1IU5A

X-ray crystal structure of the rubredoxin mutant from pyrococcus furiosus
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
51
structure length
51
Chain Sequence
b'AKYVCKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEFEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rubredoxin
publication title A neutron crystallographic analysis of a rubredoxin mutant at 1.6 A resolution.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 9
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2002-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1iu5A00
1B2JA 4K9FA 2VL6A 1R0FA 1E8JA 1B13A 1R0IA 2LCQA 7RXNA 3A44A 1YK4A 1RYTA 1IRNA 3KYWA 2DSXA 3KYYA 1BRFA 1S24A 1FHHA 4AR3A 4AR6A 4POFA 2V3BB 1FHMA 3KYXA 1YUXA 2PVXA 3QVDA 1R0HA 1R0JA 1DVBA 4AR5A 1BQ8A 1YV1A 1LKMA 1BE7A 4TPUA 4YWMA 1BFYA 4YWLA 1H7VA 1LTLA 2RDVA 1R0GA 3KYUA 5AI2A 1IU6A 1T9OA 5IY0A 1LKOA 2PYAA 1CADA 3RZTA 1B71A 1LKPA 1SMMA 2MS3A 2KKDA 3PWFA 1B2OA 1IROA 3SS2A 3PZAA 1CAAA 1YK5A 2PVEA 1DX8A 1RDVA 1QCVA 2HR5A 3MPSA 2K2DA 1JYBA 6RXNA 1VCXA 8RXNA 1C09A 1SMUA 4ME3A 1IU5A 1RDGA 1T9PA 1SMWA 5AI3A 1RWDA 2QL0A 1RB9A 1T9QA 1QYBA 3KYVA 5RXNA 2KN9A 1BQ9A 1ZRPA 1YUZA 3RYGA 1S30A 3RZ6A 4POGA 1S2ZA 2M4YA 1NNQA 2GMGA 4AR4A 4RXNA
chains in the Genus database with same CATH superfamily
1B2JA 1R0FA 1E8JA 3S17L 5AN9H 7RXNA 1I3QL 3A44A 1TWFL 3JR7A 2JA7L 2CR8A 3KYYA 2M6OA 1BRFA 3M4OL 3HOVL 2XJUA 3KYXA 4BXXL 4A3IL 5GAHc 5IYBL 2PVXA 2PMZP 4ZN1B 1BE7A 3H97A 3B08B 3S15L 4BY1L 3KYUA 5AI2A 1Z92B 1T9OA 4LHNA 2R92L 2YU9L 3PO3L 2JI2A 2WAQP 3FDJA 2O5JD 1IROA 3PZAA 1CAAA 3K35A 4JADA 4C2M1 4Y52L 1YK5A 4GS7D 3HOUL 3LWRB 3M3YL 5C3EL 4AYBP 2HR5A 2XJQA 4A3DL 2K2DA 1JYBA 2JA5L 3H3VM 3GTGL 2PSMC 4BY7L 4UY81 2A6ED 3RZDL 1RB9A 1T9QA 2L0ZA 4XXBB 1P7PA 3KYVA 5RXNA 4AI0A 3RZOL 2XJRA 1YUZA 3RYGA 5M5XL 4POGA 2JA6L 4WFN1 3S1QL 1RYQA 2GMGA 3PIP1 1B13A 4A3GL 3I4NL 2CKAA 2LCQA 1YK4A 1RYTA 3LWOB 2NVQL 2V0FA 4Y7NL 3S14L 5EIOC 4E6YA 