1IUEA

Crystal structure analysis of ferredoxin from plasmodium falciparum
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
b'AFYNITLRTNDGEKKIECNEDEYILDASERQNVELPYSCRGGSCSTCAAKLVEGEVDNDDQSYLDEEQIKKKYILLCTCYPKSDCVIETHKEDELHDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Redox power generator of a nonphotosynthetic plastid in malaria parasite
rcsb
source organism Plasmodium falciparum
molecule tags Electron transport
total genus 26
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1iueA00
3P63A 1QLBB 3FAHA 2DWQA 4JX1C 4C7YA 2K22A 4C7ZA 3DWGC 1QT9A 5MPOA 1PDXA 1NENB 1SB3C 2MJDA 1E9MA 3NRZA 3AEFB 5GXGB 4ZHOA 3DWMA 1OQRA 2Q5WD 4US8A 3FC4A 1WRIA 4FXCA 1E0ZA 1R7SA 3AB5A 3CWIA 3AV8A 1ZOYB 1CJEA 1KF6B 2AX5A 2JX5A 1FFUA 3ETRA 1KFYB 1ZUD2 2OHFA 2WU5B 2MH7A 4IDIA 1L6UA 2L52A 2QJLA 1NI3A 2WDQB 3AE9B 1L6VA 3CIRB 1I7HA 3W5VB 3AE6B 1N5XA 5H8YE 2HTME 4HROA 2WU2B 1J7AA 1NYQA 1N62A 1NYRA 3B2GA 4N58A 4YSXB 1JROA 1RM6C 4WWMA 1NVID 3NVVA 1JWBD 2EKIA 4N59A 2MJEA 3AM9A 1DGJA 3HRDD 2BS2B 3HVZA 2G1EA 1V97A 3AE3B 1FM0D 1QOGA 3ZYYX 1FO4A 1N5WA 1CZPA 1E6EB 2KMMA 2Y5CA 5C2TB 1B9RA 1XLOA 1PUTA 1AYFA 1F0ZA 1YJJA 1TKYA 1WWTA 4YTPB 4YTMB 2L83A 3HUIA 3SFEB 1ROEA 1J7CA 1QF6A 1QOAA 2BS3B 3B2FA 2WDVB 1FMAD 4LTUA 4YT0B 3AE4B 4ZOHC 2KAJA 1JW9D 3P4QB 2JQRB 1PFDA 1FRRA 2PIAA 2BS4B 1N61A 1N60A 4HRSA 3VR8B 4YSZB 1DOYA 4WQMA 3B9JA 3SR6A 2ACZB 1VDVA 3P4PB 2CJNA 1TJEA 4C80A 1TYGB 1JWAD 1TKEA 3AE5B 3NS1A 3AE1B 5H92C 1OQQA 2E3TA 1SF0A 1VLBA 3AEDB 4US9A 2PVOD 3WCQA 1UWMA 2WP9B 3W5UB 3AEEB 3P4SB 3PO0A 2CJOA 2K5PA 3EUB2 1JRPA 2DBYA 1YJIA 2WS3B 1VJKA 3SFDB 2M56B 3AEGB 1GAQB 1DOXA 2PVGC 3BIID 2FBWB 3LB8C 3NVZA 2H89B 2MJ3A 3RPFC 1FFVA 1L5PA 1FIQA 1V8CA 1E10A 1JALA 1WXQA 1XLNA 2LEKA 2B76B 3AEBB 5AUIA 3KWLA 1KRHA 4ZHPA 2W55A 2W3RA 4JWUC 4YSYB 1QOBA 1ZXIA 5EE1A 2W3SA 3NVYA 3AE2B 3L4PA 3W9CB 1FXAA 2WQYB 3NVWA 1J7BA 1WYGA 2W54A 1A70A 3AEAB 3P4RB 3AMZA 2M19A 1E7PB 2QIEB 1SIJA 1TKGA 1IUEA 1ZP0B 3VR9B 2WLBA 1RYJA 3AH7A 4P6VF 1EWYC 1FRDA 1FXIA 1RWSA 4JWSC 1OFFA 5G5HA 2BT6A 1YQ4B 2CU3A 5EE9A 1JQ4A 3AE8B 1RFKA 1XO3A 3AECB 3VRAB 1T3QA 5EE0A 3P1MA 1N63A 2N0SB 5AUKA 4A9AA 4USAA 1GPXA 3AN1A 3ABVB 3LXFA 4ITKA 4YXDB 2H88B 4N6EB 1WGKA 5C3JB 1L0VB 1QOFA 1AWDA 1YQ3B 2K9XA 4KX6B 4YTNB 3VRBB 5G5GA 1NEKB 1DOIA 3AE7B 5EE3A 2PKOA 1XLQA 1XLPA 2WDRB
chains in the Genus database with same CATH superfamily
3FAHA 2LASA 4S0RA 4NAWA 5DCNA 2CS4A 4EE2A 3AEFB 5AZHA 3RULA 1BT0A 3PVLA 2LJIA 2K3UA 3EC8A 5D6JB 3GE3C 3FKYA 1L6UA 1I4HA 3VUYA 4JIOU 3L08A 1P7EA 2HTME 2WU2B 5E6PA 2J4XA 3PLVA 3DDCB 3L13A 3HVZA 4B95A 3DHGC 4WWNA 1N5WA 4G50A 4MSQB 1ZXHA 2BS3B 4AUQC 3AE4B 2MX2A 2JSVX 2PIAA 1F52A 4HRSA 3MP9A 1UZXB 4MACA 3C19A 4BKGA 3DBLI 1TYGB 5JHBA 2IDYA 2KMAA 3NZSA 2N1VA 4D2KA 4KZ0A 4LDTB 2N1WA 1TZ1A 2G4DB 2KFKA 3TEXA 2BGFA 1R4NB 2K1FA 2QHOA 4B0MA 1I4QA 2FIDA 3D32A 2XK5B 5AZFA 4O1NA 3ZKJC 1E7PB 1WJ6A 3BVZA 2DZMA 4IWPA 3DVGX 3GE8C 1TS5A 3PGEA 2CU3A 2BKRB 2YLMA 2A5UA 1KM7A 5AUKA 1JRUA 1RRBA 1P3QU 4BBNC 3TEZA 2WX1A 2RGFA 2V4LA 3VRBB 1VR9A 1E8XA 5EE3A 5IA7A 2L3ZA 2GBJA 3HHMA 2ZPNA 4TQ0A 3DWMA 1OQRA 3C0RB 3AB5A 1ZOYB 2CR5A 3AULA 1V6EA 2JT4B 1V49A 2UWQA 2YVCA 4MGYE 4HPMB 2AYOB 3TL5A 2MBEA 2WXKA 4EOYA 2AQ1B 4WJPA 2FE8A 3QCAA 4BOZB 5LXHA 2FUHB 1P9DU 4I6PA 2KAJA 4RM9A 1I35A 1N61A 4XGAB 1N60A 4OVUA 3P4PB 2IY1B 4A3OA 1TKEA 2ZPYA 2KJHB 1XCTL 3U30A 1HQRD 2KYWA 4W9JA 1EUVB 2D3AA 5JH5C 2LZ6A 2KHWB 3WA0A 4IKGA 4M02A 1GAQB 3KVFB 4C00A 1GB4A 4XX5A 4EZJA 1WIAA 3HVDA 1WXQA 1WR6E 1LQBA 4ZDVA 2JRHA 2W55A 2W3RA 4FADA 3AE2B 1MHHE 2VH2A 3IAM1 2GI9A 2Z8LA 2ZVOA 2LHDA 2MBBB 3EFUA 1SE9A 1E90A 3P1MA 2V0GA 1WRDB 4MGZE 1VD2A 3DVGY 2MP2A 3W1SA 2JU6X 2N9KA 5E6JA 5AEKB 2HJ8A 1FXTB 1EWCA 2VRRB 1DOIA 1XLPA 2MLBA 4GDLB 1HXYD 2AWTA 3JVZX 1V80A 2K22A 4W9CA 4C7ZA 4B0EA 2UU7A 4P1CC 1JMLA 4WJOA 2AX5A 2ZCCA 1FFUA 3ZJUA 2CHXA 3ETRA 2QEJC 2WU5B 4IOIE 3VFKA 4HPPA 4KGTA 3AE6B 2I1JA 2NS5A 3H9DA 4MH8A 1V86A 5IOIA 3NVVA 1JWBD 1LM8B 4I6LB 1KLGD 5FR6A 2L1AA 1FM0D 4WURA 1E6EB 2Y5CA 1MPEA 1AW7A 1YJJA 3P42A 1F0ZA 3MFGA 2BF8B 3SFEB 1ROEA 4EZKA 1D4BA 4GLSC 5L95C 2ZJDA 5G55A 2DAFA 4M00A 1L0YB 4PS8A 3SD5A 4CO7A 3QHTA 3AE5B 1OQQA 2PMVA 2YEPF 2LUMA 2E3TA 2BTEA 2KDEB 4DHJD 4F8CB 2DZKA 2XN9C 2PLPA 2W82A 1UH6A 3KLSX 2KWVB 1V5TA 4MSMB 3RCZA 2KDBA 4ZRIA 3X23A 2DLBA 2KDFB 2MHJA 1FIQA 3ML8A 4HLEA 1I42A 5I4DA 4MH0E 2JYTA 1ZXIA 5BMIA 3ZLZA 4P7IA 2K6DB 2GBNA 3AMZA 1WXVA 1IUEA 4ANXA 3BZDB 1U4AA 3APFA 2J0KA 3DBHI 3AE8B 4XZ4A 3JSVB 5EE0A 1H8CA 1WF9A 3HIZA 1ENFA 2NBVB 4N6EB 3QAQA 3ZNID 5J2RA 2KT7A 3ZO5B 2KWCA 2D3CA 4FJVB 1Q1OA 2WDRB 4HCPB 2IO0B 1VZ6A 2V3PA 4HEA1 1OEYJ 4KIKB 5HG2A 5L83A 5J17A 3DBRB 4IW0A 3CWIA 1K51A 1ZW7A 3DCGA 3I5JC 2MH7A 3AE9B 2LMCA 4RH6A 5FK9C 4LDTD 1N5XA 1T0SC 2L05A 2KLCA 4YSXB 4OZBA 1GUAB 1QQRA 3HRDD 2LFIA 2KWDA 5KHQA 3ZGZA 1TKYA 2Y3AA 3ZTCA 1ZE3D 3N1ZC 2DYOA 4ZOHC 1N6ZA 3V61A 1FRRA 2M8SA 2ON8A 1ZKHA 4ARIA 2C7MB 2KTRB 2OOBB 3APCA 3KQ4A 1GJZA 3FILA 3PREA 2MEKA 2LI5A 3VTUA 4HJKA 1D5XC 1WM2A 4EZLA 4K3BA 4CHKA 5AUIA 2O2VB 3K9OB 4MJSB 1GB1A 1J8CA 3OG5A 1M4VA 4Q2JA 5KHOA 2LVPA 2IYDB 4IUMB 1CK1A 2LRWA 3NVWA 5IO9A 4GOCA 4BVUC 2ONQA 2KVRA 2WLBA 4IM0A 2M4NA 4ZYNA 3BK1A 1L0XB 1CQVA 4W9HA 1WZ3A 4NJCA 1UWXA 3ZUNA 3UGBB 2GLSA 2NCNA 4NPNA 2WXOA 3LYYA 1YD8U 4WQOB 2K9XA 4MELA 2M0XA 1T5XD 3OJ3A 4RF0A 4DHZB 4BKTA 4W9KA 1I4GA 1WGDA 4GGQA 1E7UA 2VH1A 2KACA 4HXDA 2V3NA 1NDDA 3T3NA 1M94A 3IHPC 2DNFA 1EO6A 1I7HA 2L76A 3IAS1 3RNAC 2FIFA 2G9HD 1IGDA 2Y5PA 3TIXA 5E6NA 1DGJA 2DHZA 2L8JA 2WWZA 4MM3A 2CHZA 4M0WA 1XLOA 2V9HA 3WIMA 4YTMB 4LJPB 3HUIA 3WANA 2J52A 4FJZA 2ZVNA 2QSDA 3TEYA 