1IULA

The structure of cell-free id.343 from thermus thermophilus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
MNDQELRAYLSQAKTIAVLGAHKDPSRPAHYVPRYLREQGYRVLPVNPRFQGEELFGEEAVASLLDLKEPVDILDVFRPPSALMDHLPEVLALRPGLVWLQSGIRHPEFEKALKEAGIPVVADRCLMVEHKRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a conserved CoA-binding protein synthesized by a cell-free system.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TT1466
total genus 44
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2002-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1iulA00
1HZJA 2ZB3A 3BA1A 4HUJA 5BSEA 3D5TA 3QVWA 2W2LA 2WYWA 4QFDA 3HDYA 2B0JA 3PHGA 4PG5A 1UH5A 1E3WB 1JU9A 2W4QA 4IXTA 3G1UA 1YGYA 1O5IA 1U2GA 2J5QA 1XDWA 3DOCA 4J7UA 4CM7A 3JD4A 4RF4A 3I6IA 4GH5A 5H83A 4ALJA 3NT4A 4DYDA 5THQA 5ICMA 1JW9B 5KKCA 4GQAA 1EQUA 4I5GA 4TSKA 4HBGA 1C1XB 4I5FA 2EW2A 3LU1A 1L7DA 1PJ4A 3QV1A 3KVOA 4NQZA 4J1NA 3ZNNA 4GLOA 4R1UA 4EEXA 2TMGA 2BFMA 4AJ1A 4BNLA 3GY0A 1M66A 3C85A 3EZLA 4YRBA 3UOGA 2Y66A 3GG2A 4L75A 3DO5A 3MJEA 1CEQA 3C1AA 3H3JA 3I9LA 4LW8A 2DM6A 5TSDA 5I7SA 1ISFA 2OXIA 2VNAA 5IZCA 1N92A 4ID9A 4INAA 1DXYA 3SEFA 5L95A 5G0SA 4PN3A 1J6UA 3WOHA 5L7WA 3Q9NA 5G4KA 2X6TA 1ID1A 1W6UA 1KVRA 3PJFA 4JBGA 4A2CA 3QWBA 4KQWA 5IN5A 3E1KA 3SLKA 2DTEA 3DFUA 2QYTA 1B8UA 1Z45A 1VSVA 1EDZA 4N54A 2PKRA 1GCOA 3FNEA 3JTMA 5A4DA 1PJ2A 1N1EA 3H4VA 3W8EA 3PWKA 2UUOA 4ZA2A 1B15A 3MJ4A 4MVJP 4D0RA 5L9AA 3JYPA 4NDNE 4GI2A 3PXXA 1QYXA 5U1PA 3BAZA 2P91A 1N7HA 2VYND 4O1MA 3TZKA 1PGPA 3LYLA 3HN7A 4OO3A 3ZCXA 2PZLA 1BXZA 2Y1DA 2R00C 4CLHA 3HN2A 2ZATA 5LDHA 3FN4A 5BSHA 5TQVA 1TT7A 3R3SA 1H9AA 4WEQA 4J90A 4A5OA 4E2WA 4J9UE 4KMSA 5IAAA 2FR8A 2CUKA 1QRRA 2RH8A 4J0FA 2HK9A 3ZHYA 2PZKA 4JXKA 4B3HA 2WD7A 1ZIDA 4RZHA 1ADFA 1PWXA 4H3VA 1UXHA 3FNGA 1XGKA 3UN1A 4RVGA 1YBVA 2CY0A 4YQZA 4QX6A 1EK6A 3BIOA 4MIEA 2EJVA 1SZJG 3HJAA 3I5MA 4WLVA 3JYOA 4GLLA 3AY7A 3IP3A 3UW3A 4JCOA 4D44A 2DTDA 3I23A 2B4RO 4F45A 4FFLA 2EKPA 4RGBA 1P1HA 1I24A 3PFFA 3PFWO 2HJRA 4IDGA 1GUFA 1J4AA 3W8DA 1I3NA 3OQ1A 5T8KC 2PTGA 2Q2QA 4NPCA 4E21A 4NBTA 4BO9A 4E5YA 1E3JA 3DEYX 4R3NA 3RUHA 1X1EA 2OP1A 3DHYA 5IDXA 4FC6A 4A73A 3I9MA 3MCVA 4G81A 4XWYA 4ZQGA 1BXGA 2J5RA 3OBBA 1EVZA 5L3ZA 1EUDA 3GR6A 3B1FA 4WLFA 3RIHA 4U6QA 4DBVO 4RVSA 4CM3A 4BMVA 3K31A 1AXGA 1DIAA 1U3VA 4Z3KA 4HNGA 3RI3A 2HMTA 3V2UA 4AJIA 4QECA 5U4QA 1JAYA 1W73A 3WMWA 5JLAA 4C7JA 2GN8A 3K2BA 1SAYA 4UVDA 1Z6ZA 4JNKA 3INRA 2I65A 2EP5A 5B12A 4YYZA 5JAZA 4GGOA 1IY8A 5I9NA 2DFVA 4WNCA 2UDPA 3UF0A 4FFRA 2VTDA 4WLOA 3TL2A 4N5LA 2V6BA 3FBTA 1GV0A 3ZWNA 1PWZA 3JQ9A 1P1RA 1QYWA 2G1UA 3RUIA 2YHIA 3R1IA 5A04A 1ISJA 3DAPA 3N7UA 1LSUA 4BVAA 4CR8A 1N1GA 4W4TA 4CR6A 2GN4A 4IDFA 1KVSA 1P3DA 4CV0A 1NBOA 5T6BA 2HRZA 1E7MA 2J3KA 5FFFA 3PYLA 2IYOA 1ZUD1 3EC7A 4UEOA 3IL2A 3NT5A 4RF3A 2BLLA 4CUJA 4S3MA 4GL4A 1UP4A 1YS4A 2H6EA 4Y67A 5JAMA 1B7GO 1LU9A 4IQ8A 2X0IA 3OA2A 3NJ8A 2EW8A 3PWZA 3SBOA 2BKAA 1JA9A 4XX0A 4JROA 1WWKA 2HU2A 2WTBA 1DIHA 3JQFC 4DMMA 2O3QA 3PQFA 4QO7A 5CG1A 1JAXA 1GDHA 4J4BA 1QKIA 3WJ7A 1YJ8A 1O89A 2DC1A 2PD6A 2XPCA 4KTVE 1RM0A 2EKQA 1YONA 3DFZA 1GZ3A 1E7SA 1LC0A 5C37A 3GDOA 4BO2A 4MVJH 4Q3CA 4B79A 5DP2A 3NKLA 2ZQZA 3JV7A 3Q2KA 1KOLA 1LLQA 5TS3A 1HL3A 2BFAA 2ZJ0A 5DBIA 4AJHA 1TB4A 2AE2A 4ZD6A 4L73A 4FJ2A 4HWKA 2EEZA 3E48A 4IIUA 4OXKA 5A3JA 4XR9A 4YJDA 2B36A 2FR1A 3D3EA 1SNYA 3OEWA 1U3UA 3M1LA 1PJTA 1QLHA 2HRBA 1E3SA 3I4FA 1KETA 3EDMA 1HLDA 2X5OA 3ZWMA 1NQTA 3WQSB 1ZW1A 4A0SA 3AUAA 4UEJA 3LVFO 4XYEA 1B3RA 3ZHXA 5CP8A 2X1HA 1NFRA 5EMHA 4TROA 1E1MA 3O26A 4G5HA 4EGFA 1R37A 5DOZA 2Q49A 3AI1A 1IOLA 5AVOA 2CF5A 4CQMA 2D1YA 4F3YA 4RJTA 2EHDA 1NQAO 2D2IA 3GFBA 1PJBA 3OQ6A 2UUPA 2DVMA 4B3JA 1NVGA 1DC5A 1R0KA 4G65A 1XKQA 3AWDA 3RD5A 5A5FA 4Y98A 2GF2A 2EKLA 5CFZA 1E7YA 1RWBA 2PY6A 1XU9A 4FPXA 4KOAA 4KTTE 3IP1A 2VUSA 3D3WB 3LC2O 3GDGA 1F0YA 4LMPA 5JY6A 5FF9A 1NM5A 2FWMX 3B20A 4GSLA 3WNVA 1I32A 4YAIA 3I3OA 4MVJF 2IDZA 4NIMA 3H5NA 2JFGA 1DHRA 4IDDA 2DAPA 2O4CA 4NJMB 3DB2A 4RDHA 1U8FO 1Z75A 4Q39A 5A06A 3ST7A 1W8DA 3KHUA 5TJ9A 1Y9EA 5BR7A 3WSWA 5A9SB 5K6AC 4R3WA 2QZ9A 4U0KA 3WIDA 2PWZA 1ONNA 2CNBA 1Y6JA 1MXHA 1H6AA 5A3VA 2NVBA 3VDRA 1XR3A 3KYDB 5T57A 3NT2A 4FIZA 4WLNA 3NV9A 2PGJA 4JJFA 3DQPA 3PZRA 2VYVD 3ONFA 3AI3A 4JIGA 5EQDA 1B0AA 1Y8QA 4YJFB 4TWRA 1BW9B 4XJTA 4GGPA 3IC5A 4OJNA 1OBFO 3U4IA 4NFHA 4Q3AA 1A27A 3TL3A 1PJ3A 1YH3A 4CM6A 1FDWA 3DTTA 3QWAA 5TGDA 3AOGA 1CIVA 4DC0A 5GMOA 3PJGA 1T24A 2EXXA 3PHJA 3P2YA 3KO8A 4BKRA 1GD1O 3WWZA 3CZRA 1A72A 1R4NB 7ADHA 3HWRA 1H0KA 4WPGA 3U5TA 5C7OO 1HDZA 4OL9A 5G0TA 1IULA 3KETA 1R6DA 2O50A 3ZWPA 4DQXA 4YT4A 1E7QA 4MVJE 1LRKA 4FC7A 3BTVA 4X54A 3BHMA 1O0SA 3M2TA 2JCXA 1NPDA 2IZZA 1Q0HA 1E3LA 3GG9A 3MTGA 5KJCA 1YL6A 1RJWA 3RFVA 4ALIA 2FN7A 2NTJA 1B14A 2CF6A 2X58A 2BELA 1EFKA 2OBYA 4YRDA 4P38A 2Q1UA 1JN0A 3WFJA 5I7FA 1G0NA 1CQJA 1M76A 1PZEA 1PQUA 3D5QA 3U9LA 4JN6B 3ZWCA 2JKVA 2Q1SA 1XIVA 4ZQBA 1PJLA 3ANLA 3BZUA 4RZIA 1OC4A 1A5ZA 2B4QA 5EERA 4OSOA 3ZHZA 3L9XA 2NU7A 3S2FA 3GNQA 4ZRNA 4CMIA 1EFLA 3CE6A 3DMYA 1H94A 4RDIA 2Y0EA 2V7PA 4XYMA 1EDOA 3UUWA 5IDWA 2HK7A 