1ITFA

Interferon alpha-2a, nmr, 24 structures
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional high resolution structure of human interferon alpha-2a determined by heteronuclear NMR spectroscopy in solution.
pubmed doi rcsb
molecule keywords INTERFERON ALPHA-2A
molecule tags Cytokine
source organism Homo sapiens
total genus 46
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 1997-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00143 Interferon Interferon alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1itfA00
2L3YA 3HHRA 5C7XA 3D85C 5D22A 2LAGA 1EERA 1HULA 4I77Z 3G6DA 1M49A 1CNT1 1CYLA 1Z92A 1HGUA 2KZ1A 1PW6A 2IL6A 1HWGA 1I1RB 3NCFA 3UF5A 3BPLA 1M4BA 1P9MB 1RHGA 1Y6NL 4X51A 4NKQC 1ITMA 1EVSA 1ITFA 2B91A 1HUWA 1LKIA 3UEZE 4ZF7A 3EJJA 1EKUA 1ETEA 5FHXA 3VA2A 1BP3A 1SCFA 5D70A 3QT2C 1BGEA 4ZS7A 4NI7A 4YQXA 2ERJD 3BESL 3LB6A 4YPGC 3SE4B 1KF9A 5E4EA 3B5KA 1RCBA 1HIKA 1HZIA 1N1FA 3D87A 3G9VB 3D48P 1CN4C 3UX9A 4FA8E 1HIJA 3S9DA 4MHLA 1VLKA 5D71A 1M4CA 2B8ZA 2B90A 3QB1A 3SE3B 1D9CA 1PGRA 1PY2A 1RW5A 5KNHI 1D9GA 3Q1SI 1Y6KL 3WCYI 1YKBA 3NPZA 4WRLB 1BGCA 3UF2A 1F45B 3DUHC 3NCCA 1RFBA 3DLQI 2B8YA 4NEJA 1AU1A 4PS4A 1CD9A 2B8UA 3N0PA 5D72A 1V7NV 1IRLA 1BGDA 2CYKA 1ALUA 1F6FA 4YDYI 3NCEA 1FG9A 2D48A 1IL6A 2ILKA 3N06A 4CNIC 3INKC 1M4AA 3NCBA 1A22A 1PVHB 1EXZA 4YUEC 1AX8A 1QVNA 5D28B 3PIWA 2B8XA 3OQ3A 1IK0A 5LQBA 1M48A 1JLIA 3BPOA 3PIVA 4Z5RD 1NBPA 2Q7NB 3L5WI 1IJZA 5FUCA 1IARA 1EMRA 1LK3A 2H24A 3QWRB 3EW3A 2E9WC 1GNCA 2INTA 2O26A 3QB7A 2D9QA 1GA3A 2Q98A 2L3OA 1ITLA 3BPNA 3HMXB 1HWHA 1Y6ML 4J4LC 1BCNA 3LB6B 4DOHA 1A7MA 2GMFA 4GRWA 2LMSA 2B5IA 4O6KA 4RS1A 1CSGA 1Z7CA 4NEMA 4O9HA 4NI9A 1FYHA 3MZGA 2O27A 1M4RA 1ILKA 3QAZA 1WU3I 1M47A 3DGCL 2HYMB 5L6YC 1BBNA 1J7VL 1ITIA 1V7MV 1BUYA 1B5LA 1AXIA 3L5XA 1LQSL 1INRA
chains in the Genus database with same CATH superfamily
