1ITBB

Type-1 interleukin-1 receptor complexed with interleukin-1 beta
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
310
structure length
310
Chain Sequence
b'CKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-1 BETA
molecule tags Complex (immunoglobulin/receptor)
source organism Homo sapiens
publication title Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1beta.
pubmed doi rcsb
total genus 49
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 1997-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13895 Ig_2 Immunoglobulin domain
B PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB01
4TQEL 1RJZB 3VRIA 1ZOXA 4LLUB 1PJ9A 1EUTA 5E5RB 2KKQA 2DQFB 4U1KA 4OCYL 1S5IH 4IRJA 4LQFH 5B39A 4I8DA 1J0HA 2XZCL 3TN0A 1TETL 4TN9A 4DOHE 3EO0B 3L7FA 4M5ZH 4PBXA 2Y5EA 4X6CB 1RUML 1KXVC 4JANB 4Z8FH 4RRPA 2G2RB 1YY9C 3DGGB 4LOUC 5JNYB 2J3SA 1CDBA 5D7LE 5SV3A 2HTKD 2ICWB 2XRAH 4PRNB 4KGLA 4MB4A 3TWCH 1AY1H 3I6KB 3QCUH 1QFUL 4OV6F 1J1PL 4JFDA 1EZVX 2ESVA 4RBPK 4QXUH 4X80H 1ERNA 4LHUB 4YDLC 3FAXA 3GJEA 3U4BL 3HI1A 2P44B 5T1KA 2RHEA 2BHZA 4TUKH 3C5SA 4NCDA 5DSCA 1I7UB 1FYTB 2FJFA 4G3YL 5I8EB 4RNRB 4FXGB 3LKQB 3TGXA 4YH6A 4WWID 2XZZA 4LKCB 3MOQA 4BQ6A 4JKWA 2IADA 3GRWA 1Q9WB 1LK3L 5K9JH 3KPSD 1EXUA 5FYKL 4OQTL 2BVUA 5HGBA 3IB4A 3IDXL 2I07B 2CJUL 1IZKA 4IRJD 4HJJH 3H0TA 4NQCE 5DFVC 3PGDB 4X6CF 1KT2B 1ONQA 1AGEB 5IK3A 4UIMB 4WUUE 4DEPB 4OFYA 2GT9A 2Q76B 2BNQB 4GS7B 1U42A 5ESVB 3MRFB 4OI8A 4WGWB 4OZ4B 4QNPF 2YRZA 2DQFA 2HJLB 5ENWB 1KPUA 5EIVA 2VDMH 4PJAA 3C5ZB 1S9XB 2YC1A 4MSWB 5DFTA 2AJVH 2HT2C 4NN7C 4PJXB 1BOYA 4C83A 2MPAH 3BH9B 4M3KB 4MWFB 5L7XH 5EC2A 5LAXB 1JUFA 5L9DL 5DWUL 1BD2D 3R4DA 3RI5K 4HUXB 4YDIL 4ZXBB 3DV4B 4OD2B 4PJ8C 4LCIH 3VI4E 4WFHE 3ARBA 2AJVL 1XGQA 3MCKB 4N1CA 4P9HL 2YN3A 2ESVB 2MHAA 3H42L 4BH8B 1GGBH 5T3ZL 4LCCB 2VXTL 1KCSH 3WHE0 1FL3A 3B2VH 1CGVA 5CEZH 1XR8A 4JPWL 5FDWA 4H1LB 1WBXB 1Q8MA 2NY2D 4IRSB 43CAA 3VFTB 3NPSB 4BFEA 2I9LB 3F6IA 5EBGA 2Z8SA 4Z0XA 3UJJH 1QQDA 2GTWA 3GJFK 4KROB 4M1DH 3BH8B 5CZXD 4Z8FL 3QG7L 4GLRH 4P9HC 3NFSL 3U4EA 4PGEA 4GMTL 4D9LL 2C9AA 1EXUB 5F7HA 1T7XA 3O81A 2N4IA 4MDJB 4TSBL 1JHTB 2BOBB 2ED9A 4L8SB 3ZE2E 4ZSOE 1O5DT 3WFBL 2DQUH 3P2TA 3NFSH 3SDAC 1QZ1A 4N0FB 1DBAH 5KSUA 4JY5H 4ODUA 1A1NB 1TFHA 4JREB 5ERWA 3QNZA 4RFNC 2R23B 1JK8A 4P2RD 4WFFD 1RQ5A 1FFQA 3RWGB 1XGYH 1S9XA 4U1HA 4N0UA 2EH8H 5I19L 2X44D 4PGCA 2EDXA 3WIFA 2YPLD 4OQTH 1F58H 5GGVH 3ZTJG 1XGUB 4D3CL 2O5ZH 3K8KA 2VDOL 1I85A 2Q1EA 4ZTOH 3BP4B 5FGBC 3ISWA 1GOHA 3T2NL 4EN3B 5HYJE 1WWWX 5DMGC 2DLHA 3MRBB 1EO7A 5DD5L 4JPVL 3OJMB 3U36B 1NH6A 1XCTA 3QZWA 4OM0H 4Y16B 2DJSA 1FSKC 4WWKC 1ZLVH 1LMKA 4L3ED 1Q9OA 4AT6A 1N7ML 1S7UB 3C5ZC 3NAAL 4TUOA 1U92B 3G6JF 5KVDL 2FX9H 1Q94A 2NY0D 4EI6B 1UZ8B 5INCA 4JVUA 5F70A 5E5UB 1CYGA 2C5DC 2JTDA 3V5HA 1MI5B 5HGGS 3U2SB 2WUBL 1PX4A 2FGWH 3BD3A 3FO2B 4EDWH 1PG7H 5D1ZB 1NAKL 2YOCA 4H1LG 5C0RL 5HVHB 5T3ZH 3TBWB 1NCBL 3WS3A 5E2TH 3QDJB 3B83A 5CWSA 3B2VL 4V2CB 5F9JB 4G9FA 1HHIA 1YA5A 2JE8A 2Q86B 1AI1H 4N0FA 4WO4B 1XF1A 3BZDA 4WRLA 3M17B 1EHNA 4Z9KB 5T3XE 2BSRA 5C07E 3VGAB 1EEYB 2MMXA 2XKSA 4HIJB 4MB3A 4XCFL 4BSWB 2BOCB 5MEQA 1QFHA 4U1HB 4D0DA 5JDSA 4P59H 5BRZD 1GPOH 1VPOL 3HS0A 4JFXB 1X5FA 2F5AH 5CHNB 2QR0B 4WTWA 3QUYA 4M4PA 4RMRA 3KHOA 2A6DA 3C8KA 5TFSL 3STZA 1KXQE 5C07D 5JW5A 1I7TA 4UOW0 5FO8B 4HK3N 2Y23A 1JF5A 3KPOB 3L5WA 2A6JB 4X7EC 3REVA 5CIPH 1MFEH 5F93C 3PWNB 4NO3A 3V7MA 1YMHA 1PW3A 2CK0L 4POZD 3L9RA 1NCWH 2DMCA 4HXBL 4PRBA 2BSSB 3EZ8A 3UPRB 5DK2B 5CUSL 3GSVA 4R0LA 3RVWD 4PJCB 4NC2B 4AT6B 1FYHB 1MCWW 4LVHC 4LP5A 5CJBA 1UCTA 3MNZB 4JG1L 1WZKA 3TBYB 5I1DB 3RWEB 5HGAB 3HG1E 2XT1B 4LSRH 4OV5A 3KHQA 1Q94B 4DN4L 3SGKC 2DB8A 2UYLB 1IE5A 4JHAL 3WN5C 4YZFE 5BS0D 4XC3H 3C6SA 5B3NA 3X12A 1MJUH 1T4KB 3L3GB 3P11L 1NANH 2YR3A 4J23A 5GSVB 1RFDL 1GOGA 3HB3D 2HFFA 5DVMA 5DJ0B 1SY6L 5E2JA 1XCQB 2NQCA 1QSVA 4X99A 4OM0L 3GB7A 4S1DD 3TYGH 3WIHH 1DDHA 1MUJB 4GSDH 4KV5E 2EXYC 4ZO7A 2DL2A 3L3JB 5ESQA 5GZOD 1I3RB 4ZQKA 3QULB 2AK4E 2EEBA 2PO6D 2VXVL 4HUUA 1LDPL 3PL6C 4P2OB 4QHUB 1FN4A 5KSAD 1BHGA 5FA3B 1FL5A 1PG7L 1OD9A 3B2UD 5IQ7H 4O4YH 5F7KC 3UTTE 2RR3A 4PY8I 3ULUD 2ZJSL 3T04D 1SJEB 4NQCA 1AJ7H 4UUJA 1OHQA 1Y6NR 2AKRB 4FFVC 3V5DA 4YXHL 2C1PA 4QKXB 2CIIB 3ARGB 4PLKD 1P7KA 4PRBB 4WY7H 4MCZA 2OM5A 2VN7A 1CDYA 1UB5A 3WHXB 2FCBA 1BREA 3CJJA 5FO7A 4YLQT 3QUML 4DKDC 5DA0B 5B38B 5CEXB 1AC0A 3W39A 4QHLA 1OARH 4TVPL 3MYJA 4W4NA 1G84A 4WI7A 5FYJL 1WITA 4GXUM 4X6CA 2OSLB 1DSFH 3THML 1CLCA 2ATKB 3BUTA 2GSGB 5KAQF 2ZUSA 1JWMA 3D87B 4YGVA 5DD0H 1CT8B 3ORJA 3WLWD 4ZFZB 1KC5H 4JFYB 3ALWA 1A9EA 3QCVH 4RISL 3O3DA 3I3BA 2AABL 1JV5B 2FHCA 4GH7B 4LHUA 2ADGA 4YK4C 4YEEA 4Z7QE 3U30B 1FLRL 1V3MA 3SE4C 3U0TB 1U2HA 4KHTH 3UTZA 5HPOA 5LWYH 1UWGL 1LO4L 5IJKA 2DKMA 1ORQA 3SE8H 1PQZB 2QQKH 3KXFA 1YUHA 1P7QA 2F53E 5T3XH 2DBLL 2IH3A 1ZHLB 4K55A 1MREH 4P2OA 2FX8L 3NGBB 3QUKB 4HF5H 5TDOB 3B9AA 1UM4H 2LQRA 1PKQA 1FRGH 3Q5TA 2EE9A 2YUZA 3H3BC 1T03H 4OTXH 3RAJH 2M1KA 5JW4R 1S7QB 1I9RH 1XAUA 3KXFD 1F6AA 1MCFA 1BVLB 1EX0A 2DJ4A 4BFIB 2CUIA 2C1PB 3DMMD 5CP3H 