4R9SA 1XA0A 3W4KA 3TN7A 3X2EA 2PZJA 3IJPA 4Q3DA 4XYBA 1R4MA 2JAPA 3FHLA 1A4UA 1LEHA 4Z0PA 1U7TA 1DDOA 3RQSA 3WGOA 5GZ3A 3CKYA 4D45A 5KJ6A 4MVJI 4IMPA 3H9GA 5LDGA 1HYHA 4CMKA 1AHIA 2DKNA 4MVJM 4DWVA 1PGNA 2RHRA 3L6DA 3WR5A 2H5LA 4NBWA 3GN2A 1M67A 1W4ZA 1O9BA 3OHSX 3I9JA 2AW5A 3E82A 3JSAA 4N5NA 5F21A 1XLTA 4BNHA 5IN4A 3G79A 1T4DA 4EEZA 4BO0A 4WEOA 4IINA 4RQTA 1TVEA 3GNSA 4Z3DA 4DPLA 5JO0A 3IS3A 3DZKA 1GQYA 4MKXA 3D0OA 2X5KO 3RUCA 5A9TA 4BNMA 3JD1A 1UP6A 1Y8RA 2RHCA 4XQEA 4OKNA 3A14A 5TF4A 1LDEA 3KSZO 2I3AA 4OMUA 1XEAA 1KEWA 1BHSA 4E5PA 1X13A 3VPGA 3AK4A 2SCUA 3OECA 3ZN2A 4CODB 4XEHA 4ZQFA 3RASA 4GWGA 4EUHA 4GWKA 2WE8A 2DLDA 2BI7A 5KCZA 3MTJA 1WP4A 2Y1CA 5JC8A 3LF1A 3AI2A 3HDJA 5BSGA 2FR0A 1E6WA 1Q0QA 5L53A 4BO5A 4KUEA 1XYGA 1BG6A 2AQHA 4TKLA 2C07A 3LDHA 3ZWVA 2GN9A 3DHNA 4FN4A 2OGUA 2W2KA 3PPIA 3GOHA 1LTHR 4LRTB 4UEKA 5A1TA 1VLLA 5DF1A 5CDYA 2GDZA 3C8MA 2H9IA 4PVCA 1D3AA 1ZKMA 3I1JA 1ZNQO 1E92A 3NRCA 1QYCA 3V1UA 3NEPX 1D4FA 5B4VA 4XIJA 1IPFA 3E9MA 2I67A 1LLDA 1V8BA 3RCBA 2Y99A 3GHYA 4WNIA 5COQA 1TA4A 1G0OA 1SB9A 4E12A 4AJKA 4PCVA 2YQ5A 4L4XA 5DBGA 2QRKA 1DEHA 4DC1A 1QMGA 5IDQA 4E2YA 1LQTA 1PR3A 3RKRA 1CF2O 2Q45A 2ZQYA 4B4UA 3JQ9C 5CEEA 2FPGA 3EVTA 3KLPX 4RL6A 1YRLA 4BNFA 1HDGO 2W8ZA 2QG4A 2Y0DA 4RVHA 4J1QA 4DPKA 4J91A 5CPFA 1C0IA 3BYZA 4IY1A 1IE3A 4LK3A 3ABIA 3IMFA 1CDOA 3NJ4A 2FZEA 2YUTA 3EGOA 4HX5A 3DR3A 4ALKA 3LC7O 4J7XA 3GK3A 4AJEA 5U9CA 1TEHA 2X8LA 5LC1A 2VHZA 3FI9A 1GEGA 3UVEA 4CMJA 4IS3A 2GZ2A 4D7AA 4BNTA 5TX7A 3CSDA 4M54A 1ZH8A 3BTOA 2DPHA 2QRJA 3GRPA 3D64A 1P9LA 4B4OA 4CLOB 2DQ4A 1SEVA 1ULSA 2NQTA 3H9JA 3ZV4A 5ICSA 5T8KA 4FQ8A 3I9NA 1LNQA 4YTEA 2PLAA 4RVUA 3ZNQA 1FDVA 3GVIA 3QVXA 4JQCA 4I08A 3VPXA 3TZ6A 3DMTA 3VH3A 5KVQA 1U3TA 1U7HA 1T2CA 2ZB7A 2ZTVA 3F1LA 1U8XX 2AEFA 3K30A 1HRDA 3ZWAA 2GPTA 4JJGA 1WZIA 2G0TA 3BMCA 2YY7A 5HWSA 1VL8A 3FF4A 3RBXA 1O8CA 4MIYA 2NVUB 2NU9A 1PJQA 4LRSB 1HLPA 1BW9A 1GQ2A 3IUPA 5JMWA 2P9EA 3EVNA 3IOYA 1JDJA 2O7SA 4A10A 3ROMA 3F4BA 1F17A 2Q4BA 1D1TA 4FDAA 3HADA 1LJ8A 4J6FA 2NM0A 2OP0A 1CRWG 2YV1A 5ES3A 1HKUA 1XSEA 3FSRA 3I52A 4EITA 4E3ZA 1X7GA 2VT2A 4BKUA 1HYEA 5I8ZA 4PLGA 5IZ4A 3KSUA 4ILKA 3ZV5A 2C5AA 2A35A 4CLRB 4OKIA 4AICA 3LT2A 2FOIA 3ITKA 5DP1A 1JVBA 4FD3A 5TJHA 4TRJA 2Y67A 2NVUA 3PQEA 1GUZA 3GZNB 1ZSNA 3WYCA 5H82A 1Z82A 4PG6A 5EINA 2AG8A 2G5CA 4Q3NA 4PZEA 4J4TA 3D4NA 4PRKA 3AFMA 2FPPA 4JBHA 2Q99A 4PLPA 1NHGA 3DBHB 1AN9A 3E9QA 5L40A 4JGBA 5TIIA 1DFGA 2YZ7A 2CSUA 4L0QA 3R0IA 1SOVA 2VWPA 5EN4A 1XQ1A 3ZGYA 4N5MA 1EZ4A 1V0JA 4YPOA 1CWUA 1YOVB 4LSWA 3K96A 5T5QA 2WWRA 4CLEA 3ZDFA 4CQLA 5FWNA 1UZLA 4MVJA 5DCUA 3HDQA 4IXWA 3HFSA 5AOVA 1PZGA 3RVDA 1ONPA 4LN1A 3V2HA 3I4CA 3K8ZA 1E7RA 4IZIA 4XQ9A 5DT9A 3OIDA 3H3FA 3IJRA 4K6FA 3E6AA 2W90A 3CH6A 4MO2A 4OAQA 4BO7A 3H2SA 1XU7A 1NPYA 2IXBA 1KVUA 3IKTA 4MJLA 1DSSG 4RV9A 3PJDA 1E1KA 3O4RA 3JYQA 4PLTA 1BMDA 4URFA 3PIDA 5A9SA 4U6SA 1LLCA 2HSDA 2HO5A 1PS8A 3L4SO 2D5AA 1PJSA 1I8TA 1Q1NA 3K5PA 3S55A 3FNHA 4XZ3A 2JJYA 1P1JA 3PIIA 5KJ1A 3TRIA 1ISIA 4GSKA 1JWBB 4WCDA 4ZGWA 3W4JA 3H9UA 5JDIA 1WMAA 3EW7A 1MG0A 3PP8A 4EI2A 3HFGA 3D3WA 3P19A 2YQ4A 3JQAA 1P0FA 3U09A 4CMHA 1E3IA 3JQFA 1TT5A 5KIAA 3KYCA 1WVGA 1Z73A 4AFNA 5JO9A 4BNKA 3WS7A 4FB5A 4EBFA 3BMNB 1PGQA 1QV7A 5TLSA 4TMFA 3DXFA 3ZU3A 1R15A 4QFCA 4CQMB 2FHSA 4BMSA 2EIHA 1QLJA 4FFPA 5FEUA 2VRCA 3ADPA 5TNXA 3VZSA 4KUGA 2VCYA 4XB1A 1GPDG 5EESA 1LDMA 1Z7EA 1PS9A 1UR5A 5JCJD 4QEDA 5JDCC 1A71A 4AJNA 3WGTA 4P22A 1T2DA 2X9GA 4J3FA 3AM4A 4Z9YA 2NV6A 1WNTA 4FSHA 2DBRA 2ZCUA 4M86A 4EJMA 4OOFA 1QSGA 2PGLA 4ND5A 1MB4A 1GCUA 3PDJA 2B5VA 3H7AA 3KLMX 4YDRA 1YQDA 1A9YA 4TRMA 1H2HA 1I0ZA 3RC9A 3F1KA 1NAIA 5T64A 3E18A 3QY9A 3O8QB 2YYYA 1JWAB 4R41A 2HK8A 4D42A 4H7PA 4IGEA 1MC4A 4ZICA 4YJGB 3ZU5A 2Z1NA 5A02A 4FFNA 4R54A 4BNWA 1CQIA 2BD0A 4E5KA 4UVHA 2DBQA 3OETA 2RIRA 1U4OA 2PKQO 3LSYA 3RFXA 1MV8A 4YJFA 4BGUA 4OHUA 1IUKA 1MXFA 4FJ1A 3WGQA 4NG5A 1SPXA 5B37A 3LK7A 1IZ0A 1N2SA 3HB5X 3SJ7A 2EG9A 1YE3A 3C3XA 1ZEJA 2OHXA 1BSVA 3ICPA 3P2OA 3JQBA 1QV6A 4M1QA 3RUEA 2WSBA 1AE1A 4AL4A 3L4BA 1QXSA 1OC2A 2CMDA 4HFMA 2GD1O 2IRWA 3VKUA 4YXFA 3GVPA 2ILTA 3PDUA 1U3WA 1BDBA 2VT3A 5KKAA 1SMKA 1ZMTA 2D3TA 2O2SA 3RU7A 2CDCA 3DBRA 3HE3A 4Y9DA 1LSSA 1NTOA 3U0BA 1H6BA 5TRTA 2BGLA 3CZMA 2O3JA 2YFHA 3GVHA 1GU7A 2VYVA 4WJZA 3VH2A 3Q1LA 3OQBA 3LQFA 1R16A 4CM4A 3RC1A 2D59A 2GR9A 2RBEA 1FXSA 1C3VA 2FP4A 1ULUA 4YA6A 5COAA 4YBZA 1C1DB 5CEFA 1I5RA 3DBHA 3DL2A 1DLIA 1NWCA 2V6FA 3EHEA 1PU2A 3VZRA 4E0BA 3K9QO 4Q9NA 3DONA 3L07A 4XRRA 1YXMA 2BFPA 4MPDA 5KVVA 2WEKA 4D3FA 1ZK0A 3EYWA 4FJ0A 5F5NA 1ADBA 1WPQA 4ALNA 4BNYA 4BS9A 1Z74A 3AFNA 1R66A 4BNIA 2P5UA 1QR6A 1A9ZA 1MA0A 5THKA 4IJWA 3WBBA 2I76A 2VHYA 1LDNA 4KUHA 4CM9A 1Y8QB 1RM3A 3GDFA 2AMFA 4DLLA 3STHA 4YAEA 1I33A 2Q1WA 4LISA 3KEQA 1VI2A 2V6GA 2DBZA 1C0LA 2YJZA 2H63A 4J7CA 2EF1A 2GNAA 2YHUA 4PZCA 3ZNPA 1X0VA 3QJ5A 4DIBA 1O94A 1Y1PA 1X7DA 4IJVA 5C3MA 4YACA 3UAGA 1ZXLA 4Y6SA 4IBOA 1VJ1A 2CDAA 4EDFA 4ND1A 2GUGA 1HEUA 1D7OA 4GMFA 1EE9A 3I83A 4J49A 1PX0A 3NTOA 4OQZA 1ZCJA 2X23A 1PL8A 4BKPA 3HUDA 4B8ZA 3RBZA 2VQ3A 4R5MA 1H6DA 1DB3A 1HTBA 