1IUKA

The structure of native id.343 from thermus thermophilus
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
136
structure length
136
Chain Sequence
MNDQELRAYLSQAKTIAVLGAHKDPSRPAHYVPRYLREQGYRVLPVNPRFQGEELFGEEAVASLLDLKEPVDILDVFRPPSALMDHLPEVLALRPGLVWLQSGIRHPEFEKALKEAGIPVVADRCLMVEHKRLFRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a conserved CoA-binding protein synthesized by a cell-free system.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TT1466
total genus 42
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2002-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1iukA00
5CPBA 4E5YA 4BO0A 3SC6A 2NACA 2X7HA 2AQIA 2CVZA 4DXHA 2X22A 1GPDG 1FK8A 4DA9A 1V3TA 2ZB3A 3JQDA 4JP3A 3G79A 2ZCUA 3DZGA 2QZ9A 5G0SA 4D45A 2BI8A 4OKNA 4PG5A 4WUVA 3BTOA 4AJLA 2GO1A 1AN9A 1QLJA 1ZXBA 3ON5A 5DDIP 1H2HA 2EF1A 3WGOA 4IDEA 3UW3A 1X0VA 4I5EA 1B14A 2PH5A 5B4UA 5IDWA 3M1LA 4WEOA 1ZH8A 2CSUA 4A26A 4HX5A 4CPDA 2JJYA 1MA0A 1U8XX 4IDDA 4QO8A 1Q2XA 2CUKA 4WK6A 4XIJA 3VTFA 3BMOB 1Y5MA 2WD8A 4KQXA 1K6XA 3ASUA 4EUEA 3ZI0A 4PN3A 2PLAA 2Y0CA 2B69A 3M2PA 4WJZA 4TRRA 1NPYA 4FFRA 3RC7A 1X14A 1PGJA 2ZATA 3RU7A 2HKIA 1O5IA 1BW9A 1KEUA 2VQ3A 1QYWA 4JROA 3OFSA 5A02A 3RUEA 3CTMA 4BUCA 5FWNA 3NJ8A 2D5AA 4IS2A 2O50A 4E32A 5ICSA 2CFCA 1UAYA 2DBRA 3QE3A 4D41A 1WZEA 5DP1A 4Z6KA 2BGLA 5CEEA 3TQHA 2ZTMA 3S2GA 3R3JA 2Q50A 3K8ZA 1BG6A 2NQTA 1HDOA 4BNNA 2DAPA 4ALJA 4CMAA 1V9LA 1XR3A 2VUUA 4PLWA 3RBVA 1NVGA 4BMNA 3H5RA 4LW8A 5ENDA 2IZZA 3KO8A 2HSDA 3PWKA 1ENOA 4AJNA 4Q9NA 4WLNA 1PZFA 2PFGA 3A9WA 1E92A 1HYEA 2EGGA 1WDMA 2QZZA 3I6QA 2ZYAA 5AQ1A 3G3EA 1NVTA 2X4GA 4P4NA 3ZWXA 1C1XA 1U2DA 2FPIA 3PFFA 5DNAA 3ADOA 1B7GO 3HFSA 3QWFA 3I9OA 3ZHYA 1A27A 1ZUD1 5KJFA 1GAEO 3S2EA 3WGGA 2J5QA 1BVUA 1E6EA 2NVUB 2GZ1A 4LVCA 1FJHA 5I7VA 4F45A 3FWNA 3HDYA 2GDZA 1CQJA 4RV9A 1MGOA 3AUAA 4XDYA 2OXIA 3WS7A 4B3HA 1PX0A 2P4HX 3VVBA 2OGUA 4YYZA 4MP3A 4YQZA 1U5CA 3IP1A 3MOGA 2J3JA 2Y1GA 4WNIA 5G0VA 3ZHZA 2V65A 1G6KA 1UP6A 3H3JA 4FR5A 2PD4A 1VL6A 4MVJF 4BS9A 2A94A 1PJ2A 4GX1A 4K9DA 3OETA 2DTDA 1Y81A 3ADPA 2Y68A 5A5EA 4NJMB 2HQ1A 3PIIA 1Y8RB 5BSEA 4RVFA 1BSVA 4QX6A 5JFOA 2X0JA 5JAZA 1P0FA 1YONA 2X0IA 1JDJA 3W1VA 4F6LA 4J0FA 2HK9A 1LDEA 3NJ4A 3FD8A 4KWHA 3EDMA 5C7LO 3GDGA 4FFOA 1ZZEA 2QRLA 1F06A 1YWGO 3OP4A 2NLOA 1PWZA 4R51A 2DU8A 4H15A 4PLHA 1DJNA 2AQKA 5TGDA 3NYWA 3NAQA 2WD7A 2X1HA 4DIFA 3BMCA 3GZ4A 3OJOA 5JO9A 3U3XA 3DHEA 1BTOA 2AQ8A 1P31A 1MC4A 1LRJA 3JYNA 4B3JA 1DRWA 4B4OA 4NK4A 4RF2A 4Z9FA 3ZV3A 4NBRA 4BO7A 2D2IA 1I8TA 9LDTA 3EZLA 4IUYA 4YRAA 1HE5A 3GR6A 5KKAA 4NDNE 4MVJD 5F1KA 4K6FA 4B7UA 3ZHXA 1L1FA 1DSSG 1HDXA 3IKVA 5TC4A 4BNUA 3FNFA 3DAFA 3V5NA 1LJ8A 1RPNA 2HO5A 1HE4A 4W82A 4II3A 5TF4A 4XQEA 1E0DA 5FEUA 5THKA 1E7MA 2Y1EA 4QO7A 1R66A 2PV7A 1C14A 4JJFA 4RQUA 4UREA 4IIVA 3U4HA 3JD3A 5CDUA 2WJPA 4LVUA 3FTPA 4WLFA 4BO1A 3DMTA 1MC5A 4CR8A 5TRTA 1P9LA 4CMGA 5EIOA 3RFVA 1E1KA 1DBVO 4GWGA 4PLFA 9LDBA 4AICA 3FNEA 3H65A 3HN7A 4B8WA 2C5AA 3GHYA 4I5GA 2DTXA 1D3AA 1F0YA 3QHAA 2E4AA 5JY1A 2FRDA 4MKZA 3SJUA 4Q39A 1DJQA 4YR9A 3U49A 5I7EA 4FD3A 2W8ZA 1HF3A 3JD4A 4PLGA 5IDYA 3FI9A 2NWQA 3RWBA 4BKQA 4CV2A 1GYQA 2H5LA 2G1UA 2RH4A 1NTOA 5F5LA 2O3QA 1VI2A 4BNZA 2VHWA 2Q1TA 3FN4A 3KYDA 5ILOA 3WQQA 3PPIA 1G0NA 2DPGA 2AE1A 1CEQA 2WD7B 4E21A 1ZSVA 5BNIA 4QTZA 2QYTA 3KSZO 3AJRA 1TEHA 2H9IA 1GV0A 1XA0A 2ZTLA 3PZBA 4WKGA 1E3WB 2HDHA 5A5FA 3C85A 4R5HA 1TVEA 2VWGA 3Q9UA 4BO9A 5T6BA 2VOJA 4UUNA 3DOCA 1NHGA 1XELA 1EK5A 4LCJA 1UDAA 1I33A 3NT2A 1Q7CA 1HT0A 4BQRA 4AG3A 3WIEA 1GU7A 4RGBA 1DLJA 3MCVA 4PLZA 3KB6A 1EBFA 1SB8A 2JKVA 3BHIA 4R1TA 4XYMA 3K2BA 4DUPA 1A7AA 3E48A 3EGOA 4RPJA 2OUIA 3MTJA 4Y67A 1U1IA 3ANMA 1OFGA 2UV8A 5DCUA 4AJPA 1T4BA 4OM8A 2VUTA 1M75A 1O94A 5CFZA 4XR9A 2ZIZA 3BXXA 2Y67A 4R16A 1VKNA 1EEHA 3BMCB 5AXDA 4PRKA 4RF5A 1NAIA 4CM9D 4O0LA 5I7FA 4J91A 5TJ9A 4A10A 2OO5A 4N5MA 4W7HA 3U09A 4EYEA 1DIBA 1I01A 3ABIA 3BMOA 4QECA 1MLDA 5TQVA 5HWSA 4PLYA 4A2CA 4LGVA 4EJ6A 1KVUA 2O4CA 3DMTC 4XR4A 1K89A 3WG9A 3F3SA 4XRGA 4BKOA 3PJGA 3RUIA 3VTZA 3ZWPA 4OYRA 1UH5A 2YDXA 3DOOA 3GZNB 4TVBA 5L9AA 3MJCA 3QVWA 4U5QA 3RAJA 4D42A 4NHEA 2LDXA 3AY3A 2CF6A 4QEDA 4DIBA 1R4NB 3A1NA 4IS3A 4U8GA 4J2HA 3WMXA 2X5JO 1AHHA 1VC2A 4DC1A 1NHWA 1PL7A 2FWMX 2XAAA 2VNSA 4KUGA 2Z1MA 4DGSA 3DONA 1YBAA 4CQLB 2NTVA 1R4NA 5L7TA 3IIEA 2PK3A 3WGZA 5T67A 4MIYA 1YE3A 2E37A 3U4IA 4L75A 4M1QA 4NIMA 1DAPA 2JHFA 1PS8A 5A3VA 1QG6A 3NTRA 3WNVA 4CL8A 2RH8A 1U28A 3DAPA 4BNMA 3AY7A 3BMQA 3Q2IA 4ID9A 4AJ2A 3NEPX 5DP2A 4J4BA 1ZK0A 3I52A 1QR6A 4TRJA 2HMVA 2BH9A 4K6CA 4I08A 4FCCA 1PZGA 1PZHA 2FMUA 4PVCA 4U6QA 4FQ8A 4BIIA 3GDOA 5H81A 3RJ9A 2OZPA 2SCUA 4D7AA 1ENYA 2ZYGA 3LDHA 4BO2A 4CUJA 4UVHA 3RBZA 3OEWA 2J5KA 4ZQFA 1XG5A 3ZH2A 1YRLA 3L4BA 1R4MB 3L4BC 3OA0A 4Z3DA 3JSAA 1G1AA 3GVPA 2ZQYA 2W4QA 5B4TA 2OORA 4FS3A 4MIOA 5TT1A 4RPGA 4J1NA 2JCYA 4ITUA 1Y8RA 1HZJA 3S1LA 2OP0A 1C1DB 3RJ5A 4KTTE 2GZ3A 3U5TA 1B8UA 4HV4A 5IN4A 1GEGA 4GH5A 4MO2A 2C07A 4YBZA 5DZSA 5IFLA 4JBGA 3ST7A 4N5NA 1O89A 1YQGA 2Y1CA 3KSUA 3P2OA 2GYYA 3ROQA 1YO6A 2F00A 3WYCA 3HSKA 3WBFA 3LC7O 1JVBA 4QSMA 2I67A 