1NMBL 3I75B 5TQ2L 3M07A 1VESA 3VXQA 3GNMH 5ID0B 3WHXA 2CO6B 3L5XL 4KXZH 3P0VH 3LS5L 3I02A 4PJ8A 1R3JA 3EFFB 3RTQD 4RMTA 4JRYD 1KLUA 3O6FB 1KCUH 1WISA 2BC4A 2H8PA 3P4LA 1SVZA 3DIFB 1HXMA 4OUUA 4KZEH 1ZVHA 1KSRA 4GOSA 4YDKL 5H94B 5L8KB 4ZAKD 4RMVA 4LDLB 3MXWH 4QTIH 5IM7A 4ZFOA 3RY6C 4NRZB 1KCUL 4G8IB 2H32H 4N90E 3TH4T 4HDIA 4QO1A 5F6HI 3WXVL 2B4CH 4GO6B 3QDAA 3F12B 5I75B 2MQCA 1T1ZA 2X9YA 3GGWA 4DEPC 3MRPB 5F88B 1MHEA 2V2WA 4KKAD 3HAEA 3MLTA 2F53A 4PP2A 2NY7H 1FGVH 5TH2A 5DRXB 3A6CL 1HHKB 4GRWE 1FH5L 4XP1H 4G5ZL 3VXME 4XTRD 3BZEB 5I8OL 2X1OA 1UZ6E 3RY5A 4M7LT 2HYMA 3NIFF 4M8VA 1QO3B 1B0RB 4HWUA 3QUKA 1P4IL 4X83A 2W92A 4PG2C 1BPVA 3WHE1 2IPUK 2NY1B 3GEWB 1NFDF 4F8QA 1RJYB 1CE1L 2YBRB 1EMTH 1U58A 5JR1H 1BGXL 4O51B 3O2DL 3HC0B 1EJ6A 1KB5A 2FB4L 4H26B 4WO4D 5IBUG 4DQOH 2VKWA 4LIQE 4IMLB 2BJMH 1HI6B 1E4XH 1W8OA 3CXHJ 4N8CH 1FVCA 1EAJA 3CH1B 5T3XL 4H20H 1UM5L 3ECBA 3P30H 3FFCD 3ZDZF 4NBZB 2QKIA 1FFOB 3IFLL 3FB7A 3S5LA 4GG8A 3CVIL 1P4BH 3EDJA 4O00A 5ADOH 4OFDA 1F4XL 4WTZA 1G9NH 2K7QA 2J6EA 5GS0D 5EZLB 1XGPB 2CQVA 2P5ED 1YMME 5DLML 1VADA 4FQCH 1IC7H 3FFCA 1MAMH 3MNVA 3NBNA 3V6FB 5GS0H 3UJJL 1OGAD 4POUB 2XTJC 1N5AA 3IDIA 4LDOB 1K8DB 2VLMD 3P0VL 1NMAH 3B8YA 5L88H 4XP4H 4NNYA 1R24B 2BDNL 3MBXL 1IC7L 4V2BA 3SPVA 2VXQL 4Z76B 2R4SL 3QQNA 5GS0L 3WE6B 1LP9F 1CXIA 2DWEB 2M26A 3OMZA 4BZ1H 4NUJB 5AYUH 5IROC 2J7LA 4L3EA 2J8UA 4LSVH 2COQA 1VERA 3IJYA 3PJSB 4WU7B 4XPGH 3B6SA 4OQ1A 1QO3A 1FO0A 1RD6A 3LQMA 3V52H 3MLVH 4P5KB 3SDDC 3GSNL 3PWJB 2R4SH 1OGAB 3IU4H 1OTUC 2V5MA 4P9ML 4OIIH 1QFUH 3RVTC 4K3GA 5CJ5A 4K8RH 1NCUA 3U0PA 5ICZB 1G9MC 5I9QC 5TDNA 4XHJD 5EU5A 2OR7A 3JTSA 4BH7B 4AENB 4R4FH 3PP3K 3QEUA 5I76B 2EH8L 4KI5D 2A83B 5F9OL 4XI5D 4GMTH 5KSBA 2NY3B 3HC4H 4KUCF 2V17H 1B88A 3D48R 3S36L 3RZCB 2YD9A 4H25A 5C0DA 3IJSB 5I1IL 3LEVL 2SEBA 3D2UA 1CQYA 1F00I 3STLB 5I6XC 3CGTA 4H1LA 4P57A 1MJ7H 5GRVK 4PLOB 1TZIB 2IWGA 1AHWA 1LE9B 3SKMA 2HT2D 3MZGB 4PJIA 5HPMB 3OPZL 4CADA 3PNWB 3NZ8B 4MXQD 3H9SA 4JM2B 3RTQC 1NBZB 3ZKND 4AIZA 3MRKA 1BEYH 3VXSB 3VRLF 5KVGL 3V6FA 5HYJA 3B5TA 3O11A 4PJBF 1E0OB 3CSYA 5JIKA 1GHFH 2Y1VA 3OPZH 1L7TH 3BESR 1RIHL 4QCIA 2PCPA 1U8JB 1GZPA 4R3SA 3FZUC 1OQXA 5KVMC 4BUHA 2YK1H 4KQ4L 4O58L 4G8GA 4FZ8L 4BZ2H 1ZLUH 1U8NA 1JZ4A 2VWEC 2EDBA 2APFA 1N6QH 1GHFL 5ERWB 1HQRB 4HZLA 5HI5D 5LJYH 4EQ2A 2HT3D 2FWOA 4Z95L 4O2FA 3HI5L 1NLDH 2YD2A 1X7QB 1A7QH 1AR1C 1IGFL 1P7QD 3HUJF 1IAIL 3U9PH 1CXLA 2FX9L 2K9UA 4WWKD 4Z7OE 2APBA 2Q6WA 3C5ZD 3X3FL 5ALCL 3ZKMC 3HN3A 3VU2A 4M1GL 4ZUTA 2X41A 3S7GA 4LAQL 3FAWA 4KQ3L 2YSSB 1VEOA 5IB5A 3QPQD 3SDAD 4GG6F 3V7AE 4OGYH 4JRXA 3F5WB 3HE6D 3DRTB 2HJKB 5IB1A 4WJ5A 4P57B 3MJ9H 5CINH 4G7YL 4PRAB 1MLCB 2R1WA 5KN5A 1ND0B 4P5TC 3S96B 4JVPA 1CGSH 1AXTH 1YNKL 3NZ8A 2OJEB 1KN4H 5I9QB 1S8DB 5I66B 1U3YA 2VIRB 5KOMC 5IOPB 1RUKL 3QEQA 4NOBA 1NCTA 2YEZA 3FN0L 3OAZK 4RAVB 1CLOL 3ZDXE 2X70B 3O4LB 3ZDYF 1F3DH 3I2CL 5CILH 2CLZB 3BPCA 4XVUC 5T1LB 3GSNB 2K7PA 2DLGA 2PCPB 3HI6H 2V5YA 4P4KC 5B38A 3P11H 5CSGA 2ZG2A 1ZANH 2WBKA 4LEXL 1BX2A 3HMWH 3OB0K 3U7WL 4UU9B 2F8XC 3QUXD 5D2LB 2F53D 1MCQA 1KG0A 3VXPA 3QUMA 1ZTXL 1CE6A 1BLNA 2EXWD 5BW7C 4LLDB 1MWAH 3HI6L 2GSGA 3GSWB 3SGKA 1F3RB 1ROWA 3TFKC 3SE9L 4QXGH 4MA3B 1UB6B 5AYQA 1UQSB 4YEFA 1I3UA 2CDEB 1G7LB 1LDPH 4PJBA 3KYOB 5JW5B 2XWJA 2NY4C 4X6DF 4L1HA 2CIKB 4EKXA 2XPGA 3AMLA 1NL0H 2DM7A 2YSSA 5IB5B 3QXVA 5C2BL 2YA0A 2DM3A 2OMNA 5HI3D 3V6ZA 4AIOA 1OTUD 1J7VR 2A77L 3HE6A 3QPQC 4Q6IB 4MQ7B 3SO3B 3ET9F 3QPXH 1WFTA 3RUGB 3B5HA 2Z9TA 5IVXA 1IFHL 4MX7A 2AGJH 1MAKA 3HE6C 4HIXH 5D7KE 1JHLL 3AU1A 4G9FD 4S1DC 3LN4A 4E41A 4Z77A 1A4KB 4DCQA 1G7QB 1YJDH 3QPXL 4YR6A 4IMKA 2ESVE 3HZKB 4QHNB 1G7IA 2O61B 4UILH 4KQ3H 1VACB 5DI8B 3U83A 5C9JB 1HHJB 2ZNXA 3IDGA 3S3PA 4LFHD 5D8JL 1S9WA 4ZUWA 4JAMA 4Y8AA 1CTOA 5HHVH 3QHFH 4QRTA 3VWKC 5DEFB 1CFTA 4GAGL 1A6WL 1KF9B 2ERJC 3CDYA 5IMKA 2MNUA 4PJAE 1X5XA 3RVWC 1G7JA 1Z2KA 3BKMH 2LABA 2VH5H 5DUML 1HXMB 4C57C 5CIPA 2JF1A 4IOFD 4WY7L 3OKNB 5TFSH 2QTEA 4XCNB 1PEZA 4PLKC 4APQB 5E9DA 4G80A 4JFED 3T3PE 2E9JA 5T5NF 1FL6A 2XNAA 3KPQA 5CILL 2AV7B 1ZHBB 7CGTA 2F74A 4AM0A 2D03H 2WIIA 4OCMC 4ODHH 1F2QA 2UWEF 4Y1AA 5TH2B 3S3SA 1DBMH 3V5DB 1L6ZA 5GRWA 4A2LA 5H35B 4ONHA 4I0PD 2VLJE 5HGHA 5BV7C 4LLWA 3O6FC 1AH1A 1OAQH 1W0VB 4MCZB 1RUQH 1RIUL 4PV8A 2VZOA 3HHRB 3O6ML 1S7RB 5I1LB 1DBML 4OZIB 3MR9B 3BEWB 3HLAB 3CUPB 3IU3A 4JQXA 3K4AA 1UXWB 3ZYJA 3OR7A 3QA3A 1I9JL 3QIBB 1R3HA 5F7DA 5DC4B 3O3UN 4O51A 35C8L 3AY4A 4ZAKB 1BZQK 2BNRE 3KWWB 5E8NA 4YIQB 2V2TA 3MRDB 3O6MH 1WTGT 4HS6A 5JORA 2X1XR 4ZYKA 2L7JA 3OKMA 4KPHH 5CP7B 3VFPA 5DEFA 3T77A 2ADGB 4YNYB 1F6LL 5ESAA 35C8H 4NSKB 1HHHB 4XMKL 4XC1H 3SKUD 3TVMC 4PGDB 5IB4B 5J12B 4ACPA 4Z78B 3ZDXF 4NKMB 1ULVA 3MOAL 3KXFB 4G6JH 5AUMA 4HS3A 4BK4A 1HE7A 4UILL 3C9NA 4MCYA 1DUYB 4S11A 2IMNA 3E2HB 3PWLB 2X4RA 4J3OC 5I8OH 5EUOA 3LD8C 5EUKB 1K5NB 1AD0A 1Q9LA 4YHNB 5JW3L 3MXWL 3DO7A 4M7LH 1HDMB 4OLXL 1AIFB 1EDQA 1RZFH 4F37F 4KY1H 4NWUL 1ZA6A 2A0LD 4K7PH 3CFKA 3WE6A 4U2YA 5FKPB 1YEJH 3WXVH 2XIDA 5EWIL 1CE1H 5IGXH 5D9SA 3ARFD 2W9EH 4HG4J 2X4OA 3NABH 4OFYD 5DJ8B 4F2MA 5T33L 