2OMEA 3HDHA 2PH3A 4RQUA 4PLCA 2BF7A 5G0VA 5IDYA 3WWYA 3OA0A 4P4LA 1NWHA 2AEMA 3BMOB 3H6KA 4XIYA 2WDZA 3TFOA 3ORFA 3BMNA 2ZTMA 3V1TC 3MWEB 4XQGA 3VVCA 3ITDA 1XHLA 3GGPA 1NNUA 1K6XA 5G0WA 4WOKA 3VHRA 5JAIA 3LC1O 3NDIA 3WSVA 1EVIA 1K6IA 3WGHA 1X1TA 2B37A 1JKJA 1PL7A 5I7VA 1KBZA 2VHVA 2PKQP 3PHIA 3MJSA 4PLHA 1WXDA 1CETA 5C7LO 1ZSYA 3SJUA 2Y1FA 4JLWA 3L6EA 4Z6KA 2PK3A 2AEJA 5HS4A 2ET6A 3IIEA 3JQBC 1HSOA 3JQ7A 1ZEMA 1T26A 4NBUA 3WICA 2H1SA 2WE7A 3GPIA 2X0JA 3ROQA 4R1SA 1WW8A 4A7PA 4N7RA 1KERA 4B4WA 3UICA 4TVBA 2G76A 4K1LA 5DBFA 4HXYA 3N58A 4U5QA 5IG2A 2X7HA 2B4TO 1R0LA 1EK5A 1PZFA 2CVQA 1E5QA 1F14A 4WCFC 2F00A 4CMGA 2ZIZA 4EYEA 4M89A 1HE2A 3DMTC 4FGWA 4GX5A 1NPTO 2JD2A 9LDTA 3PGXA 3OMLA 2EGHA 1ISGA 1T1RA 2DUUA 5G4LA 1RYDA 2JL1A 1VKNA 5L4NA 2ZYGA 5GZ1A 3ETEA 3QHAA 4RCVA 4BQRA 3U4DA 5K0ZA 2P9CA 4CMAA 2YDXA 3DAGA 1C0PA 3KXDA 5BT9A 1P77A 3QVTA 5L45A 1ZSVA 1UP7A 2XXBA 4GX1A 4RVFA 3T7EA 1EVJA 2C0CA 3TSCA 3P7MA 1Y8RB 3DZJA 3PGJA 5G0UA 4DUPA 4IIVA 2E6UX 5L7YA 2NU6A 3UXYA 1ZBQA 2C7VA 2NLOA 3ONDA 2O2YA 4C4OA 3QWHA 5DCWA 1J0XO 5H81A 5JCJA 1GPJA 3H2ZA 1I2BA 2R2GA 4E6PA 1X14A 2PH5A 3GZNA 3Q11A 4XKJA 3CXRA 3JYNA 1HWYA 2I66A 3EK2A 1P33A 4P4GA 4Y6PA 3DBLA 1WMBA 1HT0A 3FD8A 1Y81A 1EBUA 3JD2A 3MZ0A 1GQQA 5EQFA 2NQ8A 1I36A 5ER6A 5AXBA 4CQMD 4OXNA 1YB4A 4NU5A 3VTFA 1AHHA 2FPIA 3WYBA 3FR7A 4B3IA 5HBRA 4XCVA 2IXAA 4WKGA 2DBVO 4UVGA 1DFIA 4R9RA 4C7KA 1VL6A 1BVUA 5A03A 3FCOA 4OOEA 5AQ1A 3A06A 3A4VA 4TZKA 4XGNA 5FI5A 2X0NA 4PLFA 2G82A 3W8FA 1VL0A 4NFYA 2JCVA 2O4UX 1GZ6A 2UAGA 1BRMA 2VWHA 3AU8A 2QIOA 3ZW8A 1VM6A 1YL7A 4LVCA 5A9RA 4M87A 4BV8A 3GHHA 1ZXBA 1DBVO 1W0CA 2GGSA 1HF3A 2Q4EA 3M6IA 3GC6A 3C7CB 3SLGA 4DGSA 3B1JA 1ENOA 1P1IA 2IZ0A 1UXGA 3G1TA 2B35A 1KC1A 4FS3A 2J3HA 2J5KA 3LLSA 4P8RA 3BXXA 3GT0A 3TF5A 1WDLA 2FSSA 4IZHA 3HSKA 5BQFA 2AQIA 1ZK1A 4BKOA 1DC6A 3ANNA 4KDEA 1VJ0A 4CMEA 5HM8A 5DCYA 2X9NA 1MUUA 1SCUA 1V35A 2IYPA 4ZJUA 3L9WA 3Q0EA 1JKFA 3AM5A 1O6ZA 1U5CA 2BI8A 4BO6A 4FGSA 5BSFA 2R6JA 3RC7A 3V8BA 1UAGA 3WYEA 4BO4A 2PD3A 1MP0A 1U9JA 3OJLA 4JK3A 4XA8A 4ALLA 4AVYA 1WZEA 1XG5A 1QYVA 2IODA 4PRLA 1GYPA 4YT2A 1TLTA 1ZJZA 1OAAA 2I5PO 4WASA 3NDJA 4YCAA 1FDUA 5I7EA 2OUIA 1F06A 4O6VA 3ZW9A 3GAFA 1XWFA 3I9OA 2DFDA 4OIMA 4WCFA 1HDXA 3DBRB 2GERA 3DOJA 2C82A 3L4BC 4OH1A 1NFQA 3AUTA 4IUYA 3B6ZA 5LCXA 4CM5A 1ISHA 2HCTA 2J8ZA 2LDXA 3QE3A 2F1KA 3ZV3A 3TNLA 4PIVA 1N8KA 2W98A 3WB9A 5B4TA 2BGKA 5BNIA 1HDCA 1B8VA 1FDTA 3HNPA 3KUXA 4K26A 4ND4A 1LA2A 1P1KA 3F6YA 3VTZA 1PR9A 4NJMA 4L8VA 4PLVA 3RUDA 4BV9A 1UDAA 4I5DA 2A9FA 4XGKA 1QYDA 3QWIA 3UHAA 4P4NA 4XR4A 3W4IA 3AY6A 2HMUA 4YJGA 4O0LA 3TOXA 4EJ0A 3BMCB 2BH9A 4KZPA 4DA9A 4D43A 3NYWA 5A5EA 3PYXA 1ARZA 4AJ2A 1IL0A 2JFFA 3ZV6A 4UUNA 4R69A 1GFSA 1NX6A 4NK4A 2NUAA 4Q3EA 3ZNOA 1YBAA 1BXKA 1KYQA 3W1VA 3HHPA 4HFJA 3VPHA 1TI7A 4E13A 1B2LA 1MFPA 1HDRA 1UAYA 1YL5A 3Q3CA 4XD2A 3SXPA 1JKIA 4E31A 2Q3EA 1T25A 1M75A 4JP3A 4R4JA 4BGVA 2Y05A 2PR2A 1YJQA 3FNFA 4PLYA 1P45A 5KNLA 2JFHA 1E3EA 3FPCA 3H5RA 4ALMA 2VN8A 2IZ1A 3RU9A 1HETA 4PG4A 1K5HA 1LSOA 4MVJG 1ML3A 1DRVA 3KSDO 4F6LA 1I2CA 2WD8A 4NJOA 2XF8A 2XAAA 2VWGA 2DU8A 3SX2A 3T4EA 1H9BA 3KRTA 4GPD1 1UDBA 4BB5A 2Y0CA 2BFOA 1ZK4A 4QQRA 2C29D 4UULA 3KV3O 3FPLA 3OM9A 4PLZA 5DNAA 1LUAA 3QVOA 4IS2A 3C24A 4MP6A 2RAFA 4BO8A 3RJ9A 4A27A 2AHRA 4EZBA 1B8PA 3GRKA 2CD9A 4Y6RA 4ZU3A 2NNLD 5KWEA 5F5LA 1R0SA 5JMPA 2YFQA 2QQ5A 2PGDA 3BMQB 5L4SA 1OZAA 1ZVMA 1UJMA 2P5YA 3TPCA 1LLUA 1VKOA 3OJOA 1WLYA 2I3GA 4DL9A 1F8GA 3VPFA 3JQCA 3IDSA 4W7IA 1G1AA 1V3UA 1DJNA 1E77A 3FWZA 5JCXA 1JQBA 3GQVA 1Y5RA 1HE4A 3NUGA 5JW6A 4N18A 4DIOA 1DHTA 1I30A 4GX0A 4QXMA 3UCFA 3A9WA 3QA9A 2OOSA 4XYLA 2W2KB 3PYMA 3ASVA 4KP7A 4R01A 2CVOA 4UVIA 3KBOA 2WM3A 4XDYA 4FBGA 3GF4A 2JHFA 3PJEA 3ZHBA 5ITWA 3AUUA 4FOOA 3UCEA 5IZCC 4FFMA 1G6KA 3QLJA 4GMGA 2P4QA 1YVEI 1U4SA 2GSDA 4CQLB 2G17A 1CERA 2GZ1A 1GYQA 2LDBA 3N74A 4DQVA 1ONOA 3MJVA 2DPGA 1U2DA 3PEFA 1NYTA 1SBYA 1E1NA 4CM8A 5CG2A 4AJOA 4CM8B 3TFQA 3RROA 3ZU4A 2V6MA 4I9NA 1DIGA 1YO6A 3RUFA 5CAEA 3BMOA 4BNNA 4W9NC 4YR9A 2PV7A 1YB1A 1WDKA 4B8WA 4IPTA 4PFJA 3PTZA 1VJTA 3GUCA 3GAZA 6LDHA 1DAPA 2QZZA 3AU9A 1BDMA 3RFTA 3WTBA 2X86A 4CL3A 4FW8A 3E03A 1HE5A 3T4XA 1YQGA 1KVQA 4CLXA 3CMCO 2VUUA 1GUYA 3GGOA 3CMMA 2CVZA 3H5AA 2CFCA 1BWSA 1K6JA 3L77A 3ZWWA 4Z0TA 4HADA 3BTSA 5DDIP 1D1SA 5HS6A 4CM9D 1UZNA 4DTIA 3NTRA 4TVOA 5IF3A 3IQDB 4HFNA 1H93A 1PQPA 3H65A 2OORA 1PS0A 1V3VA 4JJIA 3U49A 4K9DA 5AYVA 1T4BA 1PQWA 4LGVA 2AA3A 3U3XA 3MOIA 3MOGA 1YWGO 2WMDA 1D8AA 2QRLA 1VE9A 4DVJA 4YJHA 1T2FA 4WCFB 3IKVA 2PNFA 3LZ6A 4EUFA 3PZBA 4DLBA 1H6CA 1ADGA 4ONEA 1E0DA 2Z5LA 1DFHA 1YOVA 2TMDA 4R5HA 1H2BA 2Y93A 4D79A 5A05A 2AE1A 4Q3BA 3WGGA 3RJ5A 3D1LA 3BTUA 1EUZA 2C2YA 4MDHA 3INTA 2P9GA 1NXQA 4TZTA 3KYCB 2D0IA 2I9PA 1LC3A 4CV2A 1HDYA 2HMSA 1DIRA 3EZYA 4CR7A 2J3IA 1V3TA 1NVMB 2RH4A 3ZH2A 2Q2VA 1S7CA 1V6AA 4DIFA 3F46A 4RPJA 4IQ0A 2AXQA 3WLEA 4PG8A 4IJKA 1PTJA 3EUWA 4IDCA 1HDOA 2ZJ1A 2WJPA 1ZK2A 3DZBA 4BHTA 4IDBA 3KOUA 3QIVA 1LXCA 5KVCA 1KY5A 1JTVA 2OZPA 3V5NA 2XXJA 1LSJA 3V1YA 2X4GA 4E2ZA 4UVEA 1KC3A 3F3SA 3QQPA 3IAHA 2PFGA 4HY3A 5JY1A 