3SR6A 1WZ0A 2C7HA 3UF8A 4GXBA 4NZLB 1FD6A 1WGHA 2N4FA 3BVMA 4C4VB 4RM8A 1PYWD 2Z0DB 1YN4A 3H6NA 3EUB2 2K8BA 2M56B 4ARCA 3IXSA 2PVGC 4WWPA 3RPFC 1DOXA 4TV3A 3ZRFA 2I2YA 2N7DA 4B6WA 3GZNI 1XEEA 2N7JA 1E8YA 3PTFC 1TZOA 3NVYA 2BB6A 1Y56A 2W54A 1GC7A 2LXAA 4BKSD 1EWYC 1FNUA 4GMVA 1YNTE 2SAKA 2ZZPB 1OEYA 3PRMB 4RF1A 2D07B 1N63A 3A4RA 1C1YB 4L1BA 2G4SA 2FCQA 5DPRA 1WGKA 4LLGM 2O6VB 4MGIE 5DPSA 5C3JB 2WXJA 4BZAA 1MHXA 1NEKB 3I63C 2G3QB 3VH3B 3RYTA 4KSKC 1QLBB 1I4RA 2WX0A 1MI0A 5GMVA 3P2BA 2JUOA 3FC4A 1WRIA 3BWUD 3MC8A 1KH0A 2MCNB 1KFYB 3Q3OC 3W1YA 2A4ZA 2BWES 2G45B 3BVGA 4XC2A 4HROA 3A1QA 4OZAA 4K81A 3PS6A 2WYQA 1Q5WB 2FCNA 3ZVVA 3U52E 3VTVA 5JHAA 3EHVA 3VUWA 2EMTA 4NY0A 5AZGA 3Q3NC 1PUTA 2BKFA 1V1PA 3OWEB 4M8NA 1FMAD 1AARA 2WDTB 4LNKA 4W9GA 2BYEA 4XYCA 4W9DA 3NY5A 3H7PB 3Q2AC 3R3MA 2N9LA 2SEBD 3QK0A 4W9LA 4FULA 1L2NA 4EUTA 1VRAB 2XEWA 4WAFA 2NPTB 3QWZB 3RI7C 3UQBA 1KRHA 1QOBA 1AN8A 2FCSA 2GBMA 2LJ5A 3RN9C 4GDKB 4QAYA 1Z5SB 2J7QB 2KN4A 4JL9A 3R7QA 5IKCM 1G6JA 4HJGE 1RWSA 3ZJVA 1OFFA 5G5HA 4W9IA 3NZUA 4IC7B 4DDID 3Q8CA 4GN1A 4HPLB 1TBEA 4FJYA 2GBRA 3AU5A 5E6OA 2BW2A 3PPAA 4NAMA 4HKZE 4KX6B 4M8MA 3R66C 2BYVE 4NJ7A 3UIPB 1KOTA 1STEA 1P7FA 1E7VA 1ZGUB 5MPOA 4MGKE 1TS2A 1R7SA 2RPVA 4HVBA 3RNGC 2JZZA 5IP4D 5CHVC 1D3ZA 2PEAA 4N58A 1D5MC 3DBHB 4JPSA 4ZRQA 4LNIA 4A20A 2XNAC 1WH3A 1I4XA 3M95A 4P16A 3ZW3A 4TSSA 1B9RA 1Q10A 4WIPA 3KUCB 1AYFA 2INCC 4YTPB 2L83A 2LVQA 1KJTA 2KJ6A 1WGRA 2J42A 3ZXVA 3Q6BA 1ZDVA 1TJEA 1UGJA 1JWAD 2LWPA 1YMHE 1UWMA 2V1YA 1IGCA 5HKHA 1XT9B 5EDSA 2L0FA 1J0GA 2RMMA 4N9F4 4NNJB 4A55A 2K0PA 2B76B 3LJ3A 4ZHPA 5EE1A 3R8BA 3B0AA 1FXAA 2BQQA 1YJ1A 3H1UA 3DBSA 4K7SA 4JWSC 5G2NA 1F1HA 5BMGA 2BPSA 5FKAC 3QIJA 2Y5BB 2K6QA 4OVVA 1ZPSA 3W1SC 4YXDB 1SXTA 4KZCA 2RPQA 5D94A 4HCNB 2IO3B 4AS1A 3RFZB 3CIRB 3MC9A 5BYQA 2MBQA 3Q8FA 1C4CA 1L4ZB 2XBBC 2KMCA 2CHWA 2MQJA 1WMHB 3NJTA 3PRPB 2DYBA 3U7ZA 1L7YA 3Q3MC 1OTRB 1CJEA 1VZ7A 2ZW1A 2IZVB 1ZUD2 4XE0A 3KUDB 3J9CA 4XDCA 4LK0M 3UQAA 1F2RI 2KXJA 1WX9A 2X8XX 3E56A 2NBWB 4RGOS 2IO2B 1WXMA 1CZPA 2NBUA 1ET6A 4ASWC 4YL8A 3KYDD 2D5GA 3NG0A 3B2FA 4AP4C 3L16A 2JQRB 4A6QA 1TTNA 2PW9A 2KDIA 3PT2B 1WGYA 2CJNA 1SIFA 2LGXA 3A9JB 2NVUI 1LFDA 2OEDA 1ACCA 3V6CB 2WXQA 2KTFA 4RNAA 3U8ZA 4LNFA 4US9A 3JW0X 4IM2A 2O6VD 1V81A 2DBYA 2FBWB 3LB8C 2MJ3A 4JE3B 1L5PA 1E10A 4W9EA 3Q3FA 1C4PA 1BUIC 2W3SA 1T0RC 3CSTA 2RDHA 2JRIB 2M17A 2GOWA 1JQ4A 1R4MB 3VH4B 1XCQL 3KYCD 3AECB 2B3AA 2XK5A 4IWQA 1S3SG 4ITKA 2H88B 3U2SC 2OJWA 5G5GA 3MJWA 1JCKB 1XLQA 1JWSD 1TS4A 1IP9A 1YOVB 3EECA 1WYWB 4BFRA 3TJPA 2HTHA 2WXFA 3ALBA 4GU2A 5H8YE 2FNJB 1T6BX 1IBXB 2D2QA 2DENB 1UGMA 3A9KB 1QOGA 2KDMA 2L0TA 4H2AA 2MWSB 4NQKE 4KVGB 3P4QB 1PFDA 2L7RA 2DZJA 3PZDA 2KC1A 1HTQA 2V4IB 3X0WA 1YQBA 3NS1A 2N9XA 3H7SA 2FUG1 3JYUA 3BYTB 2EKEC 1Y8RC 3W5UB 2IGDA 2R61A 1VJKA 2KC2A 1K52A 3SU8X 3ZNHB 4GB9A 1XLNA 4G0NB 3KWVA 3GS2A 3BINA 1F9JA 4ICUA 4XWWA 1D5ZC 4DBGA 3NHEB 2M19A 1SIJA 1TKGA 1A5RA 2KX3A 1RYJA 4P6VF 4DHZE 2BYFA 5BYRA 3PSEB 3Q69A 1BMLC 2ZNVC 2KJRA 4KKJA 5JXVA 4NAWB 3Q3JA 2RR9A 1PQSA 1C77A 4ICVA 3ML9A 4HDOA 1SGHA 2D11A 1L0VB 5T8IA 4EFOA 3HM6X 4J6IA 2DWQA 2IBIB 1E9MA 2MA9B 4FA6A 3DBLB 1H4RA 2QILA 4IDIA 2WXNA 1FCCC 2ZEQA 4GDLA 2BBCA 3RT3B 4FN2A 3BYYB 3N30A 2EELA 3MTNB 4LCDE 5C23A 2V3SA 3I57A 4E74A 1P1AA 3IBEA 4BKSA 3C8YA 3APDA 1EM7A 4HK2A 3U4EG 3VDZA 2WXMA 3URYA 4DK5A 3SDLC 2LXCA 2IJ0A 3DVNV 2LRUA 3EGRA 1ZDXA 4C56C 4URKA 2KFKB 1UBIA 2KN5A 1SE4A 1E8WA 2RDGA 3ZDMC 1VLBA 2UYZB 1GG3A 2PVOD 3AEEB 4AJWA 2CJOA 2K5PA 3RNBC 2Z59B 3WAPA 3L54A 1YN3A 3AEBB 3KWLA 4KGRA 3RZFA 1SSNA 5TSSA 3OAWA 3OJ4B 3QX1A 4BBNF 2WQYB 4WJQA 1YX6B 4J3OD 5LLIA 1WE6A 1WFYA 2VZKD 3VQIA 3NOBA 2N9PC 2BT6A 5EE9A 4RCOA 3PHXB 4ANUA 2QC8A 4TKNA 1FNVA 4F1SA 5D2MB 3U7DA 4YTNB 2KWUB 2MBHA 2DZIA 3N20C 4REZA 3JSVA 2OJRA 4DXFA 3SHQA 1PDXA 2QCZA 4TQ1A 2MJDA 4ZHOA 4US8A 4PT5A 3QC8B 2JX5A 2IGGA 3KH0A 1S1QB 2OHFA 3RMKC 3Q8EA 2L52A 4WH4A 1IYFA 3W5VB 1NYRA 4KIKA 3KW5B 1D6EC 2E6XA 3IG3A 2ICIA 4HDQA 2BS2B 1MVKA 1V97A 3ZYYX 2KO3A 3TCAA 3QA8A 5CHWA 2ZCBA 4LTUA 2KOXA 1MJDA 3HK0A 3I3TB 1P98A 2R2OA 4DQOC 3PRZA 2KVZA 3TSSA 4II2B 2LD9A 5D3IB 3WCQA 4WWOA 3T3OA 3O65B 4PYUA 2JZPA 1UNSA 4GSWA 1V8CA 2JYEA 2KTRA 3R2TA 1BXTA 1OQYA 1WXAA 4S17A 2WXRA 2KZRA 1QILA 2RDBC 4OVZA 3ZNGC 3GP7A 3AEAB 3P4RB 2KNBA 2QIEB 3RNFC 4K3CA 2MP2B 1ZP0B 1ISNA 4E3CA 2M1MA 3Q8BA 1K8RB 2K39A 3SEBA 4E71A 1FXIA 1EU4A 2PE9A 3V05A 5IAAC 4EKUA 2O2VA 4MJSA 2WNMA 5HI1A 4LNNA 5J18A 4USAA 2NTTA 1V2YA 4JGHB 1QOFA 1EF1A 3L10B 4WAAA 3AE7B 2WHIA 4HWIB 4JX1C 4WJNA 5D7GA 1QT9A 1WM3A 3TUOA 2JWZA 2WGSA 4K7WA 4FXCA 1SJHD 1WJUA 1ESFA 2FAZA 3IT4B 2QJLA 3V3XA 2MRPA 2QDFA 3ENEA 1QKZA 4TUUA 5CX3A 2K25A 3EA6A 3RNCC 1WI0A 4G11A 1WSPA 1JWMD 1E8ZA 2D3BA 2KD0A 3E9SA 1J7CA 1QF6A 3MHZA 1E5WA 1T0YA 3DOWA 4KSLC 1PGBA 4UDUC 2EMSA 4ZRPA 1SE3A 1DOYA 4WQMA 2PJHA 3NUHB 4YWGG 1HE8A 2IPKD 2JXXA 3AE1B 1HTOA 2RD0A 4DXAB 2I38A 2N9EB 2WXLA 1MG4A 3BIID 1TY0A 3N3KB 4C4VA 4ZYSA 1FCLA 3W9CB 1Z2MA 4K1RB 1SE2A 3M63B 3Q14C 4MT5A 4B9KA 2NR2A 2ZW0A 4RMAA 2WXIA 3GB1A 3DVNU 2DAJA 3V62A 3L0WB 1YQ3B 3R2IA 4BOSC 2PKOA 3QJZA 4M01A 4ACFA 2AEHA 3P63A 1F2RC 1SBBB 4C7YA 3DWGC 4AQ7A 1UF0A 1WJNA 3NRZA 4R3DA 2LGYA 2O6VA 1EU3A 2HD5B 1V9JA 3A33B 1L6VA 1PGAA 2FCMA 2INNE 1NYQA 1N62A 3B2GA 1TT5B 4IM3A 1NVID 2INPE 4MEMA 4A8XC 3W2DA 2KMMA 1RFAA 2INDC 1WWTA 2PPHA 3V60A 3FILB 3RD2A 1QOAA 1HEZE 1OGWA 2AL6A 2VZKB 3PZ8A 2BS4B 2IGHA 5HHDG 1XD3B 3IT6B 5H92C 2QMTA 3MJ5A 2JVCA 3V6EB 4L23A 4A90A 4A3PA 3CF6E 3UIOB 2GRIA 2WS3B 3WALA 3UI3A 3RUIB 3NS8A 1DYQA 1UD7A 3H7PA 1LGRA 3LDZE 4KDIC 1GOZA 1KLUD 2BYTA 4PK1A 2GBKA 3DQVA 