4JQCA 4CMKA 1P77A 3NTQA 1D1SA 1JVSA 1VL0A 4HFMA 1ZSNA 5GMOA 4URFA 2DBZA 3RVDA 3VPSA 4E3ZA 2ZTVA 2Q4BA 3BZUA 3DC2A 1W0CA 5T64A 3TDKA 4BL5A 4AJ4A 2PZKA 3LC1O 4J4TA 4XCVA 1PTJA 3GOHA 3JQEA 1SEPA 4ONEA 1E1NA 3GF4A 1ULSA 3LYLA 4RPLA 5IN5A 1Z45A 1GQ2A 1ZCJA 3A14A 1G0OA 4H16A 4Q3AA 4WPGA 4QUKA 1JWBB 2JHGA 1W8DA 3FR7A 1E7WA 3ZNNA 1YB1A 3LLVA 3ZN2A 1XKQA 3ANLA 3L6EA 1AXEA 5L7YA 3DAGA 3LK7A 1B3BA 5COQA 2FPPA 3EZYA 1EDOA 1PR9A 4FBGA 4BNYA 5G4KA 4ZICA 2RBEA 1LUAA 3JQFA 2DQ4A 4OXYA 3TFOA 4OSPA 2HMUA 4R4JA 1ZO8A 1BXGB 2TMGA 5ER9A 4E0BA 2VHXA 5KKCA 5KJCA 1UZLA 2D0IA 2DBVO 3JQ7B 2PKQP 1QYDA 3L0DA 2IDZA 1MX3A 2YJZA 3PJDA 3JQBC 1TA4A 1FF9A 3KRTA 2XF8A 3EUWA 5JMWA 1NYTA 5F5NA 1ZSYA 4LCEA 3E5MA 4O1MA 5CP8A 3FR8A 2O7QA 2G82A 1ZK2A 3F1KA 1ISMA 5MDHA 3PK0A 2D3TA 2OFPA 3ENNA 1W73A 4XJSA 4PLVA 3PLNA 4HFNA 4IMRA 2P68A 4XDZA 1PGQA 2O2SA 3ONDA 3D5QA 3QLJA 1GV1A 4N54A 3EVNA 2AEMA 3PHJA 4ALMA 1Y9EA 1GYRA 2C54A 2EP5A 1UXKA 2QIOA 1O9BA 1RYDA 2HMTA 3F5QA 1U7TA 1IPFA 1MG5A 1KVRA 3I1JA 5JNLA 2GASA 3DBVO 3GEDA 5I8ZA 5U1PA 4R01A 4E5NA 3KTDA 2YQ5A 3DZJA 4YAGA 1WNTA 3C1TA 1GUYA 3F6YA 5A05A 5EQFA 3OIFA 4OH1A 3PYXA 1IHYA 1E3JA 4FFNA 2NQ8A 4PGFA 2WYUA 2PGDA 3LC2O 4DQXA 1QP8A 4UEJA 3RUHA 4BB5A 2PH3A 2O23A 4W6ZA 2EW8A 3EAGA 1GQQA 1K6JA 4S1VA 2FR1A 5I8WA 1YL6A 2BMAA 3OJ0A 5CG1A 3JQ7A 3AOGA 2J6IA 1E3SA 2NADA 4HXYA 3OF2A 4XQCA 1CERA 2YZ7A 3HE3A 3AW9A 3BA1A 3P2YA 4CMHA 3T4XA 4PG4A 2E82A 5IG2A 4EJ0A 2C29D 5JCJA 1N8KA 2HK7A 3T7CA 5L95A 1H94A 2EEZA 3HN2A 4NI5A 4ND4A 4BMSA 5JS6A 4HNHA 2V6GA 4J16A 3W8FA 4UUOA 3DB2A 2DFVA 4P8RA 4YAEA 3DHYA 1DIRA 3GUYA 3ZWYA 4E5KA 1F14A 4Q3NA 5EINA 1NR1A 4BKRA 3K96A 4CM5A 4R54A 2PKQO 1ZEJA 4UVGA 3W6ZA 3TNLA 1VKOA 1O6ZA 4XKJA 4J49A 4ZHSA 2O2YA 4JJGA 4YT8A 1IYZA 2Y0EA 1ZXLA 1LC0A 2UYYA 4Y98A 5A06A 1AE1A 3W6UA 3UN1A 2FP4A 2I66A 4GLLA 2EKQA 3VPFA 3PJFA 2HK8A 1T4DA 4GX0A 4GBJA 1DOHA 3WR5A 1YB5A 3O38A 4PIVA 3I9NA 1HLDA 1KVTA 3A28A 4B8ZA 1SO8A 2QW8A 4NFYA 3M6IA 1C0PA 1GCOA 2IE0A 4N5LA 2IODA 3MJ4A 1D7OA 3RUFA 4AFNA 5A9SB 4D0RA 3AWDA 4PG7A 4RLSA 4IBOA 1NR7A 5DCYA 3I9JA 3CXRA 3QWIA 1PJ4A 1KETA 2E49A 3H9EO 2NV6A 4FPXA 4NFHA 3VZPA 1P45A 3UICA 1NXQA 2GERA 2DUUA 1SEVA 3FRJA 1NFRA 1UJMA 1I5RA 4BMVA 5TSDA 4WECA 2DVMA 2RAFA 4RO0A 3BTUA 3P7MA 1JLLA 1J6UA 2J3HA 2W90A 3KYBA 3V1TC 1LEHA 2Y93A 3ZNQA 4AVYA 2YHIA 2NM0A 3SLKA 5C7OO 1U8FO 2VHZA 3HDJA 3QQPA 1T2CA 2Q46A 3BYZA 1ENZA 2PD3A 4YCAA 4U0KA 2YV1A 2AXQA 1V8BA 1GEEA 3ETGA 4ZGWA 1M6WA 4I9UA 2EIHA 5COBA 4TZKA 3AFNA 1B8VA 3DFUA 3TZ6A 3UKOA 1NPTO 4CM9A 3LU1A 2Q2WA 4RF4A 4L4SA 3DBLB 1CYDA 2A9FA 3PZRA 1ADGA 4IDCA 4M87A 2BKAA 2BFMA 3JYLA 4PLTA 4F3YA 1GUZA 3Q3CA 4X54A 3WGHA 4II2A 3MOIA 2WYVA 4BO4A 1CF2O 1HXHA 4EUHA 4QFDA 4GAEA 3NGXA 3ANNA 1SNYA 2CDBA 4EEZA 1DIHA 3PEFA 3ZWMA 2Y1DA 4F6CA 3QV1A 2GF2A 2YYYA 4HP8A 2VRBA 2AG8A 1ZJZA 4Z0TA 5A03A 1DLIA 4JCOA 1SPXA 4CMIB 1A4IA 2PA3A 4MKRA 4G81A 1NAHA 1Z6ZA 3F5SA 3VHRA 4TROA 4E4YA 5TLSA 4PVDA 1H6AA 3CUKA 4J90A 4CV0A 2IYPA 2C7GA 5IXSA 3KYCB 4LRTB 4J7UA 3WQSB 5IXYA 2GNAA 1ISJA 3R0IA 4CJXA 3STHA 1LDMA 1DFHA 3H2SA 4G2NA 4L76A 1QSGA 3E9NA 3KZVA 1MFPA 1E7RA 4M54A 4OIMA 3JQGB 4NBUA 2PTGA 1ISHA 2PY6A 3ONEA 3GDFA 1I3KA 2P9EA 3F1LA 3AUUA 4KQWA 1JWAB 3AUTA 2EJVA 4B7CA 2BGMA 3HADA 1GUFA 4KMSA 1YJQA 1QYVA 1A71A 1LRKA 2JFFA 1FDSA 1R0KA 4XB2A 2AHRA 1B8PA 3NDJA 3D1LA 3RSHA 3BHJA 3NDIA 2RCYA 1TI7A 3RASA 3TN7A 3VC7A 4BHTA 1WZIA 4JJIA 4CMEA 4OQYA 1EZ4A 4OKIA 4WCFC 5CPFA 1M66A 3TF5A 3I4FA 4PZDA 4BKUA 1E7YA 1ISFA 2VCYA 1DHRA 2DTEA 1EE9A 2UDPA 2VTEA 4BB6A 3PYLA 5JE8A 4A0SA 3WYBA 3G0OA 4CLRB 5HM8A 4ALNA 2P5UA 4GL4A 3W8DA 5JAMA 1WLYA 3E9MA 4NU5A 1T1SA 3WJ7A 5KVCA 5DCWA 1Y7TA 1KIFA 3I9KA 4CLDA 2EKPA 2CNBA 1DC3A 1O0SA 2LDBA 4R9RA 3ZZNA 2IXBA 1XLTA 2FZEA 3GPIA 1R0LA 1XGKA 3WYEA 4OQZA 1I2CA 3AM3A 5L53A 1HWYA 4TMFA 4F46A 2VT2A 5JCJD 2D4AA 1HRDA 5JLAA 2Q1SA 5FI3A 4EITA 2EG9A 4CM4B 1WAMA 1YBMA 2IRWA 1DFIA 3A4VA 5K9ZA 1EUCA 1IE3A 4IDBA 3LF1A 4CV1A 5BSGA 4WLVA 4ILKA 5K6AA 2BRUA 1T2FA 1Y5RA 3KUXA 4NR0A 4TRMA 4E2XA 4RQTA 3TOZA 1XQ1A 3EMKA 4YT4A 5KJ1A 1E3EA 4R5MA 3QIVA 4GGOA 1H2BA 1CQIA 3Q11A 3C1OA 2W98A 2WDZA 2Y99A 2A35A 2X5OA 4ALLA 2Y66A 4FN4A 5L4LA 3U9LA 1C1DA 2B0JA 2YFQA 3NTOA 3KETA 4UUMA 4C4OA 3SVTA 1PJ3A 1UXGA 3RIHA 1ZK3A 2OOSA 3G49A 3OM9A 3PGXA 3BIOA 3OEYA 3OJFA 1E6UA 5DF1A 3VAZA 3WQRA 1IOLA 4J0EA 4CLHA 2R00C 2X0RA 2ZTUA 1WMAA 1WWKA 2IXAA 3GRPA 3INGA 1HDCA 3JQAB 3KYCA 4Y8VA 2VYVD 4DTIA 4YT5A 3O9ZA 4GKBA 5COAA 4YAJA 2XOXA 4E5PA 5DBFA 5GZ1A 5BSFA 3GVXA 5ITVA 2ZK7A 4CM1A 3TFQA 1GZ6A 3B6ZA 3LT2A 4JBHA 4CQMB 5C3MA 2D59A 2HJRA 4IQGA 3IUSA 1Q7GA 1GFSA 2B4TO 3K6JA 4R1UA 3M1AA 4ZRNA 2AQHA 4DYDA 3D4NA 3WLEA 1KY4A 4I5DA 4GVXA 4DMLA 3H9UA 3UGKA 5L40A 4NNJA 1BMDA 4OOEA 3NGLA 4YTEA 1LLCA 3H6KA 3S2FA 3V2UA 3FCOA 3W4KA 3GC6A 3OIDA 3ZV5A 4E33A 1UXJA 4IPTA 4K1LA 3JQFC 1I36A 2O48X 1DPGA 4ALIA 5I9NA 4ZQGA 1LRLA 4GWKA 2X8LA 4CUZA 1I0ZA 1PQPA 1RJWA 4XJTA 1KEPA 3ITDA 3CE6A 3GEMA 3HJAA 4WCFA 4RVDA 5I9MA 1PQWA 1E3IA 1K2WA 3ZWVA 5A3JA 1E6WA 2VN8A 2O3RA 1LDYA 5EN4A 3QWAA 5HBRA 3B1KA 1J49A 5F1OA 4BGIA 4J1SA 4OO3A 4TWRA 3NKLA 1UP7A 4YJHA 3GN2A 2B5VA 1MUUA 