1A7AA 1LX6A 1LRLA 4PGFA 3TZQA 1ZJYA 4DYVA 3OEYA 1RM4A 4CMCA 1AUPA 1DIBA 3UH1A 3PHHA 1A4IA 1J49A 3C1TA 3EY4A 3S1LA 1N9GA 2XOXA 3O03A 4FOSA 3ETGA 5JFOA 4E2XA 5I8WA 5HRUA 5CDTA 2P68A 3NX4A 1A7KA 2ZTLA 1QORA 1U28A 3WGYA 5K6AA 2D8AA 2X9VA 4ZVVA 2OL4A 3S8MA 1JLLA 2IEDA 4GVXA 4HFRA 3OJ0A 3F4LA 3CINA 4NMHA 4NH4A 4J2OA 4DREA 1FDSA 2HJSA 5ENDA 1Y5MA 4AJ4A 1NAHA 4I9HA 4UREA 1GTMA 2HQ1A 3DZIA 4MOWA 4R16A 4D0SA 1RYEA 3JQEA 1I3LA 2C59A 5EJ2A 8LDHA 2ZKLA 3JQ8B 3KB6A 4NZ9A 3HB4X 5KVSA 2R00A 5F1PA 1L1FA 3AW9A 4QUKA 3E5MA 3OIGA 3WLFA 3WGIA 4KWIA 3L6OO 5L51A 1GV1A 1N5DA 2JCYA 3JQ6A 2NSDA 2Q2WA 3O9ZA 4A03A 3MWDB 2OO5A 5IXYA 1T2EA 4YQYA 1Q7CA 3ULKA 4DBZA 5ADHA 1B3BA 1XQ6A 5FI3A 2EERA 3ENNA 3QP9A 4YAJA 4W9NA 2BHLA 4U0JA 4WK6A 4L9RA 2VTEA 1EEHA 2ZTUA 3PI7A 5CDUA 3Q6IA 3C7AA 1MC5A 1F8FA 4ZHSA 3QWFA 1RKXA 4RORA 3VZPA 4UAGA 4J1SA 4B7XA 1FF9A 3H8VA 2X22A 3CEAA 5BNTA 1PSDA 2YHIB 4MP8A 3ZWYA 4K6CA 5KOIA 1QG6A 1VC2A 3JCZA 4RVDA 3ZWXA 3COSA 1DPGA 4I5EA 1ZO8A 3FWNA 4XQCA 3BHIA 3OJEA 2GO1A 5AXCA 3WNQA 2POQX 4II2A 5CDGA 1AXEA 3B1KA 4BL5A 2DUWA 1NR7A 4WGGA 4J4HA 4ZN6A 1ZK3A 3WQQA 1DRUA 3VH4A 1Z7BA 4YAKA 4KDFA 4BNUA 4D46A 3AUSA 3TZCA 3JQGA 5EIOA 1SOWA 2FZWA 5FYDA 4I8XA 5TT1A 2QYSA 4E5MA 3G3EA 4B7UA 2J6IA 3GVXA 2HAEA 2VWQA 1C1DA 1X15A 5T67A 1DJQA 3FRJA 5CEJA 2C7GA 3K2EA 3EAGA 3MJCA 9LDBA 4E5NA 2GN6A 2VZ0A 4UUMA 2AQ8A 3HG7A 4GBJA 5JSFA 4J16A 3RUAA 2ZCVA 5B1YA 4D3DA 2E49A 4IMRA 1KY4A 3B70A 5DOVA 5F3RA 4ND3A 1EUCA 3GH3A 1NFFA 2HDHA 3SC4A 3GEMA 3H9EO 5JXWA 4M8SA 3VPSA 1F12A 5C5IA 1LQUA 4CM1A 2Y1EA 5ILGA 1K2WA 1E5LA 2ZYAA 4WECA 1Q7BA 3V2GA 3PRJA 4BNGA 4XGIA 3L0DA 3Q2IA 3GEGA 3VH1A 2O7QA 3OSUA 2IEBA 4RPKA 1KEVA 1BVRA 3LT0A 1TT5B 4UUPA 1Y9AA 3WIEA 3QSGA 4YEDA 3E9NA 4PLWA 8ADHA 4HV4A 4YJHB 2C5EA 5K9ZA 1MGOA 4ROSA 2O3RA 3Q9UA 3WGZA 2X0RA 1UZMA 2HLPA 3ZWBA 2VNSA 4I9UA 4II3A 3U4HA 5I9LA 3LF2A 2FSVA 3OH8A 2VOJA 2DTXA 2JD1A 3GNTA 4J2HA 3DZHA 1S6YA 3WJAA 1M6HA 4IGFA 4IDEA 3NTQA 3G0OA 4RLSA 3KZVA 2W2LD 4MIOA 1ZMOA 3F9IA 3QW2A 3VDQA 1YDEA 5C7IO 2QX7A 3CUKA 2HMWA 4YT8A 1NHWA 2E37A 3VKVA 1I01A 1R4MB 3INGA 1ISMA 4BO1A 4CMEC 4NHEA 3UKOA 3GUYA 2BRUA 4PG7A 1DOHA 1IB6A 2YV2A 3GPDG 1FK8A 1GEEA 4CL8A 1DC4A 1UXIA 4H16A 3HZZA 4YB8A 3WXBA 4AJPA 3JD0A 4WUVA 1UXJA 3IUSA 4RO0A 4E33A 1NR1A 2J3JA 4NR0A 4YRAA 2YV3A 3O8QA 3DC2A 4RF5A 1EQ2A 4WLUA 3KYDA 4YWJA 4B4VA 1PEDA 3AOEC 2ZB8A 1PIWA 3S2IA 4CV1A 4NI5A 5F1KA 2BGMA 1DAOA 3R3JA 4EJ6A 4EW6A 3K73O 1B26A 2BMAA 4Z9XA 3PQDA 5TT0A 3OICA 1K3TA 1T1SA 4BGIA 4IQGA 4KQXA 3W6UA 4NK5A 4JBIA 4CUKA 1TXGA 1LRJA 4D3SA 4FFOA 1EMDA 4DRYA 2WD7B 3ANMA 4W6ZA 3E5RA 2NTVA 3K6JA 1ORRA 4HNHA 3OF2A 4J0EA 1UDCA 1V9LA 2RCYA 3A1NA 2WYVA 5IXSA 2EP7A 1ENZA 1QP8A 2O3TA 4W7HA 4LCEA 3DTYA 4YT5A 5DN9A 5JYDA 3I9KA 3TWOA 3SVTA 3OIFA 2C20A 1NVTA 4O59O 3VVBA 3RWBA 3H9QA 1EE2A 2JAHA 3GLQA 1GY8A 1YDWA 4R51A 1K0UA 3HQ4O 4IM7A 1GADO 2OBNA 5CPBA 2CDBA 1BTOA 1YBMA 3MJTA 2DT5A 5EPOA 3C1OA 4L4RA 1P74A 4NBRA 3G17A 3PHLA 5COBA 1YKFA 4J43A 2WYUA 2YW9A 4U8GA 1VPDA 1WDMA 2P2SA 1OFGA 5MDHA 3DZGA 3K92A 3ZWOA 3F47A 4NNJA 4CLRA 3KYBA 4H15A 1DRWA 2GCGA 1RM5A 1KIFA 3TDKA 5JBIA 3W6ZA 3CTMA 3AJRA 1NP3A 4CMIB 1SB8A 1HYGA 3I6QA 4LVUA 4DQUA 1HE3A 1OMOA 3ROKA 3GGGA 3JQGB 4Z0HO 5L4LA 4ZQEA 5JS6A 1ENYA 1EVYA 4CUZA 4MVJD 4W82A 2O48X 2VZ9A 4BB6A 4J1TA 4F6CA 2O3UA 3RBVA 3A28A 3UGKA 3KEOA 1P1FA 4IDAA 1C14A 4KWHA 3GMDA 4BNZA 1OI7A 4TQGA 1SEPA 3VOSA 5KJFA 4RLHA 3AOEA 4DLAA 1LDGA 3D4PA 3DZFA 5IJZA 4L76A 3CPSA 2Y1GA 4MKRA 2Y1OA 4CMBA 3GFGA 2EWMA 3E8XA 3ZU2A 3PLNA 4BKQA 3WX0A 3M2PA 5ER9A 2HUNA 1X7HA 3D7LA 1HZZA 2JHGA 3QRWA 4UUOA 2VRCD 3S2GA 1ZFNA 4GVLA 4R1NA 2HMVA 1E1LA 1MFZA 4RPHA 3GN1A 2V65A 4TRRA 4CJXA 3ADOA 5L7TA 5JNLA 4NU6A 1B16A 4ZRMA 1BXGB 1C0KA 3U4CA 5HA5A 4Z9FA 2JD0A 1HSZA 1SC6A 1I2ZA 5DULA 3DBVO 2Q1TA 3BMQA 3WBFA 3F5QA 3R6DA 5JDCA 1UUFA 2GZ3A 4M55A 1P0CA 3SC6A 5JE8A 5GY7A 1LDYA 1PGOA 4JX8A 5G4KB 3DHEA 1DC3A 5G2OA 5JC1A 3C7DB 4CV3A 1VRWA 3AY3A 1Q2XA 4BNJA 5HTOA 4BQPA 3FTPA 3LLVA 5CDSA 2NADA 3P5SA 1I3KA 4M49A 4GKBA 4XB2A 2I6TA 2A92A 3JQAD 6ADHA 3GMSA 1JVSA 4BO3A 1IZ9A 1U1IA 1N9GB 3NGXA 4E32A 4K28A 4LSMA 2VOEA 2HKIA 5JDIC 4Y8VA 4DXHA 1E6EA 3MEQA 4RF2A 1DLJA 4RPGA 2FY8A 3PK0A 3LT1A 1MLDA 3ASUA 2B5WA 2EGGA 1LI4A 4ZQHA 3PLRA 5AXDA 1E3WA 2GYYA 2VZ8A 5F1OA 1PJCA 2UV8A 3TZHA 3OP4A 1PGJA 1R12A 5DZSA 1ADCA 1KEUA 2QW8A 3UCXA 4FCCA 1Y7TA 3KM0A 3GA0A 4CM4B 1KS9A 5BNFA 1T2AA 1KVTA 4AG3A 3WG9A 4QO8A 4A26A 1FMCA 2VUTA 2B69A 3FBGA 2O23A 3PWSA 4I1IA 4PZDA 4XDZA 2ZYDA 1L7EA 4WE3A 2Y68A 1CYDA 1EBFA 3JQ8A 5KTKA 3ZI0A 3VC7A 1FJHA 2VHXA 2Z1MA 3DDNA 5TC4A 4PVDA 4DPMA 1M6WA 5GZ6A 3RKUA 1YQXA 2EJWA 1M2WA 3WFIA 3GVCA 5CHEA 4YAGA 1U5AA 4OXYA 1BGVA 3JD3A 5MGBA 4B7CA 3OJFA 1NQ5A 1N7GA 2E4AA 3BHJA 3DAFA 1Q0LA 4HKTA 4EUEA 5IFLA 3OFSA 3WTCA 1HXHA 4W99A 2NU8A 2QHXA 4BMNA 5I9MA 1RPNA 4QTZA 1UXKA 2D4AA 4GX2A 2GASA 2D5CA 4TRNA 3WMXA 5B4UA 1GR0A 1Q7GA 3LT4A 2GLXA 2I99A 1AGNA 3ENKA 4U7WA 3UFXA 4D41A 1K89A 1NASA 3NAQA 4RPLA 2C2XA 3ICCA 4AJJA 1J5PA 4BIIA 2AQKA 4LMRA 4OSPA 1I10A 3F5SA 1IHYA 5JAQA 2X5JO 4BNXA 3EMKA 1H5QA 3NGLA 1O95A 2NACA 4OGWA 5JYEA 2Z95A 