2ZNVB 1WYGA 3QQ8B 3O13A 3VR9B 1YX5B 2NPTA 2GMIC 1FRDA 1WE7A 1XO3A 1TY2A 5BYSA 4FBJB 1VZ8A 3ABVB 4ANWA 3ZIMA 4GDKA 1NBFC 5BO4B 3ONSA 1JWUD 1XF5L 1UELA 3CSFA 4BAXA 3A4SC 3MC0B 1SB3C 2AQ3B 2KQSA 2D10A 2Q5WD 2L32A 3VVWB 2DYMA 3I9V1 3CMMB 4GIVA 4MM3B 4K7UA 4M0WB 1NI3A 2WDQB 1RLFA 4OZCA 1SEBD 4NJ6A 4ZRJA 2M0AA 1V5OA 1R4NI 2DX5B 4WWMA 2BVCA 1P0RA 1YIWA 3UINB 4FLHA 3NZ3A 3BY4B 3GZNB 2GB1A 4ANVA 3VUXA 4PYZA 1WY8A 2LGDA 4KGSA 4EEWA 1VDVA 2HE7A 3T8MA 2JY6A 1SF0A 1I4PA 1VCBA 2KQ7A 5IN7A 3PHWB 3P4SB 4IG7B 4RGNA 2YEPB 2W9NA 1K50A 2D3GA 1FNWA 1LO5D 1GC6A 2N7EA 4KDLB 2LUEA 4JWUC 1C79A 5JZEB 4LNOA 3L4PA 1A70A 3WAMA 2TSSA 5CTRC 1WGGA 2JXTA 3AH7A 3ZXRA 4DXGA 4FHJA 1T3QA 1QZEA 2CU1A 1X1MA 2KLGA 1KLVA 5LNK1 5TR5A 2K8HA 2MW5A 3VTWA 4DWFA 3ZRCA 2JZ3B 5CHFA 3ZJTA 1B1ZA 3DHIC 3HM3A 4JQWC 3AI5A 1WXSA 3A1QB 4P1BC 1E0ZA 2R2QA 2C7NB 3AV8A 1KF6B 1HZ6A 3N1XC 3PZ7A 2ASQA 1V1PB 3M62B 1WMHA 3RNEC 1RM6C 4RGMA 2EKIA 4N59A 3PLUA 1F77A 2MJEA 3AM9A 2J53A 2KK8A 4IWOA 1FO4A 2IO1B 3WAOA 1NI2A 3AU4A 3KUZA 2BB5A 3RZWC 2X38A 2WDVB 3N9YC 2RSUA 4YT0B 3BK2A 3B1LX 4RGTA 1FEHA 4XDDA 4PS3A 3B9JA 5D3DA 1IPGA 2BWFA 2AL3A 4C80A 3H8HA 3GOEA 1K53A 2KFJA 4TMAB 3B08A 3ZDTA 2WP9B 1EF5A 1YJIA 3SFDB 3NVZA 2H89B 2LHEA 2C60A 1CMXB 1TS3A 2CKHB 2KKCA 3VAWA 1JALA 3A9JA 4XWTA 3DHHC 2J0MA 4I6NB 1WJ4A 3EFCA 4CYEA 4KV2A 3ZQ4A 2AQ2B 4AJYB 3N1YC 4W9FA 1HA5A 4OW0A 5C1ZA 4F7ZA 2JWUA 3VXWA 1RFKA 1Q0WB 3DPDA 4JLCA 4AWJA 2N0SB 3ZNZB 2JPHA 2WXPA 1GPXA 3LXFA 4X57B 3MHSD 5DPWA 2PE6B 1AWDA 4PS7A 4MDKE 3L17A 5BMHA 1L4DB 2IY0B 3ZTDA 1WR1A 2WXHA 2Z0EB 1PGXA 1NENB 2NMQA 1ET9A 5GXGB 2MSED 3AXCA 1C3TA 3N32A 1MFWA 1KTKA 3TMPB 1J19A 1R4MI 3IVFA 3M3JA 1J7AA 1TGZB 1JROA 4AOFA 1SJED 2LGIA 4CQNA 2K8CA 5DPTA 2G1EA 3AE3B 3TBLD 1WX8A 5C2TB 4NQLB 5LXIB 4OHJA 1C78A 3IFWB 2JF5A 1UBQA 1JW9D 1WX7A 1XXGA 3TEWA 1GNUA 3K9PB 2C5LC 1IBXA 3VR8B 4YSZB 1UUPA 1C76A 2ACZB 3A9KA 3ECIA 2C9WB 1XQQA 3T9LA 3R7RA 3Q8AA 2HDEA 5FR3A 1FPYA 3AEDB 2HJ1A 3PO0A 4G3XB 1JRPA 4L2YA 2PTLA 2MBOA 2J0JA 2NTSA 3AEGB 1TIFA 1FFVA 2WXGA 4ZRKA 2LEKA 2KX0A 4KKIA 2I1KA 1HZ5A 1RAXA 4YSYB 1T0QC 1MG8A 2REXA 3DBRI 4FHKA 1V1OA 3VHTC 1J7BA 1YN5A 4RFBA 2KANA 1C9FA 4HKQA 1LXDA 1YQ4B 3OLMD 3S2AA 3VRAB 2LVOA 2L00B 5HFYA 4A9AA 3QARA 4DDGD 3AN1A 1C4AA 4DHJB 2KQ4X 4II3B 4LJOB 2LGSA 3PV1A
chains in the Genus database with same CATH topology
1I4GA 1F2RC 3P63A 3FAHA 1SBBB 1TS4A 4C7YA 3DWGC 2KACA 4AQ7A 4EE2A 4R3DA 2V3NA 3NRZA 3AEFB 1EU3A 2LJIA 2K3UA 3T3NA 2WXFA 1L6UA 1I4HA 1L6VA 1I7HA 1P7EA 1PGAA 2INNE 5H8YE 2HTME 2WU2B 1NYQA 1N62A 2J4XA 3B2GA 3IAS1 2G9HD 1IGDA 1NVID 2Y5PA 2INPE 1T6BX 1IBXB 1DGJA 3HVZA 4A8XC 3W2DA 1QOGA 1N5WA 2KMMA 4M0WA 1XLOA 2KDMA 1WWTA 4YTMB 3HUIA 4H2AA 3FILB 1QOAA 4A55A 1HEZE 1ZXHA 2BS3B 2J52A 3AE4B 3P4QB 2JSVX 1PFDA 2VZKB 2PIAA 3PZ8A 2BS4B 2IGHA 2QSDA 4HRSA 5HHDG 3MP9A 3TEYA 4MACA 3SR6A 2V4IB 1TYGB 4NZLB 3IT6B 3NS1A 1FD6A 2IDYA 5H92C 2QMTA 3BVMA 4D2KA 3MJ5A 2FUG1 1PYWD 3BYTB 1YN4A 4L23A 3W5UB 4A90A 3EUB2 2IGDA 2GRIA 2R61A 1VJKA 2WS3B 3TEXA 2M56B 3UI3A 4ARCA 1K52A 2PVGC 3IXSA 3RPFC 1DOXA 4B0MA 2I2YA 1I4QA 1XLNA 1DYQA 3KWVA 3GS2A 1GOZA 1XEEA 2N7JA 1KLUD 2BYTA 4XWWA 1TZOA 3NVYA 2BB6A 1D5ZC 1Y56A 1WYGA 2W54A 4O1NA 2M19A 1E7PB 1SIJA 1TKGA 3O13A 3VR9B 3BVZA 1RYJA 4P6VF 1EWYC 5BYRA 1FRDA 1TS5A 1FNUA 2CU3A 3Q69A 1BMLC 1YNTE 2SAKA 1XO3A 4KKJA 4RF1A 1TY2A 5BYSA 5JXVA 1N63A 5AUKA 4NAWB 4L1BA 1VZ8A 3ABVB 1C77A 3TEZA 1WGKA 4LLGM 5C3JB 2WXJA 1L0VB 5T8IA 1JWUD 3VRBB 1VR9A 1MHXA 1NEKB 1XF5L 5EE3A 1QLBB 1I4RA 2DWQA 1MI0A 3MC0B 1SB3C 1E9MA 2AQ3B 4TQ0A 3DWMA 1OQRA 2Q5WD 3FC4A 1WRIA 2L32A 3BWUD 3AB5A 1ZOYB 2DYMA 3I9V1 1KH0A 4MM3B 1KFYB 2QILA 4IDIA 2WXNA 1NI3A 1FCCC 2WDQB 2BBCA 4OZCA 3BVGA 1SEBD 2M0AA 1JWSD 4HROA 3BYYB 2EELA 4WWMA 4OZAA 3I57A 3C8YA 3U4EG 1EM7A 3NZ3A 3U52E 2WXKA 2WXMA 3URYA 1PUTA 2GB1A 2AQ1B 2FE8A 2IJ0A 1V1PA 3OWEB 1FMAD 3EGRA 2KAJA 1ZDXA 4C56C 1N61A 1N60A 4KGSA 1VDVA 3P4PB 1TKEA 1SE4A 1XCTL 2N9LA 2RDGA 2SEBD 1SF0A 1I4PA 1VLBA 1HQRD 2PVOD 3AEEB 3P4SB 2CJOA 2K5PA 4RGNA 2YEPB 1VRAB 1K50A 4IKGA 1GAQB 4WAFA 1GB4A 1FNWA 1LO5D 3HVDA 1WXQA 3AEBB 1YN3A 4KGRA 3KWLA 1KRHA 2W55A 2W3RA 1SSNA 1C79A 4JWUC 1QOBA 5TSSA 3AE2B 3L4PA 1MHHE 1AN8A 2WQYB 1A70A 3IAM1 2TSSA 4GDKB 4J3OD 2GI9A 2Z8LA 2JXTA 3AH7A 2KN4A 4DXGA 2LHDA 2VZKD 3VQIA 4HJGE 1RWSA 3ZJVA 1OFFA 5G5HA 2BT6A 5EE9A 4RCOA 1T3QA 3Q8CA 3P1MA 2V0GA 1FNVA 5LNK1 2BW2A 4NAMA 3W1SA 2JU6X 2N9KA 5E6JA 4YTNB 4HKZE 4KX6B 3ZJTA 1B1ZA 1EWCA 1DOIA 1XLPA 4GDLB 1HXYD 4REZA 1STEA 1P7FA 4DXFA 2K22A 4C7ZA 4B0EA 5MPOA 1PDXA 4TQ1A 2MJDA 4ZHOA 1TS2A 4US8A 1JMLA 1E0ZA 1R7SA 2RPVA 4PT5A 3AV8A 2AX5A 1KF6B 2JX5A 1FFUA 1HZ6A 2IGGA 3ETRA 2QEJC 3ZJUA 2WU5B 2OHFA 3PZ7A 2L52A 3Q8EA 4IOIE 4WH4A 4KGTA 3W5VB 3AE6B 1V1PB 1NYRA 4N58A 1D5MC 4MH8A 4JPSA 1RM6C 4RGMA 3NVVA 1JWBD 1D6EC 2EKIA 1F77A 4N59A 1KLGD 4ZRQA 2E6XA 2MJEA 3AM9A 2XNAC 2ICIA 2J53A 2BS2B 2L1AA 1MVKA 1I4XA 1V97A 4P16A 1FM0D 3ZYYX 1FO4A 4WURA 4TSSA 1B9RA 1E6EB 2Y5CA 1MPEA 1Q10A 4WIPA 1AYFA 1AW7A 1YJJA 2BB5A 3P42A 1F0ZA 3MFGA 4YTPB 2L83A 3SFEB 1D4BA 1ROEA 4GLSC 2X38A 2WDVB 3N9YC 4LTUA 4YT0B 2J42A 3BK2A 1L0YB 4RGTA 1FEHA 4XDDA 1ZDVA 3B9JA 5D3DA 4DQOC 1TJEA 1UGJA 4C80A 3H8HA 1JWAD 3TSSA 3AE5B 1K53A 1OQQA 2PMVA 2YEPF 4TMAB 2LUMA 2E3TA 2BTEA 1YMHE 5D3IB 1UWMA 2WP9B 3WCQA 1IGCA 3T3OA 2XN9C 1YJIA 2PLPA 2W82A 2JZPA 3SFDB 3KLSX 2RMMA 3NVZA 2H89B 2LHEA 1UNSA 2DLBA 1V8CA 1FIQA 1TS3A 2JYEA 3R2TA 1BXTA 1JALA 2K0PA 4XWTA 2B76B 4ZHPA 5I4DA 2JYTA 2WXRA 1ZXIA 5EE1A 1QILA 5BMIA 3R8BA 4OVZA 3ZQ4A 1FXAA 2AQ2B 3GP7A 3AEAB 3P4RB 3AMZA 2QIEB 1IUEA 1ZP0B 1HA5A 3Q8BA 3SEBA 3BZDB 4OW0A 1FXIA 4JWSC 1EU4A 