4OUUB 1H3XA 1FIEA 2W9LA 4W6WB 4GQ9H 2HN7B 4HWBH 3HCVA 2C4FT 4TNWK 1LO5B 3FQXA 2HG5A 4ZOAA 5DJCB 4S2SA 2I24N 4IJ3B 4O2CA 3VFPB 1QLFA 5L2KB 4H8WC 3FOMB 3QHZH 4XCEB 1RIUH 4AEHH 2N7BA 1VFAA 3F7VB 5F97E 2F53B 4NC0B 3QUXB 4X4MA 3ARGD 5D1QA 1LNUA 32C2B 3D25B 4PGDA 3QFDA 2FX7H 4JO1L 2IBZX 5T1MA 3WFZA 4Y5VA 1DN0A 4M61B 1T03L 2DQEH 5HYSB 5FGCE 5A16A 4KTDH 4CVWA 3TESA 2FO4A 3O4LD 2OTPA 1A7OL 3GBML 1CD1B 3UX9B 1QFWL 3MLSH 1PD6A 4OIAA 1NLBH 5FOJA 4IOFC 3WEXB 4CMHB 3OR6A 4KRNA 2J5LB 5K93A 2DAVA 1RIVH 4HWZB 4PJ9B 5IW3A 3WNPA 4NRXB 3MLVL 1RMFL 1ZA6B 4OIIL 3C08L 2DLIA 5JHLH 2A0LC 4MZ3A 3L3DB 1QLRA 4NKIH 1ZVSA 3FOLA 4E41E 4S10A 3K4ZA 1WCBB 1MQKL 3MV7A 3WO4C 1F11A 3FB7B 1MEXL 5JLZA 2P46B 3ZE0E 4KK9C 1GGIL 4I0PC 3C08H 5KVEH 1LD9A 1XEDA 3MJ8A 3GSRA 5E2WH 5KJRH 3TN0C 1NGPH 4JO2L 5EB9A 3BHBA 4UTBH 5BS0B 5GRXG 5J13B 1RJLA 4OGAD 3MUJA 1OLZA 4FQLL 4KHXL 5C0AD 3PXHA 4JKPH 2DS4A 4EQ3A 2IJ0C 1MCBA 1QSFE 1H3PH 3MLUL 3A6CH 5I2IA 3C09C 3MCLH 5AZ2H 4PJBE 3L3OB 2Z91A 4WUKH 4QRQA 4X0KB 5ETUB 5L2KA 5B22A 1AGFA 3VXRD 4ONFL 3QAZC 1K4CB 4UTBL 3T2NH 3N1MC 5I75C 4JO3L 4F58L 1FZOA 3SQBA 1RJZA 1ND0A 2VABB 4XVJL 1XZ0B 2M2DA 2ED8A 1TPXC 5CBEA 1RIHH 3NGBC 5TJWK 1I8MA 4KJYA 1CZ8L 1EGJA 4Z7VF 5B3JE 4K9EC 5IV2B 5I1JL 3QI9A 2EH7H 4XRCA 3IDYC 5IW6B 4F7PA 1F4WL 3O2DA 3WFEL 3KPRB 1GOFA 4MDJA 3S35L 1NSNH 3VXSD 1JTOA 5MP6L 3NCBB 3W9EA 2GK0A 1HSAA 5JNYA 3TZVA 2YD5A 1WT5A 3PP4H 1ODAA 5C08B 5IMLB 1F3JA 2A83A 4YHZH 5CFHA 1QNZL 4N9GA 4IOSD 5IHUH 3SDYH 3QIBD 3MC0A 4F37K 3WYRA 4DN3H 2I25N 3RZCA 3MFFA 2GJ6B 4HC1L 4Z7UE 3MV8A 5J3HC 4UAOC 4Y19E 2Y5TA 5T3XD 5DLMH 1CQKA 5FK9B 2I9TA 5HDQH 1MAML 2ZG3A 3L5JA 1KJ2H 3DTXB 4ZO8A 1C5DA 2JK5A 4ERSL 3TP4A 4XTRC 3MV11 4DN3L 1N6QL 2APTA 2OX5A 4JZJA 5KS9A 4CMHC 4FABH 3CDGB 4ISVA 2B0SH 3V6OA 2XWJB 1Y6KR 1A14H 1F42A 3UDWA 3QQ3B 5FYLL 5TE6H 4L29B 3P9MB 4HQQL 5EO9A 3LS4L 4NFBA 2HT3C 1OT2A 3BEVA 5F7MC 1NGXB 2VTFA 3WFHA 3RUGA 4UQ2A 1GZPB 1EGJL 2EKSB 4OCNC 3EYOA 3FN0H 4QXTA 4HUWA 1YYMH 1XF4B 4X8JA 1B6DA 3O45B 2Q7NA 3T2PA 2PW2A 5GGQH 3MV9A 5JPNA 3U2SA 3V5HB 1BJMA 4HV8A 5DI8A 2WINB 1D6VL 1FE8H 1I8IA 1G6RL 2PETA 1FVDB 4LSRL 1XIWB 3LPWA 4L8DA 4ODTH 3QDMB 1OD7A 1H5BA 5CBAB 4JDVA 4JY5L 4HCRH 4U7KA 1MCNA 1UH3A 3EYSL 2VISB 2A9ML 2B5IC 2R15A 4F7TB 4FN0A 4KKNA 1MCLA 3UTSB 2ERJB 4P49A 4PJ5D 1ZWIB 1MFBH 4DKAA 5E6YA 2P8PA 3NPSC 3P40A 3F5WA 1U0QA 1FJ1A 4EDXA 2DL9A 3MRIA 4JFXA 4LHJB 3OJDB 5I6XB 4MNGB 5DD5H 1IC5L 5IVZA 3ZYZA 1AR1D 5DD6A 5IF0A 2FSEB 4OCSH 5KS9B 2B7DT 3OKDA 2CGRH 3RPIB 1TLKA 1DR9A 5C7XH 4RIRB 5H2BA 5D2NE 2V7HA 5J4MA 1HOCA 2IAMA 5IOPA 5F8RC 3VRJA 3KYMA 2E8YA 1I8LC 3MMEB 4LLWB 3GSQA 4V1DB 4PJIF 1RZ7L 1T6VN 4Y2DC 4Z7VE 5E94A 2FR4B 4YE4L 2AP2A 2XWTA 3ARDB 1CVRA 4HKBB 3KNBA 1IGFH 1A5FH 2IAMC 2YN5A 5I16B 4I3SH 3BYTA 4GRLB 3IDNA 4WEUD 2CLVB 4OD3L 1QFPA 3LVEA 1N59A 1A6WH 3K1DA 1RZ7H 3QUMH 1IARB 3N1QC 5L2KE 3B3IB 3J8F7 3SY0B 1E6OH 1BLNB 4HGWA 3EYUL 4E5XB 4HQQH 5IFAL 3ETBF 5IHZA 4OZIF 5DHXB 4HMEA 5DS8A 4OD3H 2XA8L 3LKRA 5FGCB 2BP3A 3GIZH 12E8H 3FQNA 3MGOB 3VMNA 4XAKE 3L3JA 4L4TD 5ESQB 4QHKI 5HHNB 1TNMA 2VMFA 2ID5A 1JWSA 5DJXB 1LK2A 2GJZB 5TE4H 4Q6IA 1XCTB 1MWAA 4MA7L 2XA8H 1JNNL 4W6XB 2GW5A 3HUJA 1T0NA 1ZGLB 5MEOA 2DTSA 3HNSH 3QEGL 1OAKL 4LLMB 4MX7B 1QVOB 4JO4L 1V8HA 1YECH 2Z31D 2FATH 4LPVA 5DUMH 1A6AB 2W1NA 5D96B 5EU7C 3QIBC 4L4TE 3KPSB 3PWLA 5MI0C 2VQ1B 1CFSB 4LRIC 3T0AA 4DCQB 1VEMA 2H26A 2VDPL 3ZTNH 2VXSL 5EBLB 1MI5A 1MNUL 1KYOK 2NY4D 1J87A 1UM4L 2R2EB 3HNSL 4GQPH 4DGVL 2XYCA 3MRRA 5HVWA 2MQ0A 4WI5A 3HE7D 4LIQL 3E1F1 1IGYB 3TIDB 1W72A 5ITBL 1QFOA 3HZVA 4LRNH 4DAGH 1IKFL 4PJXF 1XF3B 1MCSA 2EYRA 2D31B 3M1BB 4F57H 1AGBA 1DVFC 3TJEL 1T1XB 2E27L 1K6QL 5E4EC 1PYWB 3UDWC 4LKXA 1FV1A 5E8PB 1HHGA 3RWFA 3BP7B 3TNNB 3V6OC 3ULUC 2OSLA 4NZUH 5EIQA 1J0KA 2IANE 4BQCA 3B9KD 1AP2B 4MJ5B 1DP0A 4IHOB 2HG5B 5JDSB 3W2DL 4IIQC 4Y1AD 1MRCH 2R9HD 4QRUB 5DVNA 5IB3A 1IEBA 1JGLL 3QO1A 5C0AE 5L0QB 4LVNC 2WUCL 3TNMA 2PTTB 4LSDA 5CD3B 3KPMB 4TRPH 2F74B 3I6GB 1M7XA 4NNXB 3O8XB 1MFCH 2BY0A 4JM2D 2R2BA 2BHYA 3H3PH 2VLRA 3V5KB 1U6AL 4P4KD 3V4PL 2WUCH 2FEEI 3GSVB 3L7EB 3CFEA 4M6NH 2EC9T 4PJGA 4U1SA 2VOTA 3M8OH 4KJQD 4GRMA 3FONB 4D0BB 1EPFA 3MTRA 5EWIH 2W9EL 3QIBA 5F7DB 1JZ3A 1JZ5A 3AB0B 3EOTL 4X4XA 5IVXF 1C8PA 4FXKB 1NBVH 4YJZL 1G6VK 2GIYA 4RCAA 1IGYA 1AFVL 2FIKA 3RVUD 2J12B 1MJ8L 5KTEH 1QR4A 3P73B 5SX4H 1VKXA 3WNMA 1CXEA 3MLWH 4EOWL 4G43A 5CLTA 5EA0H 3O41B 1HHHA 2BC4B 5D4QA 3N9GL 3WS6A 4GW1A 3U48A 2AJYH 4LL9A 1H3UA 2D7PA 3AC0A 3V9FA 4JFQB 3IXTB 4JM4L 3B4NA 2WLYA 3VJ6B 1FP5A 3MJ6A 4KHTL 3CK0H 5J13C 4NRZA 3INUL 3IAGC 1IM3A 5LWYL 5D6CB 3LEXA 4X7TA 4YHOH 5F9WC 1ZHKB 4R8WL 3IFNH 1BVKB 1F4XH 2CKBB 4JO1H 1GVIA 3K80A 4ZNCD 5AWNL 4F7EA 1SEQH 5I1GH 5C08E 5J06A 4I5BB 2JJTC 3BW9B 4GQ9L 1AO7A 1T5WA 4I18B 4LRNL 5FUOL 3UAJC 4FFVD 5IB2B 4QT5A 4QRRE 5J6GA 1A7OH 2R2CA 4YPJA 4Y19B 2VABA 2R1XB 2EYTB 2CIIA 5ABDE 4G8FB 4Y2DA 1INEH 1HILA 4PJDB 3R06B 1XGRA 4OZHB 4CKVX 4N90D 4LOUD 2OZ4H 4QGTA 1UWXK 3PQYD 4X9GA 3RHWF 3EJJX 4ZTPH 3BDBA 4M5YL 1X9QA 4PJ5A 3F58L 3T0EE 3AXLA 4PD4K 2X7LA 1N64H 3MRJA 1YY8A 3Q6GH 1B0GB 1Z5LA 5D71L 1OAXH 