1ONPA 5FYDA 1E1MA 1EBUA 1ONOA 3MJVA 4Y9DA 1T2DA 4W4TA 3LF2A 3NT4A 1BXZA 4GPD1 3OHSX 1R0SA 1X7HA 1Y1PA 3GQVA 1QORA 4OOFA 4G5HA 1I2ZA 2AG5A 3KM0A 4NK5A 1GTMA 1YJ8A 2VNAA 2HRZA 4FW8A 2VRCA 3GZNA 4DQUA 2UUOA 3AI3A 3D4PA 3VH1A 3LQFA 1OZAA 3ROKA 1GCUA 4H7PA 4ZD6A 1QMGA 3RUAA 2GSDA 3IP3A 3OJEA 2NVBA 2VWPA 1WDLA 2XPCA 4ZRMA 2FR0A 4NBWA 1J4AA 4BNWA 3H9GA 2RHCA 1DFGA 3DQPA 3PGJA 4A73A 3FWZA 1U5AA 5CG2A 2D5CA 4I9HA 4WCDA 3JQAA 4DWVA 5KIAA 1LQUA 4CM8A 3DMYA 4B3IA 3I6IA 3P19A 5BQFA 3JQAD 4ZQEA 4XYBA 1EK6A 4OL9A 3NUGA 3IJPA 4ROSA 4E5MA 5KVQA 3GVIA 1LLUA 1ULUA 1Z82A 3EK2A 4W7IA 2CDCA 1N9GA 4KUEA 1QKIA 1ZFNA 3QRWA 3TL3A 3GLQA 1EUZA 2BELA 1BXGA 4XGNA 2NTJA 3AY6A 4CV3A 5G0TA 1U4OA 2CF5A 2D8AA 3MWDB 1VJ0A 4ESOA 2BHLA 1OC2A 3I9MA 3FF4A 3HDQA 3MZ0A 3D3WA 1GQYA 3FPLA 3KOUA 1PJBA 1JTVA 1N7GA 3F4LA 3ZU2A 4FFLA 3E5RA 3KXDA 4PRLA 2G5CA 3JYQA 1D4FA 1RM4A 2A92A 3RC2A 3LVFO 3INTA 4RPHA 3QP9A 1PS0A 2J8ZA 4B7XA 3QWBA 1IZ9A 3VKUA 4D43A 4INAA 4M55A 1E7SA 1NNUA 5JCXA 3GVHA 3O8QA 4E2ZA 4IZIA 3Q0EA 4MVJA 5EL0A 2FN7A 2X58A 4UAGA 3IDSA 3JQ9C 2IZ0A 3DZKA 4E6PA 4EJMA 2O7SA 2YW9A 1WVGA 1CIVA 2WWRA 3GEGA 4FGSA 3V8BA 1E77A 2YV2A 3GNSA 4YB8A 3L9XA 3GNTA 1GY8A 3HFGA 3UH1A 1PGNA 3HHPA 4BGVA 3WX0A 1NQ5A 4OHUA 3UHAA 1FDTA 1KC3A 1DIAA 5A04A 5JMPA 1P1KA 5ILGA 2B5WA 1DC6A 1HL3A 4CLRA 5CEJA 5CDSA 1W4ZA 4P22A 1B3RA 4WLUA 1GD1O 1QYXA 1K0UA 3ETEA 3GH3A 3N7UA 4NBTA 2NNLD 4EEXA 4J43A 3I3OA 4WLOA 4Q3DA 4GLOA 1MXHA 3IAHA 5EQDA 1BGVA 1HSZA 4R3NA 1VSVA 3UOGA 3QW2A 1PGPA 4XWYA 1XCBA 1UUFA 3PJEA 1JAXA 3A06A 2ZB4A 4IXTA 5T8KC 3HNPA 1BW9B 4IGEA 1PU2A 1B2LA 4CUKA 2WE8A 5KNLA 2O3TA 5K0ZA 4AJEA 3DZHA 3E8XA 2CVOA 4UVIA 4OGWA 2DPHA 4DVJA 1XEAA 1P1RA 1P3DA 1QYCA 1YQDA 2P2SA 3I5MA 1KERA 1BDMA 4CM6A 2P5YA 5B1YA 1Y8QB 2PZJA 3VPHA 4S3MA 4J6FA 2Z1NA 4CQMD 1V3VA 3ICCA 2VRCD 3TZHA 2Y0DA 4RVSA 1GYPA 1CRWG 2R6JA 2IEBA 3KEQA 4FJ0A 1RM5A 1ZW1A 3NV9A 4AJJA 3WIDA 4FFMA 2GRAA 2ZCVA 4NU6A 5JDCC 3T4EA 4E13A 2DLDA 4ZQBA 2GD1O 4Z0HO 2X0NA 2JFHA 4I1IA 1OC4A 2P9CA 3GG9A 4FSHA 4NZ9A 5B37A 1ZIDA 3HZZA 3OA2A 5DOZA 2AW5A 5BSHA 2J3KA 4KP7A 1BRMA 2O3SA 5JYEA 4JBIA 3JYPA 4O59O 4YAKA 3DO5A 3H5NA 1IPEA 1HLPA 2VYND 3DHNA 4WOKA 4GSKA 4IJVA 3C7CB 5CDGA 1MB4A 3BMQB 4XD2A 1EVYA 1QV7A 2GN6A 2JD1A 4XB1A 2WMDA 3RKRA 2NVUA 4ZA2A 1N7HA 2VZ0A 3ETDA 3GAFA 1Z74A 4YRDA 1GR0A 4L73A 2Q45A 1VJTA 3PDUA 3Q9NA 2CDAA 1SBYA 5DBIA 4DQVA 4ND5A 2PGJA 1Y9AA 4NQZA 4HFJA 1NPDA 1NP3A 1EQ2A 3CPSA 3GMDA 3WMWA 3PXXA 1H93A 3UVEA 3F47A 4JNKA 1HSOA 1YGYA 3PHGA 3PVZA 1M2WA 1P74A 3LT4A 1YBVA 1TT7A 1DIGA 4D3SA 4AJOA 1I2BA 1E3LA 3ASVA 4QXMA 5K6AC 1HDZA 1AGNA 2H6EA 4M49A 4UULA 3GAZA 1IZ0A 2J3IA 3B1FA 1X13A 3CSDA 3DTYA 3PHHA 1DXYA 1U3WA 2JFGA 1H0KA 2UAGA 4XYEA 4Y6PA 4A27A 1GZ3A 5G4KB 1GDHA 1H6DA 3GFGA 3ZWCA 5A4DA 4WNCA 1NWHA 2JCVA 4UEOA 3H7AA 2E6UX 2BLLA 2VT3A 4DC0A 3EC7A 4PZEA 2GR9A 3VKVA 3C24A 3WDSA 3ULKA 4JP2A 1WDKA 4MIEA 3DBHA 2QHXA 4E30A 2JL1A 2RIRA 4YWJA 1PEDA 3S8MA 5FF9A 4L4RA 3UFXA 4RJTA 5U4QA 2B36A 1B26A 4IJWA 2EJWA 3K92A 3HB4X 2X5KO 5FFFA 1ORRA 1VM6A 4CMBA 5JDCA 4DYVA 2QG4A 1XYGA 4R1SA 1P1FA 2YFHA 1Y6JA 3IJRA 5JSFA 3JQGA 4MJLA 4YA6A 2B83A 2VHYA 3HDHA 4R9SA 6LDHA 4GKVA 1NX6A 1LI4A 4B4VA 3W4JA 2VYVA 2VTDA 2O3UA 1YKFA 2CD9A 2GN4A 3O4RA 5L4NA 3LSYA 2ILTA 5JY6A 3OQ1A 3P5SA 4YJFB 4MVJG 1HTBA 3GNQA 4XRRA 3GT0A 4BO5A 1EMDA 3VH2A 4QFCA 3WOHA 5LDHA 4N7RA 2VUSA 5AVOA 2YHUA 2Q1WA 4LSWA 5G0UA 4E31A 4GGPA 3VDRA 1SC6A 3IUPA 1ZEMA 3JQ8B 3JYOA 3WBBA 1XDWA 3UCFA 1PR3A 5AXAA 3QVTA 1R6DA 3JV7A 3UXYA 4D0SA 3D64A 1VPDA 2HMWA 4NPCA 1X0XA 3KYDB 1NWCA 3BTVA 3UUWA 5EPOA 4E12A 1NQAO 1P1HA 1ENPA 1X1TA 3DXFA 3JQ6A 4MVJH 2PZMA 2XXJA 4J7CA 1P1IA 2FSSA 4I9NA 4I8XA 1I30A 1FDUA 4JLWA 5IJZA 5G2OA 3WFIA 5JW6A 1ISIA 1UDCA 3R3SA 4DREA 3GG2A 1IUKA 1PJLA 4MVJM 3WSVA 3JQ8A 1ZNQO 3WGIA 3F46A 2I5PO 1JKJA 2VYNA 2ZJ0A 3JCZA 4MVJI 3NT5A 3ROPA 1JU9A 3ZWWA 2EV9A 3H2ZA 4J3FA 3DZBA 4XIYA 3ZW9A 2HJSA 4KDEA 3C1AA 4WE3A 3JQCA 3VH4A 3W4IA 4ND1A 1H5QA 4RF3A 4DLBA 3GRKA 4U0JA 2UVDA 1XWFA 3H3FA 1L7EA 2QRKA 2VOEA 3OBBA 5KJ6A 1ARZA 2IYOA 2OL4A 4WASA 1VRWA 1UR5A 4MP6A 4WEQA 3AK4A 2BFAA 1F8GA 1MP0A 3I83A 4YQYA 5TNXA 1J5PA 3SBOA 2JAHA 3PHLA 3WGYA 1VSUA 2R00A 3E1KA 3VZRA 4A7PA 4BNTA 3CH6A 3TPCA 3SLGA 1UDBA 4I5FA 3VVCA 2EW2A 5C37A 3TSCA 4FJ1A 2NVWA 4TKMA 4C7KA 5BT9A 3TJRA 3VH3A 1SOVA 4PG6A 3TWOA 4M89A 1LNQA 3RBXA 1FMCA 1JW9B 3JD1A 3ZU3A 3GY0A 1PQUA 1HYHA 1YL7A 3DL2A 4HFRA 4B79A 4DRYA 4OXKA 5A9SA 3QSGA 1OAAA 2V6FA 2HCTA 1Q0QA 1I3MA 1N1GA 2C0CA 1VLLA 3DZFA 4L8VA 2HU2A 2H63A 1C1XB 1IB6A 3TZKA 1B0AA 1B16A 3IOYA 4M8SA 3OJLA 3RU9A 1T1RA 3D3EA 1OMOA 4G65A 4L9RA 4R69A 3D4OA 4J1TA 1UAGA 4Y6SA 3JQ9A 5ES3A 1NQOA 1JAYA 1EVJA 1PJCA 2ZQZA 2YHIB 1A7KA 2A4KA 4B4UA 2GN8A 3CZMA 2AEFA 1Q1NA 1E3WA 3CINA 3GUCA 3COSA 1DHTA 4EZBA 1JKFA 3HUDA 4PFJA 2X6TA 3PRJA 1ZK1A 4CMJA 4AJKA 1R37A 3O8QB 4RDHA 4DPMA 2RHRA 2VZ8A 1V35A 1MV8A 1KS9A 4KWIA 3OQ6A 1JN0A 4D3FA 3VOSA 2FHSA 2Q2VA 4LRSB 1I3NA 3V2HA 2J5RA 3CEAA 5KVSA 3C3XA 4RPKA 1BXKA 5EERA 1ID1A 3UF0A 2GZ2A 3AI1A 1KVQA 4FIZA 4MP8A 3K31A 4KDFA 3PQEA 3JQBA 2B37A 3X2EA 1DEHA 3K9QO 2Z5LA 4MOWA 2JCXA 3ZNOA 3KVOA 