1FHMA 1NXEA 3FKIL 4A3BL 3GTJL 3QVDA 1R0JA 1IW7D 3B0AB 1I6HL 1YV1A 2J9UB 3H9CA 2AYJA 3IU3I 3GTLL 3GTPL 2Z3QB 1IU6A 3LWPB 2JI1A 5JVG1 5JVH1 2JA8L 1B71A 3HOYL 4A3CL 2MS3A 2KKDA 3PL5A 3PO2L 3J7Z1 2PVEA 3MSUA 1PZXA 2NVYL 4A3FL 3QQCE 4C3JL 1TWGL 2PPTA 2XJSA 2R7ZL 4AI1A 1QCVA 3S2DL 3LPEB 5MGNA 3WWNB 5DM71 5GAGc 5MFPA 4AHYA 5C4JL 4ME3A 1RDGA 3H9BA 3WWLA 3LWVB 2XJTA 2RFKB 2QL0A 3CQZL 1QYBA 5M3ML 3LWQB 5M5WL 3HOZL 2KN9A 3NFPI 1ZRPA 1S30A 1Y1VL 1PFWA 1NNQA 3K7AL 2E2JL 4AR4A 4U671 5M3FL 2H12A 4K9FA 2VL6A 1TWHL 1R0IA 1PFYA 3KYWA 5FJ8L 2DSXA 4C3IL 4A3KL 1S24A 1FHHA 3LNLA 4A3ML 3S16L 2V3BB 1YUXA 2BE5D 3P8BA 4ZN3B 3MQKB 2EY4E 2AUSB 1DVBA 4AR5A 5IP7L 5M5YL 3HJWB 1LKMA 4JAGA 4TPUA 4YWMA 5C44L 1R9TL 2CKCA 2RDVA 1R0GA 1OWCA 1QQTA 2VUML 5IY0A 2PYAA 4AI3A 3RZTA 1LKPA 1SMMA 3VPBE 2A68D 3PWFA 2AQCA 1B2OA 2V0EA 2B63L 1DX8A 2ERJA 1F4LA 1RDVA 2NVTL 2R93L 3MPSA 2A69D 4V196 3ZG6A 2ZIXA 1VCXA 8RXNA 1C09A 3GTKL 1SMUA 4AHZA 1WCML 2E2HL 2B5ID 3HJYB 1OWBA 1T9PA 3H0GL 1RWDA 4JAFA 4JAEA 4G6BA 2C6AA 1BQ9A 1NXGA 3RZ6A 5IP9L 1S2ZA 4LHLA 5H1Sc 1TWCL 4TVMA 5EINC 2M4YA 4B8CD 2WB1P 5GAEc 2XJVA 2M6PA 2NVXL 1VZHA 5FLML 3P2AA 1IRNA 5MFZA 3GTOL 2HVYC 1PFUA 4BBRL 2ERSA 5MF6A 5C4XL 4AR3A 1SFOL 4AR6A 3HOXL 3GTML 4POFA 4AI2A 3HOWL 3PIO1 1R0HA 1BQ8A 1VZGA 5IYDL 1BFYA 4YWLA 3S2HL 1H7VA 1LTLA 1WJVA 5K2ME 3H99A 2NYDA 1LKOA 1CADA 2APOB 5DM61 3J7Y1 4A93L 4AHXA 3SS2A 1K83L 2XJPA 5IYCL 4A3JL 3S1NL 3PKJA 2E2IL 3S1ML 3I4ML 6RXNA 3S1RL 1Y1WL 2C6BA 5GADc 2JI3A 4A3LL 1VZIA 4BBSL 1IU5A 1I50L 4XGHA 1SMWA 4QIWP 5AI3A 5MLC3 3PKIA 2Z3RB 4C3HL 3GTQL 1ODHA 2M4VA 4AHWA 2Y0SP 4X6AL 4A3EL 3HKZP 2A6HD 1PFVA 3HAXC 4RXNA 1TWAL
chains in the Genus database with same CATH topology