1KEGL 4UT9L 3BXNA 5D1QC 5D7IB 1YEKL 1PKQE 3QEQD 1FZMB 1RZGB 3FFDA 4N0CD 3MFFB 3ECBB 3UTTA 3BWAB 1TJHL 1ZT7B 5F9OH 1RZJC 1FPTH 2J8UF 4N68A 1WWAX 1Z3GL 3U0TA 3KXFE 3NIGF 3MLUH 3TWCL 4BFBD 2UWEE 5JXED 5BVPH 1MRDL 3RX7A 4HJ0C 3ARWA 1FNFA 4MAYA 4QXUL 1TJGH 2QL1A 4AK1A 2XKNA 1G7PA 4V1DE 3BPNC 4X4ZA 2HWZH 1QSEA 5HVFB 3V4VH 3QDJD 2WWKO 4KY1L 4NWUH 4ODSH 4DJMA 2EIEA 3BKCH 3CU1A 4JCLA 1NGZA 2P49B 5KSBF 5EU4B 3DUUB 3IKCA 4KDTA 1A21A 1CGWA 1JZ8A 4JFPB 5EZIL 2IPTL 3D3VD 1DE4B 5ANMA 4N8VA 5EH1A 5C09A 2AXFA 4M00A 5EA0L 1H3TA 1BVLA 3T3ME 4JHWL 5SWZA 4AL8L 1B4JL 4Q9QH 2R9HC 2I5YL 4PJAF 5CJOH 1L7TL 5T5NG 4RFNB 4U1GC 5EZIH 1UJ3C 1ZK9A 2P7TA 4DOHB 3ARDC 3BJ91 1A3LH 3OHXB 1VHPA 3INUH 1FO0B 5T3ZD 4MNQB 4KI1A 1HEZB 4LLQA 5F9WB 2ADJA 5GGRA 3QO0A 3OB8A 4FNLL 4ZAKC 1BFTA 2HVKB 3GSRB 5BV7L 1IC4H 1SYSB 3Q2CA 1JN6B 1DQDH 1MLBB 1CZ8H 4NZRL 3HFMH 4OIBA 1BFOB 2HH0L 1JGEB 5HHME 2JJVA 4I0CC 1ZVYA 4PJ9D 2UY6A 2DI7A 3U7AA 3LQAC 2DQIL 3GJFB 2WQ8A 3G5XB 3WUZA 4ESKA 5EFIA 5DMIH 4OZIE 2YZ8A 3NCEB 3VE0B 4FABL 1FSKB 4NT6A 3PWPD 3UTTB 4KTDL 1DQMH 3TA3A 7FABL 4FQCL 3RX8A 3HI1B 1FVEB 1T7WA 1YEDB 4HT1H 5E2UH 4AMKL 4F7CA 2GFBA 4Y5YC 5JHDA 4G9DA 5EC2B 4YFLI 3MLTB 2WP3O 4MNGA 1QNZH 5INDA 1KLGB 3SDYL 4X6DE 4Z7WA 4RA0C 2QSCL 2BSED 5I8EA 3QUZD 1UWXH 1OAYL 1N64L 3GBNL 3PWPB 4HC1H 1WFOA 5CEZL 4HX1A 4KAQL 1S9YB 4XP4L 1KIPA 1JF1A 3ULVF 4I48A 1XFPA 3MBXH 4G7YH 4AIZB 3VD5A 4YHIA 3FB8B 1NC4D 1IGJA 3FT4A 3QNXA 2B5IB 5JIIA 2W59A 5F89A 3NVQA 2PN5A 2QSCH 3QG7H 5DZNA 4WDIA 3MRLA 5F44A 1TJHH 2AXGA 1NANI 1KIRA 5C0CA 4ZOBA 4RAHA 3ESVF 5C8JB 4R7NB 4WO4C 3BFOA 3BD5A 5J11C 4K8RL 1TJGL 1WC7B 5BQ7B 1WBZA 4YXLL 1UZ6F 2CKBH 5FK9A 1CGYA 3VFGH 5JW4N 3WO4B 1YYML 5AZ2L 2AEPL 2IFFL 3JV5A 1LILA 2VYRE 3RWIB 1UEYA 3MJ9A 2EDNA 4GKNB 1HYRC 2NTFA 4LU5H 1CG9B 1UXSB 4MS8C 4ZD3L 3HNVH 5C0CE 4D9RE 1YPZA 5C86A 1JGEA 2OR8A 3MNVB 3RDTB 4BA8A 4Z7OF 5AG9A 3FRUB 4HKZA 3LQZA 4HKJB 2C1OA 5EFIB 4LVNB 3QDGE 1CL7H 3ZL4H 1RSFA 5JO5A 5FXCH 4UQ2B 5GJSL 1YEDA 2GAZA 4K23H 3VFRB 3D5OF 3QAZB 4MD0B 5KSAB 1HSBB 1U3HC 4YQXL 3KPNB 1B3JA 1DEEB 4N0UE 3VDCA 3P77B 1SY6A 3K7UA 1OCWL 2VDRL 3DYMA 3A0OA 2Y7QB 3KPRE 3ZKMD 2BRRL 4FOMA 4IRJB 4HIXL 5JHDE 1WIOA 3NAAH 1AE6H 2WINA 4BQ8A 5HHOE 1EERB 3FT2A 1MFAL 3QIUB 4NM4L 4NRYB 3WFDH 3ESUF 1OSPL 2C3WA 3OKKA 4ZSOA 2BOBA 1C1EL 1JI1A 4ONGH 5GRYA 1WEJH 4PJIE 2BNRD 1OWRM 2NX5D 3QCTL 1JTPA 1FYTD 1ADQH 2A73B 4K2UH 3PQYB 2H32B 5LQBH 2RBLA 3FO2A 2FEDD 1DQJA 4X7FC 5BQ7A 4QXWA 1XT5A 5LGKA 4YE4H 4F9LA 1NFDA 4HK0B 4I0PB 4PGJA 2X4QA 3LB6D 1X5ZA 4OAWB 3FO1B 3QISA 3BN9C 5MI0B 1BBDH 2W65B 4KTEH 2D4DA 1AHWB 1LE9A 3IF1B 1QUNA 2P24A 5LQBL 4F7MB 3NMEA 3MGTB 3EDEA 5F7LB 4LKCA 2GTZA 3G5VA 3Q48A 3VGEA 1N3NA 2EDLA 4O2EA 5LGHH 5F21B 3HR5B 1JPTL 3G08A 1BQSA 2BOCA 3RBGA 5HHQA 4KTEL 3I85A 1KELL 1SVCP 1YNKH 4RDQG 1W0WA 4P5MA 5GGQL 4H1LH 1RUAL 2EXWC 3BT2H 3H0TB 3CFEB 3JV6A 2HLAA 3UTQA 3JWOH 5B3JF 1KTRL 4QY8B 1AGEA 5C0BE 2Y9RT 3GMQB 3AU1B 1RUPL 3NA9H 5M94B 4GRMB 5J6HB 3ZHLA 3L5WB 2ZCKL 3REVB 4H88H 1YNLL 4NFDA 3IDYB 1N4XH 4LCYA 2D3VA 3GHBL 2E27H 3FHQA 4WFFE 4J4PD 3CPLA 2LV4A 1YEGL 3FFCE 4JHAH 1NKRA 3TBYA 2L0DA 3RDTD 2Z31C 2JELL 3SOBH 5ACZB 3SKOB 3JVGA 4M8QB 3TVMA 2MWCA 3KLAB 5DFWH 1IC5H 5DVOA 3M17A 4ODVH 1MVUB 2AXJA 3S36X 2OTWB 4WEBL 1EEZA 5GRZA 2HFFB 2D7TH 2O26U 1IM3B 1KFAL 1II4E 4APQA 1PKOA 4NOFA 1YEIH 3LDBC 2QR0A 3BPNB 4F7EB 5A1AA 1OAUH 4NKQB 2D7NA 4KJPD 1RHHB 4B50A 5ANME 1IEHA 2R69L 1K3ZA 4I2XB 3VRLE 3DBXB 5J0BA 1N0XL 5DRNA 3I84A 5F1NB 4M6NL 4L8CB 5JW4Q 1OP3K 5IQ7L 4AQ1B 1JF6A 4DZBA 3LN9A 1CWVA 2EYTA 1V7NL 4HGMA 4Z7QF 2XTLA 1T66D 4QYOB 4Z5RB 2VAAA 3FJTA 3MXVH 1NC4B 2R0LL 3H2WA 3JV0A 1EJOH 2B39A 1R5WB 3VXMA 2EYRB 1M6OB 3VDAA 1U8QB 3EYUH 3MPCA 1JI2A 4U6HA 3VXTA 4FP8H 4I13B 3TO4A 1IEAB 4P2RB 4D9RD 4WUUA 1MCOH 4D0CB 4Y88A 1Y18B 3C5JA 4HEPG 1U6AH 4NDMA 4X4ME 1F4AA 4O5LL 1KJ2A 3AAZA 4LLDA 4J1UB 1YNTB 3DURB 1M7DA 1HKLH 5LGHL 4AH2A 3EO9H 2NY4B 4PGCB 5FM4A 3JWDH 4JM4H 4HWBL 5GSRA 2EIZB 4J4PC 1F45A 4QOKD 1GZQA 1FHGA 4R96A 2G5RA 3HA0A 1D9KA 1Z9SA 3BT2L 2PTTA 2H2SC 4NQDB 3NCJL 4EN3A 3O4OC 3D9AH 2OJZL 4PGZA 3HE6B 2PO6A 2K1MA 3VWKA 3QHZL 4MNQD 1YEEH 1MJ8H 4Y5XA 3VD7A 1FNLA 5BJTB 5F7UA 5HDBF 4E0RA 2BVOB 3H9HB 5BO1H 1KPVA 2APWA 4PJ7A 2P8LA 3BP5A 1FN4B 1T2XA 3GHBH 4PJCE 5IEHA 5D7JA 1IGMH 2DQDL 2Y06L 2AEIT 1S9VB 2DTMH 2FO1A 1AO7E 2FEDC 1LO3L 2JELH 4U0RC 2P45B 2NTSP 1FNEB 3F8UB 1A64A 4CAGA 1T1YB 4K9EL 4M5YH 4X7SH 3IFNL 5DXWA 2FBOJ 1IGML 2DQDH 3IVKA 3EO1B 4WEBH 4XVSH 1S7XA 1S78D 2P7TB 4RGOL 1CDIA 3TBWA 5HDLA 5D5MB 2OL3L 5KAQG 2HKHH 4GW1B 3WKML 3CVHL 1S7QA 1OGTB 4Y4FA 3SO5A 1VFBB 4QRPB 3VRIB 2RJMA 5EC1B 3RJDA 2ZSVB 3E6HA 2NNAA 4PRHA 3VD3A 5DEGA 1KJ2B 3AAZB 4KVCL 4Z7VB 4PRIA 3WJJC 4HJGA 4XAKD 4JY6A 1MRDH 5BXFB 2OS7A 4JFFA 4ETQA 3PABB 5C0FA 3MOAH 4TQEH 3MBEB 3VG0H 2X05A 4GAJH 3DSFL 5DQ9A 3OSKA 5DD3L 5ID1A 4LPTA 4F7CB 5JHDB 5IB2A 1PX3A 2EEDA 2JJWA 4M43L 4N0YH 5H94A 3SE3A 5BOPA 1GIGH 2VDKH 1YEKH 2WIIB 4FP8L 4X4YA 2OMBA 1NMCB 1A6TB 5GGSB 5DC0A 4BELD 1QRNB 1A4JA 4M03A 5DD3H 3F7PC 5CGYD 1N2RA 5ICYB 4P48A 4YFEA 5IEHB 1RUMH 1ZGLM 1FH5H 4WHYG 2UUDH 2GK2A 3HLAA 