1ITBB

Type-1 interleukin-1 receptor complexed with interleukin-1 beta
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
310
structure length
310
Chain Sequence
CKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (immunoglobulin/receptor)
molecule keywords INTERLEUKIN-1 BETA
total genus 49
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 1997-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13895 Ig_2 Immunoglobulin domain
B PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1itbB01
1QD0A 5FAAA 3QP3A 1RPQA 2ESVE 4JRWA 2WP3O 5C8JA 1VADB 3STZA 1MELA 1P6AB 3QUZB 4YIQB 3BH8A 3H9SB 4NUGH 1P7QD 4GAYA 3I02B 4GBXA 3BISA 3U9PH 5L2KE 3NBNA 3DUSA 1LDPL 5FFLA 1XR9A 5EZLB 4MQ7A 2Z8WC 1IAIM 1AI1H 1KB9J 3G04B 1VERA 3V6ZB 12E8L 1PLGH 1V3JA 4PR5A 5KSAC 1KG0A 3GSVB 4NO5A 5IB4A 5TDOA 5AD0B 1CIDA 4NQSA 4HWEH 1BQHG 3TVMD 4M4RA 1RZGA 3UBXA 1NGYB 4ZFFA 2BHZA 2X4SA 5FK9B 3WHXB 2H2SD 3RZWA 1MFDL 1F6AA 2KKQA 1KCUL 1GVIA 2ED8A 3IF1A 5MHSD 4NNPH 4BZ1L 4PJ8B 3QEQA 5SWSB 5DK3A 5DFVD 1JTOA 4LCCA 4J1UB 1WCBA 4YNYA 3PE9A 2H41A 1FAIH 3LQZA 4RA3A 4W68A 3GM8A 3SY0B 4BK5A 4LIQE 4XP1H 1V7NH 1TENA 1RHFA 5DUML 1JZ5A 1M7XA 2I07B 3C60D 2FH6A 5FYLE 5IHLB 3QUKA 4PTTA 5CFHA 4IOIB 4ODWA 4JY5H 1BZ9A 1F8TL 5E56A 1LDSA 1M05B 4BZ2L 3VD4A 4NIKB 4U6HA 5FGBA 5EWIH 4N8CL 5J6GB 4PGEB 5D7SL 3QXDA 5TH2A 2CLZA 2R2EA 2FEEI 4FOMA 5DR5H 4G3YL 4OM1L 1NAMA 1UM5H 2FJHA 5TF1H 3V7MA 5BV7C 4QHLA 2DQGH 1IVLA 1ZLVH 4W4OC 1EO8H 4PJFB 3VXRB 4YHZH 1XF5B 4NUGL 1JZ4A 1BZ9B 3U36B 2BC4A 4U4BA 2DIAA 3IFLH 4Y8AA 4JY5L 3MR9B 1VSCA 4AG4L 4HCRL 3KPMB 3VGEA 1I8LA 3H9YA 1P4BL 2FJHB 3UYRH 3IF1B 4R8WL 1EZVX 5DLMH 2ARWA 1JGEA 4LL9A 5IEHB 4K94C 1A6VH 1IAKB 4JQXA 5IVOA 4J1UA 5JQ6H 2AV7A 3ULSA 4XNUH 1EH9A 1KBGL 3MX0A 1L7IH 3GEWB 1MQKL 5EN2A 5HY9A 3DMMA 2F5BL 5C86A 1CDCA 1L9NA 1K5NA 3E6FA 4HLZH 1OAUL 5A3ID 1IGJA 4XAWL 2KZWA 3E0GA 1TTUA 1B4RA 1RHHB 5I18L 3REVB 4U49A 3NZ8B 2AXFA 1FNAA 4DEPB 1EEZB 4NHUB 2BMKB 1EZVY 2OTUB 4F7TB 4FP8L 2ZUYA 3QBTB 4YXKL 4ZD3H 4FABH 1CTNA 3A67H 3CDYA 4PJAB 1S9KC 4X7TA 4LDLB 1YA5A 4XBPB 2YUVA 5DD6B 1LP9A 5EU7C 1ZGLB 3OHXB 1YPZF 1WAAE 5C0RH 4TOYH 3K2UH 3OKOB 4D0CB 3QWQB 3S88L 4HK0A 3CFJB 4YHMH 3EO1A 4R3SA 3I6LD 4MB3A 1LEGA 2XIDA 4YLQT 2XN9B 2BNRA 2NY2C 5CMAB 3UYPA 5JDJA 2LABA 3F6IA 3QIUD 4U1KA 2PF6A 5D93C 4UTBH 2IBGA 4Z0XB 4PJ7A 3H3PL 1ZAGA 2HLFD 4J7RA 4XPAH 1BFOA 1KIQB 2BVYA 2BVPA 1IGJB 3QXWA 5IHZA 1TITA 3V4UL 3WL9B 4K71C 3PDOA 2VDOL 2P49B 3Q5TA 1D3CA 4O51B 1J0ZA 2EEDA 5AG8A 1ZT4B 1I1CA 2FIRT 5M95B 4DCQB 3PL6D 1UC6A 1VGKA 3DROB 2CR6A 1NC4D 1HINL 1S7SA 5E1AA 4YHPA 3MODH 2P8LB 4OM0L 2QSTA 2G75A 5K9KA 4TVPH 2V2WA 1ZS8B 1A3LL 4ONHA 4UIKH 4Y2DA 2OK0H 2X41A 1V7NL 3MLWH 3QUML 1T7WA 3P9WB 1CLOH 4M5YH 3WNOA 3GBLA 5L0QC 5INDB 1I9RL 1A6ZB 2BY0A 5F6HI 1KLFA 2BNQD 3A0OA 5CMAA 5ALBH 2JJTA 2P8MA 1LO0H 1P7KB 3VFOB 2L0DA 4POZD 4OFYD 43C9B 5JA8B 3FCTB 4P23D 1JNHA 3BEWB 1T0NB 4L4VA 1IBGH 3ARFC 2EC9U 1EEQA 4JGUA 1SJHB 1T5WB 2NXZB 1C08A 3U4BL 4NWUH 1UZ8A 4S11A 1ODAA 1MFBL 4HIJA 3VMPA 1Q9KA 1XCQA 3U1SL 2VXTL 4AYFA 1TETL 4QXGL 1IC5H 3L5WA 1FL3A 4WI5A 1KB5L 2VL4A 1LO0L 1KCRL 5IQ7L 2V2TB 1AR1D 3DROA 4B53A 4PV8A 4Y16D 1ZT1B 1R0AH 1FZKA 5TFSH 3QUXC 1NC2D 4U1HB 4M4PA 1QRND 5IOPB 1RZ8A 3BW9B 3UTPE 4JM2F 4HMEA 1VFOA 1PD6A 4YQXH 4U33A 1PKQE 1RFDH 4NSKB 3EW3B 4OZIA 3Q6GL 4NM8H 4H1LB 1HINH 3BIKA 3C8KA 4XT1C 4H8WH 1N7ML 4CRPA 3O6MH 3QNYB 3MLXH 1HYSD 4OQ1A 1IAOA 1SMAA 5T3XL 1TJHH 4Z0BL 3N85L 4LLVA 1W72A 3FCTA 4P23A 5SX4H 4UQ2A 4DN4H 2R69H 2AXGB 4HJ0C 3ZTNL 4MCZA 5T5FL 4KJPC 4P3CL 4MD0B 1YJDC 1F97A 5DJ2A 1YN6B 3KDMA 1NFIA 4PRDB 4HKZA 5KG9A 2HJLA 3L3HA 3K81A 5IHBA 2MQ3A 1A7BA 1HKFA 2G60L 2NY6C 3REWB 5JZ7D 3T0WA 2K1MA 4ZAKA 2R0LL 4I77H 1MCWW 1GGIL 4M6NH 4E41E 1IAIL 5HDBF 3F12B 3OKLA 4JHWH 4YHPB 3SE9L 4P3CH 1ETZA 3C60A 3B9KB 4KQ4L 1AGEB 5EFIB 4QXGH 2PXYD 4EQ2A 4JFHE 3LKNA 2P4AB 3FB5A 4EUPB 5DJXB 5DUBB 5E0QA 4TYUA 1HXMB 1AQKH 4ZS6C 2KL6A 1YDPA 1W2KT 1OT2A 3ULVC 1I9EA 1JPFA 4UI2A 5E2WH 3IDIA 5IB2B 2CUMA 2W9DH 3T65A 1T83A 3O4LE 1IZJA 2VIRA 1B6UA 1SM3L 3ZYZA 1F42A 2DS4A 3QNXB 1JP5A 1JNHB 3BEWA 4L4VB 1KENL 3MJ9L 1CFNA 4ENEC 5EO0B 3FFDB 4XBEH 5HYJD 3GMOB 4LLUA 3RAJH 3FQUA 3X14A 5E95B 2VXSL 3JV4A 4ZO6A 1HOCB 4LSSL 4QOKD 3JVGA 4D9RD 1Z3GL 4JM2A 1R5IB 5HHVL 2CK0L 1QPPA 2XZZA 1YNTA 2DQEH 3UTOA 4OUUA 2DQCL 3OJMB 4JM4H 4YDJB 4HJJL 5CSGA 5IV2A 3GMLA 5IFJA 5ERWB 1HH6B 2CH8A 3U0TB 3PL6B 5JORB 2XZCH 1A02N 1NCBL 3O8XA 3Q3GA 1OW0A 3EOAA 1IC5L 1QFWL 4JRXA 2VOTA 4LBEB 4Y4KB 3GM0A 2FL5A 4O2FB 3VFNB 3PWLA 2X70A 1I1FB 2CUHA 5IK3B 5EPMB 1ZHKA 5HGDA 1NJ9A 4WHYH 1ZANH 4JREB 5HGBA 5HYEA 1IE5A 4J23A 1OAXH 1OTUD 3CX5J 5D96C 4N5ED 4X9HA 3ULVL 4I5BA 1MI5B 4JAMA 2NY2D 4FZEH 4G80B 3W11C 1A6ZA 1LK2B 3LB6C 3TYGL 3DX9B 4NNXB 4X0KA 3C08L 1J88A 3MLTA 1F6AB 1MRFH 3QFJB 3SGDI 1EMTL 4CVZA 5HI3C 4O02H 1A7NL 2PW1A 4Q58C 3Q5OA 1UXWB 4XNZC 3O8XC 3GO1L 4QWWD 5D1ZD 1YYLL 5F7EH 3B83A 2GYSA 1UQSB 1Z9MA 3G5VB 1YNKL 1FO0H 2YD9A 2PYEA 3MNZA 3CU7A 4U7SA 1CFVH 1CZ8L 1R3HB 3GSQB 3MLUH 1ZLUH 1L7TH 4DEPC 4YHLL 3PGFH 3UTTE 4HUMB 1ORQB 1D9KA 3O9WC 4G8GE 