4EXNA 2L3YA 5D22A 2LAGA 4EXPA 4BY1D 4A3FD 1CYLA 1HWGA 3UF5A 4ZF7A 3EJJA 1BP3A 4PYPA 4NN6A 5C65A 4LEPA 4A3JD 3BESL 4YBQA 1RCBA 5IP9D 1CN4C 5D71A 5GXBA 2B90A 3QB1A 1D9CA 1PGRA 4JREA 4A3DD 2Z3RA 4DKDA 3UF2A 3DLQI 3N0PA 5D72A 4OAAA 3I4MD 1ALUA 3NCEA 2D48A 1IL6A 4CNIC 3NCBA 3DI2A 1PVHB 1EXZA 5D28B 3DI3A 2C35A 2Q7NB 2XUTA 1LK3A 3QWRB 1PV6A 4BY7D 1GNCA 2INTA 2O26A 3H0GD 3HOVD 2JA6D 1GA3A 2Q98A 1HWHA 1Y6ML 2Z3QA 4ZW9A 5FLMD 4GBYA 4NI9A 1ILKA 1WU3I 4ZWBA 3DGCL 2HYMB 5L6YC 1J7VL 1AXIA 3HOXD 1LQSL 4PS4A 1INRA 4D2DA 1HULA 4I77Z 1M49A 4IKVA 2KZ1A 4GC0A 3NCFA 2V8NA 1Y1WD 4DKFA 1ITMA 2B91A 2VUMD 1LKIA 3UEZE 3HOWD 4IKXA 3I4ND 1EKUA 1ETEA 5D70A 4ZS7A 4NI7A 4LDSA 4YPGC 4DKCA 1HIKA 4A3LD 2JA7D 4FA8E 5C3ED 4DKEA 1HIJA 1M4CA 5KNHI 3Q1SI 3WCYI 1YKBA 4A3BD 3NPZA 4WRLB 3HOZD 1PW4A 1F45B 3DUHC 2B8YA 4NEJA 4GBZA 1V7NV 1IRLA 5IYCD 4YDYI 5D59A 1M4AA 1A22A 5D6KA 1NBPA 1IARA 4U4WA 1EMRA 2H24A 2E9WC 3BPNA 4UVMA 1ITLA 3HMXB 4DOHA 1A7MA 2Q14A 4GRWA 4IKZA 2LMSA 2B5IA 4O6KA 4RS1A 1CSGA 4NEMA 1FYHA 1M4RA 1ITIA 3PO3D 3HOUD 4A3KD 5C44D 3HHRA 5C7XA 4TPGA 4A3MD 3G6DA 1Z92A 1HGUA 3WDOA 2IL6A 1I1RB 3BPLA 4U4VA 1P9MB 1RHGA 1Y6NL 3TGXB 2R92D 1Y1VD 2R93D 1HUWA 4IKWA 4U4TA 5FHXA 4GS7A 3QT2C 5EQGA 1BGEA 5IYDD 4YQXA 3LB6A 3SE4B 1KF9A 5E4EA 3B5KA 3D87A 3G9VB 3D48P 5IP7D 1Y14A 4MHLA 1VLKA 2R7ZD 3HHCA 3SE3B 1PY2A 5A2NA 1RW5A 1D9GA 1Y6KL 4IU8A 4JA3A 1BGCA 4OH3A 3NCCA 1RFBA 4BBSD 3OG6A 2B8UA 2OQPA 4NN5A 4YB9D 1F6FA 3H3VE 2Y5YA 3O7PA 2ILKA 3N06A 4LRLA 1WCMD 4W6VA 4YUEC 4A3GD 1AX8A 1QVNA 4JR9A 2B8XA 3OQ3A 1IK0A 1M48A 1JLIA 3BPOA 3PIVA 3L5WI 4A3ED 2XQBA 4ZYRA 2O6IA 3QB7A 2D9QA 2L3OA 4XNIA 4J4LC 1BCNA 3LB6B 4TPHA 2GMFA 4O9HA 2O27A 5EQHA 3QAZA 1M47A 1BBNA 1B5LA 2CFPA 5D58A 2JA8D 4QIQA 3D85C 4Q65A 1EERA 1CNT1 1PW6A 1M4BA 4X51A 4NKQC 1EVSA 1ITFA 4ZWCA 5IYBD 4D2BA 1SCFA 3OG4A 3PO2D 2ERJD 3O7QA 4BXXD 1HZIA 1N1FA 1PV7A 5A2OA 3UX9A 3S9DA 2B8ZA 4A3ID 5TS9A 3IRHA 5C4XD 4XNJA 4A93D 1AU1A 1CD9A 5EQIA 1BGDA 2CYKA 1FG9A 2PSMA 4IU9A 3INKC 2B63D 4NN7A 4TPJA 3PIWA 5LQBA 4Z5RD 2CFQA 3HOYD 1IJZA 3EW3A 4APSA 4J05A 3AYHA 4D2CA 4BBRD 1Z7CA 4A3CD 3MZGA 2JA5D 1V7MV 4IKYA 3FKID 1BUYA 3L5XA 3VA2A 5FUCA