4LSTL 3U0WH 4K94L 4NO0A 5M7QA 2Y25A 2X7LB 4NC1C 4WDIB 1NEZG 5LBSH 3UXFA 3B9KC 4GRWB 3HNTH 3UJTL 2QLVB 2G5BB 1MSPA 4RNRA 3T08A 1U93B 3BN9D 3TV3H 5H37G 5CGMA 1NSNL 3D0LA 1S3KL 4X6BB 4JLRA 1IC4L 2F54B 4I4WB 3CZFA 3FOLB 3ZHDA 2CRYA 3RX5A 2E7CA 2J1KA 1ZT7A 3X3GL 1LQSR 2NXYD 5TDPB 1WAAE 4R8WH 5FYKD 5JLZB 3WV0A 3FQWA 3ARFA 1T66C 1LEIA 3VFMB 4TOYH 1WFNA 4FFYH 5F7WC 1T2JA 2Q76A 3D1MC 1NGWA 5MENE 1I1AD 1CG9A 4TSCH 3VH8A 5FA4A 2E6PA 3A6BH 1W72L 3E2HC 4IMLA 5K9KA 4JY6B 2WBJC 1BFVH 5BXFA 2F54D 3OAZH 4MJIE 3RKPA 4G6KH 3MA9H 4RX4D 3ES6B 4TOYL 2ZUVA 4XPHH 4GG8B 4XWOC 1GYAA 3ZSSA 5D2NA 1U8HB 4DVBB 4ELKB 4JKMA 4ZTPL 3I3DA 4LARH 4L8BB 2HP4A 1FC2D 3HUJE 3FFCB 4M6MH 3MA9L 2HVJA 5EIIB 4OQTA 3Q6GL 3IS0X 3VA6A 1GC1H 5ISZE 4XGZA 2E7HA 3O2WL 4O9HH 2NZ9D 3TT3L 4XMLH 1NGQH 1DN2A 1Q9KA 3HZYA 3KPLA 4YDIH 43CAB 1MCIA 3VFTA 4OFKA 3VCLB 3WNNA 1SBSH 4XPGL 1MQKH 4N1HB 2AJXL 3IFPB 1SEBB 1LGVA 1KTDA 1MF2L 1J0ZA 4S1RL 2DKUA 4QOKA 3ULSA 2OR9H 8FABA 3EYSH 4X9IA 3TPUA 4DK6A 2AQ3A 4JFEE 4JO2H 1NMCC 4KVNH 1IGTB 1CXKA 4MNHA 4W4OA 3HNVL 4QRRB 3U0PB 3ZO0A 4QRPD 5C9KA 2YRPA 5I76A 4QTHA 3ZYIA 3LEVH 2JJUA 3FKUS 1R3KB 3MGTA 1P84K 2VL5B 1DN0B 3B43A 2YPLE 3BKYL 4PB0L 4XNYH 3BUYB 3EZJB 2MQ3A 2WM0A 3PGCB 3VFGL 4QRSA 1RHFA 3EYVA 3TV3L 1HCFX 5IW1A 3D2UB 3QJFB 3RVXD 4PJ9C 1TQBB 3WFBH 2I5YH 3MROB 5DR5L 1NFKA 3L3HB 3V0WL 1G6RB 2CGRL 4IOIB 4P5MB 1EHLH 4D2NA 3K8MA 2NCMA 2NW3B 3MA7B 2Q8BH 5HI5C 4LSPL 4GAYA 1W2KT 1DEDA 4PB0H 3TO2B 4HWZA 1SJVA 3KYAA 2HTLC 2ZUXA 1CD9B 4WU5A 4RWYL 2DJUA 1UENA 5DURB 4HBCH 1EAPB 4L9LB 3KJ6H 3QQ4B 1X4XA 1Q9WA 1JYVA 5DJ6B 1EHLL 5DRZB 1WIUA 4LSPH 3P9LB 5DDHB 1KGCE 2F5BH 3MJGX 3TN0B 2NZ9C 5J57B 3DMMB 4JHBA 1UKTA 2DRUA 4D3CH 2X6MA 3QDMA 2OK0H 1FFNB 1FORH 3D39A 1G9ML 1H0DA 2R39A 3HI5H 4Y4FD 1TMCB 2DD8H 1EHAA 3ZT6A 2EDKA 2VXUH 5CLWA 1AQKL 1EVUA 4Y7MA 5CSBA 5DF0A 4G7VL 3U30C 5L8LB 1A14L 1FJ1B 3MRPA 4MWFA 4BQ9A 3O6LH 3W0WB 5GZNC 1CU4H 4GW5B 3MRMA 3RWJA 1D5MB 1JVKA 1TXKA 3UCRA 3ARDD 2PXYD 5F1NA 1EGJH 4KJYB 4RIRA 4XT1C 1NAKH 2IADB 4MS8D 5JXEA 2AW2A 1T2QL 1KN2H 1HYSD 1NDGA 2R1WB 4YXLH 3GRWL 1E6JH 5FM5O 3O3EA 4JFFD 1CDGA 2GCYA 2ARJB 1FNGB 5FUZH 1J05B 2F8VA 1F97A 1A47A 4PRHD 1DANT 1YEGH 3AROA 4FQHB 3ZKQD 2VIRA 4JRYA 1XH3A 4PBWD 4PJ8D 1UEMA 3DOSA 3MUHL 3PWNA 4NO3B 3X11A 1R3LA 5C71A 2X70A 1M7DB 5C6TL 1CN4A 3DMMA 3FO1A 3WIIH 5D1XA 5LXGH 3W5MA 4PJXA 2JK5B 3VWJC 4HS8H 4XXDA 5DHVA 4YDJB 2P24B 3STBA 1NDMA 1QRNE 3EYQC 2MTPA 3EUUA 5TGBB 3X17A 3D39D 4HKXB 3T0DA 1MHCB 1RJCA 3BGFB 3O4OB 3X12B 5E8EB 4Y4KD 2PO6B 1XIWD 4EN3C 4WHCA 5IBUB 4BH8A 2R56L 3DXAA 3T4AA 1X5YA 1OGAE 1UCBH 2YD6A 5MENA 2AK4D 1XGUA 4H5SA 2VITB 2XACC 1WBXA 3DJ9A 4QF1A 3UTOA 3DVGA 3LMJH 4RMWA 4JZOB 1YC8A 1LP9E 3HPLA 3TH3T 3ULUL 3V4PH 1BM3H 1WZ1L 4KI5C 2VC2H 3BQUC 2V2XB 2PXYC 4OLYH 1UCBL 4D94A 4CU6A 1I8IB 1X5HA 4PJEA 5IVXB 1AKJA 3KLDA 1ACYH 4XHQA 1HZHH 3EOTH 3VXUB 4O5LH 2FECL 3V79C 5E00A 3L1OH 2WW8A 3TVMB 1JZ2A 5D8JH 4ODWA 1M71B 3AUVA 4FQHA 1KB9J 4LRIA 1VFBA 4QRPA 2EDQA 4S1QL 5BZDB 1TNNA 4HAFA 5EBWA 3ULUF 3UC0H 4UOJA 1UB5B 3EFDL 3NIDE 4N0UB 4NP4H 3VH8G 1K85A 3TLRA 3G6AA 4Z7UF 3RA7L 2YKLH 1I4FB 5DMKB 3MUZ1 5C08D 3RDTC 4NC1E 2VDQL 1GRWA 3DX7B 2EDYA 3EYQD 2F54E 5HHOB 5TF1H 4PUBL 2EECA 4W81A 2AK1H 3CH8A 4X4YB 5AWNH 4HIJA 3BDYL 1IBGH 4LSUL 4B5EA 5I30L 3MRBA 3RA7H 3K8LA 3UROR 1E27A 4KKLC 5C0BB 3RFZC 3DVNA 5E6IB 3GM8A 5E94B 2FR4A 4F9PC 2D03L 3WLBA 2EO1A 4UBDC 2A6DB 4KMQA 3L95A 3PQYE 2D0FA 3TO4B 1UM6H 5TE7L 2OJZH 4RZCA 1T20B 5GGUA 3LIZL 4KJPC 5E99H 3QXDA 3BMVA 2VKXA 3QDGB 1QBAA 5HGHB 1ZHNA 4K7FB 3BQUA 3QWRA 3O6KH 1QYGH 1E4WH 1U41A 4FG6C 3CVHH 1X7QA 4PS4H 1AD9A 3V4UL 5CEZD 2F54A 3HPJA 1RV6X 1X4ZA 4YBQD 5J1TC 4PJFE 4A6YL 2Q6WB 3WS3B 1CIUA 3IRZA 3KGRA 3OAUL 3ARRA 4EUPH 2UYLA 3LPFA 4OCYH 4G9FB 1G7JB 4CU7A 1DBKH 4X6FA 5HHNA 1OAUL 1JGLH 3FCTB 3CMGA 4M02A 2NY0B 4UIKL 1IL1B 4S1SL 4U1NB 4M43H 4Q9RL 4ZPVA 2HTLD 1IC1A 3KR3L 1CGTA 1QVOA 4OTXL 3S9DB 1F3DJ 1NCCL 2ORBH 5FYLD 4XNXH 2BY3A 2CDGB 5AZEH 3CLEL 5IB4A 1H15A 1YN7B 2NXYB 1T5XB 4KVCH 4LPCA 2VLJB 3GNML 3T3MF 4PRHE 1S5IL 3IVKB 1F4HA 3ZE0F 4RAVA 4XBEH 1RVFH 4WV1C 1FL5B 1K9TA 4KKLD 1NBYA 4NZJA 4HGKC 1E4KA 2PKDA 3BRGC 2PR4H 4U1JA 5EUKA 3ULVL 2W0FB 5AAWA 1S7RA 2MCPH 4PP2B 4FTVA 5IVOA 1UYWL 1EO5A 2EXYD 1KCVL 1W0YT 3B8SA 1R3HB 4MJ6B 3NH7L 4ONOA 1ZHNB 2BVPB 2PNDA 4K7FA 4OF7A 2LTQC 1P7KB 3IDXH 4HJGB 3MACL 3ALXA 2NX5A 2AK1L 3IDJB 2H1PL 4LSTH 3G6JA 4YHKH 3PL6D 3WD5H 4JRWA 1UB6A 3PV7A 3PIQB 4MNHB 3HNTL 3UJTH 5BO1L 4ZFGH 4PYHA 4WI4A 1OP9A 5IEKA 3CU7A 3L6FB 5SWSA 3MREA 2GKIA 5CD3A 5F1IA 4K71B 4I0KA 4G6KL 5DMIL 3EOAA 5ICXA 1K4DA 5F6IB 1OAZH 1I1RA 2XKNB 1L7IL 1RK1B 2WWMC 4FQXB 7FABH 4PJHE 2MKLC 3MNWA 5J1AA 1P4IH 1SM3L 4P2QB 4PY7A 2NXZB 4J3VA 1A9EB 3VFUB 5E03A 1B2WH 2AQ1A 3CH1A 1QYGL 4JQVA 5T1KD 2YUWA 5E7FA 4R2GB 4M6ML 4KWUA 5IIEB 5IMMA 4XCYB 2PYEB 3CDCA 2J4WH 3LN4B 4OF6A 4R4BB 4IOIA 4PJEE 4A6YH 3AS2A 3TYFB 3CVHA 4M7JL 2EIBA 1P7QB 3D3VB 2UZIH 3FZUD 2OL3A 5HDOA 2FRGP 3WCYA 4ZUVA 2P8MB 1EFXA 2QADB 5EG6C 3BPOC 4QRTB 2ZWLT 1RIVL 1OAXL 1RZ8B 5ADPH 4JGJA 4DZ8B 4K3EL 5CEXA 2B1HH 3PHOA 5I1CL 1JJUA 4XZUA 2YMXL 1NFIB 