3V05A 2JWUA 3AE8B 1RFKA 2WNMA 5FKAC 5HI1A 5BMGA 5EE0A 2N0SB 1ZPSA 2WXPA 4USAA 1GPXA 2NTTA 4YXDB 3LXFA 1SXTA 1ENFA 4N6EB 1QOFA 1AWDA 3AE7B 5BMHA 4AS1A 1L4DB 3CIRB 3RFZB 2WDRB 5BYQA 1VZ6A 2V3PA 3Q8FA 1C4CA 1L4ZB 4JX1C 5D7GA 4HEA1 1QT9A 2WXHA 1PGXA 3TUOA 1NENB 2NMQA 5HG2A 1ET9A 5GXGB 3U7ZA 4FXCA 1SJHD 3CWIA 1ESFA 1CJEA 1K51A 1VZ7A 2ZW1A 1KTKA 3IT4B 1ZUD2 2MH7A 2QJLA 3AE9B 2LMCA 4XE0A 3V3XA 4RH6A 5FK9C 1N5XA 3J9CA 1J7AA 4XDCA 1QKZA 4YSXB 4LK0M 1JROA 4OZBA 1F2RI 3EA6A 1SJED 2LGIA 3E56A 4CQNA 1QQRA 4RGOS 3HRDD 1WSPA 1JWMD 2KWDA 2G1EA 2LFIA 3AE3B 1CZPA 5C2TB 3ZGZA 1ET6A 1TKYA 2D5GA 2Y3AA 1ZE3D 3E9SA 1J7CA 4OHJA 1QF6A 1C78A 2DYOA 3B2FA 3MHZA 4ZOHC 1JW9D 2JQRB 1PGBA 1XXGA 1FRRA 4UDUC 4A6QA 3TEWA 4ZRPA 2ON8A 1IBXA 3VR8B 4YSZB 1SE3A 1DOYA 2PW9A 1UUPA 4WQMA 4ARIA 1C76A 2ACZB 2CJNA 3NUHB 4YWGG 2IPKD 3KQ4A 2OEDA 3Q8AA 3AE1B 2HDEA 1ACCA 5FR3A 2WXQA 3FILA 4RNAA 3AEDB 4US9A 3PO0A 1JRPA 2DBYA 4L2YA 2PTLA 2I38A 2MEKA 2WXLA 3AEGB 2NTSA 3BIID 2FBWB 3LB8C 1TY0A 2MJ3A 1D5XC 1FFVA 4JE3B 1L5PA 1E10A 2WXGA 2LEKA 4KKIA 5AUIA 1HZ5A 1GB1A 4YSYB 4ZYSA 1FCLA 1M4VA 1C4PA 4Q2JA 1BUIC 2W3SA 3W9CB 1V1OA 1CK1A 1J7BA 3NVWA 1YN5A 2RDHA 4RFBA 1SE2A 2ONQA 2WLBA 4MT5A 1C9FA 4HKQA 3BK1A 1JQ4A 1YQ4B 2ZW0A 1L0XB 1XCQL 1CQVA 3AECB 3VRAB 5HFYA 4NJCA 1UWXA 2WXIA 4A9AA 3GB1A 3AN1A 4ITKA 2H88B 3U2SC 1C4AA 2KQ4X 2WXOA 3LYYA 1YQ3B 3R2IA 2K9XA 5G5GA 1JCKB 1T5XD 4RF0A 2PKOA 1XLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P63 A;  1QLB B;  3FAH A;  2DWQ A;  4JX1 C;  4C7Y A;  2K22 A;  4C7Z A;  3DWG C;  1QT9 A;  5MPO A;  1PDX A;  1NEN B;  1SB3 C;  2MJD A;  1E9M A;  3NRZ A;  3AEF B;  5GXG B;  4ZHO A;  3DWM A;  1OQR A;  2Q5W D;  4US8 A;  3FC4 A;  1WRI A;  4FXC A;  1E0Z A;  1R7S A;  3AB5 A;  3CWI A;  3AV8 A;  1ZOY B;  1CJE A;  1KF6 B;  2AX5 A;  2JX5 A;  1FFU A;  3ETR A;  1KFY B;  1ZUD 2;  2OHF A;  2WU5 B;  2MH7 A;  4IDI A;  1L6U A;  2L52 A;  2QJL A;  1NI3 A;  2WDQ B;  3AE9 B;  1L6V A;  3CIR B;  1I7H A;  3W5V B;  3AE6 B;  1N5X A;  5H8Y E;  2HTM E;  4HRO A;  2WU2 B;  1J7A A;  1NYQ A;  1N62 A;  1NYR A;  3B2G A;  4N58 A;  4YSX B;  1JRO A;  1RM6 C;  4WWM A;  1NVI D;  3NVV A;  1JWB D;  2EKI A;  4N59 A;  2MJE A;  3AM9 A;  1DGJ A;  3HRD D;  2BS2 B;  3HVZ A;  2G1E A;  1V97 A;  3AE3 B;  1FM0 D;  1QOG A;  3ZYY X;  1FO4 A;  1N5W A;  1CZP A;  1E6E B;  2KMM A;  2Y5C A;  5C2T B;  1B9R A;  1XLO A;  1PUT A;  1AYF A;  1F0Z A;  1YJJ A;  1TKY A;  1WWT A;  4YTP B;  4YTM B;  2L83 A;  3HUI A;  3SFE B;  1ROE A;  1J7C A;  1QF6 A;  1QOA A;  2BS3 B;  3B2F A;  2WDV B;  1FMA D;  4LTU A;  4YT0 B;  3AE4 B;  4ZOH C;  2KAJ A;  1JW9 D;  3P4Q B;  2JQR B;  1PFD A;  1FRR A;  2PIA A;  2BS4 B;  1N61 A;  1N60 A;  4HRS A;  3VR8 B;  4YSZ B;  1DOY A;  4WQM A;  3B9J A;  3SR6 A;  2ACZ B;  1VDV A;  3P4P B;  2CJN A;  1TJE A;  4C80 A;  1TYG B;  1JWA D;  1TKE A;  3AE5 B;  3NS1 A;  3AE1 B;  5H92 C;  1OQQ A;  2E3T A;  1SF0 A;  1VLB A;  3AED B;  4US9 A;  2PVO D;  3WCQ A;  1UWM A;  2WP9 B;  3W5U B;  3AEE B;  3P4S B;  3PO0 A;  2CJO A;  2K5P A;  3EUB 2;  1JRP A;  2DBY A;  1YJI A;  2WS3 B;  1VJK A;  3SFD B;  2M56 B;  3AEG B;  1GAQ B;  1DOX A;  2PVG C;  3BII D;  2FBW B;  3LB8 C;  3NVZ A;  2H89 B;  2MJ3 A;  3RPF C;  1FFV A;  1L5P A;  1FIQ A;  1V8C A;  1E10 A;  1JAL A;  1WXQ A;  1XLN A;  2LEK A;  2B76 B;  3AEB B;  5AUI A;  3KWL A;  1KRH A;  4ZHP A;  2W55 A;  2W3R A;  4JWU C;  4YSY B;  1QOB A;  1ZXI A;  5EE1 A;  2W3S A;  3NVY A;  3AE2 B;  3L4P A;  3W9C B;  1FXA A;  2WQY B;  3NVW A;  1J7B A;  1WYG A;  2W54 A;  1A70 A;  3AEA B;  3P4R B;  3AMZ A;  2M19 A;  1E7P B;  2QIE B;  1SIJ A;  1TKG A;  1IUE A;  1ZP0 B;  3VR9 B;  2WLB A;  1RYJ A;  3AH7 A;  4P6V F;  1EWY C;  1FRD A;  1FXI A;  1RWS A;  4JWS C;  1OFF A;  5G5H A;  2BT6 A;  1YQ4 B;  2CU3 A;  5EE9 A;  1JQ4 A;  3AE8 B;  1RFK A;  1XO3 A;  3AEC B;  3VRA B;  1T3Q A;  5EE0 A;  3P1M A;  1N63 A;  2N0S B;  5AUK A;  4A9A A;  4USA A;  1GPX A;  3AN1 A;  3ABV B;  3LXF A;  4ITK A;  4YXD B;  2H88 B;  4N6E B;  1WGK A;  5C3J B;  1L0V B;  1QOF A;  1AWD A;  1YQ3 B;  2K9X A;  4KX6 B;  4YTN B;  3VRB B;  5G5G A;  1NEK B;  1DOI A;  3AE7 B;  5EE3 A;  2PKO A;  1XLQ A;  1XLP A;  2WDR B; 
#chains in the Genus database with same CATH topology
 3FAH A;  2LAS A;  4S0R A;  4NAW A;  5DCN A;  2CS4 A;  4EE2 A;  3AEF B;  5AZH A;  3RUL A;  1BT0 A;  3PVL A;  2LJI A;  2K3U A;  3EC8 A;  5D6J B;  3GE3 C;  3FKY A;  1L6U A;  1I4H A;  3VUY A;  4JIO U;  3L08 A;  1P7E A;  2HTM E;  2WU2 B;  5E6P A;  2J4X A;  3PLV A;  3DDC B;  3L13 A;  3HVZ A;  4B95 A;  3DHG C;  4WWN A;  1N5W A;  4G50 A;  4MSQ B;  1ZXH A;  2BS3 B;  4AUQ C;  3AE4 B;  2MX2 A;  2JSV X;  2PIA A;  1F52 A;  4HRS A;  3MP9 A;  1UZX B;  4MAC A;  3C19 A;  4BKG A;  3DBL I;  1TYG B;  5JHB A;  2IDY A;  2KMA A;  3NZS A;  2N1V A;  4D2K A;  4KZ0 A;  4LDT B;  2N1W A;  1TZ1 A;  2G4D B;  2KFK A;  3TEX A;  2BGF A;  1R4N B;  2K1F A;  2QHO A;  4B0M A;  1I4Q A;  2FID A;  3D32 A;  2XK5 B;  5AZF A;  4O1N A;  3ZKJ C;  1E7P B;  1WJ6 A;  3BVZ A;  2DZM A;  4IWP A;  3DVG X;  3GE8 C;  1TS5 A;  3PGE A;  2CU3 A;  2BKR B;  2YLM A;  2A5U A;  1KM7 A;  5AUK A;  1JRU A;  1RRB A;  1P3Q U;  4BBN C;  3TEZ A;  2WX1 A;  2RGF A;  2V4L A;  3VRB B;  1VR9 A;  1E8X A;  5EE3 A;  5IA7 A;  2L3Z A;  2GBJ A;  3HHM A;  2ZPN A;  4TQ0 A;  3DWM A;  1OQR A;  3C0R B;  3AB5 A;  1ZOY B;  2CR5 A;  3AUL A;  1V6E A;  2JT4 B;  1V49 A;  2UWQ A;  2YVC A;  4MGY E;  4HPM B;  2AYO B;  3TL5 A;  2MBE A;  2WXK A;  4EOY A;  2AQ1 B;  4WJP A;  2FE8 A;  3QCA A;  4BOZ B;  5LXH A;  2FUH B;  1P9D U;  4I6P A;  2KAJ A;  4RM9 A;  1I35 A;  