3PIP1 1B2JA 2H12A 4K9FA 2VL6A 1R0FA 1E8JA 1B13A 1R0IA 2CKAA 2LCQA 5AN9H 7RXNA 3A44A 3P2AA 1YK4A 1RYTA 1IRNA 5MFZA 3KYWA 2DSXA 2CR8A 2V0FA 3KYYA 2ERSA 2M6OA 1BRFA 1S24A 5EIOC 5MF6A 1FHHA 4AR3A 3LNLA 2XJUA 4AR6A 4POFA 4E6YA 2V3BB 1FHMA 3KYXA 1NXEA 1YUXA 2BE5D 3P8BA 5GAHc 4AI2A 4ZN3B 2PVXA 3PIO1 3QVDA 1R0HA 1R0JA 1DVBA 1IW7D 4AR5A 3B0AB 4ZN1B 1BQ8A 1YV1A 1LKMA 1BE7A 2J9UB 4JAGA 4TPUA 4YWMA 2AYJA 1VZGA 3IU3I 2CKCA 1BFYA 3B08B 4YWLA 1H7VA 1LTLA 2RDVA 1WJVA 1R0GA 3KYUA 5AI2A 5K2ME 1OWCA 2Z3QB 1IU6A 1Z92B 1T9OA 2NYDA 2JI1A 4LHNA 5IY0A 5JVG1 1LKOA 2PYAA 1CADA 5DM61 3J7Y1 4AI3A 2JI2A 3RZTA 5JVH1 1B71A 1LKPA 1SMMA 3VPBE 2O5JD 4AHXA 2A68D 2MS3A 2KKDA 3PWFA 1B2OA 1IROA 3SS2A 3PZAA 1CAAA 3K35A 4JADA 2XJPA 3J7Z1 1YK5A 2PVEA 3MSUA 2V0EA 4GS7D 1DX8A 3QQCE 2ERJA 2PPTA 2XJSA 1RDVA 4AI1A 1QCVA 2HR5A 3PKJA 3MPSA 2XJQA 2A69D 2K2DA 1JYBA 4V196 3LPEB 3ZG6A 2ZIXA 5MGNA 6RXNA 1VCXA 3WWNB 8RXNA 5MFPA 1C09A 5DM71 5GAGc 2PSMC 4AHYA 2C6BA 5GADc 1SMUA 2JI3A 4AHZA 4UY81 1VZIA 2B5ID 4ME3A 1IU5A 2A6ED 1OWBA 1T9PA 1RDGA 3WWLA 4XGHA 1SMWA 2XJTA 5AI3A 5MLC3 3PKIA 1RWDA 2QL0A 2Z3RB 4JAFA 1RB9A 1T9QA 2L0ZA 1QYBA 1ODHA 2M4VA 4XXBB 3KYVA 4JAEA 4G6BA 5RXNA 2C6AA 4AHWA 2KN9A 4AI0A 3NFPI 1BQ9A 1ZRPA 2XJRA 1NXGA 1YUZA 3RYGA 1S30A 3RZ6A 4POGA 1S2ZA 4LHLA 5H1Sc 2A6HD 4TVMA 4WFN1 5EINC 2M4YA 4B8CD 1NNQA 1RYQA 2GMGA 4AR4A 5GAEc 4RXNA 4U671 2XJVA 2M6PA 1VZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2J A;  4K9F A;  2VL6 A;  1R0F A;  1E8J A;  1B13 A;  1R0I A;  2LCQ A;  7RXN A;  3A44 A;  1YK4 A;  1RYT A;  1IRN A;  3KYW A;  2DSX A;  3KYY A;  1BRF A;  1S24 A;  1FHH A;  4AR3 A;  4AR6 A;  4POF A;  2V3B B;  1FHM A;  3KYX A;  1YUX A;  2PVX A;  3QVD A;  1R0H A;  1R0J A;  1DVB A;  4AR5 A;  1BQ8 A;  1YV1 A;  1LKM A;  1BE7 A;  4TPU A;  4YWM A;  1BFY A;  4YWL A;  1H7V A;  1LTL A;  2RDV A;  1R0G A;  3KYU A;  5AI2 A;  1IU6 A;  1T9O A;  5IY0 A;  1LKO A;  2PYA A;  1CAD A;  3RZT A;  1B71 A;  1LKP A;  1SMM A;  2MS3 A;  2KKD A;  3PWF A;  1B2O A;  1IRO A;  3SS2 A;  3PZA A;  1CAA A;  1YK5 A;  2PVE A;  1DX8 A;  1RDV A;  1QCV A;  2HR5 A;  3MPS A;  2K2D A;  1JYB A;  6RXN A;  1VCX A;  8RXN A;  1C09 A;  1SMU A;  4ME3 A;  1IU5 A;  1RDG A;  1T9P A;  1SMW A;  5AI3 A;  1RWD A;  2QL0 A;  1RB9 A;  1T9Q A;  1QYB A;  3KYV A;  5RXN A;  2KN9 A;  1BQ9 A;  1ZRP A;  1YUZ A;  3RYG A;  1S30 A;  3RZ6 A;  4POG A;  1S2Z A;  2M4Y A;  1NNQ A;  2GMG A;  4AR4 A;  4RXN A; 