5DVLA 1V7ML 4PJ9A 4HIEB 2QQNL 4NKIL 1P6AB 4U1LB 4X98B 4Q58C 1PFCA 2BNQD 4HPYH 1A0QH 2EZ0D 3V7AG 5E1AA 3MLRL 3VH8B 1RZIA 4K3EH 1NBQA 4I18C 2A1WL 4TSAL 4WU7A 1WCBA 4ZFZA 5L8JB 3U46B 4LAJH 3QNYA 1N6VA 5E2WL 4LVEA 5GS1B 5KJRL 5KANG 5DUBA 1KB9K 3SGJA 4L4TB 4MLIA 2A38A 3NIFE 4P46C 4RGNB 1UADC 3MLRH 4MXWL 4G9DB 1CS6A 5EU5B 3JTSB 2D7MA 5DRWB 1UKSA 5EU7E 3IJHB 4F3FB 5IVXE 4L4VA 1QHPA 1D5MA 3SO3C 5IJVB 4YBQC 4M3JA 5GGTA 1YUHB 2DLTA 4NQEE 4HDIB 1IT9L 1IKNC 4K23L 5I17A 4YQXH 4TSBH 1FNSL 2QHRH 3GIVB 4TTGA 2A9NL 2P5WD 1CXHA 2P42B 3QA3B 2VRAA 5GXBB 3GI9L 5DSCB 1HHKA 1Q0XH 1J05A 3GO1H 1OB1A 5CBEB 2QQLL 3BDXA 5C8JA 1KCLA 3WFEH 5I1IH 4FQ2L 1DQLH 4FNLH 3QHTC 3P3YA 4HUVB 4ONGL 1DFBH 2B1AL 1N6UA 2B8OT 3BSZH 4LCUB 5DK0A 5D2NC 3ARBC 3KPRA 3EDKA 3LN5B 1Q38A 2GY7B 3PHOB 5FKAB 1DLFH 4HJ0D 3O9WA 2DDQH 3PHSA 2O5YL 4LASL 5CD5C 2XV6B 1WZLA 1I7ZA 4PBVC 4NKOA 4WW2F 4Y4HA 1P5UA 5I71C 1QSFB 3RNKA 3MRFA 4WV1A 1FVCB 1QPXA 1PAMA 3OKOB 3ARFC 2GI7A 2YC1B 1HQ4A 2X4SB 3C5SB 3K1KC 4CU8A 4KI5F 4NO5B 4LLAA 1JPST 2ENYA 4H5SB 4XVTL 2ICWI 3SBWA 2N7AA 4JZJB 1A9BA 4P46D 4Y2DD 4YHPA 4OF5A 1J86A 2FGWL 2L7UA 3QQ3A 2FJHA 5EO9B 1A7QL 2AJXH 5DDHA 1BBJA 3NA9L 3NIGE 4LPXA 3QEHA 4F7PB 4GBXC 3TBVA 4WIQA 4WTXA 4FHBD 4XXCA 2EC9U 3NACH 3OGCB 2PW2B 5C6TH 3CC5A 3TEUA 1XF2B 1YQ2A 1DUZB 3X13A 4JFZH 1KB5B 5DT1L 4U1MA 3CXDL 1S7SB 5E70A 4Y5YB 3LSOB 2Q8AL 2IPKB 2R0ZH 4ORGB 3TA3B 3MODH 3OZ9L 4YHMH 2Y36L 1ES0B 4ZXBA 4HUNB 1A3QA 5ITFA 3GMMB 3R8QA 4Z7WE 1WAAA 3BMWA 2AAVA 2ICWA 3RWJB 4XMPL 3UZVB 5E5MB 5ISZB 3ROOA 3GMRA 4UTAL 1A1MB 4D9LH 4UU9A 1JF1B 2IGFH 1MHHA 4Y4FC 4HBCL 5GGTL 3RWGA 4FQ2H 3IETA 4OCSL 2XY1A 5L2JA 1TQBC 2VC2L 5GIRA 1OPGH 3RGVA 1HH9A 1JNHB 5ILTH 4PRDA 3O3EB 1JMXA 2CLRA 1C08B 4NQXB 4CVXB 3UTQB 2CDEA 3LKQA 3G6DL 4G6ML 4PGEB 2DLEA 4Q0XH 3SDCA 1MCPH 5E8OB 3QIUD 3RWDB 3CFBA 5CCKH 3KYMB 4NN5B 5DJAB 5HGBB 5KOVC 5I1HH 3IDMA 4YPGA 4MD4B 4LMQI 3WIHL 5KG9B 1ZXQA 4DGIH 4JDVB 1TTGA 3PGDA 1S7UA 1S7TA 4KRPC 4WTZG 1HWGB 5D7JC 1DCLA 4G42B 4NBXB 4JZNA 5CMAB 1MRFH 4Q74A 2BNQA 2YD1A 3SJVD 2XFXB 5IFAH 1H8NA 1T04A 4XNZC 3VFWB 4UINH 5ALBL 4P0DA 4U1MB 4LHUG 1WICA 4UV7L 2VDLL 4WWKB 4C59B 3MRQA 1ACYL 2IPKA 1NAMB 1OQOA 2G75A 5FYJH 12E8L 3EGSB 1D9KC 2VQUA 4RFOL 4MNGE 3DVIA 3SJVA 4XWGH 1EFXD 1DEEA 1X5AA 3CFDA 2LU3A 1MIEH 3PWUA 1AGDA 4R6UA 4P2QD 5IFJB 3FB6A 1NBZA 3C2SA 1OAKH 5FUZL 1A7PH 3QDHA 4LCWD 1YN6B 5FEBA 1TIUA 4BSWA 5MEQB 1FL3B 3ARXA 4OLUH 4V1DD 2V5SA 4YUEH 1YJDC 4RAUB 1ZGLA 3H6JA 1UACL 4NN6C 4CN6A 4ZFFB 4YDVA 1FL6B 1UG9A 3BKML 1U8IB 3R1GL 1U8MB 4P4RA 3OG4B 3QSKB 5JQ6H 1U8QA 3PGFL 5F7NC 1IQWL 3LH2H 4LBEB 2FX8H 2A73A 3RL2A 4N9GB 4FTVB 1UJTA 5ITBH 1BQUA 1C5CH 5DD0L 1KC5L 2C3XA 3VFSA 3DUSA 4OJFH 5LKNA 1KBGL 5BRZE 4MD4A 3SDCC 3GHEH 2OXGA 2YXMA 1IAII 4K8RC 4JFDE 5EPMB 1A1OA 1DBBH 4DKFL 3NCMA 1FIGH 1VFMA 2X89D 4KRPD 4JZNB 5HGAA 3IU3B 4M4RA 1UXWA 4NQTA 1EBAA 1EEYA 5EZOL 3DX7A 4P5TD 3QIWC 2BVEA 4Q7DA 5A2FA 3QYCA 1X4YA 5IG7A 5DJ2B 4FTVD 3QNZB 5ELIA 5GS1C 1RUQL 5JDJA 3GHEL 3DROB 3V6BR 3HS0B 3BAEH 2EE2A 2DMBA 3DRQB 1I1CA 1MCJA 4LK4A 3ARGC 5E6IA 4NWTL 3ZZ1A 3OAUH 3B5GA 3P4OA 2Z31A 3DETC 3EKCA 3WMSA 1DBKL 4QXTB 2VSDA 1EO8L 2RCSH 3K3QA 5C0JA 3KPTA 1YMHB 1G7HA 5FCUL 2VLKA 2FEEL 4KROC 3ARBD 4NWTH 4TYUA 4XH2B 5I74B 3FB6B 5AUMB 1CGXA 3BQUB 4KK5D 4LCYB 4KK8D 4LQFL 1QBLL 4OB5L 2VLLB 3GDBA 1EFXB 1S7XB 1QFWM 3O0RL 4URTB 3D85A 2ZSWB 4RMUA 5HBBA 3O3BA 5T1LA 1KNOA 3NH7H 1U8IA 3RNQA 2Q87A 5I15H 5D5MA 3V8OA 2JIXB 3NFPA 4KUZL 1P53A 3VMOA 3FMGL 1QSZA 3NCYS 2VB5A 4X6CE 5D7LD 3WD5L 2DQJH 3TNNA 4KU1A 2CUHA 4KK9D 4NGHH 3LDBB 5AD0A 4JAMB 5FKPA 5EO0B 4LLYA 4X80L 3BRFA 2CJUH 3BKJH 1LE5B 2QQQA 5AAMA 3SCMA 4PUBH 4EDXB 1WF5A 2DLFH 4TNWF 1IBGL 4LSUH 3VXOB 5DJDA 2X4OB 5IHLB 4OF8A 4U3HA 3CMOL 1I3RA 1MFDH 1HHIB 1KCVH 2Q86A 4K7PL 3R1GH 2ZP0T 2X5PA 5C0BD 3FQUA 4LGSB 4L8CA 1INDL 3O9WD 4M62L 2QHLA 5DJ2A 4H8WH 4NNXA 4Y2OA 5BZWA 4L8SC 3FT3A 5LG1A 3KPRD 4NKDA 2X40A 3VRJB 3GJFH 4YHKL 4UNUA 4M7KL 4MLSA 3DO3A 2MPAL 4TULL 3ZDZE 1CTNA 3HG1D 4Y4HC 4WNQB 3P4OB 1JV5A 3DYOA 4J3TA 1D5IL 4M62H 1ED3B 1IAOB 4JREC 3UTZB 1R5VA 3F7VA 3ARZA 4NFCA 3GK8L 4POYA 4WW2B 2D0GA 2OZ4L 3C5JB 5HHPB 5EOTB 1J18A 3A6OA 1CR9H 1C16B 4HH8A 2E7BA 1Q72H 1F8TL 3QRGH 4FXKA 1QLEL 1V7MH 2FJGB 1S9KC 1I1AC 3QZWG 2BDNH 3EDFA 3NA4A 4ZUWB 5CZKA 4HUVA 1KJMA 3ZT5A 3O3BB 4Y19D 4PG9B 3TA3D 3O3AB 1GZQB 4UT9H 5C0AB 2H2SD 2IPUG 2XY2A 4NBYB 1E28A 4S1RH 4M7JH 4HWEH 1NJ9A 2OR9L 3H9ZA 3FQNB 5F1IB 5ACLA 1HIML 2ORBL 4L3CB 4YGAB 1LEIB 5DHYA 3QJHA 3LY6A 5FECA 2E9BA 3KLHD 1T4KA 5GSVA 4BFIA 4NKOB 3DSFH 2FL5B 1TCRA 1RZGA 2E6QA 3TIEA 4HS6B 4APQD 2AERT 2WP3T 1JE6A 3VMPA 2B1HL 4M1CD 4G80B 1KCSL 2W07A 1AKJD 3W11D 3C60C 5L88L 2B20A 4U6TA 3GKZA 5B8CC 1JGUH 1ORQB 1ZT1B 2AV7A 4W68A 1ZLVK 1X5GA 2WQRA 2EEAA 4F8TA 2C3HA 2P5WE 1FNSH 4WFEE 2DIJA 2E9WA 2NXYC 4D9QD 1IZJA 3GSUB 4ZPTB 5C0EA 1A2YB 5IM7B 5FHBL 2MCPL 5TDOA 1KV3A 2QSVA 3FTGA 4QHUA 1MCKA 1S78C 2XZCH 4Y2DB 4C4KT 2BSTB 5C09D 2AK4A 2ICCA 1W72B 4PP1D 4R90L 5C0IB 3KYNA 4DZ8A 1KJVB 3BKJL 4EIZC 3K0WA 3OX8B 3M1BA 1I7RB 5DTFA 5BMFH 4Q9QL 1F6AB 3T8XA 3EYFB 2HA1A 5KVFH 3CUPA 4L4VD 