4PCVA 5F3RA 1U3UA 4RVHA 1HZZA 1ZK4A 2NUAA 1ZMTA 2B35A 4BO8A 1D8AA 4EGFA 2EXXA 2BFOA 1Q0HA 4J9UE 4CODB 3FPCA 1V0JA 4WCFB 4CQLA 1PJQA 3WLFA 2Q99A 4W99A 4OMUA 1ZJYA 2C5EA 1ISGA 1VJ1A 3H9JA 4FDAA 5A1TA 3U4CA 4GSLA 1YH3A 2FOIA 1YB4A 4YACA 4M86A 2PKRA 2YDYA 5T8KA 3FHLA 4N18A 3ZWOA 2WSBA 5T5QA 3WFJA 1LSJA 3PTZA 4EBFA 4AJIA 4CMCA 3MJEA 4BNVA 4LMPA 3QVXA 1BWSA 2Q1UA 2QQ5A 4IZHA 2V7PA 4HY3A 4CM3A 4FOOA 3D7LA 5CEFA 4IDGA 4RORA 4Q3EA 4D79A 5IZ4A 2WM3A 4YDRA 3GN1A 2DT5A 1DRUA 4BNXA 1T2AA 3ZWBA 3GGGA 2PNFA 5AOVA 3VDQA 1F17A 4FJ2A 5F21A 1O8CA 3E18A 3RI3A 1A72A 4EI2A 1N1EA 2EKLA 3JD2A 3DBRB 4MPDA 4O5OA 3B70A 1LQTA 4P38A 3AU8A 3PLRA 3WICA 1I10A 1YXMA 1CDOA 2NSDA 3QWHA 4JIGA 1PL6A 4IQ0A 1HYGA 3CMMA 1XHLA 3BTSA 3QVOA 1IY8A 4TRNA 4YJFA 5F1PA 1WW8A 5C5IA 1UP4A 1LTHR 4QQRA 3SX2A 1TXGA 1PJTA 2FSVA 2OHXA 1SB9A 3ROMA 1EVIA 1N92A 5G0WA 1D1TA 8ADHA 4HWKA 1DC4A 4XEHA 5JC8A 3AUSA 5TJHA 1TB4A 3ZCXA 1I24A 5G4LA 4QT0A 4HBGA 1U3TA 3JD0A 3PHIA 3AFMA 1TT5B 3B1JA 2FZWA 1CWUA 3MWEB 4KZPA 1H9BA 4JK3A 1L7DA 4Z0PA 5ADHA 3H5AA 2BD0A 3TL2A 2AMFA 4AJ1A 2Y1FA 3BMNA 4PZCA 2BGKA 5JO0A 4Y6RA 1I3LA 1TT5A 2FPGA 2PD6A 1PZEA 1YOVA 4H3VA 5IDXA 2IZ1A 3UCEA 1E7QA 5AYVA 4NJOA 1C0IA 3H8VA 2BI7A 2W2KA 4L0QA 7ADHA 2NU9A 2OBNA 3ZNPA 5TIIA 1QLHA 3WWYA 1U9JA 2NU6A 5IDQA 4FB5A 1EE2A 5BR7A 1E1LA 4YVFA 4LSMA 3MJSA 3ZWNA 1P33A 4D3DA 3RKUA 1DAOA 3ZU5A 5TX7A 4NJMA 1RM0A 2VHVA 1T24A 1QXSA 2TMDA 5AXCA 3C7DB 1R4MA 4NH4A 3CMCO 3GA0A 2X9VA 2VWHA 2GPTA 3AM4A 2B4QA 2I3GA 2GCGA 3L9WA 3EVTA 5IZCA 3LLSA 3PQDA 3WTBA 5C7IO 4R68A 3IC5A 3AOEC 4BNFA 2AA3A 1M76A 1MG0A 3FBTA 1LDBA 1A9ZA 2UUPA 2XXBA 1RM3A 1YL5A 1PSDA 4W9NA 4W9NC 1DC5A 3D0OA 5LC1A 3UCXA 4O6VA 3G1TA 3H4VA 4AL4A 4AJHA 3JTMA 3VZSA 4DPKA 1OI7A 4LMRA 2HAEA 5ICMA 1WMBA 4BO6A 2H1SA 2Z95A 1NASA 3EYWA 3TRIA 1LC3A 2I9PA 1HE3A 2G76A 1P44A 4DIOA 4PLPA 4UVEA 4IDAA 1Z75A 1K5HA 4YJGB 1R16A 1N2SA 1GL3A 4UVDA 5HA5A 4ZJUA 2OBYA 5KVVA 1A5ZA 3RFTA 4A03A 3RC1A 1LLQA 1P1JA 4PG8A 2I6TA 4Z9XA 3KLMX 1XQ6A 3WJAA 2NU7A 3L6OO 1KEVA 3E03A 4IM7A 1DRVA 2FR8A 1DDOA 3L77A 2POQX 2EGHA 2VWQA 4OAQA 3WB9A 2HLPA 1V6AA 3CZRA 3KV3O 1LDGA 3HWRA 1AUPA 1QV6A 1LU9A 4B4WA 4IINA 3T7EA 4YRBA 1J0XO 4YJHB 4MDHA 4IIUA 4DBVO 5JBIA 2BF7A 3Q1LA 4J4HA 4FC6A 1H9AA 3IKTA 4DMMA 1EDZA 2GUGA 1XU9A 1HDYA 2PR2A 4BO3A 2WEKA 2X86A 5TT0A 2GLXA 2HUNA 4RL6A 2C2XA 5THQA 3TZCA 1YDEA 5GZ6A 2V6BA 4HADA 2X9GA 3NX4A 3DOJA 4IQ8A 1KY5A 1X7GA 1HKUA 2G17A 1O95A 2AE2A 5T57A 4RVUA 5EMHA 3MEQA 1FXSA 2X23A 5KJEA 3TOXA 1Q7BA 3K73O 4YXFA 5JAIA 6ADHA 2O3JA 1S6YA 5DOVA 1M67A 2NU8A 1WP4A 5U9CA 1U2GA 4ZU3A 5AXBA 3WWZA 4IMPA 1LA2A 1SAYA 4WGGA 4XYLA 3ITKA 4J2OA 3WXBA 5JDIA 5HTOA 4ND2A 5EJ2A 4CM7A 4WOJA 3O03A 5DBGA 3VZQA 4YEDA 3FBGA 3OSUA 5BNFA 1ZMOA 2C7VA 1FDVA 1DO8A 3DFZA 4BQPA 3RC9A 5KOIA 3U62A 4BNJA 2C82A 1YOVB 1PJSA 4BNHA 3D5TA 4OXNA 2C59A 3DR3A 1UZMA 3ZHBA 2I76A 1UXHA 2E48A 3V2GA 4CLOA 4BGUA 3N74A 3KSDO 2YY7A 3EW7A 4EDFA 4LK3A 1IULA 2YQ4A 4FFPA 5B4VA 3PP8A 1U3VA 1X1EA 3VPXA 4CMEC 2YUTA 4IGFA 4J7XA 1NVMB 1IL0A 1ZVMA 3L4SO 2P91A 4ZN6A 3GPDG 2WTBA 4GMFA 1BDBA 1YS4A 3AM5A 3OECA 4CR6A 1H6BA 2IEDA 4JXKA 3SC4A 5EESA 3ZV6A 5HS6A 4FC7A 3PI7A 1H6CA 5KWEA 1E5LA 2QYSA 1EQUA 3SEFA 2DFDA 8LDHA 1R12A 1HE2A 4ZQHA 4YT2A 3SJ7A 4HUJA 1EFKA 3I23A 1KC1A 3ZV4A 4GX5A 2JD0A 1F12A 4JGBA 5IAAA 3KBOA 4UUPA 1XU7A 1NFFA 2ZJ1A 3ZGYA 4BV9A 1ADCA 1N9GB 3FNHA 1QRRA 5KCZA 2NTNA 3WNQA 4BKPA 3KLPX 4J1QA 1PL8A 4MVJE 5H82A 2EWMA 5ER6A 2EERA 3RUCA 3GK3A 1AHIA 3L07A 2C20A 5IZCC 7MDHA 5ITWA 2B4RO 3K30A 4RZIA 1JKIA 4KUHA 4ND3A 1LDNA 1NQTA 2YV3A 4U6SA 5HS4A 3OQBA 2BFPA 2Y1OA 1ADFA 4GI2A 4EW6A 1LSUA 4TQGA 1PS9A 2P9GA 1U4SA 3K5PA 3LT1A 4GMGA 1HEUA 1LLDA 1YDWA 4IDFA 2DC1A 3LT0A 4CLXA 1LX6A 3I4CA 4GX2A 3OICA 1RYEA 5A9TA 3GMSA 3OIGA 1ZBQA 5L3ZA 3ENKA 4BNLA 1JA9A 3ONFA 3LZ6A 4GVLA 4YJDA 3BMNB 1LBEA 1RKXA 4XA8A 1GADO 4CLEA 1ONNA 3FSRA 5L51A 3Q2KA 4DPLA 1SOWA 3OH8A 4CL3A 1EUDA 1Z7BA 5L45A 2VZ9A 5JC1A 1ADBA 3PWSA 3R6DA 1NM5A 3GGPA 3PQFA 5JYDA 1KVSA 1V3UA 4MVJP 2EHDA 2OMEA 4D46A 4IJUA 3KEOA 2EP7A 5I9LA 2Q3EA 3BAZA 4Q3CA 1PIWA 5LDGA 3NRCA 1KOLA 4FOSA 1Y8QA 5L7WA 3DDNA 4U7WA 3WGQA 4R3WA 4Z3KA 5DT9A 3GVCA 1SMKA 3I9LA 3DZIA 3E6AA 2ZB8A 3O26A 3IQDB 3K2EA 4EUFA 1N5DA 1C0LA 4YJGA 3UAGA 2GN9A 2V6MA 2JAPA 2G0TA 4J9VA 2CVQA 2JD2A 2W2LD 5FI5A 1A9YA 5B12A 3ICPA 1WPQA 3RFXA 3WGTA 1FDWA 4WLEA 3SXPA 2W2LA 4DL9A 4NBVA 3DBLA 4K26A 4E2YA 2DUWA 3Q6IA 1S7CA 1UXIA 5J23A 3FTNA 5JAQA 1E5QA 1CETA 1AXGA 4XGKA 3RD5A 3E82A 3N58A 1KBZA 1TLTA 5MGBA 2HRBA 4P4GA 2HMSA 5JXWA 3C8MA 1I32A 1LXCA 3IMFA 2QX7A 4NMHA 4ALKA 4IXWA 2CZCA 4RDIA 4RZHA 4CQMA 5H83A 5KTKA 5DN9A 2CMDA 4R1NA 3H9QA 5ENVA 1RWBA 1W6UA 3WTCA 3ZU4A 4BOYA 1T2EA 2AEJA 5CDTA 1U7HA 3GFBA 4K28A 2X9NA 3INRA 3GHHA 2ET6A 3BHMA 1K6IA 2FY8A 4ZVVA 4O63O 2GGSA 1MXFA 1DB3A 3AU9A 5A9RA 1YVEI 2R2GA 4R41A 1OBFO 4NG5A 1Q0LA 4BGEA 3QA9A 3ZWAA 2DBQA 2Q4EA 3HG7A 3ORFA 4IY1A 5GZ3A 1X15A 4OJNA 4RLHA 1LSOA 4XGIA 4DLLA 3IL2A 3MTGA 1HDRA 3W8EA 2W2KB 3L6DA 3FNGA 2PWZA 1NBOA 5DULA 3OMLA 2I3AA 3DBHB 1PGOA 4E2WA 3D3WB 3PFWO 4Q3BA 1SCUA 4CM4A 4HNGA 1OOEA 1A4UA 4TZTA 2OP1A 1EVZA 1KEWA 4KTVE 