#chains in the Genus database with same CATH topology
 1B2J A;  1R0F A;  1E8J A;  3S17 L;  5AN9 H;  7RXN A;  1I3Q L;  3A44 A;  1TWF L;  3JR7 A;  2JA7 L;  2CR8 A;  3KYY A;  2M6O A;  1BRF A;  3M4O L;  3HOV L;  2XJU A;  3KYX A;  4BXX L;  4A3I L;  5GAH c;  5IYB L;  2PVX A;  2PMZ P;  4ZN1 B;  1BE7 A;  3H97 A;  3B08 B;  3S15 L;  4BY1 L;  3KYU A;  5AI2 A;  1Z92 B;  1T9O A;  4LHN A;  2R92 L;  2YU9 L;  3PO3 L;  2JI2 A;  2WAQ P;  3FDJ A;  2O5J D;  1IRO A;  3PZA A;  1CAA A;  3K35 A;  4JAD A;  4C2M 1;  4Y52 L;  1YK5 A;  4GS7 D;  3HOU L;  3LWR B;  3M3Y L;  5C3E L;  4AYB P;  2HR5 A;  2XJQ A;  4A3D L;  2K2D A;  1JYB A;  2JA5 L;  3H3V M;  3GTG L;  2PSM C;  4BY7 L;  4UY8 1;  2A6E D;  3RZD L;  1RB9 A;  1T9Q A;  2L0Z A;  4XXB B;  1P7P A;  3KYV A;  5RXN A;  4AI0 A;  3RZO L;  2XJR A;  1YUZ A;  3RYG A;  5M5X L;  4POG A;  2JA6 L;  4WFN 1;  3S1Q L;  1RYQ A;  2GMG A;  3PIP 1;  1B13 A;  4A3G L;  3I4N L;  2CKA A;  2LCQ A;  1YK4 A;  1RYT A;  3LWO B;  2NVQ L;  2V0F A;  4Y7N L;  3S14 L;  5EIO C;  4E6Y A;  1FHM A;  1NXE A;  3FKI L;  4A3B L;  3GTJ L;  3QVD A;  1R0J A;  1IW7 D;  3B0A B;  1I6H L;  1YV1 A;  2J9U B;  3H9C A;  2AYJ A;  3IU3 I;  3GTL L;  3GTP L;  2Z3Q B;  1IU6 A;  3LWP B;  2JI1 A;  5JVG 1;  5JVH 1;  2JA8 L;  1B71 A;  3HOY L;  4A3C L;  2MS3 A;  2KKD A;  3PL5 A;  3PO2 L;  3J7Z 1;  2PVE A;  3MSU A;  1PZX A;  2NVY L;  4A3F L;  3QQC E;  4C3J L;  1TWG L;  2PPT A;  2XJS A;  2R7Z L;  4AI1 A;  1QCV A;  3S2D L;  3LPE B;  5MGN A;  3WWN B;  5DM7 1;  5GAG c;  5MFP A;  4AHY A;  5C4J L;  4ME3 A;  1RDG A;  3H9B A;  3WWL A;  3LWV B;  2XJT A;  2RFK B;  2QL0 A;  3CQZ L;  1QYB A;  5M3M L;  3LWQ B;  5M5W L;  3HOZ L;  2KN9 A;  3NFP I;  1ZRP A;  1S30 A;  1Y1V L;  1PFW A;  1NNQ A;  3K7A L;  2E2J L;  4AR4 A;  