chains in the Genus database with same CATH topology
4A3KD 5C44D 4EXNA 2L3YA 3HHRA 5C7XA 3D85C 5D22A 4A3MD 2LAGA 4EXPA 1EERA 4BY1D 1HULA 4I77Z 4A3FD 3G6DA 1M49A 1CNT1 1CYLA 1Z92A 1HGUA 2KZ1A 1PW6A 2IL6A 1HWGA 1I1RB 3NCFA 3UF5A 3BPLA 1M4BA 1P9MB 1RHGA 1Y6NL 4X51A 3TGXB 1Y1VD 4NKQC 4DKFA 1Y1WD 1ITMA 1EVSA 2R92D 1ITFA 2B91A 2R93D 2VUMD 1HUWA 1LKIA 3UEZE 5IYBD 4ZF7A 3EJJA 3HOWD 3I4ND 1EKUA 1ETEA 5FHXA 3VA2A 1BP3A 1SCFA 5D70A 4GS7A 3QT2C 4NN6A 1BGEA 5IYDD 3OG4A 4ZS7A 4NI7A 4YQXA 4A3JD 3PO2D 2ERJD 3BESL 3LB6A 4YPGC 3SE4B 1KF9A 5E4EA 3B5KA 4DKCA 1RCBA 1HIKA 4BXXD 1HZIA 4A3LD 1N1FA 3D87A 3G9VB 3D48P 5IP9D 5IP7D 2JA7D 1CN4C 1Y14A 3UX9A 4FA8E 5C3ED 4DKEA 1HIJA 3S9DA 4MHLA 1VLKA 2R7ZD 5D71A 3HHCA 1M4CA 2B8ZA 2B90A 3QB1A 3SE3B 1D9CA 1PGRA 1PY2A 4A3ID 1RW5A 5KNHI 1D9GA 4A3DD 3Q1SI 5TS9A 2Z3RA 3IRHA 1Y6KL 3WCYI 4DKDA 1YKBA 5C4XD 4A3BD 3NPZA 4WRLB 3HOZD 1BGCA 3UF2A 1F45B 4A93D 3DUHC 3NCCA 1RFBA 3DLQI 2B8YA 4NEJA 1AU1A 4BBSD 3OG6A 1CD9A 4PS4A 2B8UA 2OQPA 3N0PA 5D72A 1V7NV 1IRLA 3I4MD 1BGDA 5IYCD 4NN5A 2CYKA 1ALUA 1F6FA 4YDYI 3H3VE 3NCEA 1FG9A 2PSMA 2D48A 1IL6A 2ILKA 3N06A 4CNIC 3INKC 1M4AA 3NCBA 3DI2A 4LRLA 4NN7A 2B63D 1WCMD 1A22A 1PVHB 1EXZA 4YUEC 4A3GD 1AX8A 1QVNA 5D28B 2JA8D 3PIWA 2B8XA 3OQ3A 1IK0A 5LQBA 3DI3A 1M48A 1JLIA 3BPOA 3PIVA 4Z5RD 1NBPA 3HOYD 2C35A 2Q7NB 3L5WI 1IJZA 5FUCA 1IARA 4A3ED 1EMRA 1LK3A 2H24A 2XQBA 3QWRB 3EW3A 2E9WC 4BY7D 2O6IA 1GNCA 2INTA 2O26A 3H0GD 3QB7A 2JA6D 2D9QA 3HOVD 2Q98A 2L3OA 1ITLA 3AYHA 3BPNA 3HMXB 1GA3A 1HWHA 1Y6ML 4J4LC 2Z3QA 1BCNA 3LB6B 4DOHA 1A7MA 2Q14A 4BBRD 5FLMD 2GMFA 4GRWA 2LMSA 2B5IA 4O6KA 4RS1A 1CSGA 1Z7CA 4NEMA 4O9HA 4NI9A 1FYHA 4A3CD 3MZGA 2O27A 1M4RA 1ILKA 3QAZA 1WU3I 1M47A 3DGCL 2HYMB 5L6YC 1BBNA 2JA5D 1J7VL 1ITIA 1V7MV 3FKID 1BUYA 1B5LA 1AXIA 3PO3D 3L5XA 3HOXD 1LQSL 3HOUD 1INRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3Y A;  3HHR A;  5C7X