1N61 A;  4XGA B;  1N60 A;  4OVU A;  3P4P B;  2IY1 B;  4A3O A;  1TKE A;  2ZPY A;  2KJH B;  1XCT L;  3U30 A;  1HQR D;  2KYW A;  4W9J A;  1EUV B;  2D3A A;  5JH5 C;  2LZ6 A;  2KHW B;  3WA0 A;  4IKG A;  4M02 A;  1GAQ B;  3KVF B;  4C00 A;  1GB4 A;  4XX5 A;  4EZJ A;  1WIA A;  3HVD A;  1WXQ A;  1WR6 E;  1LQB A;  4ZDV A;  2JRH A;  2W55 A;  2W3R A;  4FAD A;  3AE2 B;  1MHH E;  2VH2 A;  3IAM 1;  2GI9 A;  2Z8L A;  2ZVO A;  2LHD A;  2MBB B;  3EFU A;  1SE9 A;  1E90 A;  3P1M A;  2V0G A;  1WRD B;  4MGZ E;  1VD2 A;  3DVG Y;  2MP2 A;  3W1S A;  2JU6 X;  2N9K A;  5E6J A;  5AEK B;  2HJ8 A;  1FXT B;  1EWC A;  2VRR B;  1DOI A;  1XLP A;  2MLB A;  4GDL B;  1HXY D;  2AWT A;  3JVZ X;  1V80 A;  2K22 A;  4W9C A;  4C7Z A;  4B0E A;  2UU7 A;  4P1C C;  1JML A;  4WJO A;  2AX5 A;  2ZCC A;  1FFU A;  3ZJU A;  2CHX A;  3ETR A;  2QEJ C;  2WU5 B;  4IOI E;  3VFK A;  4HPP A;  4KGT A;  3AE6 B;  2I1J A;  2NS5 A;  3H9D A;  4MH8 A;  1V86 A;  5IOI A;  3NVV A;  1JWB D;  1LM8 B;  4I6L B;  1KLG D;  5FR6 A;  2L1A A;  1FM0 D;  4WUR A;  1E6E B;  2Y5C A;  1MPE A;  1AW7 A;  1YJJ A;  3P42 A;  1F0Z A;  3MFG A;  2BF8 B;  3SFE B;  1ROE A;  4EZK A;  1D4B A;  4GLS C;  5L95 C;  2ZJD A;  5G55 A;  2DAF A;  4M00 A;  1L0Y B;  4PS8 A;  3SD5 A;  4CO7 A;  3QHT A;  3AE5 B;  1OQQ A;  2PMV A;  2YEP F;  2LUM A;  2E3T A;  2BTE A;  2KDE B;  4DHJ D;  4F8C B;  2DZK A;  2XN9 C;  2PLP A;  2W82 A;  1UH6 A;  3KLS X;  2KWV B;  1V5T A;  4MSM B;  3RCZ A;  2KDB A;  4ZRI A;  3X23 A;  2DLB A;  2KDF B;  2MHJ A;  1FIQ A;  3ML8 A;  4HLE A;  1I42 A;  5I4D A;  4MH0 E;  2JYT A;  1ZXI A;  5BMI A;  3ZLZ A;  4P7I A;  2K6D B;  2GBN A;  3AMZ A;  1WXV A;  1IUE A;  4ANX A;  3BZD B;  1U4A A;  3APF A;  2J0K A;  3DBH I;  3AE8 B;  4XZ4 A;  3JSV B;  5EE0 A;  1H8C A;  1WF9 A;  3HIZ A;  1ENF A;  2NBV B;  4N6E B;  3QAQ A;  3ZNI D;  5J2R A;  2KT7 A;  3ZO5 B;  2KWC A;  2D3C A;  4FJV B;  1Q1O A;  2WDR B;  4HCP B;  2IO0 B;  1VZ6 A;  2V3P A;  4HEA 1;  1OEY J;  4KIK B;  5HG2 A;  5L83 A;  5J17 A;  3DBR B;  4IW0 A;  3CWI A;  1K51 A;  1ZW7 A;  3DCG A;  3I5J C;  2MH7 A;  3AE9 B;  2LMC A;  4RH6 A;  5FK9 C;  4LDT D;  1N5X A;  1T0S C;  2L05 A;  2KLC A;  4YSX B;  4OZB A;  1GUA B;  1QQR A;  3HRD D;  2LFI A;  2KWD A;  5KHQ A;  3ZGZ A;  1TKY A;  2Y3A A;  3ZTC A;  1ZE3 D;  3N1Z C;  2DYO A;  4ZOH C;  1N6Z A;  3V61 A;  1FRR A;  2M8S A;  2ON8 A;  1ZKH A;  4ARI A;  2C7M B;  2KTR B;  2OOB B;  3APC A;  3KQ4 A;  1GJZ A;  3FIL A;  3PRE A;  2MEK A;  2LI5 A;  3VTU A;  4HJK A;  1D5X C;  1WM2 A;  4EZL A;  4K3B A;  4CHK A;  5AUI A;  2O2V B;  3K9O B;  4MJS B;  1GB1 A;  1J8C A;  3OG5 A;  1M4V A;  4Q2J A;  5KHO A;  2LVP A;  2IYD B;  4IUM B;  1CK1 A;  2LRW A;  3NVW A;  5IO9 A;  4GOC A;  4BVU C;  2ONQ A;  2KVR A;  2WLB A;  4IM0 A;  2M4N A;  4ZYN A;  3BK1 A;  1L0X B;  1CQV A;  4W9H A;  1WZ3 A;  4NJC A;  1UWX A;  3ZUN A;  3UGB B;  2GLS A;  2NCN A;  4NPN A;  2WXO A;  3LYY A;  1YD8 U;  4WQO B;  2K9X A;  4MEL A;  2M0X A;  1T5X D;  3OJ3 A;  4RF0 A;  4DHZ B;  4BKT A;  4W9K A;  1I4G A;  1WGD A;  4GGQ A;  1E7U A;  2VH1 A;  2KAC A;  4HXD A;  2V3N A;  1NDD A;  3T3N A;  1M94 A;  3IHP C;  2DNF A;  1EO6 A;  1I7H A;  2L76 A;  3IAS 1;  3RNA C;  2FIF A;  2G9H D;  1IGD A;  2Y5P A;  3TIX A;  5E6N A;  1DGJ A;  2DHZ A;  2L8J A;  2WWZ A;  4MM3 A;  2CHZ A;  4M0W A;  1XLO A;  2V9H A;  3WIM A;  4YTM B;  4LJP B;  3HUI A;  3WAN A;  2J52 A;  4FJZ A;  2ZVN A;  2QSD A;  3TEY A;  3SR6 A;  1WZ0 A;  2C7H A;  3UF8 A;  4GXB A;  4NZL B;  1FD6 A;  1WGH A;  2N4F A;  3BVM A;  4C4V B;  4RM8 A;  1PYW D;  2Z0D B;  1YN4 A;  3H6N A;  3EUB 2;  2K8B A;  2M56 B;  4ARC A;  3IXS A;  2PVG C;  4WWP A;  3RPF C;  1DOX A;  4TV3 A;  3ZRF A;  2I2Y A;  2N7D A;  4B6W A;  3GZN I;  1XEE A;  2N7J A;  1E8Y A;  3PTF C;  1TZO A;  3NVY A;  2BB6 A;  1Y56 A;  2W54 A;  1GC7 A;  2LXA A;  4BKS D;  1EWY C;  1FNU A;  4GMV A;  1YNT E;  2SAK A;  2ZZP B;  1OEY A;  3PRM B;  4RF1 A;  2D07 B;  1N63 A;  3A4R A;  1C1Y B;  4L1B A;  2G4S A;  2FCQ A;  5DPR A;  1WGK A;  4LLG M;  2O6V B;  4MGI E;  5DPS A;  5C3J B;  2WXJ A;  4BZA A;  1MHX A;  1NEK B;  3I63 C;  2G3Q B;  3VH3 B;  3RYT A;  4KSK C;  1QLB B;  1I4R A;  2WX0 A;  1MI0 A;  5GMV A;  3P2B A;  2JUO A;  3FC4 A;  1WRI A;  3BWU D;  3MC8 A;  1KH0 A;  2MCN B;  1KFY B;  3Q3O C;  3W1Y A;  2A4Z A;  2BWE S;  2G45 B;  3BVG A;  4XC2 A;  4HRO A;  3A1Q A;  4OZA A;  4K81 A;  3PS6 A;  2WYQ A;  1Q5W B;  2FCN A;  3ZVV A;  3U52 E;  3VTV A;  5JHA A;  3EHV A;  3VUW A;  2EMT A;  4NY0 A;  5AZG A;  3Q3N C;  1PUT A;  2BKF A;  1V1P A;  3OWE B;  4M8N A;  1FMA D;  1AAR A;  2WDT B;  4LNK A;  4W9G A;  2BYE A;  4XYC A;  4W9D A;  3NY5 A;  3H7P B;  3Q2A C;  3R3M A;  2N9L A;  2SEB D;  3QK0 A;  4W9L A;  4FUL A;  1L2N A;  4EUT A;  1VRA B;  2XEW A;  4WAF A;  2NPT B;  3QWZ B;  3RI7 C;  3UQB A;  1KRH A;  1QOB A;  1AN8 A;  2FCS A;  2GBM A;  2LJ5 A;  3RN9 C;  4GDK B;  4QAY A;  1Z5S B;  2J7Q B;  2KN4 A;  4JL9 A;  3R7Q A;  5IKC M;  1G6J A;  4HJG E;  1RWS A;  3ZJV A;  1OFF A;  5G5H A;  4W9I A;  3NZU A;  4IC7 B;  4DDI D;  3Q8C A;  4GN1 A;  4HPL B;  1TBE A;  4FJY A;  2GBR A;  3AU5 A;  5E6O A;  2BW2 A;  3PPA A;  4NAM A;  4HKZ E;  4KX6 B;  4M8M A;  3R66 C;  2BYV E;  4NJ7 A;  3UIP B;  1KOT A;  1STE A;  1P7F A;  1E7V A;  1ZGU B;  5MPO A;  4MGK E;  1TS2 A;  1R7S A;  2RPV A;  4HVB A;  3RNG C;  2JZZ A;  5IP4 D;  5CHV C;  1D3Z A;  2PEA A;  4N58 A;  1D5M C;  3DBH B;  4JPS A;  4ZRQ A;  4LNI A;  4A20 A;  2XNA C;  1WH3 A;  1I4X A;  3M95 A;  4P16 A;  3ZW3 A;  4TSS A;  1B9R A;  1Q10 A;  4WIP A;  3KUC B;  1AYF A;  2INC C;  4YTP B;  2L83 A;  