4U67 1;  5M3F L;  2H12 A;  4K9F A;  2VL6 A;  1TWH L;  1R0I A;  1PFY A;  3KYW A;  5FJ8 L;  2DSX A;  4C3I L;  4A3K L;  1S24 A;  1FHH A;  3LNL A;  4A3M L;  3S16 L;  2V3B B;  1YUX A;  2BE5 D;  3P8B A;  4ZN3 B;  3MQK B;  2EY4 E;  2AUS B;  1DVB A;  4AR5 A;  5IP7 L;  5M5Y L;  3HJW B;  1LKM A;  4JAG A;  4TPU A;  4YWM A;  5C44 L;  1R9T L;  2CKC A;  2RDV A;  1R0G A;  1OWC A;  1QQT A;  2VUM L;  5IY0 A;  2PYA A;  4AI3 A;  3RZT A;  1LKP A;  1SMM A;  3VPB E;  2A68 D;  3PWF A;  2AQC A;  1B2O A;  2V0E A;  2B63 L;  1DX8 A;  2ERJ A;  1F4L A;  1RDV A;  2NVT L;  2R93 L;  3MPS A;  2A69 D;  4V19 6;  3ZG6 A;  2ZIX A;  1VCX A;  8RXN A;  1C09 A;  3GTK L;  1SMU A;  4AHZ A;  1WCM L;  2E2H L;  2B5I D;  3HJY B;  1OWB A;  1T9P A;  3H0G L;  1RWD A;  4JAF A;  4JAE A;  4G6B A;  2C6A A;  1BQ9 A;  1NXG A;  3RZ6 A;  5IP9 L;  1S2Z A;  4LHL A;  5H1S c;  1TWC L;  4TVM A;  5EIN C;  2M4Y A;  4B8C D;  2WB1 P;  5GAE c;  2XJV A;  2M6P A;  2NVX L;  1VZH A;  5FLM L;  3P2A A;  1IRN A;  5MFZ A;  3GTO L;  2HVY C;  1PFU A;  4BBR L;  2ERS A;  5MF6 A;  5C4X L;  4AR3 A;  1SFO L;  4AR6 A;  3HOX L;  3GTM L;  4POF A;  4AI2 A;  3HOW L;  3PIO 1;  1R0H A;  1BQ8 A;  1VZG A;  5IYD L;  1BFY A;  4YWL A;  3S2H L;  1H7V A;  1LTL A;  1WJV A;  5K2M E;  3H99 A;  2NYD A;  1LKO A;  1CAD A;  2APO B;  5DM6 1;  3J7Y 1;  4A93 L;  4AHX A;  3SS2 A;  1K83 L;  2XJP A;  5IYC L;  4A3J L;  3S1N L;  3PKJ A;  2E2I L;  3S1M L;  3I4M L;  6RXN A;  3S1R L;  1Y1W L;  2C6B A;  5GAD c;  2JI3 A;  4A3L L;  1VZI A;  4BBS L;  1IU5 A;  1I50 L;  4XGH A;  1SMW A;  4QIW P;  5AI3 A;  5MLC 3;  3PKI A;  2Z3R B;  4C3H L;  3GTQ L;  1ODH A;  2M4V A;  4AHW A;  2Y0S P;  4X6A L;  4A3E L;  3HKZ P;  2A6H D;  1PFV A;  3HAX C;  4RXN A;  1TWA L; 
#chains in the Genus database with same CATH homology