4XX0A 4YPOA 2D1YA 4XYGA 3ZDFA 1T26A 3NDRA 1P0CA 4TSKA 2PGLA 4CLOB 4DLAA 4P4LA 3ZW8A 3F9IA 1BHSA 1LSSA 4XQGA 3S2IA 3RROA 1HDGO 4A5OA 4NFSA 4CM8B 1MFZA 5I7SA 2ZB7A 3WSWA 4IJKA 1GZ4A 3CKYA 1BVRA 1K3TA 1M6HA 4BNKA 3RQSA 3PDJA 1IHXA 5TS3A 3X2FA 5JPIA 1UZNA 2ZKLA 1T25A 1F8FA 2QRJA 4KOAA 4CMIA 2Q49A 3QY9A 3IS3A 3V1YA 4BV8A 5L4SA 3PYMA 3DWFA 1GPJA 1ZKMA 3AOEA 3EHEA 2DM6A 2CY0A 3G17A 4TVOA 4DBZA 1C3VA 3VPGA 3AI2A 2ZYDA 4MKXA 3KHUA 3PWZA 3MJTA 3R1IA 2DKNA 4LN1A 3U0BA 5GY7A 2WYWA 3E9QA 4PLCA 1HETA 1KYQA 2C2YA 1R15A 5CAEA 3HB5X 4MINA 1SZJG 3DTTA 4YAIA 3V1UA 3DBRA 1CJCA 4D44A 4XZ3A 3DEYX 5HRUA 4XQ9A 2PZLA 2O4UX 3PIDA 1VE9A 4UEKA 4C7JA 4RVGA 1VL8A 2F1KA 3EY4A 4JN6B 2I65A 1XSEA 5JDIC 4CR7A 2WE7A 3GGOA 3RCBA 4Z9YA 1C0KA 1XIVA 4OSOA 5LCXA 1B15A 4GQAA 1X7DA 2I99A 3S55A 1Z7EA 2P4QA 3F4BA 2Q2QA 4BNIA 3CIFA 4FGWA 5CDYA 3QVSA 4HKTA 2Y05A 5IF3A 3RUDA 4L4XA 5CHEA 1JQBA 1NFQA 3M2TA 4JX8A 4L74A 3U4DA 3C7AA 1WXDA 4TKLA 3B20A 1ML3A 1YQXA 1EFLA 3HQ4O 4BVAA 4RCVA 3QJ5A 4LISA 1PWXA 1Z73A 5BNTA 3TZQA 4BNGA 3G1UA
chains in the Genus database with same CATH superfamily
2OHHA 3K0HA 2HV9A 3OFKA 5EEHA 2ACVA 5EIXA 1TYAE 3UAXA 3QXHA 3SC6A 3TFWA 1PT8A 1TTTA 1W0JA 1DJMA 3F7OA 1ZWLA 2CVZA 4ZODA 5ESXA 1FK8A 4DA9A 1V3TA 2ZB3A 3C4JA 5DGTA 2O8EA 2Q6TA 3DZGA 4OHWA 821PA 1M6VA 5G0SA 4D45A 1XAHA 4PG5A 5SY9A 4GYYA 2PJUA 3BTOA 4KGXA 4WUVA 2GO1A 2YFYA 3FWKA 2J6BA 1Z6GA 2Q3CA 4IDEA 1G2IA 3HXKA 3KQMA 3E35A 2PH5A 3N0WA 1XZDA 3JRNA 1NN3A 1Z6PA 3IAXA 3M1LA 4WEOA 2CSUA 2CKMA 3WV4A 2CUZA 1QF9A 3L8EA 4HX5A 3RIGA 2PUAA 2DLCX 2CUKA 2P5SA 4KQCA 1OCEA 5JD4A 3BMOB 1NBWB 4RYDA 1YJ5A 3STXA 4BC0A 1K6XA 1SCJA 4EUEA 2LGJA 4ESVA 3ZVRA 2Y0CA 5FBHA 5EWLB 4F21A 1V1RB 1XMJA 4PC6A 1M2OB 4FZ5A 4TRRA 1NPYA 1UQRA 3RC7A 2GCEA 2O8CA 2ZATA 4ZDWA 2HKIA 1W48A 1O5IA 1BW9A 4KO1S 5BN5B 5HUHA 1L1EA 1SXJE 3OFSA 4IIBA 4OBEA 1QHNA 5DTQA 4HDRA 1GUDA 2F48A 3U19A 2Z2KA 1XTUA 4E32A 2C2BA 2O50A 5ICSA 4B31A 3PDHA 2DBRA 2XB2A 3QE3A 3WYGA 2Q5OA 4O4JB 4MWOA 2G80A 4X1YB 4Z6KA 3MD9A 3B3AA 4OKSA 3S2GA 2H16A 2Q50A 3K8ZA 1P5JA 4MQLA 2NQTA 1HDOA 3HUUA 2DAPA 1TYEB 3BDAA 1C8VB 1YR3A 2CEAA 2PRSA 3OC6A 2F3UA 3TO5A 1XR3A 2VUUA 2X77A 3KJXA 3HNRA 5D51S 3OFJA 4IZ6A 4A9AA 1NONA 1X80B 3BGSA 4LHXA 4LW8A 4M9RA 1OGYA 4QPCA 2WIBA 5JCPA 3KO8A 3PWKA 3IIJA 2VDJA 4Q9NA 4Q3LA 4WLNA 4ASUD 1PZFA 3K5IA 3A9WA 3HUTA 3LECA 4M9XA 1E2QA 1E92A 4O2AB 1ECCA 1EZZA 1U98A 4ZU1X 4ZI7B 4E4RA 3I6QA 2ZYAA 5CBKA 1QQAA 2XCQA 3G3EA 3KQHA 2MJLA 1C1XA 1N6OA 1YDMA 2FPIA 1QUEA 2JFNA 3VC3A 5DNAA 5KTTA 1LS6A 4UD6A 5KYXA 1S89A 1TUBB 4MLPA 4RIIA 1ATIA 1B7GO 2J09A 3HFSA 1HEYA 1RKQA 3D1JA 3HWX1 1A27A 1JBKA 3MELA 1RRGA 1C7FA 2DY0A 1Z7GA 2Q3MA 3IR5A 4I1UA 4R2KA 4U63A 1GAEO 1ZC3A 4BP8A 2LCFA 2Z5VA 4MKFA 2JPDA 4WZAB 4JASB 1TUEA 1WUTA 1EFDN 2D1SA 3CPEA 4LBZA 4CE6A 5BMVF 2GDZA 4AZVA 3F67A 2VPTA 3ZCSA 2J3MA 4EVRA 1DAGA 2P4HX 4ZCMA 5CT8A 2ZBVA 2OFWA 2Y3IA 1D2NA 2PJZA 3IP1A 1V2HE 3LHIA 4ZOLA 5EJMA 2Y1GA 4AF7A 4PZUA 2OGSA 1G6KA 2N46A 1IQPA 4PU0A 2AFHA 2FPUA 1UWLA 2X14A 2ZXFA 1PJ2A 5IAKA 3GJXC 4K9DA 4TXNA 2WFLA 3IP9A 4WBSA 5ARCA 2DTDA 3JW8A 3THOA 2X2PA 1EFAA 2Y68A 2WSSA 5HKLA 3E7DA 5EIWA 4MV5A 4NJMB 1P5FA 4B3MB 3K70C 3IR7A 5JAPA 3PIIA 1Y8RB 3I2IA 4X6XA 1BSVA 1U0NA 5E8JA 2CNLA 1EP2B 1HLFA 1ZCAA 4Q15A 4INJA 4PXAA 3U56A 4K8OA 2X0IA 2LD4A 2RGCA 2XADA 1QRAA 1VBMA 1WUHS 4JUBA 4KSBA 4DDKA 2ORYA 1XZHA 4F6LA 5INTA 2XWJI 2Z8YA 4ZYVA 4NV1A 4D8VA 2E4ZA 4KWHA 5EGSA 4I2NA 3DT6A 3KBBA 5H59A 3RJMA 5LQRA 4Z51A 4P3OA 1L5RA 3KDPA 4KXFB 5J4VA 3DBIA 1PWZA 1RI1A 3A3NA 1NF3A 1XVUA 2HSJA 2WD7A 5FJJA 2ICAA 2BSXA 3KEGA 3GZ4A 4JB8A 1UC8A 3OJOA 1MHTA 3LX4A 5JO9A 1U3DA 3U3XA 5IBCA 2K7FA 3E0QA 5FO0A 4M9QA 3H0EA 4Y6GB 3S70A 5IUJC 1MO5A 1YS7A 4RF2A 5AJHA 4Z9FA 4BO7A 3QVMA 1YQ9A 2OHJA 3BFJA 3PQ5A 3ANYB 1I8TA 1KAHA 4PX2A 1VL5A 4XUCA 4F56A 9LDTA 3VKGA 4IUYA 5CLQA 1Z68A 4AY2A 2YWFA 1C7JA 2TRSB 1HE5A 1SR8A 2WU4A 4G1EB 1Z2CA 4BECA 3L6RA 5F1KA 4K6FA 5EJ5A 4ARCA 3ZHXA 2I2DA 5AI5A 3IKVA 2WUVA 4PCAA 3FNFA 3DAFA 3V5NA 4CU5A 3IGFA 3P4XA 1RP7A 3S8YA 2QJFA 1I3CA 3CLVA 4HYYA 5D86A 2QTCA 4C2AA 1RKBA 2Z8YM 4WHMA 5JZ9A 3RK4A 1LFDB 2I3DA 2GLTA 3IDQA 2CT8A 3GLIB 2HJVA 1OTYA 1R66A 3IE0A 4B3GA 1K4KA 3QLUA 3JD3A 5CDUA 3G0BA 1PYOA 3KUDA 3T0IA 1EX9A 5JLJA 2WPDD 4WLFA 5ALXA 4CR8A 4I8DA 4MUMA 1OHHD 1YVUA 1VLZA 2VSXA 2VPIA 3FNEA 4KQGA 1GVHA 1I4DD 2C4WA 4OHVA 3S7ZA 5CURA 2DTXA 1F0YA 2W6JD 5E0OA 1D9XA 2Y2VA 4PEVA 3E23A 4IV5A 3PPVA 2EFEB 4Q1EA 4BX0A 4JLOA 3EPPA 4Q39A 4GDFA 1DJQA 3I1YA 3KKLA 4WZAA 5AJUA 4FD3A 4OXIA 1W4RA 4CV2A 4PLGA 5IDYA 1HDIA 3A1WA 1MH1A 3V55A 5K0FA 1JBEA 1GYQA 2H5LA 2G1UA 2RH4A 1NTOA 2IU3A 4YPVA 4UCWA 1KJ8A 1VI2A 1XZ8A 2VHWA 3COYA 2Q1TA 1ND5A 2XYQA 2O8DA 1P0MA 1CEQA 4PSUA 1B6SA 2HPAA 3O8NA 4LWPA 3AJRA 2WM9B 1U9ZA 1N0WA 2H9IA 3N8GA 1XA0A 2X2OA 3L1VA 3PZBA 3HKCA 1RCUA 1RWKA 4JY7A 1ADYA 4CZ2A 1XKXA 1WDWB 2O59A 2FX5A 1SOUA 4FYIA 1TVEA 2VWGA 2FAXA 4YRNA 5GVSA 1NBAA 1IM5A 3D8RA 1XELA 3NHMA 4OHZA 2WU0A 2BEVB 1AU9A 2RARA 5FUXA 1I33A 3VDNB 2BHRA 1KE1A 2NXCA 3UT5B 2LCIA 1N2HA 4Y2RA 2O06A 4HGZA 1GU7A 3E9EA 4US2R 3QYAA 1EBFA 1XUOA 1RRCA 4CI9A 4R1TA 3SIWA 1LI7A 