4GAEA 2PD4A 2YDYA 4XYGA 4XJSA 2NTNA 3DBLB 4WLEA 1PZHA 3QVSA 1E7WA 1C1XA 4OQYA 4ITUA 4S1VA 3RSHA 3TJRA 3TQHA 1MG5A 1IHXA 4MINA 4NFSA 4BNVA 5KJEA 5ITVA 2FMUA 3WQRA 4ESOA 1ENPA 3AM3A 1MX3A 2Q50A 3JYLA 4LCJA 4ND2A 5EL0A 4OM8A 4O5OA 3O38A 3G49A 1E6UA 2O3SA 2IE0A 2FRDA 1NQOA 1P31A 3U62A 3TOZA 1WAMA 5ILOA 2C54A 4XRGA 3NDRA 7MDHA 4HP8A 4J9VA 4CPDA 3VZQA 1ZZEA 3JQDA 2VYNA 2E82A 3DOOA 4MKZA 3M1AA 1SO8A 3X2FA 3JQAB 4BUCA 4TKMA 2P4HX 3CIFA 4QT0A 3T7CA 3DWFA 4E4YA 4FR5A 4BOYA 1CJCA 5JPIA 1GZ4A 4R1TA 3VAZA 4CLDA 4NBVA 1LBEA 1XELA 4MP3A 2GRAA 4QSMA 5ENVA 3RC2A 1YB5A 1GYRA 1DO8A 1GAEO 1OOEA 3ONEA 3PVZA 1GL3A 2OFPA 2NVWA 4YVFA 1I3MA 2A94A 1R4NA 4GKVA 3ROPA 4JP2A 3FTNA 3WDSA 4AJLA 5J23A 4L4SA 4IJUA 3S2EA 2VHWA 2NWQA 4R68A 1XCBA 2PA3A 3GZ4A 4BGEA 3ETDA 3KTDA 4DMLA 2B83A 3FR8A 1PL6A 2A4KA 5AXAA 1VSUA 4OYRA 3GEDA 1IPEA 4G2NA 2VRBA 1LDBA 3JQ7B 1P44A 2AG5A 1KEPA 2EV9A 2UYYA 4CLOA 1IYZA 2ZK7A 4WOJA 2CZCA 2PZMA 3ZZNA 4O63O 4L74A 1X0XA 3D4OA 4E30A 3ON5A 2E48A 3RAJA 2ZB4A 2Q46A 4F46A 2UVDA
chains in the Genus database with same CATH superfamily
4BWVA 1HZJA 1TO1E 3BA1A 4G6ZA 5BSEA 1CNEA 1F51E 3QVWA 2WYWA 4MA4A 5AHWA 2LNDA 3PHGA 1C7JA 2RHHA 5ELXA 2GOYA 1U0EA 3O9VA 1PL0A 4MNTA 4UTPA 3SM9A 5CFMA 1AKUA 2W2OA 1S8FA 3WGLA 1H4QA 3LOUA 3CZPA 3MWDA 1MQSA 5J2UB 3DOCA 1EX6A 3K8QA 4KXLA 4PO9A 4AD8A 4K9NA 4F3RA 4XI9A 3CSSA 3ENZA 3IELA 5CURA 4DYDA 1Q19A 1CLUA 4MWGA 3GNLA 5ICMA 3ZVNA 6GPBA 3CUSA 4GQAA 4TSKA 1M7BA 2QX9A 4I5GA 1I9GA 5JS2A 4HBGA 1NW5A 1C1XB 3F5MA 3LU1A 3OZVA 1PJ4A 4M76B 5IUKC 3ZNNA 2VP2A 4GLOA 4R1UA 3REGA 2F55A 4NWIA 2ZM5A 2BCJQ 4YDHB 3AEUA 3H8WA 3HKEA 4AJ1A 5A4KA 3EZLA 2XECA 1ZD9A 4ME6A 2FSPA 3GLIA 3DO5A 3R0VA 3MJEA 4PHGA 3PNSA 4NARA 2P9TA 5I7SA 5KQSA 2BZ1A 4ZCIA 4ER5A 4IILA 4H31A 3TR5A 1W5BA 5IZCA 1SU8A 4XDHA 2QUZA 3BXGA 3R3YA 5LN1A 4X8MA 1BROA 3V8EA 1L7BA 3UENA 3DM5A 1BA3A 1ID1A 1Z5WA 1PHPA 3FTCA 4JBGA 4JJKA 2AXPA 4CXMA 5B6JA 3VPCA 3WHLA 1PYGA 1EVEA 1OUMA 3E1KA 1QHXA 3SLKA 2DTEA 3TGLA 5HMLA 3K9BA 1Z45A 3C2QA 3KSMA 1OH7A 4N54A 2V55B 1GCOA 3C6XA 3QM1A 2WSLA 3MTAA 4KO4S 4NJEA 4DE5A 3H4VA 3W8EA 1JDUA 2UUOA 4ZZ0A 4PE5B 4MVJP 5DNVA 3NETA 2OV4A 3MJDA 2XIQA 4B17A 4F4DA 3JYPA 5KVAA 1I51A 2EJUA 4I4CA 4YP5A 2W6ZA 1CQWA 3LGAA 1O0CA 2QTVA 4GXRA 3G9ZA 1QYXA 4PC6A 2HW8A 1JPNA 2ZCJA 5TXGA 3S2YA 5AVKA 1E64A 1Z13A 3N53A 1H1TA 1VHJA 2P5SA 4BJ5A 1RXCA 2JFWA 1PGPA 3LYLA 4HQFA 3LX4A 5G3YA 4HYYA 3HN7A 1Z26A 3AR5A 1DKOA 3O8CA 3U3DA 2Y1DA 2VJDA 2E1PA 3PGLA 1JX6A 4RJ2A 1TAUA 4P3YA 1TT7A 4DBLE 2LCFA 2ZJOA 3DGEC 5J4VA 1JT9A 2PGXA 1AQNA 1E2GA 4J90A 1KNXA 3LOQA 3RYHB 5TQ0A 4KYTA 3KOOA 1WHTA 2VCEA 3TXYA 3G88A 3DOEA 1Q0TA 1OU0A 5IAAA 3ZHYA 2PZKA 1KZ9A 4EX7A 2IUEA 4V3BA 3V3TA 5HKOA 1QPZA 1PWXA 3R3XA 4TN1A 1YZLA 5J2TB 1V71A 3FNGA 4IV0A 4G89A 2CY0A 3FDZB 4N0MA 2B21A 3BXPA 4IIHA 5IJAA 1EK6A 1Z83A 3C70A 2B4AA 3BRWD 5FAXA 1N3BA 4GF5A 3BIOA 1TADA 4MIEA 2PRIA 3CLRC 4WLVA 1QIMA 4HZIA 3AY7A 1ZMBA 3DW1X 2RBKA 3P9QA 4AO7A 2FN4A 2R62A 3UW3A 1V4NA 1RLJA 2HI0A 3JVEA 2ZIXA 2DTDA 4ZZ1A 2B4RO 4F45A 3CG4A 1AS0A 4RHFA 5BWLA 5I4IA 4YI3A 1ZNYA 3HCFA 3O95A 1SVIA 1YR1A 4HXGA 3DLHA 4BMCA 5K3CA 3MA0A 3PFFA 1C9NA 2VZEA 2JGDB 4H9GA 4LBYA 1VMEA 1J4AA 2IEZA 1H2EA 4MW2A 2AC4A 4Z4GA 2KLBA 2QRQA 4NPCA 2FOXA 4NBTA 1P60A 5AM5A 4E5YA 3ZYCA 1S0UA 3AF4A 5F64A 4DUYB 3K94A 4ZK6A 3FYHA 3QG5A 2HX1A 2V5VA 3IPCA 3RUHA 1FFXA 4R8SA 5IRCD 2OYSA 2XZOA 1FS6A 3HMQA 4Q5IA 4MEJA 1U0BB 3QELB 1BXGA 3ESAA 5E3IA 4KIUA 5BVGB 4EMBA 2Z6QA 1EUDA 3ENWA 3O8BA 4M9SA 5JCZA 2XB9A 5AOAA 3AF1A 3R44A 4J0QA 1WXXA 3TNJA 3FPJA 4ZI7F 4YWHA 4Z3KA 3NWBA 1JDBB 3MFQA 2VHJA 1XHEA 3GIWA 3RF6A 1M9NA 4QECA 1WULS 5U4QA 3V2UA 4PIPA 4DQDA 4LE2A 5JLAA 2P6PA 2GN8A 4NZMA 4C7JA 1Z6ZA 1LF5A 4X62B 4LDZA 2BSAA 4UNNA 1FFDA 2EP5A 1OYVA 1BH6A 1RW4A 2NUTB 2OCDA 3PD1A 4TLDA 5A6SB 5B12A 3KQNA 1IY8A 2J07A 1GN8A 3CO5A 3MMSA 4LC9A 1AQLA 1QOQB 1YULA 2VTDA 4Y0AA 2V6BA 2ADMA 2HHCA 3MRTA 3IQXA 1GV0A 5LBIA 1KSGA 4HH1A 4TUYF 4RVCA 5AVXA 2QZJA 3RUIA 4MVWA 1Q1EA 4RIEA 3LDFA 3A7DA 3N7UA 1P2GA 1LSUA 1MQ9A 3BCUA 4QOHA 2DCMA 2XE8A 1E94E 1J0CA 4FLMA 1FOEB 1NBOA 2V97A 1U7ZA 4GQBA 1I1NA 5T6BA 5A5VA 3OZXA 1INLA 1G8JA 1OXVA 1DQPA 1OLOA 2XRYA 1XMPA 4HTFB 3EC7A 4AT1A 4MUJA 4UEOA 2YX1A 5KYWB 3NBXX 4QBHA 4MLZA 2JLWA 4KXYA 1Z36A 2YJ6A 4B34A 1W52X 1M2VB 2XNJA 3HFRA 3RRFA 2VPZA 1L3CA 2REBA 3JARA 1SXJD 3GL9A 4LPKA 3S99A 4IQ8A 1X77A 5AVRA 4IGAA 1IRIA 4JSRA 3PWZA 4HLNA 1ULBA 3M3PA 4JROA 3MWLA 5LL6P 1CEXA 1N4AA 2WTBA 3RYHA 5EXSA 4QDUA 3K0CC 2O3QA 2GHIA 2C5SA 2WG2A 1CUZA 3V80A 2RC6A 4UTNA 2PD6A 3V42A 1TEVA 2LR0A 4U63A 4KTVE 1IXRC 2EKQA 1Z8FA 2WJJA 3M33A 4D8XA 2Z6VA 3GDOA 3ND7A 2FRDC 3CVOA 4WOPA 3UMSA 4BO2A 4B79A 3KUUA 2HQRA 5H4GA 2BFCB 2J4CA 1IMOA 1V11A 3NEYA 1K08A 4Q15A 3ODGA 1N32B 3CRVA 3QBJA 2DPLA 1FTGA 1HL3A 2PL1A 3ZD8A 3K9FC 4FFBA 5LP1A 3GA7A 5JISA 4YQEA 4JJ4A 4E5DA 4CL0A 4BLOA 2EEZA 3H0KA 4KAFA 4BFZA 1BOOA 2GUWA 3I5UA 1UADA 3TEMA 2B1QA 1Y7PA 2OMKA 2R1TB 4FE3A 3RRNA 1RAIA 5I47A 1JG7A 1SNYA 2NZVG 2WJ3A 2DQKA 3OEWA 3P1JA 4MJ3A 1FEZA 2ATIA 1KK1A 1E3SA 1NXXA 2IP2A 2VNJA 1HLDA 1FFGA 2X5OA 3EDMA 5EXPA 1HQKA 5GGYA 1N78A 