 3PIP 1;  1B2J A;  2H12 A;  4K9F A;  2VL6 A;  1R0F A;  1E8J A;  1B13 A;  1R0I A;  2CKA A;  2LCQ A;  5AN9 H;  7RXN A;  3A44 A;  3P2A A;  1YK4 A;  1RYT A;  1IRN A;  5MFZ A;  3KYW A;  2DSX A;  2CR8 A;  2V0F A;  3KYY A;  2ERS A;  2M6O A;  1BRF A;  1S24 A;  5EIO C;  5MF6 A;  1FHH A;  4AR3 A;  3LNL A;  2XJU A;  4AR6 A;  4POF A;  4E6Y A;  2V3B B;  1FHM A;  3KYX A;  1NXE A;  1YUX A;  2BE5 D;  3P8B A;  5GAH c;  4AI2 A;  4ZN3 B;  2PVX A;  3PIO 1;  3QVD A;  1R0H A;  1R0J A;  1DVB A;  1IW7 D;  4AR5 A;  3B0A B;  4ZN1 B;  1BQ8 A;  1YV1 A;  1LKM A;  1BE7 A;  2J9U B;  4JAG A;  4TPU A;  4YWM A;  2AYJ A;  1VZG A;  3IU3 I;  2CKC A;  1BFY A;  3B08 B;  4YWL A;  1H7V A;  1LTL A;  2RDV A;  1WJV A;  1R0G A;  3KYU A;  5AI2 A;  5K2M E;  1OWC A;  2Z3Q B;  1IU6 A;  1Z92 B;  1T9O A;  2NYD A;  2JI1 A;  4LHN A;  5IY0 A;  5JVG 1;  1LKO A;  2PYA A;  1CAD A;  5DM6 1;  3J7Y 1;  4AI3 A;  2JI2 A;  3RZT A;  5JVH 1;  1B71 A;  1LKP A;  1SMM A;  3VPB E;  2O5J D;  4AHX A;  2A68 D;  2MS3 A;  2KKD A;  3PWF A;  1B2O A;  1IRO A;  3SS2 A;  3PZA A;  1CAA A;  3K35 A;  4JAD A;  2XJP A;  3J7Z 1;  1YK5 A;  2PVE A;  3MSU A;  2V0E A;  4GS7 D;  1DX8 A;  3QQC E;  2ERJ A;  2PPT A;  2XJS A;  1RDV A;  4AI1 A;  1QCV A;  2HR5 A;  3PKJ A;  3MPS A;  2XJQ A;  2A69 D;  2K2D A;  1JYB A;  4V19 6;  3LPE B;  3ZG6 A;  2ZIX A;  5MGN A;  6RXN A;  1VCX A;  3WWN B;  8RXN A;  5MFP A;  1C09 A;  5DM7 1;  5GAG c;  2PSM C;  4AHY A;  2C6B A;  5GAD c;  1SMU A;  2JI3 A;  4AHZ A;  4UY8 1;  1VZI A;  2B5I D;  4ME3 A;  1IU5 A;  2A6E D;  1OWB A;  1T9P A;  1RDG A;  3WWL A;  4XGH A;  1SMW A;  2XJT A;  5AI3 A;  5MLC 3;  3PKI A;  1RWD A;  2QL0 A;  2Z3R B;  4JAF A;  1RB9 A;  1T9Q A;  2L0Z A;  1QYB A;  1ODH A;  2M4V A;  4XXB B;  3KYV A;  4JAE A;  4G6B A;  5RXN A;  2C6A A;  4AHW A;  2KN9 A;  4AI0 A;  3NFP I;  1BQ9 A;  1ZRP A;  2XJR A;  1NXG A;  1YUZ A;  3RYG A;  1S30 A;  3RZ6 A;  4POG A;  1S2Z A;  4LHL A;  5H1S c;  2A6H D;  4TVM A;  4WFN 1;  5EIN C;  2M4Y A;  4B8C D;  1NNQ A;  1RYQ A;  2GMG A;  4AR4 A;  5GAE c;  4RXN A;  4U67 1;  2XJV A;  2M6P A;  1VZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...