2EXWC 3L3OB 3BKML 1OM3H 1ZWIA 4ODWB 2EDBA 1NCCL 2R29L 1Z3GH 4ODVH 2R0ZL 4NN5C 1MF2L 2XYCA 4Z7VE 2J2ZA 2D7QA 1BWWA 2D9QB 5IW1B 5JLZB 3WS3B 1YEIH 3IS1X 4Y5XC 5FM8A 5HI5D 5I1AA 5C9KA 2EDNA 5KS9F 1ZA3B 4P5TB 3ULUD 2YSSB 3BQUA 1VFBA 2ORBL 3FTGA 4JPKH 2ZZUT 5ENWB 5ESQA 1OF2B 2CKNA 3LD8B 4MGXA 1J1XH 3OJVC 4NQDB 2P5WD 4JPIB 1IAMA 4PRIB 2ITCB 2FSEA 3DURB 5FM5O 4UUJB 1CXKA 4P4KC 4YE4L 3MLTB 3RJQB 2Y9RT 4YJZL 1PDKA 4LLMB 4Z7WE 4ZUSA 5GSVA 4RZCB 4TQEL 3VXMB 4ZNCD 1UH4A 1G7IA 1ZVSA 2VLKD 1KG0B 3G6AB 3GSVA 4ZOCA 5GRUL 5FYJE 2V5MA 4KRPC 2VUYA 3ULVH 5L2JB 2BSED 2OZ4L 5FUCC 5GSRA 3VWJA 4I2XB 2EDDA 3DURA 3O6LH 3IU4H 1K4CB 3VRIA 3E6FB 1N4XL 4EI5B 1VEPA 2Z93A 5J0BA 5J7CC 2A6JB 4XX1E 4Y4HB 3MRHA 3MYJB 1SEBA 2WUCL 1N0LA 4Z7UB 3RWHB 2WZPD 4YBQD 5KVFL 4ZXBD 4Q9QL 4UAOC 4ODHH 2ZKHL 4YNYB 1UZ8B 4NC1C 5GISH 3T08A 4LBEA 5I30H 4NNYA 3Q5YA 5FOBB 2LE9A 4M7KL 5HPMB 1I1AC 2VLRA 2H2PD 3CUPB 3FZUD 3QQNA 4U0RC 4JFOA 4OD1H 3BYTA 3D85B 4CJ1A 3MJ7B 4U7KA 3MRHB 2LV4A 1N4XH 5CWSB 1S7UB 2DYPD 1A7RL 3SDCC 1KJ3H 4P3DB 1OQXA 4K3JL 5E8NA 2NW2B 5L9DL 1M7DA 5HYQB 1U8MA 4X5WB 2ERJC 3OKEB 5E6ID 3VFVA 1I3GL 3VWJC 1MVUA 3BJ91 4F33A 2AJUL 3X3FH 4G6AC 3AM8A 3MOBL 3DRTA 4PGBB 2WIMA 3WLWD 3D18A 4KK8D 3SO5A 3F7YA 5GS1A 5T5FH 5DZLA 4N0FB 4H1LH 2IMNA 3WEXA 2Z9TA 2W9EL 2QKIA 1FBIH 1D6VL 3PV7A 2X4NB 1MVUB 1R6VA 1S9XB 2GJ6B 4FFVC 4F33B 5B38B 3SHSA 3KNBB 4OCYL 5T5NF 4ZUVB 1AHWB 2KZ1B 5IROA 4OIIL 3BMVA 4YHNA 2UVEA 1C12A 3DX7A 3NIGF 2AQ2A 2ITDB 1EO7A 1PKQA 3TVMC 1U2HA 2CMRL 1N59B 4LLYB 5IV2B 2W9EH 4ODTL 2EYRA 3ARSA 4P9HL 4FQJH 3VFSA 1U8OB 4OGXH 4P48A 4HGWB 1HXYA 4HFWB 2AXJA 4I18B 1I9IH 4X80H 3L7EB 1FVDA 3RNQA 3O45B 3QDJA 4WIQA 5JIKA 5JXEA 4K7PH 3BGAA 1P4LB 3KR3L 2OR7A 2VXUH 1K2DA 2R1WA 1ZLVK 2Q6WB 2EIZB 4NWUL 1VACB 4K23L 5EUOE 3SE4A 1LP9B 3VFWA 5DMYA 1G7IB 1ZVSB 1FZJA 2XA8L 4HGMA 1G9EA 2F54B 3PHOA 1T89C 3BPLB 4WV1C 4H25A 4YH6A 3VH8B 1RUKH 3CVHH 1CGYA 3G08A 4JKKA 4WTWA 3SGKA 4KDWA 2EDHA 2C4FU 2VDML 3ULUL 4XHJC 4QKXB 4K9EH 3HC0A 3TYFA 4HJJH 1MCSA 3WD5L 3S88H 4K23H 1I4FB 4CNIA 2P5WB 2UVFA 2R2HA 3QIBA 4K3EH 4V1DA 1J18A 2AW2A 3IDMB 4MNQB 1S9WB 1TLKA 1HQRB 4ZQKA 1AP2B 3DV4A 1YEGH 1G1YA 4U1GC 1DVFC 2NYYD 1LEKA 2XZQH 3S7GA 3IDNA 1Q38A 4E42A 2AJYH 1CFTA 1XCTB 1J0YA 1MHCB 3PXJA 5CWSA 4K3DH 4G43B 3VXUA 4RWYL 5BXFB 4LSVL 5D1XB 5T3ZH 3MLRL 1I7RB 2JJUA 1I1AB 5KJRH 1QA9A 4U6XA 4MHHG 2C7UA 5F72S 1FRGL 4P2RE 5I1GL 5DQJB 5IB3B 3O4LD 3B2UD 1N3NA 3E3QE 3GBNH 4HHAA 4RIRA 3OB0H 4QT5B 2UV3A 4XXCA 3EYOA 2ZSWA 3GKWL 4K71B 1FYTB 3ES6A 4PRIA 4NKDB 2ADGA 4DUWA 2BY3A 5DJ2B 4GMSL 3GIVA 1UJ3B 3PQYE 4FXLA 2FJFA 4KTEH 1TCMA 5B38A 5KJRL 3B2VH 3O3DB 3IKCB 1X5KA 5KSBB 1BLNA 1INEL 1EAPB 2Y5TA 3P0YL 4F2MB 1YPZE 4K94H 5DZOA 2HJFB 3RTQB 1MCQA 2XZAH 5FUOH 3IJSA 3QIBB 1OSPL 1A6UL 3VI4F 3F12A 32C2B 4NFBA 4X6EB 4YO0A 2W07A 3FJTA 5IWLA 4LIQL 3VD3A 2BZDA 1CS6A 1XIWA 3BO8B 1KIPB 2VDKH 5JQ6L 1P2CA 2AEQH 4CU8A 5IW6A 3EOBA 2ZNWA 1HXYB 3N1GC 5E2TL 4N0UE 5D2NA 3WO4B 4QXTA 5ID1A 3EUUA 1J05B 1QSEB 3VE0A 4DGYH 5D96B 5DRWB 1F8TH 4Y16B 4MA7H 4XCNB 4XAWH 4OFVA 3KGRA 1T5XB 2E7BA 5EBMA 3RWFA 2KQMA 3C5JA 4XXDB 1V05A 1Y6KR 1BOGA 2XKUA 4APQA 1P84J 3B3IA 4DZ8A 4ONGH 1XIWD 3AMKA 2O61B 4JRXD 5CINL 3T04D 1MRDH 4UV4H 3OKEA 3VFVB 4Y5YB 3IDJA 1MCCA 3T0EB 5T1LA 3WJLA 5D1QC 3SDXA 3C2AH 2EO9A 2E7MA 3HNVH 1KT2A 1RZKC 3MLWL 5IKCA 1SY6H 5IMKA 3GSNB 1FLTX 1U8JA 3SDYL 3IFPA 1YEJH 1RZJC 2EECA 2HT3D 4G9DB 3B3IB 3QG6A 4O00A 5DJ8A 3VGHA 2M8XA 5JW3L 2IAMC 1OAQH 2I9LB 4WFHE 3VXSA 5E5MB 3FQWB 1UGNA 3GI8H 1EUTA 4ISVA 3ILPB 1M71A 3O11A 3TT1L 5D7LE 5T1KB 5J11B 5DTFA 1CFTB 2YC1B 1INDL 1RK0A 1CN4A 4JHAL 1Z9OA 3NGBB 4ONOA 5HHOB 1WFNA 4S2SA 1UB6B 5D2NC 5DJDA 4F58H 1DEEB 5JNYB 3V6OC 1IGMH 5DRWA 3SY0A 3STLB 3MV7E 2X70B 1BQLL 1UA6H 3LQAH 1I8IB 8CGTA 4K3EL 1LP9F 4JFYB 1CR9L 3SJVD 5L9DH 1E4KC 3PWNA 3VFGH 1BF2A 5E6IC 4ZD3L 3R8BB 3PGCA 2M26A 5L88L 5CEZL 1EV2E 2BVEA 4EBQL 3CH1B 1AR1C 3MCKA 2DL2A 3FO1B 4EN3A 1JNLL 4ESKA 3T0EA 3DX9A 1CDGA 5DC4B 4W4NA 1IKNC 3BJLA 5FA3A 4TOYL 4HUVA 1KEML 5EZLA 1G0YR 4TNVF 1G7QB 1GZPA 4X4XB 4JFPB 3EYVB 4HUNB 4E5XB 1D9KC 1DQQA 5IEKB 2R9HD 1KCUH 4LSTH 2WWMD 4RA0C 4IRZL 4JG1L 4PGCB 3T1WA 2P45B 3QUMA 1Q9WB 3ZKQD 5ANME 2EEAA 5CEZH 3CH1A 3DPBA 2H32A 3QUYD 1QFHA 5H37G 3LRHA 5FGCE 3OAYK 1MAJA 3CC5B 2YA1A 2QTEA 3DBXB 3ZHLA 3L3OA 1B0RB 1FG9C 4AIXA 5I1HL 4ORGA 1X5ZA 3QUZC 1I7UA 1A6WH 5F44A 5I74C 4LHUA 5TE4L 1RUPL 3K0WA 3QDGD 1DQDH 4HKJB 4NFDA 3P0YH 4X98A 4YWGL 2IBZY 1H15A 4MMZC 4XVTL 1I9JL 2VL5A 4U1NA 2ZUVA 4H1LG 1L0YA 4RWHA 3QXAB 3W9EB 1X7QB 3BRDA 1FGNL 3QIWC 1CBVL 2APVA 1UM5L 5HVHB 2X9XA 3N1FC 5EUOB 5BS0E 2DQFA 3NZHH 2X1OA 3DVGA 3HE7C 1B0GA 4LLDA 4M3KB 4U05A 4XCEB 1MH5B 3L5XL 1Z6JT 4S1SL 3VFNA 4HXAH 3GB7A 1U95A 2IALA 1E4JA 2HH0H 4UBDC 3WUZA 5EULV 4P5KB 5C0AA 4KQ4H 4DVBA 3RA7L 3BZEA 4UIMA 2EYSA 4JZOA 2PXYC 3X13B 2OMBA 2IPKB 4G5ZL 3CVIL 4LCYB 3DHMA 1AJ7H 1RIVL 2ICEB 3L1OH 3UPAA 5IUSA 1U8HA 4QO1A 4H0HB 1NAML 3MBEC 4NNXA 3KPMA 1FV1A 5I1JH 5CAYB 3U4BH 1MCIA 3EJYC 4HIEB 2FWOB 4MQ7B 3UTZB 1A3RH 4Y4HC 1AD9B 5B39G 1ZK9A 5GISL 2QADC 1WZ1L 2BFVL 4Q2ZB 3BZEB 4MNGE 