2GO7A 4LXUA 4XYMA 1VB3A 3K2BA 3MW8A 3CRVA 3E48A 2W2MA 3NAMA 3UT6A 1XEXA 4R7GA 2OUIA 5ISMA 3AVTA 1U1IA 2MYTA 3ANMA 3SP1A 5LR6A 1XROA 2V9PA 3K32A 2QN3A 2YCLA 1DKQA 2Q9AA 4U9HS 2NSLA 2D7DA 2QUHA 4AJPA 1T4BA 2GM5A 2REBA 3EIQA 4OM8A 3TLMA 3WDKA 5K0NA 4A0QA 5JROA 5TEWA 2P40A 3BXXA 2EYQA 2Y67A 2H11A 3T7TA 3TR5A 1JMKC 3G9TA 3R3ZA 2QTWB 2PVCA 2JGEA 5FXMA 3Q8WA 4PRKA 5SY6A 4CM9D 1JG4A 2Z2ZA 3JQPA 4J91A 3Q5GA 3P0RA 2DX7A 1CBUA 1GLNA 2OO5A 4N5MA 2EHJA 1F3OA 2HA3A 2R84A 1Z4IA 1U8ZA 1G3MA 3MGKA 5JANA 4F2WA 4ZOCA 1MLDA 4WN9A 4AI6A 2DEUA 1EYZA 2YH2A 1PVOA 3ZE0B 2RHOA 1S9DA 2DHQA 3ER8A 2CXTA 2C7QA 1K86A 2GYUA 4XR4A 1K89A 4MUAA 4H0CA 2B5OA 3B9QA 4DBLC 2BH2A 2FDCA 2I4LA 1V4BA 1XEWX 2JCSA 2H2AA 3RUIA 1R1DA 1PHPA 2HUPA 1S2DA 3HCBA 1ACLA 1U6KA 2YDXA 4JJKA 4OYRA 4Q0MA 1Z6QA 2GEJA 4Q24A 2AWNA 1V16A 2PCJA 4TVBA 4UE2A 1YBFA 4DQDA 3CYFA 5L9AA 3TGWA 3DHWC 1T9KA 4NEHB 3MQFA 2AI3A 1GFZA 2XRMA 1RTKA 1OXTA 5EP2A 4DIKA 1R00A 2P2NA 4MV8A 3RV3A 1JLMA 5B2FA 3AY3A 1OV4A 5C3UA 1IN4A 3OCXA 5DK6A 3C3MA 5DXJA 1HURA 5FBLB 4DC1A 4EGCB 4K46A 4PO1A 3UY4A 1T0JB 3WLMA 3NAZA 2QZSA 5ESRA 3FSEA 1W4AA 1NMSA 3F7NA 2BFEA 2XAAA 3MUFA 4FR0A 4XEUA 1K66A 1M1YE 2Z1MA 2NTVA 3SMQA 3P94A 5D6OA 5L7TA 1Q50A 2EL7A 1NKSA 1NOIA 1N5RA 2H85A 3DKKA 3IIEA 2HA6A 3WGZA 4DWOA 4AQYB 1UFOA 1YE3A 3UB4A 2P1RA 4FCWA 4OUDB 3U4IA 1YE8A 3KFLA 4HRAA 4L75A 1JX6A 2VAXA 4X1IA 2IYEA 4X8LA 2OKGA 3FWPA 1N6NA 1ZRSA 5ANRB 1DAPA 5AVXA 5A3VA 3NTRA 1N2ZA 1MDFA 3BFXA 4PFSA 3FETA 3Q6NA 2CNWA 3LVBA 4PRZA 1FRNA 4MWTA 2ZUUA 3JTEA 1SZPA 3AY7A 4BNMA 4J4BA 1GT6A 4UMDA 1QR6A 1QZXA 2HMVA 2BE9A 3IQXA 2JGAA 4K6CA 3AXSA 3JVDA 4I08A 5EJGA 1L4YA 2BHSA 4G4SP 1V37A 1C50A 4KYTA 3HPRA 3TUIC 4FQ8A 1NLYA 1E58A 5LZ9A 5H81A 1QOQB 1K9SA 3FNIA 3WB1A 2ILVA 4C05A 3NDPA 4B35A 3ZV7A 3GLGB 2ZYGA 4CUJA 5SV2A 5JI3E 1KTIA 1E6LA 4ZQFA 3TQSA 4D98A 3WOVA 2NTEA 2GEVA 3E5NA 4ZVNA 4KWTA 3I2YX 4KDCA 2H0QA 4PX3A 3A6FA 5FTNA 5DNCA 4M37A 4HYTA 2R60A 3ESYA 3JAKA 3KZKA 2GI4A 2ZXEA 1L7NA 3ND6A 1ZHOA 2EFYA 2F8LA 1GN9A 4RDCA 4MIOA 3LQKA 2WI8A 1Z8DA 4J1NA 4UNIA 3S1LA 2ZJ3A 1FE8A 2O6LA 3DYBA 1EIZA 2OP0A 3BWDD 4U7PB 4CQJA 3DLBA 4Y6OA 1C1DB 3VR2D 2JNWA 1AM4D 4ON9A 4PGHA 4DILA 1ZQ1A 2RB4A 4H1UA 1L6IA 4HV4A 4GH5A 5C53B 1E2BA 4MO2A 2C07A 4MYDA 1FS5A 2J41A 2R47A 4YBZA 2IYYA 4JBGA 4O4LA 3ST7A 3VOTA 1O89A 1YQGA 3AW8A 4N0QA 1LF0A 3IP6A 2BFFA 2F00A 1XJWA 3WBFA 1FS6A 1VQ1A 3HY6A 3LC7O 1Z2NX 3N2GA 2QTLA 3M5WA 4JLSA 4TWIA 4QSMA 3OD5A 5AHRA 4DC9A 2I67A 3KTAB 4JZYA 1K88A 1KOFA 2FFAA 5EIAA 3RGWS 1E62A 4URFA 2QPTA 2DBZA 3CW8X 4DDUA 2Q4BA 1MAHA 1Y3FE 3P4UA 5T64A 3TDKA 3MMPA 4B33A 2R5FA 7MHTA 3ZY3A 3EQZA 4XCVA 1I51A 2KX7A 1BFKA 2I62A 3GOHA 4JI2B 4F8EA 3JQEA 4ONEA 5IUNC 1E1NA 3GF4A 3KKMA 4RPLA 1NW6A 4YP0A 4FE4A 2UUCB 1Z37A 4O4JF 3A14A 3REFA 4JA2A 4H16A 1AK2A 4JI3B 5CGQB 1W0KA 3GUHA 5E4JA 4B6JA 1JWBB 2XRYA 1ULAA 4HNQA 2BSQA 1QCZA 1OH7A 2OGTA 4BBJA 2XNJA 1RZRD 5IFKA 3C3JA 3OKPA 1XKQA 5L7YA 2G8NA 1N0HA 1UODA 4ZAXA 1B3BA 3EZYA 1XFAA 5DX1A 3OO1A 3A9RA 2RBEA 2WJIA 2ORED 3BWXA 3JQFA 4I81A 1OAOC 2DQ4A 5LD2B 1FMFA 2G71A 4B2YA 3C14C 1NBMD 3A37A 4FIDA 4XJXA 3TFOA 2HMUA 5KKCA 1BXGB 4FHEA 5KJCA 4BPRA 3ZI4A 3H75A 3RVLA 4C08A 2EX4A 4QARA 5A4MS 3REQB 3DPSA 5CFNA 3CRNA 2PKQP 3ZQUA 4H3SA 2XKAA 5LP6B 2PGIA 1XQWA 2WF9A 1ZNYA 4ATNA 4N3CA 4KR3A 5DW3A 3OAAA 1QU3A 5KYKA 1ITZA 3ZDZB 2QZPA 3VC1A 2PL9A 1FF9A 1M2HA 3IEPA 1A8SA 4L8FA 2MT9A 2XF8A 1AO3A 4OHKA 4U7FA 1NYTA 4UHDA 4XLZA 1OU0A 4LCEA 4S04A 4RE5A 2VBFA 2JAOA 3MBKA 1WW3A 3N0TA 3HU2A 4KXNA 4R9VA 5CP8A 5SICE 2VH1A 3F1KA 5IHXA 3PX2A 3UENA 3NBQA 4WNAA 2F90A 3VA7A 3BX1A 2H4WA 5KZMB 4I5IA 5KSYA 4G1UC 2B1QA 2MSDB 4KR2A 2DWUA 3B7WA 3H16A 3C4VA 1B0ZA 2WILA 1OZFA 5F73A 3S44A 4J0GA 2ATXA 1OLXB 3B1YA 2KW5A 4IMRA 4XDZA 1GAQA 1CD5A 5JFGA 2O2SA 3TCXB 2WFMA 1GV1A 2FK8A 3FUVA 5BN1A 4ALMA 3T3PB 1HDEA 5ALEA 3I5UA 2X5XA 4BV2A 1YB6A 4U2EA 5AI4A 4P3XA 2C54A 1UXKA 1E0SA 5DI9A 1NDUA 1O9BA 1RYDA 4TTJA 3AVWA 1GIAA 2Q7XA 1UKAA 2CXOA 1YI8A 3DT9A 1MG5A 1SZCA 3DMGA 2QTBA 5KVAA 2R6R1 4FI3C 2H8KA 2GASA 1X3SA 2B8JA 1XFDA 2XE8A 1U8YA 3GEDA 1XDZA 4MROA 3C6MA 2ZDQA 3VAAA 4F9TA 4JSRA 1V8DA 2AV6A 5CCDA 2KHZA 3BXFA 3T5MA 1AT1A 1WNTA 3F5DA 3GLIA 4QTYA 5A05A 4R2XA 1OT3A 2OCDA 3PL1A 1G63A 4FFNA 1WBBA 4QYMA 4RK6A 1U7DA 2QVLA 2WVGA 1P4HA 3EVCA 1IEXA 2PGDA 1PQYA 1C8KA 3KR1A 3LC2O 5HMMA 1ZVJA 4IWYA 4DQXA 3RUHA 2GX6A 1J20A 4BB5A 1XD9A 3AHJA 2TMYA 4H7FA 2EW8A 5ES4B 5HGXA 1NRWA 2OECA 4S1VA 1MR3F 1YL6A 2P79A 2BMAA 4LHVA 4C20A 2BL4A 2PUTA 1BMFD 3B89A 3JQ7A 2FFJA 3MF4A 3SQMA 5BUSA 4J0DA 3I61A 1HC7A 1IEWA 1E3SA 4NFLA 3R8FA 1E1QA 2FA9A 1YRHA 3LCUA 3G88A 1KZ6A 1R3DA 4IIDA 2AW3A 2FEAA 4AD8A 1TO1E 1LK7A 3DVLA 4EWLA 5DLEA 2E2WA 3RSOA 3NWOA 2C29D 4TUYF 4ZO9A 3FPHA 1N8KA 3NGMA 1GTL1 2QNIA 3T7CA 3WJ2A 4WZBE 4BB0A 1Z2EA 2EEZA 3HKEB 4NBNA 4ZOBA 3SE0A 5JS6A 1QP0A 2WUFA 3T06B 3HO8A 1FSPA 3FSJX 4X97A 1VFPA 4UHEA 1UOPA 3IO5A 1OU4A 4YAEA 3RPEA 5FLYA 1SC4A 4D9EA 1YA4A 3C3KA 4RABA 3AR2A 3U4GA 2Q4OA 1II8A 1RAGA 1SUEA 1K6EA 2FG6C 1NR1A 4BKRA 1TKRA 3K96A 5ESWA 3PPXA 4LJ5A 4B43A 1DQNA 1HG0A 2Z3ZA 3D8SA 1FZQA 4D25A 1KR2A 4RL4A 1O6ZA 2BY4A 