4HIEA 5JMOC 5I8KH 2NR6D 3S37L 4HWNA 4DFIA 4WW2A 4PLNC 1Z5LB 1CI5A 1GL4B 2DM4A 4XNQB 2CH8A 4WUKL 4Z7VA 2AEWA 3X13B 1XGTA 2E5EA 1BWMA 4WFGE 1MI5E 3IFOB 1FZKB 4CNIA 4MNQE 3PABA 1WWCA 3LSOA 4FZ8H 1B0WA 4L4TA 4TSCL 4KROD 3QO0B 1FCCA 1J0IA 3RGVD 3TA3C 4LLVB 3OKLB 1FG2B 3S4SB 5SWSD 4ZDHA 3ROLA 4WENB 3D0VB 3O8XA 4M9PA 5IUSA 4OF0A 2D2OA 2X4TB 2UZYB 2C7UB 2R2HA 3ROOB 1SMAA 4K07A 5HGDB 4FFZL 4JG0H 3MOBL 4OT1H 1F4WH 3JV4A 1CR9L 4HPOL 4L5FH 4NJAL 4X5XB 5CAYB 3B9KB 3C87A 2NY1C 5GS3A 2O5YH 1BGXH 4ZXBD 3SDDB 4P3CL 2YK1L 4P23B 4X6DB 3OKEA 4O9HL 2AJSH 4TPRL 1JYWA 2NY6C 1DL7L 3BZEA 1GCFA 5IHUL 4CVXA 4F9PA 5IESL 4NJ9L 1NEZB 3RIFK 3NCCB 1E4XL 4LMQE 2J5LC 3GSUA 1H3VA 1MH5A 1T2QH 2HJFB 5T1LD 2LFGA 5FYJU 1B0RA 4HFWB 1GPOL 1PZ5A 4UV4L 3DX8B 2ZOKA 5A2KH 3WDHA 3D85D 1IAIH 1CD1A 3QBTB 1P4BL 3W5NA 1N8ZA 4M1DL 1FC1A 1LO0H 2XZAH 2Y72A 1KIQB 1J9CT 5L7XL 4I77L 1HXYA 4NZTH 2Z35B 1FFNA 1YMMD 4BKLB 4NQVA 2JCCE 4LAQH 2BFVH 3EYOB 3QIWA 4G42A 4KVNL 3JBG7 2HN7A 2NR6C 3EDDA 4OZ4A 4Y4HD 2DWEA 2XWBB 1FGNH 3RNKB 2VR5A 2JCCF 1KJ3H 4NIKB 5K9KB 4RMQA 1LO0L 2XZAL 1WBZB 2BVYA 3LZFL 4U6XA 5DJCA 1YMMB 1RULH 5DYOB 3PJSA 1R3JB 3B6SB 4OZHE 1LO2L 2DWDA 1VPOH 1F11B 3MJ9L 5CINL 2W38A 5EORL 1QLFB 3BH9A 3BKYH 2DBJA 5HD8C 1AO7B 1T5WB 3ARTA 4LF3B 3IXAA 2GFBB 4HUXA 3WNKA 4NQEB 5KS9E 1JGVL 1S7VA 2X4PB 4DUWA 4L8BA 2X89A 2XN9A 1ZWIA 4ZFOB 1CL7L 5C0NC 3QFDB 3MCKA 3DPBA 2C7UA 2R2HB 3UO1H 2A6IA 5FHAL 1JWUB 3D69A 4NCC1 3I2CH 4JFDB 5IHBA 4QGYA 1R24A 3ULVD 1K4CA 3QEHB 4F80A 4L3AA 3ARSA 3QXAB 1ZE3C 3HC4L 1UA6L 3BH8A 1XR9B 2WBWB 1JZ7A 1I8KB 4M93B 1FNGA 3Q6FB 4B53A 1ZV5A 4IDLA 2JB5H 1ZTXH 2H45A 4YBHA 4R9HA 3U4EB 4HFWA 1U8OA 3LKSB 4MA1B 1XGYL 4P5KA 3DX8A 1T7ZA 1BJ1H 1QLRB 4YHYC 4EUPB 3QIUA 1UA6H 5TDNB 1N8ZB 4V1DA 3WDJA 4AENA 2IH1B 3PL6B 4P2OC 3OXSA 3MYZA 3RVVD 3OXRA 4BKLA 1D5ZA 4P99A 3EAKA 3C6LA 3UC0L 3GMLB 4MAUL 4GKNA 4PP1C 2CLVA 4JR9H 4H26A 1U8NB 2AJ3B 2XXCB 1RZKC 2ZKHH 5I71B 1T6WA 1MHCA 2W0LA 3SY0A 2GSIA 2Y5TB 2FWOB 3RUGF 1MIEL 3I50H 4RSVA 3HRZB 4Y89A 3RZCD 4ALAH 2J2ZA 5FV2A 4P46B 3ZKNC 3R0NA 2ADFH 2ATPB 2IG2H 2VH5L 4AEIH 1NQBA 4PTUA 4GG6B 3DXAB 2YHGA 3MA7A 2NW3A 2IQAA 2CLRB 4NQXA 5C09B 5H37H 3OKYA 3BIKB 4NQEA 4JPIA 4B7IA 4YUEL 3VW3L 4UV7H 4Z7UA 1WCQA 1B9ZA 1RUAH 4UQ3A 5FO9B 5GHWL 1CFNA 3QHFL 4S0SD 5JIPA 1U8JA 1RURL 1UM6L 5TE7H 1NCBH 4RQQB 1EUUA 4R97B 1WLHA 2ZSWA 1JPFA 3EOYG 1A22B 2CO7B 2Q8AH 1XIWC 4EN3D 4EI6A 2AEQL 1XR9A 4G6AD 1E4WL 2JIXA 5C08A 5IMLA 2VR9A 4ODWB 1T04B 4PR5B 3GSOB 4OLUL 4XCFH 2Q20A 4MSWA 2HFEA 3UYRH 3T1WA 3QEGH 1GGCH 5EBWB 2VLME 4NT6B 5EO0A 2H2PC 4HLZH 2P5WB 3TH2T 1NCAL 3TBTA 2P4AB 3PL6A 1JNLL 5GZND 4HHAB 1AXTL 4PJDF 4ZUTB 2BK8A 3VXOA 4JANA 4AEFA 4RRPG 1TZHA 3S34H 3H7BA 3Q1SL 1MFEL 5GGVY 1AQDA 1QBML 3QXTA 4XXCC 4ODUB 1MOEA 1KTKE 3G5VB 3DRTA 4TVSa 3T1FB 1TETH 1IM9A 3GJEB 4HH9A 5KN5B 4NCC2 3RWCB 2ICEA 4KKBD 4YDVB 1A6ZA 4YHYB 1ZS8B 4UT6L 1XF5A 2BVQA 4PREB 3U7WH 1INQA 4PJIB 1UQSA 4H0GA 4QTIL 5EU3B 1OL0A 4R7NA 2BHUA 5EO1B 2XPGB 3GKWH 2K3TA 1UWEH 3SBWC 2HKFL 2IAMB 3GZKA 2ZUUA 1QACA 4DZBB 5I15L 2QSQA 1WC7A 5SWSE 1JHTA 1NCDH 2V9RA 4F9LC 4YAQB 2RFXA 4HV8B 4GBXB 3RIAK 3GUTA 2J8HA 4Y16A 3ZE2F 4R0LC 2I07A 3KS0H 3G6JE 4QCIB 1H5BB 4Y4KA 1CLZH 1MELA 2V5TA 3U6RB 2ZNWA 3FB5B 1U3HD 1ZLWK 4G3YH 2KPNA 5C0AA 1NCDL 5IMOB 4D0CA 2QADD 2R23A 4NP4L 5EUOE 1G7QA 4Q6IC 3MO1B 2P8PB 1FZJB 3LQZB 3PWVB 1HHJA 3IDGB 5GPRA 5JXEC 4KK5C 1EA9C 4ZFGL 2FL5A 4LP4A 3KVQA 4WW1A 1YQVL 2Y07L 1CFTB 1G9EA 2GAZB 2G60L 1RURH 5F1SA 4YWGH 2VDNH 3BO8B 5CGYC 4I2XE 4XNUL 5C0JB 1ZT1A 1U3HA 3BQUD 3G5YA 3QWRD 4UB0L 2EE6A 1JPGA 2VLKB 1PGRB 3I3EA 2NXZD 1AQDB 1JNJA 1XGQB 4LSSH 4Q6YA 5EUOF 3G5ZA 3RTQB 2V6HA 3TBSA 5KW9L 1YYLH 3FO9A 1ZA3A 3NZHH 3FTGB 2HJKA 5D7JD 1KTLB 4P3DB 3N9GH 2X1WL 5L6YL 1UZ8A 5INCB 4OI7A 2ARWA 3CSPA 1XF5B 2QQKL 1WUNT 4GAFB 5IWLC 2D0HA 2P5EA 3HAEG 2WANA 3WKNA 1PVHA 3C8KB 2X9XA 3NTCL 3RZCC 5I66A 2YRLA 3CK0L 3BP6B 3MRNB 1DBBL 2EKJA 4P9HH 1D9KD 3PP3H 5K9OA 3B3IA 4RISH 5AD0B 4LLYB 1S5HB 1UH4A 4GBXA 1W0VA 3BISA 3AREC 5EZJA 2VLRD 3N06B 2HRPH 5DJDB 2VXQH 2C3VA 1RMFH 2Y6SD 4WO4A 3MYJB 5AEAA 4U3CA 3LKRB 2W9DH 4GLRI 4LLVA 2A1WH 4XAWL 5JA8B 5FGBA 1FG2A 3ULVC 2ZSVA 3E6HB 4G8GD 4LPWA 3HR5A 3ZKXC 1K4DB 2VLJD 3DV6A 3GKWL 3K74B 4LCIL 1LK2B 2GJZA 4F15C 2ZCLH 4I3RL 3BD4A 4X5WA 1W0WB 2QEJA 4E0RB 4YDKH 5IB3B 5TF0A 2IMMA 1HN1A 3B9KA 5CSZA 3AMKA 4YFLF 1OT1A 3KPOA 3MV01 3P0YH 4OGZA 3KYOA 4NZDA 1IAOA 1H5BC 4RZCB 1IT9H 2VQ1A 3DNKA 1JP5A 3L9RB 4LVOB 5K9QG 3IAQA 1D5XB 1G7PB 2QHRL 3VXNB 3QZWB 1KPRB 1R6VA 1T3FA 3BZ4A 1PZ5B 3RVVC 2F19H 1NEUA 5EDXA 4BQBA 4TUKL 4P3DA 2KUTA 2WWMD 3HZVB 1BECA 1FO0L 1XF3A 3MACH 4ZUSB 2P5EB 1A4KA 3SGDI 1HXYB 4ZAKA 2FZ3A 5F3HB 4QRPE 3BIBX 2OBGA 5K9JL 4MA8L 4GUPA 2OTWA 1FNHA 4GG6E 3S35H 3WJJA 5E1AB 1JFQH 1FO0H 5MP6H 4HJJL 3C2AL 1FQ9C 1I1AA 2ITDA 4JCMA 2VE6A 4GT7A 3LD8B 3O2DH 5MEPB 5CWSB 4M7LL 4OLXH 4PLJC 1AHWC 1F90L 2QJDA 1UVQB 3WL9A 4FFZH 4TNVF 1Z0MA 2VUYA 3FRPG 5CJXC 1W72H 2E9IA 2HVKA 1U91B 4C55A 3PWPE 3SQOH 4KDTC 4Y5VC 2XN9B 3ILPB 3OAYK 1AXIB 2R2BB 2G9HB 4ZNEE 1BZ7B 4G6AC 5ECJE 2EZ0C 5C0IA 4BUGA 3CZJA 5DWUH 1CDHA 3SQOL 2OI9B 