4YHYC 1JK8B 4LAQH 1BP3B 4R4FH 2P8PB 4FQIH 4EUPG 3V6FA 2VXVH 3VFTA 3TBSA 1R3HA 3GSQA 2YD6A 3AUVA 2EDEA 4X8XA 5ALCL 1C5DA 25C8H 3DMMB 4JFXB 4N5EC 4NQCE 4PJHE 1WVZA 1ZT7A 5F3BB 1BFTA 4GAJH 5D72H 4DTGL 2BVUA 5DI8A 3VGBA 4TPRH 4JO2H 4F80A 2DM2A 4LVOC 4YZFE 3DGCR 3MV8A 3T8XB 4XAKD 5CIPB 1RZ7L 4JHAH 4YR6A 2B7DT 1VKXB 1QSFB 2CXGA 3B2UC 4Z7QF 4DJMA 4J3OC 1OSZA 4M9PA 1Y0LA 4OZFB 4RISL 4IHOB 3GI9L 2W59A 2FIKB 2Q8AH 5FCUL 5J89A 1CGXA 4APQB 4M7ZB 3LRGA 4Q9CA 3RVUD 4ODSH 1JGUL 2FX9H 1Q9OB 3TIDB 1NCBH 4TRPH 3ISWA 2PETA 4Z0BH 3TCXA 2UZIL 1WBXB 5GS2H 3BN9C 2DI7A 4X8JB 3TBTA 1MCOL 2ITCA 1ROWA 2H32B 3KXFE 4R3SB 1T7YA 4ZYKA 5FYLD 1JYWA 4EUPH 1JZ3A 5JIIA 2ZWLT 5I6XB 2GJ6D 5IMKB 2HP4A 1DQJB 3IGAB 4JM2C 1MJ7L 1TZGH 2GT9B 5I16B 4NQXB 4PJFF 5FDWA 4NO0B 4IDLA 3UO1L 3O4OB 1IGYA 3ULUC 4X7SL 1NDMA 4LCCC 1WBXA 3QEHB 2N7AA 1G9NC 3SDCA 5T1MB 5IF0B 5IFHH 5ANMA 5LBSL 1BFOB 3CSPA 4LARH 1FC1A 3GSRA 5T1KA 4KV5E 4A6YH 1BJMA 3VA6A 3MV7B 1X7QA 3MRFB 5GRUH 2N1KA 1EXUB 1XF3A 3BD4A 4LGPB 4K8RH 2W60A 3EFDL 3G6JA 4AT6A 1XGTA 1U91A 3S37H 5HGAB 1AGFB 3AGVA 3L3KA 3MFFA 1A6VL 2R1YB 3PWNB 5C0CD 2EDTA 3EOTL 4MCYB 5HHPB 5DJ6A 4AJ0A 3BO8A 4KKAC 3BOVA 5EOQL 3BDYH 3AU1A 1CD1B 2XXCB 1FL6B 3TFKC 4DTGH 3MJ6A 1ZXQA 4P46A 5GGRB 4NO5B 1H8SA 1ONQA 4X8JA 2EDYA 3WV0A 1CDBA 1LO5A 3LMJL 1CICD 4X5WA 2B1AH 3LIZL 3BPOC 1OTTD 4ELMB 5HI5C 2HT3C 3QIBC 1KPRB 3UTSE 1DQQB 5I9QC 4QCIB 5IBUG 3CK0L 1TDQA 4F3FB 1CXIA 2GAZA 3FZUC 4L3CA 4PJEA 5GGRA 1ONQB 1PSKH 2CIIB 3MO1A 1S8DA 3RP1A 1NDGB 2JELL 1RIHL 4O2EA 1CL7H 3ULUF 2EDRA 3S4SG 5J13B 2NTFB 3BPCA 5F3BA 1SBBA 3VFPA 1E4WH 4NC1E 1FBIL 3BKJH 4NT6A 5EUKA 1AO7D 5E08L 1EFXD 3NA4A 4LLYA 4HQQH 4CVUA 4G7YL 3ZE1F 4FQIL 3DWTA 2P5EA 1I1RA 5TDNB 3Q6GH 4NM8L 2VLJB 3L95A 2W65A 1J8HD 5D1QB 4X6CF 4OQTA 5JTWA 2HG5A 1YY8B 4HS8H 1D5ZA 1CQKA 3SDDD 3QZWA 5EC2A 4S0SD 3IFNH 4I0KA 3CVHB 3OR6B 4KAQH 1J8HA 1FVDB 4FQLL 3U36A 5E6ZA 3TBTB 3S37L 4C54A 1A2YA 4F7PA 5SWSD 2V5YA 4LFHD 4L9DA 4RISH 3FN0L 2XRAH 2H9GA 2ED7A 2J6EA 3L3GA 3BDXA 5GGUB 4FQQB 1L7IL 4OCMC 4WHTB 3SKOB 1UCTA 4F9LA 3JTTA 4KAQL 2FD6H 4M8VA 1B2WH 4C56D 4NJAH 5FKAA 3C5SA 3QUMH 4OGYL 3AS2A 1INQB 5C0FA 2EICA 3NGBC 4NKMB 4FHBD 4WO4B 1RHHA 2Y6SC 2NY2B 2GW5A 3EOYG 3QRGL 3O6FA 5BZDA 4QRRB 4NT6B 3B9EA 4OBSA 4UTAL 2L7UA 3KXFB 5ICXA 4X7CC 3W5NA 5J6HB 3AREB 1F4WL 1FC2D 3WLBB 5FF6B 4BSWA 2CXKA 4YC2C 4IRJD 1U93B 3PIQB 3FO9A 3MRBA 3MACH 5IIEA 1YEIL 5KTEH 1FZMA 5E4EB 1TZHB 4YHOL 1PX4A 1OAKH 2J8HA 1M7IB 3P3YA 4N8VG 3RL1B 1RD6A 1T21B 3P9LA 4FXKA 3X12B 1FIEA 4TULH 1GPOL 1X5JA 4X6DF 4ZTOH 1T7VA 4OD1L 3WNPA 1F4XL 5KOVC 1TNNA 1T1XA 3H9SA 3BH8B 4F8QA 1ADQH 2RR3A 3IB4A 3O0RH 4O9HL 1I3GH 2P5EE 4D2NA 4GBXB 1DQLH 2CKBB 5F70A 2D9CA 3ZZ1A 5B39B 4GKNA 4QOKB 5A40E 3MRRB 2AK4A 3LMJH 4LKXB 4HIIA 2ADJB 5D71H 2COQA 4LAQL 3VXTB 5LGJB 2AK1H 2BCKA 3UJTL 2MNUA 3QCTL 3V5KA 5HYJB 3U0WL 2J5LB 5TDOB 5AD0A 5IB4B 3V0VB 4QRRA 2VQTA 2YD4A 2ZCKH 5HGHB 1LO4H 3DVFA 4I48B 5KN5A 1NGPH 1DEEA 1GXEA 1B6DA 3P73B 2GTWB 4KI5E 3QDJE 3SDAC 3TJHD 4KXZI 3ABZA 1I8IA 3JWOC 4XHJD 4QRTA 1ACYH 2P8LA 3MV8D 2N56A 1S78C 3U0TA 1B2WL 5CGYC 4OI9A 2UY6A 4XMKL 3N9GH 5ID0A 3Q6FB 3ZL4H 3F65A 1QO3A 3BH9B 4P9MH 2PXYB 1J1PH 4LF3A 4NUJA 1VFAA 4ZFGH 1WLHA 3RVUC 1I9RH 1VFUA 3G6JF 4R2GC 1MREL 3ARDC 4FQXB 4HD9A 4DN3H 1ED3B 4R9HA 3MGAA 3LPGA 4KHXH 4WI7A 5I1IL 3QYCA 1KJ2H 4R90L 5FEBA 2FLBT 3GRWL 1CXHA 4YPGB 4ZDHA 2DQDL 4NWTL 4Y88A 3BZFA 2E9WA 3QWOB 1A3LH 4LOUD 4HK0B 3EYUL 5J6GA 3U2SA 2X9YA 4G80A 4L4TD 5ETUB 4WCYH 4XPFH 4JN2A 3L7FB 4ZUTA 3C6SB 3SDXB 4LHQB 1I3VA 5DA4A 4DKEL 3TV3L 3WIFB 1F4XH 5CEYB 5LXGL 3JTSB 4MLSA 4FXGA 5L7XL 2FJGA 4MJ2A 2DWEB 4N1HB 5FYJH 5LVEA 4KPHL 4ZDHB 4NQSB 3MZTA 4PB9L 4O9HH 4GG8B 4JPVH 4QF1A 4XB7A 4G8GA 1EEUA 1XIWC 3RGVB 2VL5B 1NFKA 2UWEA 4UU9A 2QR0B 3M07A 3MYJA 3MRBB 4G7VH 3LV3B 4UDUA 1JGEB 4U3CA 4RMQA 2GCYA 1Q8MA 2VR4A 4Z7NF 3ARFB 3N1MC 1RFDL 1N0XH 2XPGA 3WJJC 2AEIT 2F58H 4F7CA 5C0CB 3FT2B 2I9TB 1BAFL 2NZIA 3QXTA 5GIRB 3V9FA 3VFRB 2PYFA 4PJIA 3D85A 1WWBX 1A1OB 3G04A 1DBAL 3ARBB 3LN5B 5FO8A 1AHWC 1AC0A 3LIZH 1RZIB 3ARED 4Q9RL 3GHBL 4NQEA 1G1CA 1WAAA 2OQJA 2YEZB 3ZL4L 3QIBD 4QRUA 1BQLH 5EO1B 3MV7D 5IJKC 3MRQA 4N68A 3FAXA 1IJ9A 2ICWB 4KH2A 2WWKO 5I66A 4YQXL 1KXTB 5C07E 2F5AH 2X4RB 3MUHL 2O5YL 1WT5C 4R4BB 5D6DC 5ELIA 3VFOA 3TBWB 4KMTL 4NOFA 3RPIA 4JHZA 4PRBB 4D8PB 2EDOA 2ZOLA 5JW5B 1FNHA 1RZIA 4L4TA 1NEZB 3BVNA 4NQEB 4XI5C 3MJ8A 5C07D 4EXPX 5JHDB 3PXHA 3ARWA 4NRYB 1YMME 3HG1E 5BV7B 5BMFH 4YAQB 4H20H 4HFUL 5JXAL 1T1ZA 1KPRA 2EH7L 3C9NB 3EYFA 4LVNB 1B0RA 1XH3B 4R97C 3TPUA 4BSJA 5JA9A 2FGZA 3FONA 4Y7MA 5C0AD 1SYSB 5JO5B 3DSFL 12E8H 1PLGL 5CIPA 5DHVA 5EU7E 3VWKB 3T1FB 4PB9H 1MNUH 2H8PA 1BJ1H 1PKOA 5IIEB 4N0YH 3RPKA 4LPUA 4JFQB 2VKXA 4IS6B 3MLVL 4CADB 5DEZA 3GKZA 2ZUQB 2J8UF 5D7JA 4XP6H 1T03L 4LSDA 3FT3A 2DQUH 1MIMH 2MJWA 4NO3B 4UB0L 1O7VA 5AEAA 3BZFB 2NY3C 2CLVB 2NY1D 2ZUSA 3MRQB 4OZ4A 1QFWI 5T33H 1EBPA 3K1DA 2VXSH 4JN2B 3HR6A 1K2DB 2R1WB 2Q6WA 1GC1H 2BJMH 4LLVB 4KK6D 4KV5F 5CINH 2AK4D 1EHXA 4PJGE 2A38A 1IGYB 3QIWB 2X5PA 4ZUUA 4WRLA 4A6YL 1DBBL 5HYJE 4KJPD 1LE9B 1KPUA 2A83A 2Z92B 