5GA 4ORGA 1P7KA 4YDIH 5C0FB 1J05B 1VFBB 1ZLSL 1ES0A 4NO3B 3UTTE 1UM5H 1LE5A 4L8CB 3JWDH 1FIEA 2GJJA 2VDPH 1I7RB 1HH9A 4M7ZB 3CD4A 3QDJB 3GSWB 1JGEB 4U6XA 4C4KT 2R2BB 3RPKA 3V0VA 1Y0LB 5MI0C 4U0RC 1AI1L 3Q6GL 3QP3A 4JJ5B 1S9WA 2XQBL 5GGTL 3NCCB 4LNRA 3ULVF 1N0LA 4J3XA