4PSCA 1Z6QA 2IEGA 4BEJA 1P2FA 4FYVA 2GFIA 5AKYA 5EMHA 3N1UA 3Q7SA 1R0BA 4NZNA 1GZ5A 1O94D 1MIHA 5DLQC 5AVOA 3TDMA 2I4RA 4RJTA 3KQPA 3S40A 1CHDA 1XK6A 1BZYA 1RYZA 5TMDA 3GFBA 1L8QA 1PJBA 1GTZA 3VC1A 1P4RA 2ALJA 3IX7A 1XKQA 1L5VA 1KP2A 2QW0X 4MI9A 2GF2A 1YBFA 5DJ5A 5CFZA 3RBAA 1E7YA 1YMQA 4NC9A 2VAPA 3I01M 2H59A 4FPXA 3IP1A 4NE7A 2GHTA 2BR3A 1P7CA 2FN8A 1U8ZA 2IBMA 3GDGA 3L93A 3BERA 4Y7DA 1AO0A 5FF9A 4G1EB 1NM5A 1YACA 4W1PA 1I32A 4JI5B 4YAIA 3I3OA 3HWWA 3DFKA 2IDZA 2C1EA 1X9GA 3H2HA 5GP1A 4MUHA 2JFGA 2PLWA 5FUBA 2FGJA 3B3QA 4RESA 2HPZA 3FKQA 4D57A 4NJMB 1YZTA 3ST7A 1W8DA 3KHUA 2EIXA 3EEBA 3M6LA 5TJ9A 3ER9A 2PKYX 3FFTA 4M21A 3WSWA 2FXVA 3MXTA 2XMZA 4DW8A 4YUZA 2Y2UA 5A9SB 2WG0A 4U0KA 1J24A 4XWTA 2V7XA 2CNBA 4HDMB 1Y6JA 1H6AA 1R8YA 2VR1A 4GRIA 1RJDA 3QVGA 3KYDB 1UC5B 1RI3A 1UOOA 3SFVA 3TFWA 3WLKX 3WSTA 4JJFA 1IK6A 4BAGA 1M34B 3PNOA 3PZRA 3MS2A 2VYVD 4EPXA 1U9ZA 2ZRAA 3U4GA 2Y27A 4U8HA 4GGPA 4K46A 4RY8A 2G9NA 3LD9A 3ZWDA 2CLSA 1L5OA 3IC5A 2VJPA 3FSGA 1OBFO 3I73A 3U4IA 4JJ7A 3NO4A 4ZWNA 1D1QA 1PJ3A 2OWDA 1CQZA 1FDWA 1QX4A 1G63A 3QWAA 3IQWA 4W8OA 1WPXA 1NC1A 2GEFA 3L0ZA 3OU7A 1WL8A 4L4UA 2Q7XA 1ZGCA 3IBFA 4KE8A 4KQGA 2PMFA 2YZKA 3F6BX 3THWA 1WY5A 4KHZA 1GD1O 5IKEA 4TYWA 1CZHA 2YXLA 1A72A 3HU5A 3C39A 3JRXA 4OVKA 3TVYA 4XTRA 2C84A 4U7HA 1JAHA 4KXXA 2CLLB 3AINA 2GYVA 1B42A 2J67A 4IAOA 4CHGA 4GOOD 5C7OO 4ED9A 1IULA 4QPZA 1R6DA 4BUZA 1MT0A 3ABZA 3BRQA 1PG0A 1E7QA 1YNOA 3FMGA 4MVJE 4X54A 5DTMA 5CX1B 3ZHSA 3MILA 3EQ7A 1U7UA 1D7AA 5ALLA 3U7FB 4Q05A 4WVLA 3GG9A 4P83A 3CLSD 1I4DD 4BEBA 3B3JA 1GRVA 3SZMA 1KI9A 4KXFB 1X7ZB 5A6VA 1QQ6A 1U9YA 3AR9A 4MICA 2NXCA 1B14A 4P7JA 1EFKA 2OBYA 4YRDA 4P38A 3EEOA 2Q1UA 3WFJA 5KOHA 1RJGA 4Q9KA 3NEJA 5IYZA 1OQAA 3SFTA 2C57A 1PZEA 3D5QA 3GEPA 3IBYA 3CF4G 1QPBA 3NHAA 1NUPA 3KAKA 4JN6B 4NZOA 4P4TA 2KJQA 4Y1EA 3FNIA 1GFIA 3WGKA 1XIVA 2PUDA 1PJLA 1SIUA 2H57A 3CEHA 1YAJA 4GO1A 4OG2A 4QUGA 3AV0B 4X61A 5ERXA 1V9CA 1A5ZA 2Q1YA 3OESA 1Z17A 4V1CA 5M34A 4YJ3F 5EERA 4OSOA 1UT8A 2NU7A 2YWHA 2R8EA 1C9YA 1CJUC 2KBFA 4CMIA 3UPUA 5ALSA 4BZWA 4H17A 3GFVA 2O8FA 3DMYA 3DYVA 2PVSA 3PRYA 3ANYB 4UHCA 4RDIA 1U8UA 2OHOA 1T91A 3IUQA 1JJ7A 1TZ2A 2NU8A 1J42A 5LZ8A 4H1UA 2HK7A 4JODA 1WMSA 1YFJA 4L5AA 3KKNA 1X7WA 1IY0A 2A5YB 2R8RA 2VQDA 3DZDA 3BDIA 3IJPA 3OWXA 4Q3DA 1AO3A 1DAMA 2JKZA 3F7MA 4Z0PA 1AQJA 4PV7A 2YYSA 2X9QA 5KJ6A 2VQ6A 3T0FA 2JFNA 1SCIA 3OJCA 4DV3B 1FXWF 2WABA 4O4JA 4RZUA 3H9GA 5LDGA 4YRQA 4B83A 1NSTA 3VU9B 1QUEA 5FKJA 2V4ZA 2C94A 3L6DA 3Q10A 4BFCA 5KNDA 4NBWA 1OTYA 1E2BA 1AQUA 1XN1A 1M67A 4RQBA 4FM9A 4KLCA 4EVQA 4GLJA 3VZDA 1O9BA 1SUWA 1XNHA 3OCVA 2ZUVA 4IGIA 3I9JA 5F21A 3JSAA 2ZI7A 4PPGA 4BMZA 3AVQA 1XLTA 4BNHA 2AG0A 1W8IA 2QE7A 3PG5A 4B80A 3E35A 5HJ5A 2XVZA 3ZBPA 1LLFA 2W4IA 5ABPA 5EJIA 1VHQA 4WEOA 1RHKA 1WB6A 3OUTA 4RQTA 5DYYA 4B5LA 4AM8A 2PBLA 3GNSA 2QXUA 4DPLA 5EE9A 4AW9A 4QYSA 1RC8A 2WTUA 4JB2A 2CZQA 2AYZA 3NOOA 2P9HA 4JDPA 2X5KO 3AF3A 2MJLA 1KEEA 3RUCA 1Y9JA 3HB1A 1W34A 1N6KA 3EXHC 1U0NA 1GKYA 4S2UA 3SS8A 3EFHA 3TMKA 1TM2A 4J3JA 4LV5B 1U1CA 4OMUA 5CTAA 1XEAA 2VFAA 3S5JA 1BHSA 4E5PA 3LUCA 2GF0A 1PZNA 2GCPA 2SCUA 3MWYW 3ZN2A 3O2JA 2NYAA 4CKYA 3WK5A 4ZQFA 2EGUA 1ZI6A 4GWKA 2H54A 1EZ1A 2Z4TA 2H3EA 1CCWA 3VI3B 3GJ4A 1IG0A 1LK0A 4M0DA 3RT7A 5KCZA 1QRSA 1M1YA 3MTJA 2Y1CA 2I6GA 4GMHA 5JC8A 1TLFA 1MT3A 3N0TA 3T3GA 4PC3A 2JZNA 4YCMA 2FR0A 1E6WA 4FBMA 2AQHA 2BMEA 2JFUA 4HMOA 1USUA 5JJ5A 3LDHA 3ZWVA 1UQUA 1YZGA 4D0LB 3F8WA 5TVKA 2QJRA 1RXIA 4NULA 5FTLA 3DO8A 2CHGA 1JLHA 5EJ6A 2TRSB 1O7JA 2AZTA 3N6RA 1PJ8A 1N6HA 4LRTB 3JZIA 1LTHR 4U6NA 5AJHA 4RWZA 4BECA 1VLLA 2CJYA 1ZH6A 3WDKA 2H9IA 2I0FA 1ZKMA 4WOCA 3PPXA 1O6CA 2NW6A 1Z62A 1ZNQO 3K4HA 3G85A 1EIWA 3AVOA 3NRCA 3PD7A 1KQNA 1ZVJA 16PKA 4HPWA 5ALWA 5B4VA 4MB6A 2A8YA 1GITA 4MYRA 2I67A 1V8BA 4URYR 4HYQA 1X80A 2VCHA 2Y99A 1A7JA 3GHYA 5CCBA 2VDPB 4WNIA 3ZE1B 2AKAB 5FIUA 4WK2B 5CVCA 1SB9A 2I4LA 4TLEA 3O91A 5JLJA 4PCVA 4L4XA 5KSYA 3T0GA 3H5VA 3HI4A 1PR3A 3R7WB 4Q1BA 2FPGA 2OBFA 4DSUA 3U19A 2L17A 1SKYE 1E5VA 1BCSB 4DLVA 2QG4A 3V6MA 2VJMA 4J1QA 4EYKA 4P92A 5EP4A 2CGEA 5LLSA 1VA5A 2OYCA 1COWA 5KNBH 1L4LA 5M2QA 5BR1A 2ACVA 3NJ4A 1T3ZA 2YUTA 3X44A 3HCAA 2NP6A 2GPYA 1VBNA 3LC7O 4AMYA 5KYUB 1WXEA 3OFND 4AJEA 1TEHA 1FPQA 1VCMA 1X7YA 2P30A 3COVA 3N2EA 4LHVA 3VR6A 4OQPA 5CA1F 4F2WA 1GEGA 1C3JA 1DAFA 3CH7A 5EP3A 3UVEA 1GAQA 2ZBGA 4IS3A 4CMJA 3SVLA 1BJTA 1OE0A 4X3PA 4BNTA 1NI5A 3CSDA 4M54A 2QRJA 3GRPA 5JS7A 2PSJA 1OIWA 2UU9B 2OAQ1 2I6UA 4RD4A 2NYRA 2PU7A 4KXNA 2AK2A 2WB2A 1KEKA 2BMFA 1ZL0A 2QQFA 4FVTA 3V32A 3VYUB 2ODBA 3ZV4A 1O4VA 2R60A 3EWNA 2BLNA 1FX1A 4FQ8A 3I9NA 1LNQA 4YONB 1CFZA 3DWGA 3FWPA 4UCQA 5JD5A 3CVUA 3LPMA 2PLAA 4I3HA 1FDVA 3GVIA 2WAAA 4NFLA 1S2GA 1TCUA 3KS9A 3DMTA 3JALB 1VLMA 3L7IA 5IHXA 1U3TA 4RNDB 5IH3A 3T99A 1L7PA 2AEFA 3BG5A 4L5IA 4H77A 3B82A 1YQWA 2OQRA 3ZWAA 1JHOA 1L8LA 3GXBA 3LUGA 3BMCA 1VL5A 2YY7A 5HWSA 5JECA 4BMOB 3P4UA 3DPSA 4MIYA 4J6EA 5TQ2A 2AYYA 4ZOQI 1RLTA 4HN4B 4MYDA 5HDQA 1NDQA 4RSHA 3O83A 4LRSB 2XB4A 1BW9A 1GQ2A 1D5CA 2RHBA 3PGA1 1Q7TA 4YJ2B 2O7SA 4IJQA 1NJ6A 3BE5A 1F17A 1JR3A 2Q4BA 