1N5YL 2X4QB 3CFBA 4XBGB 2EDJA 3VXSD 3GBMH 5C70A 3QNZA 5GS0H 1K85A 3VXNA 3AC0A 4UDUB 4PLJD 5FDYA 4XCFL 4B50A 4JG0L 1JK8A 3AB0C 3G6JB 3WS6A 1N26A 5KSUA 1N59A 4JFFB 1J1OL 3QUYC 5I1JL 3SPVB 5MP6H 4PJ7B 4PY7A 1H0DA 3LQZB 3FOMB 4OM0H 5EIIB 1A3RL 5DVNA 4XX1G 4CW1B 3IDNB 1PY9A 3KPOB 4PG9A 3GNMH 5GGVH 4N1CA 3QO1A 1EGJL 1JPTL 3MBED 4JGMA 1N5YH 2F8VA 1CFSA 4G8FA 1MWAB 4TSBH 3MV8E 2YPLA 4OF3A 2E9IA 1RJLB 4I0CC 3SDXF 3QDJD 4TNWF 3MNVB 2CLVA 4OZ4B 2X44D 4RQQB 5DRZB 3FB8A 4OLVL 1ED3A 1DJSA 3U46A 4WNQA 1BD2A 2X4UB 1RJCA 2ID5A 4RSVA 3RY5A 3ULUE 4HHAB 3M1BA 4S10A 3WXVL 1PBYA 1MQKH 1U3ZA 4KRLB 1QHPA 1DBAH 1F3JA 3E2HB 4XB8A 3QDGB 1GCFA 3BPNB 3DX8B 3N50A 3T2OA 3X3GL 3ZKND 1RY7B 1TPXB 1WZLA 5D6CA 1ZOXA 1HKLL 2RIKA 4XNXL 4KKCC 4OI7A 3OKYA 1W72H 1YECL 2ZG3A 3BUYA 4H26B 5F9JA 1Q1JH 5B38G 1WUNT 2VABA 3U9PL 2HAZA 1QFWM 4PP1C 5ICZA 3ARRA 1BIHA 3ARVA 4OSUH 2CK2A 3BQUC 5D2NE 2R0KH 1OP3K 3EYFB 5JPNA 2W91A 3EO0B 2R56L 3SKNA 5I73B 3D25A 4CNIB 2OYPA 1T20B 1JGLL 2G5RA 3NIDE 4PRPE 2P7TB 2V6HA 4HUUA 1NBVH 1K4DB 3IETA 3EJYD 2XTLA 4UT6L 1KYOK 1IGML 1YNKH 4P4RA 3V4PL 1HQ4A 1R3KB 4J12A 1TCRB 2CJUL 1UM6L 4JJ5A 4BYHA 4Z78A 2Q76A 4DN3L 1E28B 4G42B 1T6VN 4WWKC 2PTTA 4Z95L 4LLWA 3PGDB 2WIIA 3MNVA 3ZTJG 4QTIH 2V2TA 3W39B 3SJVB 1QSZA 1GH7A 2Y1VA 2QEJA 43CAB 1S7TA 2ZSVB 3CFEB 1ZHKB 2XICA 3D5OF 4EI5D 4NQVA 2ATPB 3QDGA 5E5RB 5C71A 4C56E 1HHIB 2FD6L 3FB5B 1B88A 3GSNH 1QG3A 4XVJL 1UM6H 3LB6D 4LEXH 1KJ2B 3KPSE 4PRPD 1UVQB 3C87A 1OAYL 1EFXA 1O7SA 2Y7QA 4GSDH 3EOTH 2VLKB 4KJWC 3FN9A 5FYJL 4FZ8L 1G6VK 4NKIH 4ERSL 3VXPA 1F6LL 3P77A 1AD0B 1RI8A 2HN7B 5L8LB 1WICA 4EIZC 2VXUL 2DKSA 2YD2A 3PP3K 1H0DB 5JW4N 3KDMB 1HOCA 3BPCB 1OARL 1KXQE 2PCPA 4GUPB 1T04A 2I5YL 2WBWB 4JQVC 3IDXL 3WN5B 4OZGF 5KVEL 4PJDA 4WI4A 5E5UB 1JMZA 5CCKH 3NZHL 3F7QA 1FIGH 2HFFB 2WBJA 5F88B 1CGSH 3WFBL 1CICA 1UJ3C 2BVQB 2UWEB 1F3DH 4WI9A 5B3NA 5JHLH 3WD5H 1H5BC 2ICCA 1H5BA 3C2AL 3BE1H 4PGBA 2H3NB 4JO3H 5AG9A 4MAUH 2NY7L 2DI8A 5I1DB 4G6MH 5I1LB 3DX8A 3RTQC 2YPVH 3K4DA 2XZQL 2FNBA 2CUIA 1D5XA 2IGFL 4IRJB 5L0QB 3LKOB 2UY7A 1DL7H 4LLMA 4M7LL 4DOHB 5EPMA 4L4TE 1WIUA 5HGDB 1P6FA 3INUL 4WHCA 5AZEL 4QRRD 1A7QL 2ESVB 1PEWA 5K59F 1KCVH 3UTSD 1YNLH 3VXSE 1AGBB 1PG7W 3H9ZA 3QG6B 1IEBA 1QVOA 4LPYA 3G6DH 5C07A 4Y16C 4WFGD 5C0RL 3K2UL 3NN8B 2OL3H 2EKSA 4ODTH 2A6JA 3FFCE 2FX7H 5FYJD 1MHEA 4UDTB 2J88L 1IEHA 4POYA 5HHQB 2EDKA 1ULVA 2PUQT 1CR9H 3RWHA 4WO4A 5ID0B 2NY0B 3MOAL 3CCHB 3BHBB 4U31A 4NM4H 3T2NH 3KYKL 4J4PC 4WUUA 3WHE0 4MDIA 3RNKA 3QI9B 3QWRD 1JGLH 5B3JE 4DN4L 5DS8B 2AEPL 2V7NA 1KNOA 2F15A 3OKNB 3GRWA 2AQ3A 1NC4A 3QQ3B 1I1AD 5DHYB 5HDQL 4HWNA 4FS0A 5D1XD 4G6KL 1E6OH 3U7AA 3HZYB 2WQRA 4K9EC 1UH2A 4DKEH 3BZ4A 1BECA 2DDQL 1D5IL 1KB9K 3RBGA 4NBZB 2AJZA 5MEQB 2DQJH 3MOQA 3ZKXB 3S9DB 3U46B 2O5ZH 1RZKL 3VI4E 2R0LH 4G6AD 2A6DA 3RNKB 4EZMA 1A1NB 5I75B 3D18B 1ZGLM 4FQPA 1CE1L 1FFNB 5C0AE 2BRRH 2GIYA 5F7UA 2HMIC 1JPSL 4LQ1A 2YRZA 3NACL 3O81A 1IL1A 1MLBA 4MS8D 3K80A 4Z7NE 4X6BA 2AGJL 4XC3L 3LQMA 3RUGB 4I5BB 4MXWH 3UTTD 4G6FD 4WEUD 4I13B 1DQDL 4G9FE 2FCBA 3B6SA 1JF1A 3WYRA 4ONGL 1YEGL 1GJIA 4L9LB 4PRIE 5JORA 2K7PA 1JV5A 2OTWB 2EZ0C 1KEGH 3IFPB 3QUXA 1R0AL 4JRXB 1QTYT 4ZAKB 3PWPB 5TQ0H 4TUJB 3VXRE 1K4DA 3C6LB 3E3QC 3OB8A 3PJSA 3FB6B 1KPUB 1Y6MR 1C5DB 4JFXA 4L3EB 5BV7H 4CMMA 4O5LH 1LILA 4KMQA 2Z93B 3B9KD 2LTQB 4P2RA 3QUKB 4PTTB 4OZHF 4YBHA 4R0LC 1PX3A 3J8F7 3MRMA 3CDGA 3NPSC 5FKPB 3W39A 4Z18A 5J3HD 3SQOH 5D7IB 4RGMC 1BJ1J 2PYED 2OJZH 3MCLH 4U7MA 4XRCB 5IMOB 5IR1A 2FX8H 4BSVA 1CGVA 1EK3A 1UENA 2F9BT 1UJTA 3CDFA 1KPVA 4MD4B 5HPMA 5IWLC 4GOSA 5DXWA 4D9QD 2OX5A 1UACH 3MZGB 3FFCB 4D0BA 4P59H 2FBOJ 1LNUB 3LS4H 2YSSA 3BQUB 4S1DC 4MSWA 5JPMB 4AH2A 2YPLB 1PGRB 5F9AC 3VH8A 1D5BA 5FO7B 4TULL 5GRWA 1CXLA 4PJHF 3O2VL 1JPST 2IC2A 2ZUTA 3VRLF 3X11B 3ZE0F 3D6GA 4X7EC 5KANG 3DETC 1MHHA 3JTSA 1ADQL 3ARDD 1G0XA 2AV7B 1RZFH 5DMGD 3ULSB 2JJWA 5F1NA 3MLVH 3OKKA 1ZANL 5C7XH 5DC0A 3IXTA 4WCYL 4GAFB 3D69B 3BT2H 3N0PB 4LCUA 2CDEB 2EDLA 4LOUC 1AIFB 3HLAA 3KYAA 4MJ6A 1HCVA 2C1PB 4HUWA 5DLML 2UWEE 1JGDB 3ZDYF 2XKNB 1OGAB 4MQXC 4XPHL 3LRSA 3RWEB 3WXWL 1MRDL 4R0LA 4UV4L 5ICYB 3MRMB 1YEHL 4OZIF 1BQHB 3MBEB 4Y4KC 1KC5L 2EYRB 3HNVL 3MRJA 1S3KL 4LCWA 4WI3A 1NJ9B 1U36A 3RIAK 5B3JF 1QFPA 3M8OH 5IKCB 4Z78B 2ICWI 2I60L 4QRQA 4JB9H 3CGTA 2DQFB 3M17A 4HBCH 3BKMH 4P3DA 4NKDA 3C5ZA 1KGCD 3LKOA 1KLUB 2RCSH 2UYLA 1E6JH 4QRSB 4E41D 3CH8A 4KY1L 2XN9E 2VDLL 3LEVH 3O9WD 2VZVA 1IAOB 3VU2A 3MRJB 1IGFH 1KCRH 1U8LB 4MD5A 3L5XH 5FDWB 3D0VB 4YEFA 4O2CA 2P47B 4M61A 4N0FA 5SV3A 1R24B 5TQ2L 4DFHA 3WN5C 1N6QH 3VXMD 3ECBB 4LCUB 2P42B 4ZTPH 3HNSL 4F8TA 5EC1B 4KZDL 1T80A 2HJLB 4XVSH 2VR5A 3ARGA 2FWOA 4OFYA 3C8DA 3VFGL 1OP5K 1S9YB 4WWKB 4R6UA 5D9SA 1XH3A 4ZODA 5JW4R 1LD9B 2E7HA 1EXUA 1XF3B 3OL2A 1A1MA 1I9IL 2BSTB 2CO6B 5EOTB 4NN5B 3KAAA 4X6DA 3TIEA 1RSFA 4LQFH 1G7LA 3CDGB 1WFUA 3VXUD 4Q74A 5GGVY 3P4OA 3KPLA 1BD2B 2X4UA 4X5XB 2DQEL 1P84K 1D5ZB 2A2QT 1GPOH 4LCWB 1FFPA 3O3AA 3BP6B 5C09B 4LK4A 4BUGA 4PJBE 3O3EB 2XG5A 1LNUA 5BZWA 2Q87A 4WEBL 2D7TH 3WEXB 4Y5YA 5GRJL 3KLAB 1S5IL 1MEXL 2X1XR 2ICES 