A;  3D85 C;  5D22 A;  2LAG A;  1EER A;  1HUL A;  4I77 Z;  3G6D A;  1M49 A;  1CNT 1;  1CYL A;  1Z92 A;  1HGU A;  2KZ1 A;  1PW6 A;  2IL6 A;  1HWG A;  1I1R B;  3NCF A;  3UF5 A;  3BPL A;  1M4B A;  1P9M B;  1RHG A;  1Y6N L;  4X51 A;  4NKQ C;  1ITM A;  1EVS A;  1ITF A;  2B91 A;  1HUW A;  1LKI A;  3UEZ E;  4ZF7 A;  3EJJ A;  1EKU A;  1ETE A;  5FHX A;  3VA2 A;  1BP3 A;  1SCF A;  5D70 A;  3QT2 C;  1BGE A;  4ZS7 A;  4NI7 A;  4YQX A;  2ERJ D;  3BES L;  3LB6 A;  4YPG C;  3SE4 B;  1KF9 A;  5E4E A;  3B5K A;  1RCB A;  1HIK A;  1HZI A;  1N1F A;  3D87 A;  3G9V B;  3D48 P;  1CN4 C;  3UX9 A;  4FA8 E;  1HIJ A;  3S9D A;  4MHL A;  1VLK A;  5D71 A;  1M4C A;  2B8Z A;  2B90 A;  3QB1 A;  3SE3 B;  1D9C A;  1PGR A;  1PY2 A;  1RW5 A;  5KNH I;  1D9G A;  3Q1S I;  1Y6K L;  3WCY I;  1YKB A;  3NPZ A;  4WRL B;  1BGC A;  3UF2 A;  1F45 B;  3DUH C;  3NCC A;  1RFB A;  3DLQ I;  2B8Y A;  4NEJ A;  1AU1 A;  4PS4 A;  1CD9 A;  2B8U A;  3N0P A;  5D72 A;  1V7N V;  1IRL A;  1BGD A;  2CYK A;  1ALU A;  1F6F A;  4YDY I;  3NCE A;  1FG9 A;  2D48 A;  1IL6 A;  2ILK A;  3N06 A;  4CNI C;  3INK C;  1M4A A;  3NCB A;  1A22 A;  1PVH B;  1EXZ A;  4YUE C;  1AX8 A;  1QVN A;  5D28 B;  3PIW A;  2B8X A;  3OQ3 A;  1IK0 A;  5LQB A;  1M48 A;  1JLI A;  3BPO A;  3PIV A;  4Z5R D;  1NBP A;  2Q7N B;  3L5W I;  1IJZ A;  5FUC A;  1IAR A;  1EMR A;  1LK3 A;  2H24 A;  3QWR B;  3EW3 A;  2E9W C;  1GNC A;  2INT A;  2O26 A;  3QB7 A;  2D9Q A;  1GA3 A;  2Q98 A;  2L3O A;  1ITL A;  3BPN A;  3HMX B;  1HWH A;  1Y6M L;  4J4L C;  1BCN A;  3LB6 B;  4DOH A;  1A7M A;  2GMF A;  4GRW A;  2LMS A;  2B5I A;  4O6K A;  4RS1 A;  1CSG A;  1Z7C A;  4NEM A;  4O9H A;  4NI9 A;  1FYH A;  3MZG A;  2O27 A;  1M4R A;  1ILK A;  3QAZ A;  1WU3 I;  1M47 A;  3DGC L;  2HYM B;  5L6Y C;  1BBN A;  1J7V L;  1ITI A;  1V7M V;  1BUY A;  1B5L A;  1AXI A;  3L5X A;  1LQS L;  1INR A; 
#chains in the Genus database with same CATH topology