4EKGA 3K6SB 3HADA 1LJ8A 1UC9A 2YWCA 1CRWG 4G0ZA 1HKUA 2QV7A 5TVGA 1XSEA 3FSRA 3MTDA 5GWXA 1KARA 1V2GA 2OO3A 4KPUA 5LZ4A 2XGJA 1GA4A 3W5CA 2AC2A 3EGDB 3L7AA 4HGRA 1K0FA 5I8ZA 5BY2A 1RJ9B 1Z34A 1N5MA 1EFUA 2I2AA 2IXTA 2QPOA 3BIXA 3KSUA 4PLGA 3W7BA 3ZV5A 1SKMA 2OZVA 4UTRA 1Y8CA 4CLRB 1T43A 2FOIA 2RJNA 4XJVA 5EHQA 5DP1A 5KAPA 2XW6A 3WISA 2LCIA 1M74A 5K3FA 3NVDA 3LCUA 4N65A 4QDTA 3U7RA 5GONB 1FTNA 2NVUA 5EGSA 4DLKA 1HBJA 3F67A 3GZNB 3OLCX 4NS1A 5AUNB 5K1ZA 4B35A 4C04A 3A3NA 4LJ9A 2DR2A 3COPA 4AN4A 2C04A 3PSHA 1DL5A 2G5CA 5BQPA 1XTVA 2FK7A 5TQ0B 1L4YA 3IMGA 5E2IA 3PUIA 3HVKA 1ADYA 1QYRA 1RJFA 3A37A 1DRJA 4NE9A 5DMHA 1PI3A 2GXAA 2MSDB 3OTOB 1G6HA 1YZYA 1XXHA 4LXXA 3LY9A 4KSBA 2FPPA 3LRPA 4PLPA 3DBHB 1AN9A 2ECPA 1SXJE 5EWMA 4YRMA 5CLLA 3SEAA 5K0BA 3HA2A 1U2TA 2YZ7A 3IERA 4PXAA 4AECA 1TTQB 4ETMA 1SOVA 1JE0A 2VWPA 5K3AA 4W5QA 1G9SA 2Q5LA 2VF7A 5IANA 1CLEA 1EFVB 4TLLB 1CWUA 3NANA 3ZXSA 2PO7A 4LSWA 4BWYA 4CLEA 1YJAA 2WWRA 1JDTA 1VCNA 3FRHA 3N3AC 1NW8A 4MHSA 4R7ZA 3N75A 4X3CA 3O8OB 3JAKA 4MVJA 1YDGA 2F3SA 2IZ6A 3OM8A 5JAUA 3V1MA 3V2HA 4X7RA 4IZIA 4G1BA 1CUSA 3SYKA 3IAM1 3B6EA 5DT9A 3IJRA 3AFHA 3KL4A 4YAUA 4TV8B 1J2TA 3I2IA 4BGDA 3CH6A 3OLYA 5KTTA 1SCDA 3ODPA 4KEAA 1XU7A 1KVUA 3MJHA 3FJOA 1H4VB 4RV9A 4Q12A 3O4RA 1RCUA 1W4AA 3JYQA 4JI7B 1PWHA 1P73A 1BMDA 1XZNA 2ODAA 4YRTA 3CRNA 3NGMA 5JPDA 1TUBA 4YDQA 2DE0X 3P26A 1U94A 1X87A 5C8YF 2HO5A 1BS1A 1V5FA 4Y1RA 1AZLA 4BKMA 5TR9A 2XRZA 3ZLTA 4MI1A 1L1QA 1FYVA 4Y9TA 2Q6LA 1EK0A 3S55A 1E9BA 3ROXA 3TQQA 5JEEA 4GSKA 2OZKA 2W6IA 3KTFA 4ZYTA 1UWKA 1T2NA 4OUDB 1CE8A 4BPRA 5J4LA 2XHZA 3U40A 1CP3A 3EW7A 1DQNA 2PRSA 2JFBA 2PLRA 1W94A 3D3WA 4YNBA 2YQ4A 2O2IA 4HBZA 2Z09A 3SIPA 2H0AA 3JQFA 1NW9B 4NU0A 5KIAA 3SZOA 3TGPA 4WZAE 3KYCA 1WVGA 5H70A 4B73A 2IP4A 2PANA 4AFNA 5JO9A 3O8NA 4FB5A 5D3MA 2Z57A 1PGQA 1QV7A 3BMNB 3CZ4A 4JUBA 2ZT6A 1NZFA 4XVCA 4CQMB 4HL6A 3Q40A 2EIHA 1GRNA 3U3ZA 5FEUA 2VRCA 2BKUA 4IVQA 3UJBA 3S2SA 5TNXA 4A8TA 5A1JA 1W4BA 4KUGA 3H5IA 1J23A 5C3UA 1TAQA 2EKZA 3FMPB 5KNDH 4KN8A 3NHBA 1Q77A 1PS9A 1YMUA 2XKJE 3IAEA 5C1DA 3OTIA 1XD2B 2IV3A 4F97A 3WGTA 2X9GA 3FAZA 2V98A 3AM4A 1N5KA 4NMXB 1YHNA 1BHQ1 1WNTA 3SBEA 3MQ2A 2DBRA 3FB1A 1E1RA 4Q3OA 2Q62A 5EZYA 4YGXB 2ZJ8A 4PNEA 3DYIA 1OHHA 2WPNA 1AN0A 1KI3A 1QSGA 2HNKA 3T7TA 3U44B 1FJXA 4ND5A 4YMHA 2I4IA 1QZZA 1QTRA 4YDSA 5KYXA 4HDAA 2FSIA 4QODA 1EJBA 1LPBB 2GM5A 1YQDA 2XD4A 4LSZA 4EENA 3EH2A 4F04A 2RHOA 3QY9A 5KCMA 5G40A 3U26A 3DULA 4BJ1A 1L7QA 3KZMA 3LPCA 4ZQCB 2AJDA 5GIPE 4WY5A 1B00A 4H7PA 3W2IA 1MC4A 1SELA 4YJGB 4DCUA 3W78A 3H0CA 4FFNA 4BNWA 3EARA 5DNEA 1AY0A 4QOSA 1P2DA 4MV9A 3IOMA 1U4OA 2Y6UA 1M34E 3DOFA 4OHUA 1MXFA 2JEYA 3KVRA 3L01A 3UAVA 3WGQA 4JBXA 6NULA 1HT2E 1SPXA 1YCHA 4UC0A 1N2SA 5EUQB 2O06A 1M8GA 3SJ7A 4HC4A 3RTAA 2QD4A 4DKJA 3L41A 1VLVA 3HCCA 1ZL2A 1R6BX 3EMDA 1DWOA 5JXIA 2FI1A 2QI9C 2WSBA 3ILVA 1M10A 3DMPA 3ICOA 4BLRA 4HNAA 2CMDA 1Q91A 2JA2A 2GD1O 3PGMA 4HFMA 3DAHA 1ZD3A 4JA0A 4PCUA 4RD1A 3D8BA 4ZRDA 3VKUA 2H06A 2QTHA 3SD7A 2VT3A 1FMJA 1XCOA 1SMKA 2PQ6A 4ML3A 3O9MA 1QWOA 2QPLA 1ZMTA 3HP4A 2WZCA 1I13A 1GPMA 4N8SA 1MRZA 2CDCA 1SPBS 4GECA 2ZIUB 4HAWA 5BSTA 3H2BA 1DUVG 4YECA 3ZU6A 2W11A 4QULA 2ATXA 3OZCA 3FRIA 3AIKA 1H6BA 2BKXA 3I53A 1X38A 2BGLA 2IDJA 2ORYA 4MX8A 2G25A 5F5XA 3U3JA 3GVHA 2WQ7A 2VYVA 3ZY3A 2HA4A 3O8RA 1R16A 3AIMA 1LWNA 4IFIA 1ZIXA 1ZCAA 2GR9A 1FP1D 3GJ0A 5CAEB 1JYFA 1TEZA 3QOFA 4LRXA 3HKCB 1ULUA 1WVMA 3EVZA 5CEFA 4QYTA 4R31A 3DBHA 4UFPA 3OWHA 1CULC 2ZR8A 1PU2A 3FVWA 4C2TA 4R71A 2A0UA 1VIVA 3L07A 3O3CA 4MMYB 5KVVA 3OLZA 3OD5A 3OQMA 3EYWA 4JNCA 1CNFA 3VKGA 4MK4A 4ALNA 1ADBA 2M32A 1J25A 3BFJA 1BDHA 4BXOA 3O2QB 3RK4A 1KAEA 2Z04A 4P3NA 3OUZA 1IN8A 1N9ZA 3MJRA 2QDKA 1Z74A 3UV6A 5KQPA 4RVOA 1R66A 2XT6A 4JR2A 4I36A 4MPPA 1A9ZA 2AL7A 3KJFA 4PAQA 5HCNA 5THKA 2B2NA 5DYIA 1H2YA 1WIWA 4CM9A 2NU9B 4FSXA 4OQFA 3UJ7A 2Z08A 5BURA 1SA0A 2QTLA 3FY4A 2NZ8A 4MUFA 5JBQA 1BRTA 4DLLA 2NZWA 3BKXA 2ERXA 3IIKA 4H1WA 1FSZA 2PO5A 2X0EA 3EOZA 2H11A 2XWJI 2B99A 1E3DA 1YA8A 3VZBA 3R7NA 5A7FA 1IHPA 2A0YA 5LXTF 2ZYSA 2FWJA 4UJ3A 5LU9A 1PDWA 3MINA 5L3VA 3HM2A 3MMPA 4P58A 1X0VA 3AW8A 4PINA 4DIBA 2OFOA 3TLYA 2XUIA 2XIJA 3R7BA 3S68A 4YACA 3O82A 3UAGA 4BRWA 1GAJA 3ENVA 1VFPA 4DEVA 2CDAA 4OFZA 1MAWA 4ND1A 3TRHA 5AHOA 4EDFA 4YXWD 1GPAA 3DT9A 4DZTA 5DNYB 4CT4B 4EB6A 2ERCA 2TMYA 5K3BA 3ZGOA 1PL8A 4GOLD 2C98A 2HH9A 4Q9AA 1L9KA 4BKPA 4FYKA 4M6WB 4ZI7A 2UZ1A 1KNQA 1WCIA 3RE1A 1NVBA 3WLMA 1A96A 2VQ3A 2YXEA 3X1DA 3IHKA 2EQBA 2JDIA 3LQKA 3HDHA 1GZVA 2PH3A 1KWKA 5G0VA 1Z6AA 4P4LA 1PD0A 3LHDA 2YWEA 3JWJA 4R6WA 1PK9A 1TVKB 4GD3Q 4WBNB 3I9FA 5FXMA 1NLYA 2DQZA 1UEIA 3P4YA 1GNSA 1AKVA 2ZTMA 1XVUA 4PCLA 4XQGA 1R0WA 1XEWX 1Z0SA 3VMFA 1IY2A 1NW6A 3BZBA 1RMYA 2Z4RA 4D02A 5LQMA 3NDIA 3ER8A 1ZHHA 1ZM7A 4BC1A 1FW8A 1KI7A 3RWOA 2DY1A 2MR5A 3C48A 4ZT2A 4K88A 1ZM2A 4BNIA 1QHNA 3CXUA 4GXQA 1JRLA 3PXEA 1PL7A 5EIEA 3PHIA 4U3JA 2GA9A 3O1HB 1WXDA 1CETA 2YMMA 1KH1A 3OOJA 1ZSYA 4BLSA 5C7LO 5KPJA 1CG6A 2EZ9A 4JLWA 1YRWA 2I4TA 4HQRA 1PN3A 1RI2A 4NBUA 5T41A 2A88A 3GV0A 1T0BA 3ROQA 5IAOA 4M99A 4QXQA 3U0VA 1WW8A 4UFNA 