4D0CA 3GSUA 3FO0H 1IM3B 1MRFL 5FGSA 4X83A 3DSNA 2C7UB 2VKWA 4PJCA 3CMGA 2YUXA 2VIRB 3U9UA 2AJXL 2DQDH 3MROB 1GAFH 4M7ZC 4LSRL 3RZCA 1FO0L 4RX4D 5F7MC 4WFFD 3DYPA 3EYUH 4YBQC 2ITDA 1JHTA 5F7WC 1EDQA 5FCSH 3RQ3A 3U79A 2YMXL 2HRLA 2XNAB 5J57B 4PJXF 4JY6A 4X98B 1U8PA 5HBBA 2Q3ZA 3ARGB 2O93L 3GSXB 2NY1C 1ZLWK 1SEQH 4DGVH 5HHNB 3V8OA 4U3HA 4JM2B 3IGAA 4BFBD 3CLEL 4XP1L 3D3VB 5H37H 1JF6A 9CGTA 1DBJH 3K7UA 4JZJB 3BP7B 3MMEA 4R4NC 4EXKA 4ZFOL 1QLRB 3HNSH 1TIUA 3DJ9A 2FLRT 5I1GH 2YZ8A 1QEWA 4Q6IC 5CLWA 4MA8H 2ZCLH 15C8H 3IDUA 1FL5B 5LKNA 5CEZE 4OQTH 2ZP0T 1FZJB 2EIBA 3O4LA 3S35H 1WCQA 2XRAL 4JJHA 5E8EA 4ZXBB 3M17B 1JE6A 5B22A 3VGAC 1UVQA 3PP3H 1FGVL 1KPVB 4U6VH 2BX5A 4YHZL 1ZHLB 4OT1L 4OZIE 4ZAKD 5C0EA 3DYOA 3HAEB 1KGCE 1NSNL 1B0WA 1KLGA 3UTTA 4CBPA 5DJ0A 5I8KL 1GZQA 2APWA 2VB5A 1FL6A 5FOJA 4WU5A 2WWMC 5HDOA 1M1SA 1L9MA 4JPKL 4NZJA 1G7PB 3NCEB 4PJ7E 3GMMB 1R24A 2AEWA 5FGRA 4ELMF 4W6XB 3PP4L 1J1XL 1WZMA 1IKFH 3VFTB 3C2SA 3V6BR 3O6ML 3UBXI 1ES0B 4Y4FA 2ZUUA 1KBGH 4GUPA 2FHFA 3P4NB 1F58L 5JR1H 4KRPB 1U3HC 3KWWB 3QJFB 3UX9B 3B9KC 3KXFA 3RHWK 4HF5H 4HLJA 4U1NB 1P7QA 4LP5A 4RAUA 2R0WL 2F54E 3GDBA 5GXBB 3WFDH 2NCMA 1KJVB 1H5BB 2V17H 4WUUD 1U8NB 4V2CB 2A6KB 3HI5H 5J3HC 4E9LA 4RMRA 5DEFB 5FUCE 1CE6A 2JCCB 1UM4L 2UUDK 2HVJB 2AJUH 3X3FL 5HSFA 1ZGLP 2HVKB 1YNTB 2VAAB 5DVMA 4UINL 5KVFH 4O02L 4XCYA 1MCWM 5EZJA 4JDZA 1HH6A 1G9NH 5C0EB 3KPSB 5EBMB 3RWFB 2JK5B 4HIXL 5HYSA 1SJEA 4HH8A 1FNEA 3JWOH 4F7EB 5IHUH 4JE4B 1T1YB 3BEVA 3CJJA 4RFOL 3QWRA 2ICEA 2VZSA 1EEZA 1UYWL 1GRWA 4NHUA 2FGWH 4KI5F 3LAFA 3U0WH 4FQHA 4EI6A 3BUTA 1A7PL 3FL7A 5D2LE 3GSOA 3FKUS 2VAAA 4LHUG 1H3UA 4GJTB 4OLZH 1Z5LA 4PJ5B 3NCMA 3JV4B 1FQ9C 2X1WL 1ORSB 3EFFA 3RBSA 1CXFA 4N9GB 5KVGH 5FYKU 1NGQL 5HHQA 1U8LA 2VTFA 3D0LA 5EOCL 2Z4QB 4CN6A 3MA9L 5F21B 5EU6A 3EOBB 2DWEA 3HUJE 3NABH 4P2QE 4NYLA 3SOBH 3T77A 1NBYA 3C6LC 4OCRH 3SGEI 3G6JE 4XPGL 3SJVE 4PV9B 1YUHB 3VI3E 1MIEL 3C5ZD 3T0AA 1CL7I 3T0DA 3H9HA 1UA6L 3KLSA 3AXLB 1K8DB 1T66D 2I07A 3DYMA 3V5HB 3BQUD 2WINB 4NQDE 1U92A 3DUUA 4Y4KD 1KJMB 1UWEH 4IRSB 3MUGA 4PYHA 1RK0B 3LKNB 3O4LB 5EA0H 2PYEB 3MNZB 5DFTA 5IMMB 5M94B 4D3CL 3CFIC 2R2CA 1VEOA 2Z31C 1H15B 4XPAL 5DQDL 4HUXA 3BP4A 2IANE 2YK1H 3CX5K 1G84A 4N1EA 3BD3A 4NC0B 4U0RB 3O3AB 3D3VE 5JOFA 1JGDA 2K3TA 1MJUH 4YPJA 2XQBL 2OQJB 3VXRA 1VCAA 2LAGB 5EU5B 1OTSD 2NXZC 4FTVD 4MAYD 3PWUB 4NQCD 3P9LB 1CGSL 2DRUA 5DMJB 2BDNL 4TVPE 2BP3A 3QFJA 3BPLC 4WV1B 4CVZB 1ORSA 3EFFB 4U1LB 3UZVB 2YKLH 4LP4A 4K55A 3WNMA 3CFCH 2GITA 4NC2B 1MWAL 4Z8FL 2GUOB 5T3ZE 5I30L 2QSVA 4RFOH 4EVNA 1E4XH 3K4ZA 1DFBH 4P23B 3C6LA 4MX7A 5ANMB 3CXDH 4JG0H 3MRNB 3ARPA 1D9KB 1QHOA 3EDJA 4OV5B 4JFYA 3CSYA 3H3BC 5FGCB 3LHPL 1RUAH 2WNGA 1MHEB 1QNZL 3E1F1 4NQUA 4F9PC 4YHNB 4F9PA 3WJLC 3OX8B 3VW3L 3QAZB 4AMKH 4K9EL 3GNML 3JVGC 1I7UB 4EN3D 2WBJC 3VXME 3IRPX 1RURL 4MLIA 2VNCA 4EVNB 3CZFB 1AY1L 2VDRH 2CLRB 3OXSA 1DBKH 1XAUA 4CJ0A 1LEIB 1J8HB 5D1QD 3DIFB 1ZVHA 5LQBL 3A6CL 2J12B 3HE6B 1F2QA 2E7LA 3KPRA 1NC4B 3ARBA 1BQUA 3LKQA 5L6YH 1IGIL 5E70A 4NQDA 1NUDA 5EA0L 3WFBH 4IHOA 3WUWB 5HHOE 3PQYD 4LLQA 3LSOB 1BMGA 4U6YB 3GJFB 2AV1A 1W0YT 5JXAH 3A6CH 3CAFA 3MRCA 3BT2L 3MJ7A 1JWUA 5HXMA 4PG2A 1U8JB 3HUJA 3TA3D 3V4UH 1B4JH 4DOHE 2B2XH 3QIUB 4P57B 4X6CA 1NDGA 4O2EB 1WEJL 5AYQA 5ICXB 4R7DB 4WW2C 2XWJB 4WW1B 4POZC 4N8VA 3VRIB 1YUHA 4OLWH 1XGPB 4GXUN 1T3FB 4GRLB 4OV5A 1QYGH 1AIFA 4CL7A 5E2TH 2VZ3A 3LDBB 3V5DB 1MJ8L 4ONFH 3WKNA 2HLAB 5KVGL 3LVEA 5E99L 2YC1A 1NGZA 3HZMB 4NO0A 5AAMA 1NAKL 3G5ZB 3LEYH 1RIUH 3JV6B 3GSWA 5KSVA 1W0VB 3VMNA 5IF0A 3T4AA 5GGRY 1F90H 1GL4B 5KW9L 4HWUA 5F7NC 4KGJA 2CQVA 3HZKB 2EYSB 4JZOB 3X13A 4IIQA 2EKJA 4ODXA 4PJDE 3MXWH 1T1XB 2W9DL 4JRYE 5E9DB 4UMGA 3G5XA 5DRZA 4AEHH 1KLUA 3ARYA 1NAKH 3LEYL 3QEUA 4CKVX 4NPYB 4JFDD 1XF2B 5I8KH 5CP3H 4WFEE 2JB6A 1CQYA 1WBZA 3BD5A 3WIHH 3DVNA 5DMKA 2ZPKH 4U1MA 2ZJSH 1H3GA 3LN5A 5FO8B 2PYEE 3F7RA 4HKXB 5DJXA 4YFEA 3S96B 5DURB 4YGVA 5AYUH 4AM0B 3DGGB 4PRNA 1SQ2N 3QIUA 4P57A 2E8ZA 3FQNB 3K4AA 4I48A 4FG6C 2H6PA 5J12B 2IFFH 2E8YA 4KK5D 4MX7B 1XGPA 2BHUA 2NX5E 3D0LB 3MRLA 4X7DC 4EI5A 5FXCH 3CSYB 1KTLB 3QIWD 4LDOB 4S1SH 3QNZB 1FG2B 5ITFB 5CIPH 1DQJA 3PF2A 1NBYB 4OGAD 3QXUA 1OARH 3QCUH 1T20A 4ZSOE 1Q0XH 2JTDA 1FRGH 4M1DH 5FF6A 2PXYA 3SCMC 5FV1L 4F57H 4I8DA 2E6QA 3QQ9D 3RU8L 3RVVD 1R3IL 2VH5H 2W0FB 1ES0A 4Y4FB 5GHWL 3QEQE 3S4SA 4MJ5B 5CJ5A 4I4WA 1Q9OA 4ONFL 3TIDA 2HTLD 2OSLA 3G5XB 5ACZB 3VWKC 4DK3A 4HUXB 2DQCH 5GQBA 5BV7L 1AY1H 2M2DA 1A5FL 4XNXH 5DQ9B 4W6WB 4PJ9A 3DO3A 4D9RE 5JDSB 4CADA 1JGVH 1FH5H 2PR4H 4P5KA 5C0AB 3UTQA 4M6OL 3O8XB 3OZ9H 4KUCD 1MREH 3ZKMD 3H7BA 2C3HA 3FB7B 5ACZA 3HZVA 2A9NH 4P99A 3O3BA 2VSDA 3FO2B 4WY7L 4PREB 5T1LB 4Z7OF 4WU7A 3IAQA 3OSKA 5C2BH 4GAGH 1V5JA 5I1HH 4NWTH 3EYSL 5DJAA 3NAAH 3MV7A 1CG9A 1TVHA 5KAQG 2BY1A 2LVEA 4HK3N 1BWMA 2HT4D 4Q6IA 4HBCL 3C5ZC 2WUBL 5KS9E 3V4PH 3I6KA 1NLBL 3EO0A 5DJYB 2HN7A 4OCLC 2DMBA 1U3YA 4CU6A 4JFFE 5IM7B 1GSMA 3O6KH 4FZEL 4JEGB 2XPGB 3GIZH 5D70L 1S9WA 3IT8D 1HDMB 5CJQL 6FABH 4JFHD 1EHLL 1MI5D 1VA9A 4RFEB 1S78D 1FNSL 3QJHB 1QRNA 1Q72H 1JRHI 2ENSA 2LAAA 