 4EXN A;  2L3Y A;  5D22 A;  2LAG A;  4EXP A;  4BY1 D;  4A3F D;  1CYL A;  1HWG A;  3UF5 A;  4ZF7 A;  3EJJ A;  1BP3 A;  4PYP A;  4NN6 A;  5C65 A;  4LEP A;  4A3J D;  3BES L;  4YBQ A;  1RCB A;  5IP9 D;  1CN4 C;  5D71 A;  5GXB A;  2B90 A;  3QB1 A;  1D9C A;  1PGR A;  4JRE A;  4A3D D;  2Z3R A;  4DKD A;  3UF2 A;  3DLQ I;  3N0P A;  5D72 A;  4OAA A;  3I4M D;  1ALU A;  3NCE A;  2D48 A;  1IL6 A;  4CNI C;  3NCB A;  3DI2 A;  1PVH B;  1EXZ A;  5D28 B;  3DI3 A;  2C35 A;  2Q7N B;  2XUT A;  1LK3 A;  3QWR B;  1PV6 A;  4BY7 D;  1GNC A;  2INT A;  2O26 A;  3H0G D;  3HOV D;  2JA6 D;  1GA3 A;  2Q98 A;  1HWH A;  1Y6M L;  2Z3Q A;  4ZW9 A;  5FLM D;  4GBY A;  4NI9 A;  1ILK A;  1WU3 I;  4ZWB A;  3DGC L;  2HYM B;  5L6Y C;  1J7V L;  1AXI A;  3HOX D;  1LQS L;  4PS4 A;  1INR A;  4D2D A;  1HUL A;  4I77 Z;  1M49 A;  4IKV A;  2KZ1 A;  4GC0 A;  3NCF A;  2V8N A;  1Y1W D;  4DKF A;  1ITM A;  2B91 A;  2VUM D;  1LKI A;  3UEZ E;  3HOW D;  4IKX A;  3I4N D;  1EKU A;  1ETE A;  5D70 A;  4ZS7 A;  4NI7 A;  4LDS A;  4YPG C;  4DKC A;  1HIK A;  4A3L D;  2JA7 D;  4FA8 E;  5C3E D;  4DKE A;  1HIJ A;  1M4C A;  5KNH I;  3Q1S I;  3WCY I;  1YKB A;  4A3B D;  3NPZ A;  4WRL B;  3HOZ D;  1PW4 A;  1F45 B;  3DUH C;  2B8Y A;  4NEJ A;  4GBZ A;  1V7N V;  1IRL A;  5IYC D;  4YDY I;  5D59 A;  1M4A A;  1A22 A;  5D6K A;  1NBP A;  1IAR A;  4U4W A;  1EMR A;  2H24 A;  2E9W C;  3BPN A;  4UVM A;  1ITL A;  3HMX B;  4DOH A;  1A7M A;  2Q14 A;  4GRW A;  4IKZ A;  2LMS A;  2B5I A;  4O6K A;  4RS1 A;  1CSG A;  4NEM A;  1FYH A;  1M4R A;  1ITI A;  3PO3 D;  3HOU D;  4A3K D;  5C44 D;  3HHR A;  5C7X A;  4TPG A;  4A3M D;  3G6D A;  1Z92 A;  1HGU A;  3WDO A;  2IL6 A;  1I1R B;  3BPL A;  4U4V A;  1P9M B;  1RHG A;  1Y6N L;  3TGX B;  2R92 D;  1Y1V D;  2R93 D;  1HUW A;  4IKW A;  4U4T A;  5FHX A;  4GS7 A;  3QT2 C;  5EQG A;  1BGE A;  5IYD D;  4YQX A;  3LB6 A;  3SE4 B;  1KF9 A;  5E4E A;  3B5K A;  3D87 A;  3G9V B;  3D48 P;  5IP7 D;  1Y14 A;  4MHL A;  1VLK A;  2R7Z D;  3HHC A;  3SE3 B;  1PY2 A;  5A2N A;  1RW5 