2LVQ A;  1KJT A;  2KJ6 A;  1WGR A;  2J42 A;  3ZXV A;  3Q6B A;  1ZDV A;  1TJE A;  1UGJ A;  1JWA D;  2LWP A;  1YMH E;  1UWM A;  2V1Y A;  1IGC A;  5HKH A;  1XT9 B;  5EDS A;  2L0F A;  1J0G A;  2RMM A;  4N9F 4;  4NNJ B;  4A55 A;  2K0P A;  2B76 B;  3LJ3 A;  4ZHP A;  5EE1 A;  3R8B A;  3B0A A;  1FXA A;  2BQQ A;  1YJ1 A;  3H1U A;  3DBS A;  4K7S A;  4JWS C;  5G2N A;  1F1H A;  5BMG A;  2BPS A;  5FKA C;  3QIJ A;  2Y5B B;  2K6Q A;  4OVV A;  1ZPS A;  3W1S C;  4YXD B;  1SXT A;  4KZC A;  2RPQ A;  5D94 A;  4HCN B;  2IO3 B;  4AS1 A;  3RFZ B;  3CIR B;  3MC9 A;  5BYQ A;  2MBQ A;  3Q8F A;  1C4C A;  1L4Z B;  2XBB C;  2KMC A;  2CHW A;  2MQJ A;  1WMH B;  3NJT A;  3PRP B;  2DYB A;  3U7Z A;  1L7Y A;  3Q3M C;  1OTR B;  1CJE A;  1VZ7 A;  2ZW1 A;  2IZV B;  1ZUD 2;  4XE0 A;  3KUD B;  3J9C A;  4XDC A;  4LK0 M;  3UQA A;  1F2R I;  2KXJ A;  1WX9 A;  2X8X X;  3E56 A;  2NBW B;  4RGO S;  2IO2 B;  1WXM A;  1CZP A;  2NBU A;  1ET6 A;  4ASW C;  4YL8 A;  3KYD D;  2D5G A;  3NG0 A;  3B2F A;  4AP4 C;  3L16 A;  2JQR B;  4A6Q A;  1TTN A;  2PW9 A;  2KDI A;  3PT2 B;  1WGY A;  2CJN A;  1SIF A;  2LGX A;  3A9J B;  2NVU I;  1LFD A;  2OED A;  1ACC A;  3V6C B;  2WXQ A;  2KTF A;  4RNA A;  3U8Z A;  4LNF A;  4US9 A;  3JW0 X;  4IM2 A;  2O6V D;  1V81 A;  2DBY A;  2FBW B;  3LB8 C;  2MJ3 A;  4JE3 B;  1L5P A;  1E10 A;  4W9E A;  3Q3F A;  1C4P A;  1BUI C;  2W3S A;  1T0R C;  3CST A;  2RDH A;  2JRI B;  2M17 A;  2GOW A;  1JQ4 A;  1R4M B;  3VH4 B;  1XCQ L;  3KYC D;  3AEC B;  2B3A A;  2XK5 A;  4IWQ A;  1S3S G;  4ITK A;  2H88 B;  3U2S C;  2OJW A;  5G5G A;  3MJW A;  1JCK B;  1XLQ A;  1JWS D;  1TS4 A;  1IP9 A;  1YOV B;  3EEC A;  1WYW B;  4BFR A;  3TJP A;  2HTH A;  2WXF A;  3ALB A;  4GU2 A;  5H8Y E;  2FNJ B;  1T6B X;  1IBX B;  2D2Q A;  2DEN B;  1UGM A;  3A9K B;  1QOG A;  2KDM A;  2L0T A;  4H2A A;  2MWS B;  4NQK E;  4KVG B;  3P4Q B;  1PFD A;  2L7R A;  2DZJ A;  3PZD A;  2KC1 A;  1HTQ A;  2V4I B;  3X0W A;  1YQB A;  3NS1 A;  2N9X A;  3H7S A;  2FUG 1;  3JYU A;  3BYT B;  2EKE C;  1Y8R C;  3W5U B;  2IGD A;  2R61 A;  1VJK A;  2KC2 A;  1K52 A;  3SU8 X;  3ZNH B;  4GB9 A;  1XLN A;  4G0N B;  3KWV A;  3GS2 A;  3BIN A;  1F9J A;  4ICU A;  4XWW A;  1D5Z C;  4DBG A;  3NHE B;  2M19 A;  1SIJ A;  1TKG A;  1A5R A;  2KX3 A;  1RYJ A;  4P6V F;  4DHZ E;  2BYF A;  5BYR A;  3PSE B;  3Q69 A;  1BML C;  2ZNV C;  2KJR A;  4KKJ A;  5JXV A;  4NAW B;  3Q3J A;  2RR9 A;  1PQS A;  1C77 A;  4ICV A;  3ML9 A;  4HDO A;  1SGH A;  2D11 A;  1L0V B;  5T8I A;  4EFO A;  3HM6 X;  4J6I A;  2DWQ A;  2IBI B;  1E9M A;  2MA9 B;  4FA6 A;  3DBL B;  1H4R A;  2QIL A;  4IDI A;  2WXN A;  1FCC C;  2ZEQ A;  4GDL A;  2BBC A;  3RT3 B;  4FN2 A;  3BYY B;  3N30 A;  2EEL A;  3MTN B;  4LCD E;  5C23 A;  2V3S A;  3I57 A;  4E74 A;  1P1A A;  3IBE A;  4BKS A;  3C8Y A;  3APD A;  1EM7 A;  4HK2 A;  3U4E G;  3VDZ A;  2WXM A;  3URY A;  4DK5 A;  3SDL C;  2LXC A;  2IJ0 A;  3DVN V;  2LRU A;  3EGR A;  1ZDX A;  4C56 C;  4URK A;  2KFK B;  1UBI A;  2KN5 A;  1SE4 A;  1E8W A;  2RDG A;  3ZDM C;  1VLB A;  2UYZ B;  1GG3 A;  2PVO D;  3AEE B;  4AJW A;  2CJO A;  2K5P A;  3RNB C;  2Z59 B;  3WAP A;  3L54 A;  1YN3 A;  3AEB B;  3KWL A;  4KGR A;  3RZF A;  1SSN A;  5TSS A;  3OAW A;  3OJ4 B;  3QX1 A;  4BBN F;  2WQY B;  4WJQ A;  1YX6 B;  4J3O D;  5LLI A;  1WE6 A;  1WFY A;  2VZK D;  3VQI A;  3NOB A;  2N9P C;  2BT6 A;  5EE9 A;  4RCO A;  3PHX B;  4ANU A;  2QC8 A;  4TKN A;  1FNV A;  4F1S A;  5D2M B;  3U7D A;  4YTN B;  2KWU B;  2MBH A;  2DZI A;  3N20 C;  4REZ A;  3JSV A;  2OJR A;  4DXF A;  3SHQ A;  1PDX A;  2QCZ A;  4TQ1 A;  2MJD A;  4ZHO A;  4US8 A;  4PT5 A;  3QC8 B;  2JX5 A;  2IGG A;  3KH0 A;  1S1Q B;  2OHF A;  3RMK C;  3Q8E A;  2L52 A;  4WH4 A;  1IYF A;  3W5V B;  1NYR A;  4KIK A;  3KW5 B;  1D6E C;  2E6X A;  3IG3 A;  2ICI A;  4HDQ A;  2BS2 B;  1MVK A;  1V97 A;  3ZYY X;  2KO3 A;  3TCA A;  3QA8 A;  5CHW A;  2ZCB A;  4LTU A;  2KOX A;  1MJD A;  3HK0 A;  3I3T B;  1P98 A;  2R2O A;  4DQO C;  3PRZ A;  2KVZ A;  3TSS A;  4II2 B;  2LD9 A;  5D3I B;  3WCQ A;  4WWO A;  3T3O A;  3O65 B;  4PYU A;  2JZP A;  1UNS A;  4GSW A;  1V8C A;  2JYE A;  2KTR A;  3R2T A;  1BXT A;  1OQY A;  1WXA A;  4S17 A;  2WXR A;  2KZR A;  1QIL A;  2RDB C;  4OVZ A;  3ZNG C;  3GP7 A;  3AEA B;  3P4R B;  2KNB A;  2QIE B;  3RNF C;  4K3C A;  2MP2 B;  1ZP0 B;  1ISN A;  4E3C A;  2M1M A;  3Q8B A;  1K8R B;  2K39 A;  3SEB A;  4E71 A;  1FXI A;  1EU4 A;  2PE9 A;  3V05 A;  5IAA C;  4EKU A;  2O2V A;  4MJS A;  2WNM A;  5HI1 A;  4LNN A;  5J18 A;  4USA A;  2NTT A;  1V2Y A;  4JGH B;  1QOF A;  1EF1 A;  3L10 B;  4WAA A;  3AE7 B;  2WHI A;  4HWI B;  4JX1 C;  4WJN A;  5D7G A;  1QT9 A;  1WM3 A;  3TUO A;  2JWZ A;  2WGS A;  4K7W A;  4FXC A;  1SJH D;  1WJU A;  1ESF A;  2FAZ A;  3IT4 B;  2QJL A;  3V3X A;  2MRP A;  2QDF A;  3ENE A;  1QKZ A;  4TUU A;  5CX3 A;  2K25 A;  3EA6 A;  3RNC C;  1WI0 A;  4G11 A;  1WSP A;  1JWM D;  1E8Z A;  2D3B A;  2KD0 A;  3E9S A;  1J7C A;  1QF6 A;  3MHZ A;  1E5W A;  1T0Y A;  3DOW A;  4KSL C;  1PGB A;  4UDU C;  2EMS A;  4ZRP A;  1SE3 A;  1DOY A;  4WQM A;  2PJH A;  3NUH B;  4YWG G;  1HE8 A;  2IPK D;  2JXX A;  3AE1 B;  1HTO A;  2RD0 A;  4DXA B;  2I38 A;  2N9E B;  2WXL A;  1MG4 A;  3BII D;  1TY0 A;  3N3K B;  4C4V A;  4ZYS A;  1FCL A;  3W9C B;  1Z2M A;  4K1R B;  1SE2 A;  3M63 B;  3Q14 C;  4MT5 A;  4B9K A;  2NR2 A;  2ZW0 A;  4RMA A;  2WXI A;  3GB1 A;  3DVN U;  2DAJ A;  3V62 A;  3L0W B;  1YQ3 B;  3R2I A;  4BOS C;  2PKO A;  3QJZ A;  4M01 A;  4ACF A;  2AEH A;  3P63 A;  1F2R C;  1SBB B;  4C7Y A;  3DWG C;  4AQ7 A;  1UF0 A;  1WJN A;  3NRZ A;  