4RFNB 1I3RA 2HA1A 5TQ0L 4CDHA 5L8KB 1FO0B 3I6KB 4P2RD 1GGYA 1VFAB 4CN4A 4XH2B 5FHAL 2W0KA 5J6HA 3I6GB 1CF8H 4L4VE 3T65B 3OGOE 5DYOA 1A9EA 2ZSVA 3CFEA 1MLCB 3BGMA 4X9BA 3SE8H 4PY8I 5EOCJ 1GOHA 4YPGA 3MRPB 4Y19E 2X89A 5D5ME 1KN4H 4M03A 1F11B 3IJHA 5F9OL 3UDWC 1FO0A 4ETQB 1LE5A 3NACH 1BIIB 3MA7A 1G7JB 4JFFD 1K6QH 4Y16A 2CRZA 7FABL 2VERN 5EH1A 5EDXA 5F89A 4JKLA 4WDIB 5IVXE 2IH3A 2MQCA 2PTUA 3EHBC 2ZUXA 3GMRA 1QVOB 3B4NA 1A47A 4LPCA 3BIBX 4QF1B 1QLFB 4PJBF 4OF0A 3EYQC 3EDEA 1BFVH 5DHVB 3DXAE 1SVCP 4HZLB 4GRWH 3GMLB 2E27L 5IESH 4EEEA 5BOPA 2EXYC 4HKZB 1GGBL 5C92A 4KKAD 4HG4K 3TFKD 1SJXA 4QRPD 1X5GA 4BKLA 3H3PH 3EIFA 4MB5A 2FBJL 1YMHB 2A74B 1F4YH 2VDPL 1G9NL 2R1XB 3BWAB 2BFVH 4AZ8A 4HS6B 4AL8L 3FHQA 1A6UH 4TTDD 3WFCL 3V0WL 1J10A 3LN4B 2BOBA 1CI5A 3TO2B 5T1DH 4MCYA 4MJIE 4LVNC 3A67L 2GKIA 3KYMA 3AREC 2O5XL 2CRMA 5EBLB 1TCRA 1ZLSH 3TT3H 1HEZA 4ZXBA 4K3GA 4LF3B 4XCEA 5BRZA 3U83A 4P23C 3STLA 1JPFB 5IB2A 4Z7WB 2JB6B 2J4WH 4S0TD 4MNHA 1JPGA 4NZUH 5GGSA 3IXAB 2MPAH 4Q9BA 4CGTA 4U1IA 4MDJB 1FVCB 4UOW1 5EU6E 3MLZL 3DO7A 1G7MB 4JCLA 3T3MF 3MLYH 3R06B 3TVMB 4XWGH 3QT2A 5EBLA 1XGYH 1U8IB 3MV9B 5BS0A 1TJGL 4HKBB 3TNMA 2KPNA 5DRXB 4BSWB 2V9QA 4MXQC 3MRLB 4LEOA 3UCRA 1NSNH 1HDMA 3KYKH 3UTZA 3BGFB 3UXFA 2LU3A 2VDQL 4L9LA 5KG9B 4XVJH 1DBBH 4LSRH 5F1SA 5GZOD 1E4KA 3LH2L 5E94B 4HPYH 4WFED 5K9OB 1CT8A 5JW3H 1Z0NA 4GG8A 4JFDB 3NTCH 2XFXB 3TBSB 4HIHA 3RVXD 1D5IH 5CBAA 3BP4B 3CFDA 1UXSB 5CKGA 4PJIE 1A4KA 3MLSL 3GJEB 3I3EA 3N06B 1BD2E 1V7ML 4K7FB 1JMXA 3NH7H 1VFBB 4C4KT 1T2JA 2HKHL 2W65B 4PB0H 2JIXA 4U1JA 1TZIB 2DQGL 5D7JD 3GRWH 1Q9LB 2ADIB 5E1HB 3GMPB 4OLYL 5E94A 2BXYA 2H32H 4W81A 3WBDA 5C6PB 3ZT6A 4R4ND 4HULB 5IR1B 2AI0L 4CMHB 5IBUB 5GIRA 3VFRA 5CD3B 5EZJB 3VRLE 1QA9B 1A1NA 5ITBH 3IJYA 1BQSA 2YOCA 4OLUH 4M93B 5CZVH 4HFWA 4IIQB 4ODXB 1XGRB 5H35A 2NX5A 3RNQB 4U0QB 5ALCH 1J9CT 1RUAL 2DM4A 3ZT5A 3RWGA 4C56B 1JNLH 4HKBA 3TNMB 1KIUA 5I74B 1MH5A 2QL1A 5DRXA 3SBWC 4X7FC 1C16A 5D5MF 4X0KB 4IRJC 5DMIL 1I8MB 3T3PF 4RNRA 5IHUL 2VO5A 1HKLH 4MA3A 5DTFB 1AXSA 1Z9SA 4P4RB 1UYWH 2IQ9H 4FNLL 5F1NB 2H45A 3BPNC 2Z91B 4Z95H 2C3WA 3T77B 2CRYA 1H3XA 4G42A 1E28A 3FQNA 5AWNH 4LFHG 3FN3A 4HEME 2J1KA 4RGNC 4ODSL 4KC3B 3DXAA 4Q0XL 1FNFA 4DAGH 2G60H 3ETBF 3OBAA 5IFJB 4ZUWA 1IQWH 3VDAA 3OKDA 4Z7VB 1NUGA 3CPLB 4LRNH 4FFWC 4ALAH 1YEKL 5I1EL 2OXHA 2H1PL 3BAEH 2FEDC 1BZQK 2BRQA 2CJUH 4BSVB 4JY4B 4XCNA 4PBWD 4Z7WA 1WIPA 4PJGF 3G9AB 1NCCH 1MHCA 2R29H 3K2MC 2BSSA 5D93B 2VRAA 2PKDA 4Q0XH 4DAGL 1NCDH 1NMBH 3QI9D 3V4VL 4DVRL 1X4YA 4PJXA 1NCNA 3EJZD 4NBXB 4U6VL 4B7IA 1QSFA 4IRSC 2QV2A 3UPRB 5HVFB 5I1EH 2V5RA 1F4AA 1KV3A 5HDBE 5IBTL 2B1HL 3QDAA 1IKNA 5ADPH 4QRPA 3RI5F 5CGYD 2F53A 2XZAL 2IH3B 2XY2A 5I76A 3ZDZF 4M43H 4KWUA 2HKFH 1AH1A 3V0VA 3MGTA 4OM1H 2WMPA 2G9HB 5DJ8B 4HZAA 4PJCE 4NRYA 3P73A 2ERJB 3VWJB 4I2XA 1D7FA 1P5VA 2OJEA 1G6RH 1H3PL 1IGCL 4M7JH 5KSAB 1C8PA 4Y4HA 2D0HA 5KSBA 4PLKC 2NNAB 3TEUA 5DRNA 2IAND 3HMWL 1DLFL 2JCCE 3RL2A 3O6LL 3QG7H 3KPRD 4JHBA 4NPYA 1XF2A 2X4PA 3UJJH 4NOBA 2JB5L 1ACZA 1ERNA 2AVGA 3V79C 2DMKA 1QPXA 4YK4C 3O0RL 1BGXL 4X4ME 1R3JB 1UM4H 2UUDH 5ALBL 3PWPE 1AE6L 1FYTE 2XWTB 3MBXL 4EI5C 1RURH 4JCMA 4RRPA 3CLFH 1QSEA 4FQ1L 5E2UL 1QBMH 2B0SH 3AS1A 3C5ZB 1FNGA 3GGWB 4TUOB 1T5XA 1N6VA 1U58B 1PYWB 4J4PA 1YEJL 5DYOB 2NY7H 1IEAB 1CDYA 2D2OA 3S3PA 1DEDA 4JN1L 1XGUA 5JOPD 2FX9L 3MUZ1 4F37K 3IFOA 4LSSH 4LHUD 5F1OB 2QHLA 3HUJB 4NKOA 5ISZE 5DZNA 3QEHA 4I0PC 4I18C 4M9OA 2E5EA 3SDCB 1RUML 3DNKA 1TVDA 5E6YA 4LEOB 4BFEA 1BM3L 1E0OB 2I24N 4JKMA 2F8OA 2FHCA 1JBJA 1R5VB 4LKCA 3H8NA 5E6IB 4QNPF 5DO2C 5HHMB 4RCAA 4BH8A 5F1IB 4YUEL 3SKNB 1DDHA 4H5SB 3T2PA 4JPWH 4PJEB 4KZEL 4LPWA 4HWBH 3OKKB 3WKML 2V2XA 3D85D 5HI4D 1EHAA 2D3VA 3KPQA 2LU7A 3MOAH 4OIIH 1GYAA 1RZFL 4GW1A 2D0FA 3FAWA 4AMKL 3EYOB 3FQTB 2WBJD 5ABDE 3H7BB 4HIXH 2J4WL 3X12A 5JMOC 1OAZH 1WWAX 3KLAA 4PJ7F 4R0LB 5ICYA 4XMKH 3H42H 4CMHC 3C8KB 3VGGA 1ZHLA 2NZ9D 1NLBH 4IRZH 4N5UA 3RX7A 5HYIA 5EG6C 4RDQG 2DBLH 1OSPH 1CLYH 1ZEAL 1UG9A 2X42A 3CXHJ 3HS0A 5F97E 5IEHA 1IEBB 4L29B 4DGVL 5F6IB 4HKXA 1MI5E 2EE2A 1AKJA 3HMXL 1OGTB 1WC7B 4JFFA 2OP4H 1U3JA 4UV7H 1OQOA 4LKXA 2XNAA 4YGAB 1OP3H 1H9VA 4UNVA 4P2QA 2XOTA 4Y1AB 3JV5A 5T33L 1JWSA 1TNMA 2HT2D 1DE4B 2FH8A 2ZUWA 2YUWA 4D9LH 1MJJB 2OZ4H 4PJ8A 5SWSA 3RWJB 5GGUA 2VC2L 3F58H 2AABL 2ZNXA 4M61B 5HVGB 1NL0H 2C5DC 3QA3B 4PJGB 3TGXA 5BO1H 3MMEB 4P5TD 4JFEB 3AMLA 4L4JA 3MGOB 4OLYH 1GGCL 3OKMB 5F3HA 4KK6C 4GLRH 5CD5D 1ZVYA 4M93C 2Z35B 2G2RB 1CE6B 3H9SD 1DE4A 4JDVA 2WSKA 1NFDE 1CLZL 2CO7B 4P46B 3QXVA 3ILQD 4IMKA 3RWJA 3SE4C 1G7JA 3VXQB 1LO5B 2O5YH 4OGAC 4TUOA 3RKDD 1V3LA 4V1DD 4WI8A 5FGBC 4XNMB 2CRIA 3TPKA 3D3VD 4NKIL 2HMID 1YEFH 3MXWL 3ZTJH 3QEQD 1YJDL 1MHHB 4PTUA 3GO1H 4N90E 4FABL 3QWOA 1YYLH 2IAMB 3CFCL 1WC7A 2I9LA 3ZDXE 1L0XA 1RJYB 2XV6B 2ADGB 2CK0H 4Y1AD 4URTB 4HZLA 2ZG2A 4AIZB 4WWID 1BHGA 3H42L 4LCWE 4WW2F 1QLEH 4K7PY 3OWEA 2GFBA 2Y7QB 4R4FL 5I8EA 2NTFA 2ZJSL 3U6RA 1JYVA 1FVEB 4OF8A 1A64A 3SGEH 1JHTB 2FHBA 2PTVA 4ZFFB 5D72L 3IJSB 5DUMH 1XR8B 1C5BL 1S7TB 1ZLSL 5C6TH 3W0WB 4N0UB 4LNRA 4OGYH 