A;  1D9G A;  1Y6K L;  4IU8 A;  4JA3 A;  1BGC A;  4OH3 A;  3NCC A;  1RFB A;  4BBS D;  3OG6 A;  2B8U A;  2OQP A;  4NN5 A;  4YB9 D;  1F6F A;  3H3V E;  2Y5Y A;  3O7P A;  2ILK A;  3N06 A;  4LRL A;  1WCM D;  4W6V A;  4YUE C;  4A3G D;  1AX8 A;  1QVN A;  4JR9 A;  2B8X A;  3OQ3 A;  1IK0 A;  1M48 A;  1JLI A;  3BPO A;  3PIV A;  3L5W I;  4A3E D;  2XQB A;  4ZYR A;  2O6I A;  3QB7 A;  2D9Q A;  2L3O A;  4XNI A;  4J4L C;  1BCN A;  3LB6 B;  4TPH A;  2GMF A;  4O9H A;  2O27 A;  5EQH A;  3QAZ A;  1M47 A;  1BBN A;  1B5L A;  2CFP A;  5D58 A;  2JA8 D;  4QIQ A;  3D85 C;  4Q65 A;  1EER A;  1CNT 1;  1PW6 A;  1M4B A;  4X51 A;  4NKQ C;  1EVS A;  1ITF A;  4ZWC A;  5IYB D;  4D2B A;  1SCF A;  3OG4 A;  3PO2 D;  2ERJ D;  3O7Q A;  4BXX D;  1HZI A;  1N1F A;  1PV7 A;  5A2O A;  3UX9 A;  3S9D A;  2B8Z A;  4A3I D;  5TS9 A;  3IRH A;  5C4X D;  4XNJ A;  4A93 D;  1AU1 A;  1CD9 A;  5EQI A;  1BGD A;  2CYK A;  1FG9 A;  2PSM A;  4IU9 A;  3INK C;  2B63 D;  4NN7 A;  4TPJ A;  3PIW A;  5LQB A;  4Z5R D;  2CFQ A;  3HOY D;  1IJZ A;  3EW3 A;  4APS A;  4J05 A;  3AYH A;  4D2C A;  4BBR D;  1Z7C A;  4A3C D;  3MZG A;  2JA5 D;  1V7M V;  4IKY A;  3FKI D;  1BUY A;  3L5X A;  3VA2 A;  5FUC A; 
#chains in the Genus database with same CATH homology
 4A3K D;  5C44 D;  4EXN A;  2L3Y A;  3HHR A;  5C7X A;  3D85 C;  5D22 A;  4A3M D;  2LAG A;  4EXP A;  1EER A;  4BY1 D;  1HUL A;  4I77 Z;  4A3F D;  3G6D A;  1M49 A;  1CNT 1;  1CYL A;  1Z92 A;  1HGU A;  2KZ1 A;  1PW6 A;  2IL6 A;  1HWG A;  1I1R B;  3NCF A;  3UF5 A;  3BPL A;  1M4B A;  1P9M B;  1RHG A;  1Y6N L;  4X51 A;  3TGX B;  1Y1V D;  4NKQ C;  4DKF A;  1Y1W D;  1ITM A;  1EVS A;  2R92 D;  1ITF A;  2B91 A;  2R93 D;  2VUM D;  1HUW A;  1LKI A;  3UEZ E;  5IYB D;  4ZF7 A;  3EJJ A;  3HOW D;  3I4N D;  1EKU A;  1ETE A;  5FHX A;  3VA2 A;  1BP3 A;  1SCF A;  5D70 A;  4GS7 A;  3QT2 C;  4NN6 A;  1BGE A;  5IYD D;  3OG4 A;  4ZS7 A;  4NI7 A;  4YQX A;  4A3J D;  3PO2 D;  2ERJ D;  3BES L;  3LB6 A;  4YPG