4HQNA 4MQMA 4P5EA 4XKJA 1F2VA 3BWBA 4R1OA 3WLAA 2O7RA 1P80A 2QRHA 3G2JA 2Y0EA 4JJGA 3BL5A 2OZLB 1NURA 4N5IX 2PKXA 4X3PA 5A06A 2BPOA 1AE1A 1AK1A 4JHLA 2FP4A 2I66A 3BORA 2EKQA 3R76A 3UN1A 3VPFA 4C2BA 2FUG6 1WP9A 1X80A 1T4DA 3D02A 2NSHA 3CUEF 4GBMA 4GX0A 4EVIA 1T5TA 4KRYA 1F5SA 3ZBTA 3O38A 1BJRE 3N2ZB 1OTXA 5JXHA 3ETHA 4PIVA 1C7ZA 1KVTA 2GD0A 4ENVA 4L3WA 4E94A 2JIRA 4NFYA 1SUFA 4XSVA 4GM4A 4UM7A 2DB3A 2AC2A 2W48A 3BDVA 3NBKA 4IHQA 3LHKA 2IODA 4N5LA 5FO1A 2JAUA 5A9SB 4NS4A 4PQFA 3GPLA 1W6RA 4RLSA 2Y0PA 4DWWA 2YXBA 3MJHA 4OQDA 1DBIA 2J7KA 3M81A 4JR1A 5DJ5A 3A4LA 4UDNA 3F8TA 3UWKA 4DJJA 1TW2A 2FWPA 4PTYA 1KETA 1QRDA 3VU9B 3VR3A 1Z4KA 1CP3A 1VG8A 3A1TA 3FRIA 4PY2A 3LY8A 4C1NA 4TOIA 3LUBA 4N0PA 2NYRA 3Q5EA 4D6PA 4IUBS 1SEVA 3NASA 4KV7A 2HSEA 2PRKA 2IUUA 4LJLA 5A3RA 1N8TA 1I5RA 3M6XA 4BMVA 5TSDA 4P3YA 1J1UA 3OU7A 3T3EA 1VJCA 2YOGA 1TUGA 2C4NA 4RO0A 4URWR 2WTAA 1O1YA 1J6UA 3FCYA 5AW5A 3OQHA 3CLUC 1Q95A 2YVUA 4MQBA 2ZYVX 3SLKA 1OX4A 1U8FO 4ZCRA 5LDDC 4F5WA 3COZA 4MGZR 4EMSA 2CV1A 1H4VB 3JPWA 4I6EA 4LXQA 4PHGA 4YCAA 3TTYA 1G18A 1VMDA 4X71A 1TUIA 4U0KA 4XQ0A 1RPJA 2AXQA 2RB5A 3AKCA 5IS2A 3RADC 1SVUA 4BCBA 3ADBA 1B8VA 3C3YA 3KR0A 4OPMA 3UKOA 1EJ2A 2H1IA 3V32A 2EL9A 1NA5A 2PMBA 3V7NA 4RF4A 4L4SA 4FXOA 1W88A 1RAEA 2B8EA 3DBLB 3V4LA 3ND5A 3N2KA 4IDCA 2BFMA 4FMPA 3DMFA 1J8FA 1SBTA 1TVCA 2YINC 3Q3CA 1J97A 4I1OA 4II2A 4EP1A 1M33A 2ZRKA 3NNSA 5E3IA 1B74A 1X7XB 3WLHA 1EM6A 4LZZA 4MMXB 4EUHA 1CY0A 4QFDA 3M3DA 3NGXA 2C00A 4FOLA 4KPUA 5CJPA 4V24A 5H9VA 4BJ6A 2QL7A 1SNYA 1M0SA 1E1RA 3VNBA 3OIYA 3RJZA 4DV2B 5DMXA 2PHZA 5KQSA 2Y1DA 1Z34A 1JSLA 3PBKA 3UHPA 4C07A 4F6CA 1A9RA 2GF2A 1MQSA 2YYYA 1R10A 1YRQA 2C2WA 3RYTC 2PUFA 3G9UA 4Z0TA 3R7LA 4RADA 4AQDA 4MI6A 2V55B 4EB6B 4MKRA 2B7LA 4G81A 2UZ1B 3F5SA 4G4SO 1EZ1A 3MOSA 2VHUA 1RJ9B 4E4YA 5TLSA 4PVDA 3CUKA 2MYNA 2PMKA 3BC1A 3KZ1E 4J90A 4OUKX 4PS0A 3KT0A 4XUGB 3KYCB 3RFUA 3SYTA 4J7UA 3WQSB 2N47A 1HY3A 2ZREA 4B6PA 3R0IA 2PMFA 4ZT2A 5GAJA 3STHA 2SKCA 3ROGA 3ANTA 4LHSA 3KZVA 1S01A 1VLVA 4DRZA 5C1BA 1ANKA 1J24A 2VPPA 3JQGB 4NBUA 4I4LA 3SIRA 1LTQA 1ISHA 2PTGA 2PY6A 4NY1A 4DNQA 4KQWA 4QXAA 1A8UA 2C9YA 3AUUA 3LQ4A 2I1WA 2YWJA 4LKOA 1QH9A 4K9SA 4K9RA 2EJVA 5D3ZA 4UAJA 3W5BA 3HMKA 2BM0A 2IXDA 5T6MA 1UBEA 4X8MA 4EF4A 4ARAA 4DG8A 4F5YA 4KMSA 1E63A 4HDAA 1A71A 1JHOA 3CO5A 2JFFA 4EZEA 3USCS 1K7XB 2IE8A 2GA9A 2H51A 2HHCA 3EXHB 2AHRA 2OCLA 3KQYA 3RUPA 3T9FA 3D1LA 3ZE2B 1EUYA 1NLZA 1XO1A 1DQSA 2RCYA 3RNLA 2WYOA 3RASA 3M6MD 2HCRA 3UYKA 4O4HA 1WZIA 2AMJA 4JJIA 4YJ2F 2Q0HA 1EZ4A 2BHTA 3FXAA 2FEKA 3EGXB 4IQFA 5B7PA 4E1AA 4KNYA 1CW2B 1PSZA 1FFCA 2J6HA 1JNXX 2R8YA 3A25A 3PRKE 1BXRA 1PFKA 3E3NA 3FMFA 1DHRA 4GM0A 4NBSA 4OY3A 5AK0A 1EE9A 5FOUA 2QD5A 2R7LA 2VTEA 4BB6A 1Y1TA 4Z1OA 3PEWA 1G2PA 3CVOA 4KW7A 1ACMA 3I45A 1J0BA 3RSCA 1R0YA 5DWVA 4HLUA 3RS0A 4XPIB 1WLYA 4NU5A 2XLBA 4WV3A 3OZ7A 3I42A 5GM2A 2R0QC 3O2QB 4QDOA 1OWOA 4KOEC 1BMFA 4S2UA 3HUFA 2CNBA 3QMWA 3DYVA 3AINA 1O0SA 2LDBA 2B8NA 2OHFA 4HEA1 4U2BA 4LOLA 2OENG 3LUFA 4IO1A 4XGRA 2IXBA 2PLWA 2PSSA 1R0LA 5HP4A 1T3TA 3BK1A 4V38A 2GBFA 3EA5A 2YBDA 4LBYA 2VT2A 2EJCA 3ORYA 4RJ2A 2QGZA 4DA4A 4L8YA 3L7DA 4P08A 4Q5IA 4S05A 2GVDC 4HB3A 2G4VA 2J6CA 1WAMA 4HAVA 1F0PA 1KO5A 1YBMA 1VZ3A 3A4VA 3O3OB 5IJXA 4FM9A 4MI9A 2LCQA 4YI3A 4RFVA 4OREX 3T3HA 3MUOA 1Z0AA 4H35A 5E7QA 5K6AA 4LF9B 1SBNE 3A0UA 2HBYA 4B7ZA 1QVRA 4NR0A 1I5OA 1BCSB 4C7BA 4E2XA 4F5DA 3TOZA 3EMKA 4D8WA 3THYA 4LNUA 1U9CA 4BQNA 3MB5A 3OJXA 3QIVA 2GPJA 2RSLA 1H2BA 3IVCA 1CQIA 3DEHA 3NP9A 5GIPE 3HXOA 5DASA 2W98A 1ZIOA 4ADSG 2WVAA 4TPKA 1EGQA 2A35A 2GK3A 5B7GA 1S8OA 2Y66A 4XUDA 4QBHA 3L2OB 3TKLA 1UC4B 5CHYA 3V1KA 3X43A 4X7BA 5L4LA 3T1YB 4FI3F 1E2HA 3NTOA 1CUGA 4RFSB 1UXGA 3THRA 3PGXA 4FSDA 3FWHA 1ZVQA 3TD6A 3OJFA 5BPHA 3FRHA 5H9WA 2R00C 4M22A 3NXSA 2O0JA 4X65B 1BE1A 3SYKA 1XTQA 2ZTUA 1UANA 2QQ0A 4OX9Y 2ODQA 3HCPA 1HDCA 4FT4A 1J5XA 3ZYCA 4BFYA 1AB6A 4B3TB 1UK9A 4UARA 4KPEC 3OTOB 4ENQA 4S1TA 1N3YA 5DBFA 2B2XA 2O2JA 2P5TB 4C4AA 2CB9A 4URXR 1YU9A 4UATA 1RYMA 2HK6A 4EYSA 4KN9S 2PANA 3TFQA 1P1CA 5I4KA 2X0FA 5CFQA 1GDDA 1ODJA 3I4LA 5C5DA 3T1TA 3GLFB 4W7SA 2YIVX 1JEDA 3M1AA 3B1WA 2D1TA 4KRGA 4JL8A 4DYDA 3D4NA 4EZIA 4RPIA 1Y3CE 3VYRB 1ZUIA 3WP1B 4ZGGA 3NCHA 5JOQA 4FONA 5HZGA 2CSXA 3BSYA 3B8HA 4WY8A 2XGGA 2GD2A 5FUQA 5IMBA 3UA3A 5DNVA 3SX0A 2CBXA 3HNOA 5KHLB 2D0PB 2XOKA 3N2EA 3OJCA 3AP2A 2VR1A 2C3MA 2OZKA 3GFFA 3PRHA 4P34A 5I4BA 3O73A 5F3WB 3F6PA 4G85A 2ZUEA 3JQFC 2XMGA 4DA6A 1SC9A 1ZGCA 2O48X 3FGZA 1DCTA 4E2FA 4ZZIA 1LRLA 4ZOQI 2GZSA 4N47A 4CKXA 2X8LA 3AKZA 4DCOA 4EVQA 3T8YA 1GNPA 1VIDA 2UZ0A 2FQXA 3PTAA 3SMVA 1GR1A 4QG3A 1NM5C 1U8EA 2A0UA 1PQWA 3OOSA 4EPWA 5I51A 1E61A 3RHTA 3IP5A 3AF6A 1W35A 2GWHA 1EXWA 2D0OB 2VPZA 3JY6A 1QC5B 1IVYA 5M34A 5BWMA 3ZLUA 2JLVA 1W0KD 3T3DA 1CE8A 3MIIA 4J1TC 3BBLA 1VYTA 2N42A 3LQYA 4A1FA 2GTIA 5IVHA 3IIMA 2ZI5A 4UFPA 3H9BA 4MTCA 4A6EA 1BOOA 1GPAA 1EBUA 4CTMA 3H17A 1VP3A 2PSDA 1BE8A 2B82A 1V26A 5K3OA 1CS0A 3D1VA 4QOFA 2GESA 1PT9A 4GPD1 3GQVA 3NU1A 2QLLA 1XTBA 2GS9A 4MRVA 1NW3A 1Z0DA 2QMEA 2AG5A 2D3WA 1DKPA 2XBLA 2ZQ5A 1T5DX 1IZZA 3LPCA 