5JIPA 3L3HB 2BY2A 4M7KH 4GW1B 5DDHA 3ZTNH 3RFZC 2Z35A 5A1AA 4JO3L 1Q0XL 5E9DE 5E8OB 2FL5B 4XCYB 3AAZA 1HWHB 4JFPA 3S6CA 5BQ7A 2BERA 4D0BB 4PBXA 3RWCB 3OKNA 2C3XA 3HUJF 5I1KH 1EMTH 1VADA 5SWSE 2HFEB 3STZB 4HAFA 4FFZL 4DZ8B 4HJGA 1EGJA 5J1AB 3TO4D 1CCZA 1S7VA 2ZOKB 2FYYB 3VWKD 3MNWA 4OCXL 2MMXA 3IDJB 1OSZB 2J5LC 1S3KH 4DKDC 4OV6F 5DVLA 1XR9B 2ZPKL 3QCVH 4FQ2L 4ZOBA 3TZVC 4TUKH 2VLLA 5E8PA 5I19H 1TQCC 3KYOB 2F53D 2X6MA 5JPNB 3QUYA 5D9SB 5KN5B 4QHUA 4M6AA 1CBVH 1SM3H 4NQED 4PLKD 3AREA 2NW3B 4ZS7H 4OKVA 3T09A 3HMWH 5HDQH 5HVHC 4F15B 3E6HB 1Q9LA 2OTWA 4PJAE 5EUOF 3PP4H 2D7TL 5C09A 1LO3L 3O2DA 4JKPL 4U1SB 5ITBL 3KWWA 4GRMB 4LLWB 4EOWH 3OJDB 5MEND 1DVFA 4HS6A 3BDYL 5BW7A 3EHBD 3A6BH 3VXQA 4LARL 2DM3A 1ACYL 2YN3A 2OR9L 1C5BH 2P5EB 1EFQA 1QSED 4JQXC 4XNMA 1N8ZB 1KB5A 4XP4H 3RWIB 3KR3H 5H35B 5ESQB 5GGVL 4NBYB 4YHKL 3KS0H 4NO3A 1BBJA 4NCDA 3NFNA 3ARFA 3PWJB 4RAVB 4P9ML 2O61A 3EDFA 2DTML 3H2WA 1SYVB 3S3SA 1CIUA 2C1OB 4B41A 3Q0HA 5EORH 2SEBB 1DFBL 2IADB 4K8RD 2JIXD 4Z5RA 5J13C 5D5MB 4UT9H 5HHPA 1XZ0A 4JY6B 3SKJH 4M6OH 5C0CE 1PSKL 4I0PD 2C3VA 2R56H 2GQHA 1AXSB 1ZGLA 2E6JA 5INCA 4GRLD 5MEPB 1KULA 4YHYB 1WWCA 5F8QC 2GUOA 3MREA 4FFZH 3JUYA 2P8PA 4WVRA 3BEVB 2PO6C 1DBMH 3VG0H 1U8IA 2CMRH 3GGWA 3P40A 1SHMA 4DZBA 4GRLA 5E5MA 2SEBA 4O5LL 2BVOA 1T03H 4QRTB 3CFBB 4XBGA 1EBAA 1N64H 1INEH 2GJZB 1FYTD 1M71B 3P2TA 4IBLT 2WANA 4G7YH 3CPLA 1A0QH 2VH5L 5HI4C 5DUPL 5EBGA 4Z7VF 4NDMB 4L4TB 3BSZH 2IBBA 4GRMA 1JCKA 3EYQD 3ZE2E 2V7HA 5DR5L 1RVFH 4JPVL 3JWNC 1MCEA 4BK4A 4DQOH 3PJSB 3THML 5FK9A 3HG1B 4LKCB 2GJ6E 2YXMA 5C8JB 1J5OL 2GJZA 5BZWB 3UYOD 4UQ3A 2W38A 1TZIA 4FQXD 3LKQB 1UADC 3PGCB 1B0GB 1RUQH 3A6OA 3ARXA 1IMHC 5I1LA 4FXKB 3FO1A 4EN3B 2EDXA 3B6SB 4L1HA 4F7TA 5I71B 2R4SL 4NZTL 1JVKA 3ZE1E 4ERSH 2YD3A 4JQIH 4PJAA 4LU5H 5J9PB 2D03H 5HDLA 4J3TA 1OTTC 1Q0YH 5LJYH 1JHKL 4LSPL 3QFDB 1RU9L 4I3SH 3U7WH 4X4YA 2BNUB 4XAKE 2AI0H 1FFOA 4J4PD 2X4SB 4IM8A 1U8PB 1MJUL 5F7HA 3NN8A 3U1SH 3W81A 3RWDB 4UU9B 1HE7A 5E4EC 5D7SH 4HIIB 5E8DL 4M1GL 5ITFA 3CNKA 3MRFA 2D31B 1C12B 1V8HA 3DX7B 5JOEA 2FZ3B 4ZO8A 3NCJH 3QO0A 1X44A 1U91B 3H9SE 4ZO7A 5KAQF 2AEQL 3I9GH 5FO9B 4WHTA 5E03A 3T0ED 4Z7QE 5B4MC 1GIGL 5L2KD 5GJSL 3MR9A 2AJ3A 4M48L 4Q6YA 4AG4H 5HJ3A 1I7TB 2YPLE 4WUKH 4DKFL 1R3JA 5B8CA 5AUMA 1F4YL 2VDPH 4GS7B 4HX1A 2ICWJ 3IKKA 4M5YL 5ACMA 3OAYH 4UAOB 5C0BE 3OF6A 3O45A 2OXGA 2QHRL 3CFJA 2XZCL 3RVXC 2YS4A 3CZFA 5E1AB 5TH2B 2YR3A 1HIMH 5IOPA 2W0LA 3LKRA 4ZG1A 5F7LB 1IZKA 1MY7A 4CW1A 4TSCL 4Z5RB 1NGXA 5D7JC 2ATKB 4K2UL 4ZSOA 4PJBA 3ZHDA 1DBKL 4PGZA 4WUKL 4DKFH 3G5YA 2NMSA 2B20A 3VGDA 4RMSA 2VITB 3GI9H 3SDAB 2QQQA 1FCCA 2BMKA 2IQAA 1F2XK 3E8UL 4PJCB 2VLLB 1PW3A 4WO4C 2K9UA 3C6SA 4G3YH 4X6DE 1X4ZA 3WL9A 1CG9B 5LAXA 3S34H 3O2DL 4DKAA 4QHKI 2HFTA 5CHNB 2R8SH 2VLJE 1U3HD 4M6NL 2XG4A 4P59L 1MCOH 2A77L 1Q94A 2CKBA 2DWDB 2G9HA 8FABB 2VLRD 5BJTA 3OGCB 2Y6SD 5HD8D 5CSBA 1XEDA 1H8OA 4AK1A 3F7VA 3GSNL 1IM9A 5DEGA 1JUFA 4ORZC 3QR2A 4F37F 5B8CC 5CHNA 3CVHA 3L6FB 3AFLA 5D1XA 1NGPL 3U4AA 4MNQE 3UDWA 1J1OH 3BRFA 3GSWB 5KSVB 1V7MH 4U3XA 2FSEB 5DK0B 5E4IA 3WIHA 2A9NL 1VFMA 3MRDB 2X4TA 3O2WL 3NCFB 4S1QH 3QUZA 4YIQA 3U82B 4XC3H 5DQDH 1NCAH 2YBRB 5DMGC 4O2CB 5D7KD 1Z2KA 4ELME 2PW2B 2C1OA 4Y4HD 3BZDA 3HFML 1JTTA 5DVKA 4C83A 3HC4H 5K93A 4CU7A 3ARTA 3IDIB 1VGKB 4D9LL 5D5MA 2HH0L 2JCCF 2VXQL 1XZ0B 3GMNA 2P24B 4M8QB 3MRNA 3ARDA 4WDIA 1ITCA 1INQA 1A22B 5LAXB 1AGCB 1RMFL 4QLRA 4NQVB 4K2UH 1INDH 2GTZB 5GS3A 1NAMH 2YBRA 2VMFA 4L3CB 4Y89A 3VXRD 3U2SB 2HJFA 3BVNB 4PRPB 2F54A 4X4ZA 1NDMB 1I1YB 1YECH 1KXVC 3FOMA 4PRID 1ZTXH 3UROR 3CK0H 2VLKA 4M8QA 2WINA 1I9JH 5F93C 1OP9A 3QEQB 4ZFZA 3P4NA 3TV3H 2QLVB 3IS0X 5C08D 3MRIA 4YXLH 3K3QA 1HH9A 3REWA 4OI8A 3LRSB 1RMFH 4IDJL 1SVZA 2JELH 4XH2A 3NMEA 3IU3B 1I85C 4OCSL 4RRPG 4NO2B 5KZCD 2KBGA 3NPSB 4A2MA 4OKVB 1FDLL 2X10A 1KEMH 3GJFK 4Y2DB 7FABH 1OL0A 4QRPE 4PJ9C 4KVNL 1ZA3A 4RMUA 2CDGA 4NKQB 4DWHA 5H2BA 1OF2A 3ARZA 4PJDB 2AJYL 3DXAD 5INDA 1JF5A 5JXEC 5LWYH 4BZYA 4F7MA 1PZ5B 4JFZL 3B8YA 5DMIH 1MCRA 1HHHA 1QACA 2NLJA 4OIAA 5C6TL 4GXVH 3VI3F 3WDJA 1WGOA 3HR5A 4HV8A 1QLFA 1CLOL 2VSCA 4NO0D 3RIFK 3W11D 1JL8A 3GMMA 1MHPH 3RWDA 3GIVB 3BP5B 1MJ7H 1TZGL 4M3JA 3C5SB 2PW1B 3LQAL 4S1RH 3MJGX 2DDQH 3O3DA 1U6AL 1FL3B 1DUYA 2NZ9C 4X7SH 1F13A 3QHFH 1UQSA 1CD9B 5IVZA 3O8XD 3UMTA 3I84A 1HN1A 4S2SB 3TJEH 5LBSH 1KC5H 1YMHA 2A74A 4BQBA 4OCNC 1YEEL 5F96L 3NAAL 4UINH 1JYXA 2Z0BA 3QDJB 5IJVB 5C0GA 4FQXC 1MSPA 2XT1B 2LTQC 1TZHA 5HYFA 5AUMB 4XP5H 2H3NA 5DO2D 2QQLH 3RL1A 5DEFA 4OFPA 4PJFE 4JO1L 1FPTH 5C08B 3MLZH 1U6AH 3AS3A 3HA0A 3L1OL 4OGXL 1K8IB 3GSUB 2YPKA 3LSOA 2IFFL 5F7FA 5HYQA 4PJHA 3LEXA 3IJYB 1NC2A 1RZJL 5IP4A 2C3GA 1HILA 2YZ1A 4MQSB 3V52L 2B1HH 3I50L 2J8UE 3B9KA 1AQDB 1QBML 2B0SL 1YMMB 2MQ0A 1AGEA 4DFIA 1CGWA 2QQKL 1MPAH 1OAZL 5TE4H 2FECI 3SE8L 2EH8H 2XWJA 2I60H 4WW1A 2MTPA 3PGFL 4GG6B 5F7DB 2X7LA 4RNRB 1MVFA 2DIJA 4XI5D 4PJ8C 3VXMA 1EUUA 1WK0A 1I7ZA 4GAJL 5EBWA 4NN6C 4ODVL 5B4MD 5D2LA 2IPTL 1YNLL 2Y36H 4ZUUB 4P4KA 3TCLA 4LSQL 4ZMAT 1NUFA 3T4AB 2W9LA 1LO2H 1UB5A 4PRHE 3T0BA 4ZNEE 1DLFH 