C;  3SE4 B;  1KF9 A;  5E4E A;  3B5K A;  4DKC A;  1RCB A;  1HIK A;  4BXX D;  1HZI A;  4A3L D;  1N1F A;  3D87 A;  3G9V B;  3D48 P;  5IP9 D;  5IP7 D;  2JA7 D;  1CN4 C;  1Y14 A;  3UX9 A;  4FA8 E;  5C3E D;  4DKE A;  1HIJ A;  3S9D A;  4MHL A;  1VLK A;  2R7Z D;  5D71 A;  3HHC A;  1M4C A;  2B8Z A;  2B90 A;  3QB1 A;  3SE3 B;  1D9C A;  1PGR A;  1PY2 A;  4A3I D;  1RW5 A;  5KNH I;  1D9G A;  4A3D D;  3Q1S I;  5TS9 A;  2Z3R A;  3IRH A;  1Y6K L;  3WCY I;  4DKD A;  1YKB A;  5C4X D;  4A3B D;  3NPZ A;  4WRL B;  3HOZ D;  1BGC A;  3UF2 A;  1F45 B;  4A93 D;  3DUH C;  3NCC A;  1RFB A;  3DLQ I;  2B8Y A;  4NEJ A;  1AU1 A;  4BBS D;  3OG6 A;  1CD9 A;  4PS4 A;  2B8U A;  2OQP A;  3N0P A;  5D72 A;  1V7N V;  1IRL A;  3I4M D;  1BGD A;  5IYC D;  4NN5 A;  2CYK A;  1ALU A;  1F6F A;  4YDY I;  3H3V E;  3NCE A;  1FG9 A;  2PSM A;  2D48 A;  1IL6 A;  2ILK A;  3N06 A;  4CNI C;  3INK C;  1M4A A;  3NCB A;  3DI2 A;  4LRL A;  4NN7 A;  2B63 D;  1WCM D;  1A22 A;  1PVH B;  1EXZ A;  4YUE C;  4A3G D;  1AX8 A;  1QVN A;  5D28 B;  2JA8 D;  3PIW A;  2B8X A;  3OQ3 A;  1IK0 A;  5LQB A;  3DI3 A;  1M48 A;  1JLI A;  3BPO A;  3PIV A;  4Z5R D;  1NBP A;  3HOY D;  2C35 A;  2Q7N B;  3L5W I;  1IJZ A;  5FUC A;  1IAR A;  4A3E D;  1EMR A;  1LK3 A;  2H24 A;  2XQB A;  3QWR B;  3EW3 A;  2E9W C;  4BY7 D;  2O6I A;  1GNC A;  2INT A;  2O26 A;  3H0G D;  3QB7 A;  2JA6 D;  2D9Q A;  3HOV D;  2Q98 A;  2L3O A;  1ITL A;  3AYH A;  3BPN A;  3HMX B;  1GA3 A;  1HWH A;  1Y6M L;  4J4L C;  2Z3Q A;  1BCN A;  3LB6 B;  4DOH A;  1A7M A;  2Q14 A;  4BBR D;  5FLM D;  2GMF A;  4GRW A;  2LMS A;  2B5I A;  4O6K A;  4RS1 A;  1CSG A;  1Z7C A;  4NEM A;  4O9H A;  4NI9 A;  1FYH A;  4A3C D;  3MZG A;  2O27 A;  1M4R A;  1ILK A;  3QAZ A;  1WU3 I;  1M47 A;  3DGC L;  2HYM B;  5L6Y C;  1BBN A;  2JA5 D;  1J7V L;  1ITI A;  1V7M V;  3FKI D;  1BUY A;  1B5L A;  1AXI A;  3PO3 D;  3L5X A;  3HOX D;  1LQS L;  3HOU D;  1INR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...