3NALA 4OXXA 3WL8A 5AVQA 4MR8B 5BNZA 1GTMA 1YJ8A 4G0QA 3R0VA 3TD9A 4EHNA 2LPMA 1PYGA 1YIDA 1KWKA 3O8RA 4CYMA 1NBEA 4DQUA 4ZOAA 2UUOA 2ENUA 3AI3A 4QG7A 1OZAA 2OK7A 5EZ5A 3ROKA 4ER7A 1SVLA 2NXEA 2Z4TA 2ZEJA 3HYTA 3KLNA 3GEHA 1CEEA 1I1QB 2Y76A 1HT3A 1NE2A 1ZZGA 4H1HA 2BGTA 5EUMA 5C1OA 5L8VA 1G8AA 3OJEA 1XVIA 3G5UA 2RHJA 4XOIA 5HILA 1X9GA 2G5PA 3RYHB 1TD1A 3Q9LA 1NUUA 4ZRMA 3ZE7A 3A7DA 5BR4A 1NUQA 1ORDA 2Y9PB 4C04A 2VJBA 2JANA 2J3EA 3IDAA 5IJAA 3MS2A 5AVZA 3EVGA 3JQAA 5KIAA 1LQUA 5DW0A 2AEEA 2MINA 2QN7A 2R8RA 3DMYA 4MKHA 4RETA 4B3IA 3ETJA 3EUFA 3QEMB 3UG7A 1NXXA 3NM5A 4MR9A 4PYOA 4ZQEA 4F97A 5BQFA 1QO0A 2IYZA 5KREA 1M2VA 2AX4A 4O02B 4JKIA 1KH3A 3KZNA 3A2NA 5KVQA 3PG5A 3GVIA 1GGMA 1UBGA 3EIOA 2CLEB 6GPBA 4W5TA 4WXYB 4OB7A 1QKIA 3LGXA 3TL3A 3PC6A 1G8PA 1XA4A 3CLTD 3DKIA 3V4OA 4DKXA 1XC7A 1C41A 2NTJA 3HXTA 5A7GA 5G0TA 1D2CA 9ATCA 1M72A 1U4OA 4BP3A 1DBPA 3MWDB 2Q6LA 4IDOA 3FDZB 4C0KA 2K2WA 3VMMA 1G5TA 3FF4A 3HDQA 1U2QA 4KXWA 4KG7A 1T3GA 2XUZA 1GKIA 2JFWA 2RGWA 1QIFA 2WZCA 4OB6A 3RT9A 2A5JA 2J67A 4EFNA 5AM5A 2TYSB 1YRAA 4TX1A 1D0VA 5FIUA 1NJFA 2JGIA 3KXDA 1QP4A 1VJRA 4ZCQA 3UHJA 1RM4A 5LZ7A 3EOAI 5I5GA 1W88B 2I87A 4N6OA 5KNDD 1PS0A 1IZ9A 3IR6A 4QDKA 3VKUA 4XTCS 2J3DA 4RLFA 4D43A 1AZLA 1SCQA 2DJIA 4V39A 3PNQA 3GVHA 1XA3A 1PK9A 4NCIA 4IZIA 2I6SA 4K9PA 1XD2B 4UU7A 3Q0EA 2W8BB 2GPAA 3CBGA 2FN7A 2MYPA 4PIPA 5AW3A 4CEHB 1SVKA 4XVHA 5EUCA 3BWEA 4MH0R 3TEMA 2Z3WA 4YDSA 1OBOA 1JBQA 1RMTA 1U9IA 1KXJA 1Y6ZA 2ZIUB 3NBFA 4OAOA 4UM8B 4E6PA 1NP6A 1QKKA 3PQ2A 3USES 1AGXA 3K0FA 2C2MA 2F17A 1CIVA 2XB9A 3FUTA 4FGSA 4JJAA 4G5XA 3GNSA 2PQ2A 4HQOA 2PLFA 3R2JA 2X4DA 4WN3A 3ONNA 4OHUA 1PSWA 2EDCA 1LK0A 2PDAA 3CUUA 4B5KA 4DJDC 1YULA 4ZHQB 5JZMA 3S40A 1JJ7A 3IQFA 5JMPA 4DCPA 4HOYA 3WKAA 2GD6A 4OHXA 5DI3B 1GU0A 2H54A 4CLRA 1FFSA 1EIWA 2BEJA 4REOA 5CDSA 3AILA 4OQPA 2XGOA 5KUTA 2PX0A 1MX1A 3EX7C 1WBDA 1W4ZA 4PFQA 1AUVA 1SIOA 4JI4B 1GD1O 2FSFA 4WL0A 2IVFA 1FNDA 5JRZA 2QIPA 4NBTA 1A3CA 5HQTA 2XDQA 4CNBA 4RTSA 3AL2A 5KHAA 3T52A 4Q9HA 4XVUA 2IVZA 4WLOA 4U6NA 1CY7A 1A50B 2XTJA 3F49S 1MXHA 2FU5C 4LC1A 4UQOA 4R3NA 1VMAA 3L8YA 2R44A 3UOGA 4XWYA 1PGPA 4QREA 1WUYA 1LK5A 2I22A 1Z2OX 5LA6F 3KZXA 2D62A 3QLUC 1P6XA 2N1MA 1UDXA 2ZB4A 3A4NA 4D0GA 3CB4A 3S27A 2B3DA 3H1BA 1MOZA 2ORVA 4GS5A 4MUKA 4Q01A 2O3TA 4HDKA 5KNLA 4B34A 2VDLB 4KIJA 4GZMA 1SY7A 2XSZD 1BIFA 3M3HA 3WBKA 4F1WA 1RJDA 1SZDA 1CJUC 4V1CI 3U4QB 2GRJA 2WVJA 1P1RA 4CDNA 4F2HA 1QYCA 1V1MA 5BXQC 2A1TR 3KUUA 1WZCA 1WV0A 3HZOA 1KERA 3OKCA 3OLQA 3VR0A 3NVMB 1WXXA 3EEFA 3LDGA 2CUTA 5DYIA 2PZJA 2FRDC 2PZBA 3B6KA 2WFLB 4J6FA 1OXKB 4UE3S 3RSSA 5IYZB 3LPDA 5HDBB 3S7TA 2LTAA 2Z1NA 2CLOB 1Q11A 4D1YA 3GYGA 3PGMA 4NMXB 2QB5A 3UAOA 2ODTX 1CRWG 1IFXA 1YZFA 3AH8A 2HH9A 2PLRA 3CVUA 2IEBA 1RM5A 3NV9A 5EWJB 2DUMA 1FP2A 2XRFA 4QFMA 3VTKA 2ZCVA 4N49A 3PR1A 3T4EA 4E13A 1U0BB 2DLDA 1Z18A 4R2IA 3B48A 5CLLA 4Z0HO 5LQSA 4XI9A 1OC4A 2P9CA 2Q9UA 2ZWOA 3PNYA 4NZ9A 4UZFA 5AVYA 2IWRA 5LP1A 5DOZA 4Q18A 2AW5A 5I9BA 2BP7A 4KP7A 2HPVA 3Q3IA 3NP7A 4HNSA 2BJVA 4JBIA 3RVQA 3SS7X 2GMWA 1RI4A 4DTCA 1PLLA 2W00A 3QYPA 1HLPA 3MRXA 2G08A 1W5AA 2ZJ4A 3IOCA 2V0GA 3EEQA 3C7CB 3I62A 1MB4A 2QG9A 3BMQB 4LY0A 1QV7A 2JEOA 3IT3A 2VQ6A 2NVUA 4LOIA 1SBHA 5CB4A 3ETDA 5K01A 4RTNA 1Z74A 3QX8A 2HX1A 3KJZA 2GAOA 4DAEA 5ERGB 4L73A 2Q45A 3Q9NA 3IAM6 1PI3A 5G40A 2FUNB 1LI5A 5LLDA 3PV0A 3NVDA 5AMXA 3PDWA 2UZIR 2F7SA 2VTBB 3A26A 1WXHA 3CE9A 3DJFA 1PEYA 3R20A 4QUEA 1QU2A 1YA8A 3TSWA 3MMXA 1EAYA 2O2ZA 4RGQA 3BOSA 4G9BA 2ZUFA 3CPSA 3GARA 4WK2B 2VZEA 4B2IA 2B98A 3PNVA 2XGMA 3PXXA 1I7QB 4ZYUA 1CQXA 3UVEA 1OF1A 2XB8A 4JNKA 3EBLA 1HSOA 2YV4A 2ZRIA 3IEVA 1YBVA 4E22A 4O33A 5CITA 4GZLA 1YMVA 2MOKA 1CJTC 1E3LA 1U02A 1S8NA 4MITA 4IX9A 2IDJA 3DF7A 5DYYA 1HDZA 2WP8J 3GFVA 5EZYA 2WW8A 1TMOA 3GAZA 5K6AC 2OLJA 1EVEA 3B1FA 3RYHA 1X13A 3DTYA 1DXYA 2WHXA 2JFGA 1AMUA 4BLQA 1F1JA 4Q4LA 4XUEA 1NLFA 4XYEA 4TZ6A 3MN1A 1VBNA 4JEIA 1ESCA 1TCAA 5DGHA 3CKLA 5I3ZA 4RU1A 1U1CA 4WNCA 2ZUTA 5K0CA 4MUBA 5AKIA 1N1DA 4A15A 1J8VA 1GUAA 1TF7A 2E6UX 2ZRGA 3AVVA 2FJ0A 1FXUA 2KE5A 3BA6A 4I19A 4DC0A 5JJKA 1XZMA 2GR9A 4XWAA 5I7OA 1XJQA 2ZYIA 2OE2A 4RH3A 3V48A 3P0EA 2VTBA 4IFBA 1T1EA 4TQ9A 2XODA 4LI0A 3RTBA 4YRMA 2P2ZA 1PZXA 1WOYA 3H6HA 4CF6A 1G41A 1YQUA 4EG5A 4UTZA 2UZ4A 3THWB 3MPOA 3VVMA 1PV4A 1MBZA 2B36A 4KYVA 3ZQJA 1L8LA 1MVOA 3QBTA 2PRIA 4FKBA 4RH1A 3HB4X 4ZEXA 1KI6B 4GECA 1VM6A 3UJ8A 1IWOA 3VGJA 1IM2A 4GL2A 4R1SA 1TQHA 1UBNA 1Y6JA 3CRQA 3PUXA 1JFRA 2X76A 3Q85A 5K3CA 3RC3A 4YA6A 1EUCB 3PEEA 3WL6A 2AB0A 1FY2A 3HYNA 4H0NA 2GZMA 3W4JA 3EC1A 2VYVA 2FLKA 1EFRD 2QUAA 1BNCA 3AETA 4XWKA 2ILTA 3OHPA 1VZ2A 3OI7A 5FUWA 2OBBA 4KLZA 5CFLA 5CDHA 1W59A 4D26A 1BVYF 1MOQA 2W5UA 3KFXA 5F2OA 3HJGA 2O2IA 4BO5A 3N7TA 2QLBA 2FE4A 2ZR7A 4L5IA 4QFCA 4RK0A 4RZQA 3U44A 4HWPA 2VUSA 2ZRAA 2EQAA 3GLGE 1EH5A 4MAFA 1SC6A 1FTSA 1MIHA 3JYOA 4A5SA 1YS2X 1PR3A 1YV9A 2HXSA 5AXAA 4C0SA 4G8JA 3IRVA 4BB9A 1S3IA 1DNPA 3C70A 4PCUA 4BZXA 4NP6A 2QEQA 2HMWA 2XUOA 5CH3A 4KQ6A 1UWCA 1NWCA 1WE2A 1E9VA 3BTVA 4H7DA 3MXTA 2VK1A 3ZDRA 1GQOA 4RV4A 5JRDS 3GLGA 2XCOA 3HO6A 4LV8B 3W78A 2ODAA