1NCTA 2DKMA 3IU3A 5TQ2H 5DS8A 1A5FH 1A6AA 1V3MA 5BVJA 3B5HA 3W0WA 1KB5B 3SN6N 1A4JB 5DQ9A 4U1JB 4GRWE 3FO0L 2DQIH 5SX5K 4DCQA 4ETYA 1MI5A 4JAMB 4JJ5B 4ZXBC 5H2BB 1T21A 1HXMA 4PJ5E 1E27A 2HRPL 3RHWF 4QHKJ 1GGIH 3DUSB 4EKXA 3V6OE 2VLRB 3CUPA 4Y0GA 1FDLH 1P53A 3MLRH 1DLHB 1JNNH 4D8PA 1XF1A 5EU6B 4ELKA 3D2UA 3NA9H 5CBEB 2N4IA 2D7PA 1HHIA 4MWFB 4M02A 2H6PB 4RGOH 3VWJD 6FABL 4KK5C 4X4MA 5D1ZB 3GJFA 1RZJH 2VUOA 1BZ7B 3L5IA 4OF5A 3CFKB 1KJMA 1OB1B 4O58H 3QUYB 3QFJD 3G5YB 3SE3A 5IVZB 4PGCA 4XMPL 2AGJH 3GHEH 1J5OH 3EDDA 3ZDXF 1T22A 4G9FD 2RQ8A 4FTVA 4MAYA 2R2HB 1YEKH 2R69L 3RAJL 1HWGB 4CVXB 3TO4A 5CJOL 3L3IA 2GHWB 1WTLA 1HQRA 2FB4H 4ZQKB 5HTSA 3L9RA 3O6KL 4NGHH 1DN2A 1A7RH 1G9MH 3UC0H 1NKOA 1PG7X 4QY8A 3T3ME 1A7NH 2NR6C 1IARB 1NUNB 1ZKAA 5EOCH 3RX8A 1CYGA 4OCWH 4GQ9L 4LSQH 1EJOL 1YDPB 1JNJA 4HIHB 4EIGB 4Y2DC 3TN0D 4I3RH 2DQHL 3W9EA 5IBTH 2EDQA 1UCBH 2C1PA 4HUWB 4MA7L 4LEXL 3HRPA 1VB9A 5MI0B 1QSFE 3C6LD 1BX2B 2NW2A 4M1GH 3UO1H 1FFOB 1BAFH 3IU4L 4FQHB 1IC1A 1K4CA 5ETUA 3KPNA 2Z92A 5IG7A 1HK6A 5DT1L 4ODBD 5C1MB 3IRZA 2APFA 3TJHC 4Q9QH 4TTGA 3B9AA 3VJ6A 4I3RL 5JW5A 4HXAL 1JV5B 2F5BH 4NZDA 2YRPA 5JMRA 3KLDA 1LVEA 2FJGB 3NIFE 4UT7L 3NA9L 2R0WH 3LS5H 1KJ2A 5D71L 1HHKB 1F90L 5KSBE 2VC2H 4L4VD 4XZUA 1T1ZB 3C9NA 3RDTC 4P9HH 3CVIH 3HC0B 1G7HA 4FQJL 3TYFB 5JUEH 4BQ6A 4X6EA 1MWAA 2Q86B 4GKZA 4QRRE 4RWYH 2JF1A 5ESAB 4J8RB 1OTSC 1RJZA 1PKQB 1BVZA 5C7XL 5DD3L 1UKSA 2V7HB 4MJ4A 1I1YA 4KJQC 1E27B 1RK1B 2AK4E 1N64L 3GBNL 4JFQA 5KVDL 4KMLB 2MPAL 4M6MH 4QXUL 3IVKB 4PJIB 5I2IB 5D7JB 1W72L 5CEXB 1D6VH 1CFBA 1A3QA 1S7WB 1BOYA 3MV8B 3HZYA 3PABA 1J0HA 4G6JL 3VW3H 4JFZH 2VDNL 3MRKA 5T3XH 2AJZB 2Y07H 2BVTA 3EKCA 5MEQA 4YFLI 5I1IH 1JZ7A 3ULUH 4OF6A 4QNPE 1WSST 1DQML 3CMOH 2HLAA 4C59B 3Q48A 1A14L 4F3FA 2OL3L 3CFKA 2Q8AL 4MA1C 3JV6A 2A0LC 2YPVL 1D5XB 4YGVB 4AM0A 1KJ3L 4GG6A 3IXTB 5TGBA 2WAHA 4G8IA 5DSCB 4JG1H 2EXYD 1A7PH 4XNZB 3NH7L 1A4KB 4PRHB 2IG2H 5EU6D 4OLXH 4R26H 2IPUK 1XMWA 2WLZA 1LK3L 4JANB 2B5IC 3MA9H 5EO9A 3VFMA 3KPSD 3KPLB 2LU4A 3LH2H 1F45A 1RK1A 5M7QA 5TGBB 4FQLH 1P1ZB 2DJUA 3LOWA 3GB7B 5C0DB 2A6IA 2WM0A 2JE8A 1U8NA 1FFPB 4MB4A 1JGVL 2ATPA 4BZ1H 4KROC 3W9DA 4AEEA 3CVHL 3S96A 4G43A 4M7JL 5E8NB 2BSRA 5HGGS 3BIAX 2GSGA 4WUUB 3P4MB 5E99H 4DQOL 4M48H 4GQ9H 5GRVL 3DX6A 1KIRB 1S5HB 1IM9D 2R39A 5IVXF 3ZYJA 2QQKH 3ZLQC 1SY6L 1CLCA 3T0EC 4IOSD 5DQJA 4QYOA 1I8KA 4QXUH 1CDJA 4R97B 2W92A 4ZSOB 2XWTA 4KRPD 4E0RA 5I17A 1RJYA 1VENA 4PRPA 3BFOA 2I5YH 2N7BA 3I75B 3SKJL 3WXVH 4WU7B 2DOCA 5MEOB 1I85A 1NL0L 2WK2A 2XQYG 5FKAB 4FQ1H 2Y72A 3LY6A 3EZJB 4ZUVA 2F74A 1AQDA 2Q86A 1OAKL 1M6OB 3VFUB 3OG6B 1PQZB 2XFXA 1G7LB 4LVHC 3BAEL 5CUSH 2E7LC 1Y0LB 5K9JL 1WT5A 3PHSA 1HNGA 1QEWB 3OKMA 5F3HB 4PJ9B 4Y5VB 1HQ4B 4RFEA 5L88H 5TE6L 1HHJA 3O4OC 4PRAA 1C7SA 5F1KC 3SO3C 5CGTA 5D2LB 4OLXL 3BXNA 4D0DA 5CEXA 2VLJD 5F1IA 2A9ML 4QXTB 4I18A 5DGRA 5JNYA 5E9DA 3GHBH 3FB6A 5GZNC 4ODHL 4RQQA 4XCCL 5J1SC 4HUKB 4GXVL 4P5TA 3WLWC 1BVLB 4YUEH 3L95B 1QLEL 1KJVA 2VWEE 3WFEL 1XGQA 4M43L 3RZCB 4ZPTB 5L7XH 1WISA 4LASH 3O6FD 3HR5B 3S5LB 2Y06H 1BFVL 4K3JH 4I0PA 3S36L 3TWCL 1YN6A 1KUMA 4YZFF 4M62L 4LU5L 2OJEB 3P0GB 3ZSSA 4G8IB 5DSCA 1L6XA 2AQ1A 3VA2C 3PV6B 5JPMA 1P7KA 4ELKB 5HHNA 4G9FA 3WE6A 2H9GB 2GSIB 2ADFH 5D8JH 5K33A 1D5BB 5FO7A 1A0QL 1T5WA 1NANI 2EE3A 1T0MA 2DYPA 3DXAB 3WSQH 2ARJA 2FRGP 1PY4A 1IT9H 2EZ0D 4NQCA 1QZ1A 2AP2A 2YWZA 4YDVB 4NCC2 1OB1A 3QUZD 3ZKMC 1LWRA 1NH6A 5I1KL 2BDNH 1MJJA 1K9TA 4MZ2A 5MI0C 5FYKE 4Y2DD 2OSLB 3D69A 3NCCB 5EOTA 1FSKB 2FO4B 1IC7L 2WUBH 1JIBA 3BI9X 1I1AA 3RIFF 2BVQA 1VEMA 2OI9B 2DYPB 4JY4A 1MFCH 4KQ3L 3MV11 1T2XA 3GJEA 3RUGE 1EAJA 4OZFA 5EWIL 4KKLC 3RWCA 5DD0H 2BOBB 1E4XL 4FQ2H 1W0WB 3QCVL 3QULB 2XY1A 4QYOB 3HTLX 3NFNB 5T3ZD 2QHRH 3F5WB 3HCVA 4JFEE 1U8MB 1J0KA 3ZO0A 3WHE1 5DT1H 5IW1A 5JLZA 4FP8H 4NKOB 4MNGB 3EJZC 4TNWK 2IADA 1JF1B 1QKZH 1HSBA 1ND0A 2C26A 4QTHA 4R7NB 1KACB 4U6YA 4WFFE 2ILLA 5GGSB 3MC0A 3DUHA 4PS4L 1UFUA 3RDTD 2FGWL 4PV9A 1REIA 1N0XL 1DANU 1LGVA 1DN0B 4L8CB 3O9WB 1XF4B 3HC3H 5T1MA 1S9VA 2Q7YA 2AK4B 2QR0A 4OSUL 4XNUL 1DSFH 5DURD 1NGQH 3SQOL 3B2VL 4RMWA 3BKCL 3TBVB 5E2VL 4NDMA 1WAAF 1JI1A 1NBVL 3RL2B 4NQDD 5L2JA 1YY9D 4HMCA 3P0VH 1W0VA 3B5GA 1CXEA 1ITBB 4N8PA 5C0JA 1OOAA 2P43B 4PGJA 1AGFA 5CUSL 3D87B 5BVPL 4J3UA 4BUHA 2DJ4A 5DHYA 4G6JH 2JK5A 4Z7VA 2R1YA 4H0GA 4LRIC 1R3IH 2R23A 5JW4M 1KB5H 3FQXB 3MV9E 1OGAD 5IT2H 3LN9A 1VKXA 3DMMD 2AKRA 5HHMD 4N9OB 4L29A 4EUPA 4GAYB 2J8UB 4YC2B 3QEUB 3ESUF 1DQMH 3CMOL 1W8NA 4TVPL 2IFGA 3IFNL 4PJHB 2DMCA 2AJVH 1U95B 4WI2A 4YHML 4X6FA 1HILB 2Z4QA 4OFKA 4JLRB 3QPXL 4LHUB 3QFDA 4X4YB 4I1NB 4XP9H 3GMRB 3G5VA 4PJXB 2Y5TB 1S5IH 3MRKB 4YBLB 5C07B 2Y23A 4TTDC 3MO1B 1A9BB 3BMWA 32C2A 4HIEA 3O11B 1Y6NR 3TZVB 4M62H 3L9RB 1DBJL 3I3BA 4GAGL 4Z7OE 1II4E 3QDMB 5E00B 3EFDH 1G6RA 2H26B 1SMOA 1TTFA 1CF8L 2HWZH 1IQDA 1UWGL 4WUUE 1FLRH 3VGAB 15C8L 1JHLH 1G0DA 3KPQB 2RJMA 1UB5B 5FUOL 4KVCH 3HG1A 2OBGA 1I7TA 4MMXC 5ILTL 4WTZG 4YDLC 4DGIH 1HHJB 4PRAB 3LN4A 2XKSA 3DV6B 2I9TA 2EEBA 2IPTH 3I6LE 4ORGB 3T2QA 2W60B 2CSPA 3KYMB 4PG2C 3QZWB 2OI9C 3Q3GB 5EO9B