4R3D A;  2LGY A;  2O6V A;  1EU3 A;  2HD5 B;  1V9J A;  3A33 B;  1L6V A;  1PGA A;  2FCM A;  2INN E;  1NYQ A;  1N62 A;  3B2G A;  1TT5 B;  4IM3 A;  1NVI D;  2INP E;  4MEM A;  4A8X C;  3W2D A;  2KMM A;  1RFA A;  2IND C;  1WWT A;  2PPH A;  3V60 A;  3FIL B;  3RD2 A;  1QOA A;  1HEZ E;  1OGW A;  2AL6 A;  2VZK B;  3PZ8 A;  2BS4 B;  2IGH A;  5HHD G;  1XD3 B;  3IT6 B;  5H92 C;  2QMT A;  3MJ5 A;  2JVC A;  3V6E B;  4L23 A;  4A90 A;  4A3P A;  3CF6 E;  3UIO B;  2GRI A;  2WS3 B;  3WAL A;  3UI3 A;  3RUI B;  3NS8 A;  1DYQ A;  1UD7 A;  3H7P A;  1LGR A;  3LDZ E;  4KDI C;  1GOZ A;  1KLU D;  2BYT A;  4PK1 A;  2GBK A;  3DQV A;  2ZNV B;  1WYG A;  3QQ8 B;  3O13 A;  3VR9 B;  1YX5 B;  2NPT A;  2GMI C;  1FRD A;  1WE7 A;  1XO3 A;  1TY2 A;  5BYS A;  4FBJ B;  1VZ8 A;  3ABV B;  4ANW A;  3ZIM A;  4GDK A;  1NBF C;  5BO4 B;  3ONS A;  1JWU D;  1XF5 L;  1UEL A;  3CSF A;  4BAX A;  3A4S C;  3MC0 B;  1SB3 C;  2AQ3 B;  2KQS A;  2D10 A;  2Q5W D;  2L32 A;  3VVW B;  2DYM A;  3I9V 1;  3CMM B;  4GIV A;  4MM3 B;  4K7U A;  4M0W B;  1NI3 A;  2WDQ B;  1RLF A;  4OZC A;  1SEB D;  4NJ6 A;  4ZRJ A;  2M0A A;  1V5O A;  1R4N I;  2DX5 B;  4WWM A;  2BVC A;  1P0R A;  1YIW A;  3UIN B;  4FLH A;  3NZ3 A;  3BY4 B;  3GZN B;  2GB1 A;  4ANV A;  3VUX A;  4PYZ A;  1WY8 A;  2LGD A;  4KGS A;  4EEW A;  1VDV A;  2HE7 A;  3T8M A;  2JY6 A;  1SF0 A;  1I4P A;  1VCB A;  2KQ7 A;  5IN7 A;  3PHW B;  3P4S B;  4IG7 B;  4RGN A;  2YEP B;  2W9N A;  1K50 A;  2D3G A;  1FNW A;  1LO5 D;  1GC6 A;  2N7E A;  4KDL B;  2LUE A;  4JWU C;  1C79 A;  5JZE B;  4LNO A;  3L4P A;  1A70 A;  3WAM A;  2TSS A;  5CTR C;  1WGG A;  2JXT A;  3AH7 A;  3ZXR A;  4DXG A;  4FHJ A;  1T3Q A;  1QZE A;  2CU1 A;  1X1M A;  2KLG A;  1KLV A;  5LNK 1;  5TR5 A;  2K8H A;  2MW5 A;  3VTW A;  4DWF A;  3ZRC A;  2JZ3 B;  5CHF A;  3ZJT A;  1B1Z A;  3DHI C;  3HM3 A;  4JQW C;  3AI5 A;  1WXS A;  3A1Q B;  4P1B C;  1E0Z A;  2R2Q A;  2C7N B;  3AV8 A;  1KF6 B;  1HZ6 A;  3N1X C;  3PZ7 A;  2ASQ A;  1V1P B;  3M62 B;  1WMH A;  3RNE C;  1RM6 C;  4RGM A;  2EKI A;  4N59 A;  3PLU A;  1F77 A;  2MJE A;  3AM9 A;  2J53 A;  2KK8 A;  4IWO A;  1FO4 A;  2IO1 B;  3WAO A;  1NI2 A;  3AU4 A;  3KUZ A;  2BB5 A;  3RZW C;  2X38 A;  2WDV B;  3N9Y C;  2RSU A;  4YT0 B;  3BK2 A;  3B1L X;  4RGT A;  1FEH A;  4XDD A;  4PS3 A;  3B9J A;  5D3D A;  1IPG A;  2BWF A;  2AL3 A;  4C80 A;  3H8H A;  3GOE A;  1K53 A;  2KFJ A;  4TMA B;  3B08 A;  3ZDT A;  2WP9 B;  1EF5 A;  1YJI A;  3SFD B;  3NVZ A;  2H89 B;  2LHE A;  2C60 A;  1CMX B;  1TS3 A;  2CKH B;  2KKC A;  3VAW A;  1JAL A;  3A9J A;  4XWT A;  3DHH C;  2J0M A;  4I6N B;  1WJ4 A;  3EFC A;  4CYE A;  4KV2 A;  3ZQ4 A;  2AQ2 B;  4AJY B;  3N1Y C;  4W9F A;  1HA5 A;  4OW0 A;  5C1Z A;  4F7Z A;  2JWU A;  3VXW A;  1RFK A;  1Q0W B;  3DPD A;  4JLC A;  4AWJ A;  2N0S B;  3ZNZ B;  2JPH A;  2WXP A;  1GPX A;  3LXF A;  4X57 B;  3MHS D;  5DPW A;  2PE6 B;  1AWD A;  4PS7 A;  4MDK E;  3L17 A;  5BMH A;  1L4D B;  2IY0 B;  3ZTD A;  1WR1 A;  2WXH A;  2Z0E B;  1PGX A;  1NEN B;  2NMQ A;  1ET9 A;  5GXG B;  2MSE D;  3AXC A;  1C3T A;  3N32 A;  1MFW A;  1KTK A;  3TMP B;  1J19 A;  1R4M I;  3IVF A;  3M3J A;  1J7A A;  1TGZ B;  1JRO A;  4AOF A;  1SJE D;  2LGI A;  4CQN A;  2K8C A;  5DPT A;  2G1E A;  3AE3 B;  3TBL D;  1WX8 A;  5C2T B;  4NQL B;  5LXI B;  4OHJ A;  1C78 A;  3IFW B;  2JF5 A;  1UBQ A;  1JW9 D;  1WX7 A;  1XXG A;  3TEW A;  1GNU A;  3K9P B;  2C5L C;  1IBX A;  3VR8 B;  4YSZ B;  1UUP A;  1C76 A;  2ACZ B;  3A9K A;  3ECI A;  2C9W B;  1XQQ A;  3T9L A;  3R7R A;  3Q8A A;  2HDE A;  5FR3 A;  1FPY A;  3AED B;  2HJ1 A;  3PO0 A;  4G3X B;  1JRP A;  4L2Y A;  2PTL A;  2MBO A;  2J0J A;  2NTS A;  3AEG B;  1TIF A;  1FFV A;  2WXG A;  4ZRK A;  2LEK A;  2KX0 A;  4KKI A;  2I1K A;  1HZ5 A;  1RAX A;  4YSY B;  1T0Q C;  1MG8 A;  2REX A;  3DBR I;  4FHK A;  1V1O A;  3VHT C;  1J7B A;  1YN5 A;  4RFB A;  2KAN A;  1C9F A;  4HKQ A;  1LXD A;  1YQ4 B;  3OLM D;  3S2A A;  3VRA B;  2LVO A;  2L00 B;  5HFY A;  4A9A A;  3QAR A;  4DDG D;  3AN1 A;  1C4A A;  4DHJ B;  2KQ4 X;  4II3 B;  4LJO B;  2LGS A;  3PV1 A; 
#chains in the Genus database with same CATH homology
 1I4G A;  1F2R C;  3P63 A;  3FAH A;  1SBB B;  1TS4 A;  4C7Y A;  3DWG C;  2KAC A;  4AQ7 A;  4EE2 A;  4R3D A;  2V3N A;  3NRZ A;  3AEF B;  1EU3 A;  2LJI A;  2K3U A;  3T3N A;  2WXF A;  1L6U A;  1I4H A;  1L6V A;  1I7H A;  1P7E A;  1PGA A;  2INN E;  5H8Y E;  2HTM E;  2WU2 B;  1NYQ A;  1N62 A;  2J4X A;  3B2G A;  3IAS 1;  2G9H D;  1IGD A;  1NVI D;  2Y5P A;  2INP E;  1T6B X;  1IBX B;  1DGJ A;  3HVZ A;  4A8X C;  3W2D A;  1QOG A;  1N5W A;  2KMM A;  4M0W A;  1XLO A;  2KDM A;  1WWT A;  4YTM B;  3HUI A;  4H2A A;  3FIL B;  1QOA A;  4A55 A;  1HEZ E;  1ZXH A;  2BS3 B;  2J52 A;  3AE4 B;  3P4Q B;  2JSV X;  1PFD A;  2VZK B;  2PIA A;  3PZ8 A;  2BS4 B;  2IGH A;  2QSD A;  4HRS A;  5HHD G;  3MP9 A;  3TEY A;  4MAC A;  3SR6 A;  2V4I B;  1TYG B;  4NZL B;  3IT6 B;  3NS1 A;  1FD6 A;  2IDY A;  5H92 C;  2QMT A;  3BVM A;  4D2K A;  3MJ5 A;  2FUG 1;  1PYW D;  3BYT B;  1YN4 A;  4L23 A;  3W5U B;  4A90 A;  3EUB 2;  2IGD A;  2GRI A;  2R61 A;  1VJK A;  2WS3 B;  3TEX A;  2M56 B;  3UI3 A;  4ARC A;  1K52 A;  2PVG C;  3IXS A;  3RPF C;  1DOX A;  4B0M A;  2I2Y A;  1I4Q A;  1XLN A;  1DYQ A;  3KWV A;  3GS2 A;  1GOZ A;  1XEE A;  2N7J A;  1KLU D;  2BYT A;  4XWW A;  1TZO A;  3NVY A;  2BB6 A;  1D5Z C;  1Y56 A;  1WYG A;  2W54 A;  4O1N A;  2M19 A;  1E7P B;  1SIJ A;  1TKG A;  3O13 A;  3VR9 B;  3BVZ A;  1RYJ A;  4P6V F;  1EWY C;  5BYR A;  1FRD A;  1TS5 A;  1FNU A;  2CU3 A;  3Q69 A;  1BML C;  1YNT E;  2SAK A;  1XO3 