4I18A 4XCCH 1U8KB 2VZ3A 5EN2B 1AI1L 3VXRE 4J8RA 4YHZL 5DO2C 3OQ3B 3CFJB 1MCWM 2R1XA 4NQDE 2H2PD 3BZFB 3CCHB 3CD4A 1K8IA 5CD5D 5KZCB 4R97C 4OCWH 1QKZL 4Z7WF 1S9YA 2LAAA 3IRPX 1XGTB 5IROA 4P59L 1UM5H 3CAFA 4HT1L 5E2UL 3LKOA 1SBSL 5GJTH 1KJ2L 4CJ1A 1HH6A 2JB6A 4QRRD 1KB5H 3P73A 5FGSA 4ZUSA 2XN9D 3OR7B 5IESH 3LZFH 3OXSB 3HC0A 1QR1A 1CFVH 4JRYE 4S2SB 3QFJA 1RUKH 4UV4H 1JGUL 3C6LB 4YHLH 2QV2A 3ULSB 4XPFH 3QFJE 4P9MH 5DJ0A 4JFEB 2DICA 3GBMH 3VFUA 2RB8A 4Z0BL 2E7MA 3MLZH 3VXQB 5I8CA 5ID0A 5D6CA 3RKDD 4NZTL 3GMOA 4N8PA 5D93C 3QUXA 4OZGB 1S9VA 4ZS6D 2CDFB 1HNGA 5E6ZA 5C2UB 1J8HB 4FQIL 4OZHF 1CDCA 4DK3A 1HWHB 3S4SG 4NHCL 1U8HA 4LCWE 1KJ3L 4NKMA 3MLZL 1GGYA 4JN1L 2R4RH 3SDXF 3F7QA 4U33A 4NO0D 1L0XA 4JY4B 1QSEB 4GS7C 1GXEA 2CKBL 2BCKA 2KL6A 2PW1A 1C5BH 4HKJA 1NGZB 1RU9H 2YD7A 3RBSA 4QRQB 3TYGL 4DWHA 3PHQB 2F8OA 5JOFA 4N0CC 5EUOB 2R4RL 3RUGE 3C2AH 4HIHB 3RGHA 3S35X 1JPFB 4N1EA 2GUOA 1U8PB 3LQAH 3VCLA 1YY8B 4APQC 3VWJD 1ZVSB 3X14A 2NY6D 4PJ8B 1DLFL 4HWBA 3MQIA 4CW1A 4G6FD 3Q3GA 4IRZH 1S7SA 2R8SH 1N7MH 2XQBL 3WFCH 3N1GC 1CGUA 4JQXC 1E4KC 4EXPX 4MAUH 1TTFA 1MRFL 2Z92B 4I3SL 2GJ6E 1HH6B 1GJIA 1IQDB 2AVGA 1IGTA 2ZJSH 4TTDC 3V0AC 3MOBH 4OT1L 3SE9H 4E42B 1L9NA 4Y4KC 4GKZB 4PGBA 5DJYA 3DGGA 3S8WA 5IQ9A 3W9EB 1GAFH 1AQKH 4Y16C 2WUBH 4C54A 3LRHA 4FMFA 4TVPD 1RY7B 1JGDA 3EBAA 2IG2L 4AEIL 2YPLB 4KMLB 5ISZA 5J12C 5KVGH 1CT8A 2A77H 2MSPA 2PXYB 3IJSA 3RY6A 1HI6A 1KENL 1T1ZB 5E2TL 1EHXA 1J11A 3UJIH 2H41A 4PB9H 1A7NL 3W0WD 5DRXA 5EOQL 43C9A 1CFBA 1A5FL 2W65A 1ADQL 3U7YL 1EV2E 1OLLA 5T1MB 2R29L 3Q6FA 1PEWA 1D3CA 1VGEL 2XI9A 3N1FC 2VERN 2HLFC 5SWZB 1A7NH 5KS9F 1N3NB 4JO4H 3ARYA 3JWOC 2F15A 5EOQH 4YHLL 3T0EC 4OLEA 1F4YH 4I4WA 5DRZA 2MCG1 3OHXA 2X10A 5D7IF 1QOKA 3BOVA 2I27N 3KYKH 2L4OA 3VW3H 5J8OA 3U6RA 5DGRA 1A3RH 3A67L 4RGMB 1KPUB 1M7IB 1OP3H 1D6EA 2HRLA 3VWJA 3Q3GB 3NN8B 4WHTB 5I1EH 4HF5L 2KZ1B 3G5XA 5IJKC 3SDAB 1XIWA 2X4NA 4GW4A 3HMWL 4GG6A 2DN7A 5EZLA 5DUPH 4NZUL 4PGBB 5DJYB 5HDBE 4DVBA 4ELKA 1I9RL 4KFZC 4HIIB 5ACZA 4BH7A 4OZFG 5I1EL 1TITA 1N4XL 4ODHL 1CD8A 1MJJB 1LO4H 1U3HB 2FHBA 3S88L 1BD2E 3RDTA 1G6RH 1I1YB 2MHAB 3TT1L 5FO9A 3AY4C 4CL7A 3G5ZB 3TBSB 2P5EE 1DQQA 5B39G 2ICWJ 1O7VA 2B4CC 3HC3L 3G6DH 4FMKA 4G6MH 4GBXD 3UBXG 3BE1L 3SDXB 4RAUA 3HZYB 4Z76A 3VI3F 3MRIB 3HR6A 5T1KB 3S96A 4Z0XB 3KG5A 3IAPA 5F6HJ 4G6JL 1RHHA 4DN4H 3H3PL 1KCRL 3SEPA 5FAAA 4BYHA 1T22A 2LAGB 4FZEH 3QFJD 4AZ8A 5HXMA 2B4CL 5IW6A 4QYOA 4BSVB 1MRCL 4F7TA 4DFHA 1FFPA 3QUXC 1KENH 3LS5H 1FBIH 2G2RA 1ES0A 2LVEA 4JB9H 4L4JA 2GK0B 5H8DA 4DVRL 1WIPA 1RI8A 1NL0L 4JVWA 4L1DA 4PRID 4XP1L 5E5MA 1YEJL 3LEYL 3EFDH 2DI8A 3JWDC 1M7IA 3BPLC 3T2OA 1MHHB 3KLSA 3MXVL 4XNUH 3UP1A 1MFDL 2AGJL 2AJYL 5IF0B 1KACB 1NGYA 1F4YL 2NPLX 5JO5B 1FYTA 5HPMA 4IM8A 3T0VA 2EIZA 3C8DA 3VD9A 2BVQB 3DX9B 1INQB 5D7KD 3ZT7A 5B4MC 2V7HB 2YPVH 1QP1A 1KXTB 1HKLL 2AEQH 1QG3A 1AXSA 4G5ZH 4YAQA 1JPSH 3MUGB 5HJ3B 2FH6A 3DVNB 1K8DA 4Y16D 2DQGL 4CVZA 1MHPL 4GXVL 4TUOB 1I9EA 5D5ME 3BP5B 5IB1B 3JV6B 3CVIH 3J7HA 1MLCA 1PY4A 3L95B 4UB0H 3RZWA 1A6AA 4GFTB 1JRHH 2I9LA 3QRGL 4MA1C 3VWKD 5HTSA 2XFXA 4YC2B 4I9WE 1F2XK 4YK4B 3ZMRA 3NZHL 1MHPH 3MO1A 4GXVH 3H3KA 1VSCA 3EIFA 5IHZB 3PDDA 3Q1SH 2IANB 4L8DB 2EDDA 4W4OC 4PJFF 4XAWH 1FFPB 4CVUA 5B8CA 3SCMB 3C60A 4LGRB 3L5HA 3CX5K 5D71H 5F9JA 3PDOA 4EBQH 3BAEL 2DYPB 2UUDK 5DMKA 3WL9B 2FYYB 4S1SH 4C58B 1EEUA 5FV1L 3SE8L 3HMXA 5E8PA 3T0WA 2BNRA 4ZUUA 1X3DA 1A1NA 4HUMB 4J6RH 2X2YA 5FF6B 3RTQA 2HAZA 4D0DB 5C0DB 3O8XD 2HRPL 1Z3GH 3FT3B 3N50A 5JOEA 4MQXD 3QXWA 5CHNA 1KTLA 2FGZA 1J5OL 2IQ9L 1NDGB 3C6LD 5IVZB 4JKLA 2PTUA 4P4KA 2HT4D 1URLA 2H6PB 1AC6A 4R4FL 2CDGA 5BRZA 3ZHKA 1CLZL 2VLJA 1XH3B 3CFJA 4R90H 3EHBC 1G7MB 2IQ9H 1K8IB 4Y1AE 5EU6B 3MUY1 4N0RA 1O0VA 4PRPB 4C56D 4Z6AT 1GGUA 4LSVL 1J8HE 3RWHB 4DW2H 5L0QC 2GEEA 3MR9A 1T1XA 2CRZA 4WEMB 1CF8L 2VN4A 1A1OB 3MGAA 4AL8H 2E6JA 3VXPB 4OM1H 4MJ5A 3C6SB 5A2JH 1SYVA 3REWA 2VDNL 3NABL 4A2MA 1OF2B 3TVMD 2WWKT 2NX5B 1CF8H 3QI9C 3T77B 5I8CB 4OCLC 4RDQF 3UZQA 5FB8A 5FYKU 3BP4A 3PDOB 3ALPA 1IAMA 2CXKA 3MREB 4KV5F 3T0ED 4JZOA 1J1OL 1FGVL 2OCFD 4U4BA 3JSSA 2W91A 3GMNB 2ZOLA 4PFEA 5SX5K 1AFVH 1MWAB 4XCCL 4YO0B 4JY4A 5KTEL 1KPRA 1A2YA 4I1NB 5D1ZC 1FCGA 5IWLA 1KPVB 4JQVC 4EOWH 3U9PL 2XG5A 4FXLA 1ZHKA 5EBMA 3D85B 4ERSH 1J1OH 2EICA 3PG2A 5HY9B 1R5WA 3VXMB 4PLJD 4X9HA 3NFPB 3OX8A 3UPAA 5F9DC 5HI4D 3W11C 1VACA 3SGEH 5C9JA 4PJCF 3A6BL 4JKKA 4BZ2L 2E3VA 1G0DA 2DQIH 4JRXE 4ZUVB 5CEYB 3DUHA 3D18A 2BJML 4I77H 3ELAT 4KTYA 4N8CL 3TIDA 2BSSA 4MXVE 4LHUD 5D7IE 5B4MD 3RWHA 3BGAA 2DQTH 3IFOA 1GSMA 3G6AB 4AMKH 2D31A 1UVQA 2NYYC 1A0QL 3MNZA 4CDHA 4UBDD 3NFNA 3IXTA 4E42A 1WBYA 1HHGB 5IQ9B 2A74A 5SWSB 3DLQR 5D2LA 4OCWL 2UWEB 5HHOA 4XCNA 4KAQH 3SN6N 3N85L 4GXUN 3G04B 4PRHB 5BZWB 5I1AB 5FYLH 5TE6L 2W0PA 3VFNB 3L3GA 4NUGL 4TVPE 3AS3A 3T3PF 5C0BA 3FFDB 5FYJE 4JFFB 2XICA 3TPUB 4MJ4A 3BW9A 3QI9D 3H42H 1UJ3B 3OKMB 3STZB 2VXTH 3QO1B 1CFVL 4ZMAT 1NC2B 2OQJB 4DW2L 1KEMH 4NSKA 4AIXA 3U9UA 3SDDA 5D96C 3MLPA 2GQHA 4UNVA 1P2CB 1P6FA 4G9FE 1PQZA 3MCLL 3TFKD 2ENSA 4YBLC 4L4VB 5E4IA 1WQVT 1TJIH 3QDGA 3ZL4L 3WSQH 1VDGA