5ARDA 3WK8A 3K0EA 1BIFA 2PM8A 4IO0A 1VYHA 3MELA 5FWDA 2P7HA 2PX4A 2VA9A 3RDPA 1KERA 1NBMA 2ODTX 4B4WA 4F5YA 4TVBA 4MUBA 3RVJA 4QKQA 3DHWC 3C4VA 5BWNA 4OHYA 3KVNA 4JVSB 4HXYA 1CFJA 3HCBA 1GZSA 4B3GA 1FU4A 1MTOA 1R0LA 9MHTA 2A1TS 4KSCA 3CB4A 2CNOA 2R4QA 2ZJZA 2ZJ6A 3AY0A 3E2IA 3GQBA 3I6BA 1HPLA 1OWOA 2NT3A 2ZIZA 4M89A 2JJMA 3FIUA 4FGWA 4GX5A 1NPTO 2WMYA 3LC0A 4KAXA 4Y7CA 2HC9A 2EGHA 1ISGA 2QG9A 3AESA 2DUUA 4OPMA 3S2ZA 4RHCA 4WN9B 2ZE6A 3EVEA 3FKSA 2WOJA 2ZYGA 3B36A 1ZUNA 3QHAA 4BQRA 1T8TA 2P9CA 4OHBA 3T54A 3DAGA 3QJGA 1C0PA 1T4CA 3KXDA 3R5FA 5AWFC 5L45A 2BJHA 2XXBA 4GX1A 2GHQA 1RQ2A 3HACA 3ESBA 1NW4A 1TKCA 4LJ7A 2V7QD 3PGJA 1WW2A 5AW7A 4JJ8A 4YCCA 3VJKA 5L7YA 2QSJA 2NLOA 1E2PA 1C9JA 3IODA 4TTPA 3CT6A 3OOWA 1EVQA 2OXCA 1J0XO 4X64B 1CUYA 2VDWB 3TW6A 4F7DA 4LG1A 4G67A 2J0UB 4LC0A 4N3BA 4U2DA 4H18A 4D74A 3FG9A 2R87A 4QBIA 4XKJA 2O2ZA 3CXRA 1J8FA 4FCWA 2I66A 4IHAA 4Q82A 2ZREA 4Y6PA 2PSDA 4H4DA 3DBLA 5HF6A 4CL2A 1GPWB 3T7IA 1EBUA 4M0PA 4MW7A 4ASUA 4URUR 3DDCA 3IP7A 3RS5A 1Q6YA 4AMGA 3IUNA 2LIVA 4KPYA 1JSXA 4FDTA 3A6PC 1DKPA 1XRJA 2ISSD 3RTDA 5CNJA 3D8SA 4WA8A 1XXHB 1GG8A 2VQSA 5ALKA 4BQEA 3NG1A 4I99A 4DLXA 2WKQA 3PUYA 1UPTA 1V5GA 4B3IA 4EA6A 5LQJA 1P2BA 4P3XA 4EQ6A 3SGLA 3PLAE 2Z83A 5KB3A 2YL2A 1Z6YA 2I7TA 3VR2D 3FCOA 4LJ4A 4LS3A 4OOEA 1XNJA 5DHQA 1APBA 3GW8A 2DR0A 3EF0A 5IP5A 1OV4A 2ZRNA 1VL0A 1GG9A 3DXZA 2O4UX 3W8FA 1CW2B 4Q47A 2UAGA 2IX3A 4X95A 3V8QA 3H04A 5DWVA 3AU8A 4DR1B 2XTZA 2AR9A 2D2VA 2ZBRA 3ZW8A 5BMVA 1YL7A 4P81A 3PFKA 2YJGA 3KU1A 2QLLA 5A9RA 2QRVB 4YMLA 1T5DX 3N2GA 4LXGA 1W0CA 4I6GA 2JI7A 3H1EA 4XD7A 5PNTA 1GZ7A 3SLGA 2RG1A 2PRJA 4NESA 1YZFA 4RJJA 1CR2A 1EG7A 3BXHA 3NP7A 1KC1A 4PEVA 3SQLA 4Z4IA 4JYZA 4JYAB 1Y9DA 3LLSA 2X40A 3KT6A 1WUJS 3HP1A 2E7ZA 3SR0A 4ZHQB 1ZK1A 5AT1A 1DC6A 4ZCLA 4XSHA 4YFVA 2AT1A 2C1XA 5TE9A 4ES6A 1W30A 3QENA 1F2TB 3PUVA 4WK4B 3TQSA 2QMOA 2YXBA 2AOTB 1BX1A 2BOVA 1MUUA 5DCYA 1KJQA 2OQ2A 1F4LA 1PEKE 1NU8A 2O07A 3Q0EA 4NSNA 1JKFA 1JR4A 1Z8DA 4ZOLB 1U5CA 4A1FA 3U56A 2VJBA 2GM3A 3PCRB 2QD2A 4LZJA 1W48A 3RC7A 1WVIA 1ZLXA 2PD3A 3BK1A 1MP0A 1U9JA 3OJLA 4XA8A 1FVOA 3W06A 4U7GA 1QYVA 3N2YA 1PDOA 1P5HA 4YT2A 3VSDA 1P5ZB 3IFSA 3Q1KA 3GLFB 2I5PO 1VCIA 4UNQA 2CLDX 4WASA 3P32A 4GFDA 2YICA 3QU2A 1GQFA 1XMOB 3GRFA 1W93A 1ANKA 1FDUA 2SKCA 5I7EA 3PF9A 4MW6A 2ATVA 4O6VA 1BMQA 3D7RA 3ZW9A 3OU6A 1K4YA 3B1YA 3RV4A 4WCFA 1M33A 2EFYA 2GERA 3DOJA 4P5DA 5GIOE 4EJ2A 1O3YA 2I7VA 3IPYA 4RD0A 4IDNA 3WLSA 1QG4A 2LDXA 3LWZA 1IHUA 3P8ZA 4P84A 4B2YA 2HSJA 3IEUA 4FHDA 4M88A 4CKEB 2F1KA 1R2QA 1P8JA 1UPBA 3TQTA 5I4BA 3Q7PA 4R83A 1RQRA 2I8LA 3D2BA 2YC4C 3CONA 1DIOB 2VJMB 3K0CA 5BNIA 5HDBB 3IILA 1HQDA 1U8CB 1FDTA 1UBOS 1GKLA 1UMCA 2PYDA 3ABRB 3ASYA 4WKPA 1ZC3A 3VV2A 5AW3A 3USZA 3F6YA 5SY4A 1C30B 4DV1B 1QR2A 3FLEA 4L8VA 3VTKA 3RUDA 1T8PA 5AK3A 2VXYA 1YVRA 2W9XA 3IHLA 4ZIRA 4HNVA 5AVJA 1N5JA 1R0ZA 5CTJA 2A67A 3U3KA 2O7NA 4XR4A 4W5RA 1JDBC 1EM8A 2IHYA 4TS3A 2Z0MA 3Q7IA 4EJ0A 1CU1A 4G8DA 1L6RA 3B8HA 3TL6A 1EXDA 5ALEA 1OASA 1RWQA 2RIPA 4S1NA 1ARZA 2P1DA 3RRMA 4UUNA 3WAKA 1FRNA 2AOXA 4NK4A 2NUAA 3A9SA 3IOBA 4XUDA 2E4VA 5A4IS 1YBAA 1BXKA 1KYQA 5CYPA 1OWPA 2H18A 1P7VA 2ON6A 3BQMB 3HHPA 2AFIB 3VPHA 1B2LA 3A58B 1GU0A 1HDRA 4XD2A 1C8KA 1JKIA 2H1OA 4E31A 1T25A 1GL6A 3A36A 4EA9A 3M9XA 1XPUA 4JP3A 4GVPA 2ROQA 2VLIA 3DNFA 2VAVA 2Y05A 3VSEA 2C3UA 1SQ5A 5AJUA 4L9SA 2R1VB 5KNLA 1SRRA 1H0HA 2EX0A 2JFHA 3AEKB 4HUJA 4KDCA 5FJIA 5BYBA 1IXKA 4BB9A 1HV8A 3DE4X 4WW0A 2ORIA 3HCRA 2QBYB 3A05A 3UA4A 2B6HA 2FW9A 2C5BA 1ML3A 1COWD 2CYAA 4MVJG 4MYHA 4WY2A 2MHCA 1I2CA 2PKEA 4FMDF 2XF8A 2PVPA 4NAUA 3JRNA 5LKRA 2DCUA 2VWGA 5FWYA 1YFLA 3EQ8A 3ZE9A 2B8WA 3KJXA 1WD5A 1FB5A 4LUCA 4GPD1 1UDBA 4TT3D 2Y0CA 3GROA 3E27A 3EDOA 5D85A 1NE7A 2AWNA 2A1UA 3PIRA 4ESEA 3FXAA 1NDHA 2ASVA 1RIIA 3DE3X 3FPLA 4I8DA 1SQFA 4WGFA 4C4YA 4EYSA 1KEEB 1WV0A 4E3WA 4K5QA 1OHHD 5LMCA 4GPTA 2GJSA 4BO8A 4HPXB 4UAUA 1MC1A 2NNLD 3AYXB 3DKIA 1Q0RA 3ORRA 2VA8A 2H52A 4EOGA 3WGVA 2PPVA 1N6OA 3U4AA 5JMOA 2QQ5A 5KTRA 1H3EA 1TAGA 5L4SA 1M8FA 2C88A 3QTTA 4EUNA 2VI5A 1ZVMA 5AI4A 2OBBA 2QR5A 2FWPA 1PBNA 1WLYA 3KQWA 3O8OA 4QG7A 2FEWB 5ALNA 4MLDA 3T0IA 1G6OA 4NLLA 3CLUD 4WMLA 1U5BA 1H8ED 5JNSA 3W04A 1W5EA 1L7VC 4C4RA 2R8PA 4Q4LA 3R77A 1DINA 3ORQA 4MPTA 1HE4A 2YH2A 4IF4A 4TXHA 1WSWA 1OY1A 3JW8A 1K63A 1Z0AA 1NVVQ 4HN2A 3A1UA 1DHTA 3I1IA 1ACMA 3L7KA 4GYYA 1JDZA 1M1UA 2BFEA 4NPHA 5DFAA 3QA9A 3A6ZA 4KFRA 2Q3BA 2W2KB 4F21A 2DFPA 3LG2A 4KP7A 2PJZA 4R01A 2Z2ZA 4UBLA 4MCJA 4LHWA 5DK4A 2IW3A 4C0BA 4Z4EA 4F2GA 1AA9A 1SIBE 4E03A 5ITWA 1XZPA 1FA9A 3QLTA 1J2UA 4UE3S 1PR2A 1KTVA 4IKEA 4FFMA 3VSAA 4BBPA 1TM7E 5FNVA 1LVGA 5KHOC 1H66A 2CJWB 1FDRA 1YVEI 3EVDA 2FW8A 3I72A 1GT6A 1R6XA 2GSDA 2WHPA 3OLWA 4N8DA 1JHDA 3I28A 4QTUB 1K3UB 1ABBA 2FZ4A 3QUCA 2WMNB 4H6PA 4UQLA 3QUBA 4B8YA 2CEAA 4C0WA 4LDJA 4DQVA 1JGTA 4RSRA 4JS0A 1FQOA 4QBTA 2PGOA 4DM4A 4HLUA 4ECEA 5E4YA 3E23A 4Y6GB 3W77A 1U2DA 2JIZA 2EP8A 1SBYA 4QJ4A 2P5TB 4QXRA 5KNCD 1QP7A 4G56A 4X0EA 2XMCA 1XCJA 3L0CA 3LDUA 4I9NA 4O4JF 1E69A 3B5JA 5H8WA 5H3CA 1IB0A 1YB1A 2LKDA 2OHJA 2W48A 3M9LA 3WGNA 3L7YA