A;  4KKJ A;  4RF1 A;  1TY2 A;  5BYS A;  5JXV A;  1N63 A;  5AUK A;  4NAW B;  4L1B A;  1VZ8 A;  3ABV B;  1C77 A;  3TEZ A;  1WGK A;  4LLG M;  5C3J B;  2WXJ A;  1L0V B;  5T8I A;  1JWU D;  3VRB B;  1VR9 A;  1MHX A;  1NEK B;  1XF5 L;  5EE3 A;  1QLB B;  1I4R A;  2DWQ A;  1MI0 A;  3MC0 B;  1SB3 C;  1E9M A;  2AQ3 B;  4TQ0 A;  3DWM A;  1OQR A;  2Q5W D;  3FC4 A;  1WRI A;  2L32 A;  3BWU D;  3AB5 A;  1ZOY B;  2DYM A;  3I9V 1;  1KH0 A;  4MM3 B;  1KFY B;  2QIL A;  4IDI A;  2WXN A;  1NI3 A;  1FCC C;  2WDQ B;  2BBC A;  4OZC A;  3BVG A;  1SEB D;  2M0A A;  1JWS D;  4HRO A;  3BYY B;  2EEL A;  4WWM A;  4OZA A;  3I57 A;  3C8Y A;  3U4E G;  1EM7 A;  3NZ3 A;  3U52 E;  2WXK A;  2WXM A;  3URY A;  1PUT A;  2GB1 A;  2AQ1 B;  2FE8 A;  2IJ0 A;  1V1P A;  3OWE B;  1FMA D;  3EGR A;  2KAJ A;  1ZDX A;  4C56 C;  1N61 A;  1N60 A;  4KGS A;  1VDV A;  3P4P B;  1TKE A;  1SE4 A;  1XCT L;  2N9L A;  2RDG A;  2SEB D;  1SF0 A;  1I4P A;  1VLB A;  1HQR D;  2PVO D;  3AEE B;  3P4S B;  2CJO A;  2K5P A;  4RGN A;  2YEP B;  1VRA B;  1K50 A;  4IKG A;  1GAQ B;  4WAF A;  1GB4 A;  1FNW A;  1LO5 D;  3HVD A;  1WXQ A;  3AEB B;  1YN3 A;  4KGR A;  3KWL A;  1KRH A;  2W55 A;  2W3R A;  1SSN A;  1C79 A;  4JWU C;  1QOB A;  5TSS A;  3AE2 B;  3L4P A;  1MHH E;  1AN8 A;  2WQY B;  1A70 A;  3IAM 1;  2TSS A;  4GDK B;  4J3O D;  2GI9 A;  2Z8L A;  2JXT A;  3AH7 A;  2KN4 A;  4DXG A;  2LHD A;  2VZK D;  3VQI A;  4HJG E;  1RWS A;  3ZJV A;  1OFF A;  5G5H A;  2BT6 A;  5EE9 A;  4RCO A;  1T3Q A;  3Q8C A;  3P1M A;  2V0G A;  1FNV A;  5LNK 1;  2BW2 A;  4NAM A;  3W1S A;  2JU6 X;  2N9K A;  5E6J A;  4YTN B;  4HKZ E;  4KX6 B;  3ZJT A;  1B1Z A;  1EWC A;  1DOI A;  1XLP A;  4GDL B;  1HXY D;  4REZ A;  1STE A;  1P7F A;  4DXF A;  2K22 A;  4C7Z A;  4B0E A;  5MPO A;  1PDX A;  4TQ1 A;  2MJD A;  4ZHO A;  1TS2 A;  4US8 A;  1JML A;  1E0Z A;  1R7S A;  2RPV A;  4PT5 A;  3AV8 A;  2AX5 A;  1KF6 B;  2JX5 A;  1FFU A;  1HZ6 A;  2IGG A;  3ETR A;  2QEJ C;  3ZJU A;  2WU5 B;  2OHF A;  3PZ7 A;  2L52 A;  3Q8E A;  4IOI E;  4WH4 A;  4KGT A;  3W5V B;  3AE6 B;  1V1P B;  1NYR A;  4N58 A;  1D5M C;  4MH8 A;  4JPS A;  1RM6 C;  4RGM A;  3NVV A;  1JWB D;  1D6E C;  2EKI A;  1F77 A;  4N59 A;  1KLG D;  4ZRQ A;  2E6X A;  2MJE A;  3AM9 A;  2XNA C;  2ICI A;  2J53 A;  2BS2 B;  2L1A A;  1MVK A;  1I4X A;  1V97 A;  4P16 A;  1FM0 D;  3ZYY X;  1FO4 A;  4WUR A;  4TSS A;  1B9R A;  1E6E B;  2Y5C A;  1MPE A;  1Q10 A;  4WIP A;  1AYF A;  1AW7 A;  1YJJ A;  2BB5 A;  3P42 A;  1F0Z A;  3MFG A;  4YTP B;  2L83 A;  3SFE B;  1D4B A;  1ROE A;  4GLS C;  2X38 A;  2WDV B;  3N9Y C;  4LTU A;  4YT0 B;  2J42 A;  3BK2 A;  1L0Y B;  4RGT A;  1FEH A;  4XDD A;  1ZDV A;  3B9J A;  5D3D A;  4DQO C;  1TJE A;  1UGJ A;  4C80 A;  3H8H A;  1JWA D;  3TSS A;  3AE5 B;  1K53 A;  1OQQ A;  2PMV A;  2YEP F;  4TMA B;  2LUM A;  2E3T A;  2BTE A;  1YMH E;  5D3I B;  1UWM A;  2WP9 B;  3WCQ A;  1IGC A;  3T3O A;  2XN9 C;  1YJI A;  2PLP A;  2W82 A;  2JZP A;  3SFD B;  3KLS X;  2RMM A;  3NVZ A;  2H89 B;  2LHE A;  1UNS A;  2DLB A;  1V8C A;  1FIQ A;  1TS3 A;  2JYE A;  3R2T A;  1BXT A;  1JAL A;  2K0P A;  4XWT A;  2B76 B;  4ZHP A;  5I4D A;  2JYT A;  2WXR A;  1ZXI A;  5EE1 A;  1QIL A;  5BMI A;  3R8B A;  4OVZ A;  3ZQ4 A;  1FXA A;  2AQ2 B;  3GP7 A;  3AEA B;  3P4R B;  3AMZ A;  2QIE B;  1IUE A;  1ZP0 B;  1HA5 A;  3Q8B A;  3SEB A;  3BZD B;  4OW0 A;  1FXI A;  4JWS C;  1EU4 A;  3V05 A;  2JWU A;  3AE8 B;  1RFK A;  2WNM A;  5FKA C;  5HI1 A;  5BMG A;  5EE0 A;  2N0S B;  1ZPS A;  2WXP A;  4USA A;  1GPX A;  2NTT A;  4YXD B;  3LXF A;  1SXT A;  1ENF A;  4N6E B;  1QOF A;  1AWD A;  3AE7 B;  5BMH A;  4AS1 A;  1L4D B;  3CIR B;  3RFZ B;  2WDR B;  5BYQ A;  1VZ6 A;  2V3P A;  3Q8F A;  1C4C A;  1L4Z B;  4JX1 C;  5D7G A;  4HEA 1;  1QT9 A;  2WXH A;  1PGX A;  3TUO A;  1NEN B;  2NMQ A;  5HG2 A;  1ET9 A;  5GXG B;  3U7Z A;  4FXC A;  1SJH D;  3CWI A;  1ESF A;  1CJE A;  1K51 A;  1VZ7 A;  2ZW1 A;  1KTK A;  3IT4 B;  1ZUD 2;  2MH7 A;  2QJL A;  3AE9 B;  2LMC A;  4XE0 A;  3V3X A;  4RH6 A;  5FK9 C;  1N5X A;  3J9C A;  1J7A A;  4XDC A;  1QKZ A;  4YSX B;  4LK0 M;  1JRO A;  4OZB A;  1F2R I;  3EA6 A;  1SJE D;  2LGI A;  3E56 A;  4CQN A;  1QQR A;  4RGO S;  3HRD D;  1WSP A;  1JWM D;  2KWD A;  2G1E A;  2LFI A;  3AE3 B;  1CZP A;  5C2T B;  3ZGZ A;  1ET6 A;  1TKY A;  2D5G A;  2Y3A A;  1ZE3 D;  3E9S A;  1J7C A;  4OHJ A;  1QF6 A;  1C78 A;  2DYO A;  3B2F A;  3MHZ A;  4ZOH C;  1JW9 D;  2JQR B;  1PGB A;  1XXG A;  1FRR A;  4UDU C;  4A6Q A;  3TEW A;  4ZRP A;  2ON8 A;  1IBX A;  3VR8 B;  4YSZ B;  1SE3 A;  1DOY A;  2PW9 A;  1UUP A;  4WQM A;  4ARI A;  1C76 A;  2ACZ B;  2CJN A;  3NUH B;  4YWG G;  2IPK D;  3KQ4 A;  2OED A;  3Q8A A;  3AE1 B;  2HDE A;  1ACC A;  5FR3 A;  2WXQ A;  3FIL A;  4RNA A;  3AED B;  4US9 A;  3PO0 A;  1JRP A;  2DBY A;  4L2Y A;  2PTL A;  2I38 A;  2MEK A;  2WXL A;  3AEG B;  2NTS A;  3BII D;  2FBW B;  3LB8 C;  1TY0 A;  2MJ3 A;  1D5X C;  1FFV A;  4JE3 B;  1L5P A;  1E10 A;  2WXG A;  2LEK A;  4KKI A;  5AUI A;  1HZ5 A;  1GB1 A;  4YSY B;  4ZYS A;  1FCL A;  1M4V A;  1C4P A;  4Q2J A;  1BUI C;  2W3S A;  3W9C B;  1V1O A;  1CK1 A;  1J7B A;  3NVW A;  1YN5 A;  2RDH A;  4RFB A;  1SE2 A;  2ONQ A;  2WLB A;  4MT5 A;  1C9F A;  4HKQ A;  3BK1 A;  1JQ4 A;  1YQ4 B;  2ZW0 A;  1L0X B;  1XCQ L;  1CQV A;  3AEC B;  3VRA B;  5HFY A;  4NJC A;  1UWX A;  2WXI A;  4A9A A;  3GB1 A;  3AN1 A;  4ITK A;  2H88 B;  3U2S C;  1C4A A;  2KQ4 X;  2WXO A;  3LYY A;  1YQ3 B;  3R2I A;  2K9X A;  5G5G A;  1JCK B;  1T5X D;  4RF0 A;  2PKO A;  1XLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...