1IUZA

Plastocyanin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
98
structure length
98
Chain Sequence
AQIVKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETVVRKLSTPGVYGVYCEPHAGAGMKMTITVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Novel insight into the copper-ligand geometry in the crystal structure of Ulva pertusa plastocyanin at 1.6-A resolution. Structural basis for regulation of the copper site by residue 88.
pubmed doi rcsb
molecule tags Electron transport
total genus 23
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1996-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1iuzA00
3NJMA 4HIPA 1SFHA 2HXAA 3WKQA 5D4IA 5I6OA 3AG4B 4GP5B 1IBZA 2EIMB 1OCOB 4RH4A 1W6WA 1SHXA 2EIJB 3FU7A 1MG2C 3NJJA 3TA4D 3PAUA 3X1NA 3S8GB 2E86A 3NJNA 2CUAA 3FS9A 2YAOA 4YSDA 3AW5A 2BP0A 1ZDSA 2PPCA 5D4HA 1GS7A 3ZDWA 3SQRA 2P80A 5FC9A 3ABMB 3OMIB 3CVCA 4E9XA 1ZDQA 1JVOA 2IWEA 1JXFA 2PPAA 1IKOP 2VM4A 2IH9A 2PP8A 3NP3A 4DP9X 2J5WA 1E5ZA 4WTQA 1AAJA 3UACA 1CUOA 1NICA 4YVUA 1L9RA 2HX9A 2J56A 3CVDA 1A4BA 2GC7C 3NJIA 1NDTA 2AANA 2MRYA 1JERA 1OCZB 2GIMA 3WKPA 4ZK8A 2CBPA 3T6VA 4DP5X 2IDTA 3FQ2A 4G70B 1ET8A 4YL4A 2YAEA 3SBPA 4BXVA 1KYAA 2JFCA 2JKWA 4BWWA 1L9TA 3ASNB 4BXSV 1PCSA 2BP8A 2Y69B 4GP8B 1ZV2A 2DV6A 3PCYA 3NSFA 3EH3B 1OE1A 3FQYA 3QPKA 4G71B 1A65A 4GYBA 2UXFA 4E9VA 3GXUB 1OCRB 2XXFA 1SJMA 2EILB 2HX7A 1PLCA 4GXFA 4K9JA 2YAQA 3ERXA 1E5YA 3IN2A 5EHFA 1JZHA 1PNDA 4W1TA 2FQFA 2HRHA 1HAWA 3PAVA 1SDDB 1TKWA 2IAAC 3ASOB 3N55A 5TK4A 4TXVB 1CYXA 2QDVA 1PF3A 3EH5B 4W9ZA 1PZAA 1CC3A 1SHWA 4DPBX 1PLAA 2VW6A 5I6PA 3QJRB 4N8UA 3U25A 2H3XC 3GYRA 1AANA 4E9SA 4BK5C 2OJ1A 3UAAA 4DPAX 1AZBA 1TU2A 4E9TA 1JVLA 4BDVA 3HB3B 5B3SB 1J5CA 1BAWA 3KW8A 3CZUB 2XWZA 2FWLB 4MFHA 4HHWA 3NSYA 4UF7C 1M57B 3OD3A 3OMAB 4E9WA 2DWTA 3FU9A 1NTDA 1X9UA 1EZLA 4AKQA 1VLXA 1NPNA 2BP8B 4NERA 3ZIYA 1X9RA 1N68A 3EHBB 5AZUA 2PP7A 2QPDB 1ZIBA 2R7EA 1R1CA 1SNRA 2VW7A 2XV2A 1RZPA 1FFTB 3CG8A 3T6XA 3OM3B 1E65A 2DYSB 2Q5BA 3TBCA 5I6KA 1NIEA 2BZCA 2IH8A 4A67A 1PZCA 3UAEA 4KO9A 1A4CA 4G7QB 5B1JA 2QDWA 1KBWA 5I6MA 3NJGA 3T6ZA 1PAZA 1ZPUA 2AFNA 2CALA 1AQ8A 3V9CA 2HRGA 2PP9A 5B1KA 1AZRA 1OF0A 4JKNA 4DP8X 3FPYA 1J5DA 1JZEA 4HAKA 3ZX1A 4GP4B 4DP7X 1AIZA 1UATA 4DPCX 3NSDA 4Q89A 2YQBA 2BW4A 4HZ1A 3NP4A 4YSRA 4G7RB 1BXVA 2FQEA 4YSQA 1GR7A 2J55A 1ID2A 1QNIA 1HFUA 2FJSA 2HX8A 3X2QB 3CDZA 4YSAA 3G5WA 1J9TA 3UGEA 1WA1X 2J57A 2X87A 1ZIAA 4QLWA 1OOWA 1GYCA 1OCCB 3PLYA 2HLEB 2N0MA 1RZQA 4E9YA 1JXGA 3T6WA 4FA7B 4AZUA 2PCFA 1BYOA 1KGYE 3ZBMA 3WI9A 2VM3A 2UX7A 2R7EB 2MTAA 2YARA 3AG2B 3X1BA 2FQGA 3V9EA 2ZXWB 3FSWA 3TBBA 2AZAA 1URIA 1JZIA 1I53A 1KCBA 2AVFA 1AR1B 4DP0X 5D4JA 5B1JC 4DP4X 4KOBA 5I5JA 3JTBA 3UADA 2Y1AA 1GS6X 4L0PB 4P5SA 1DZ0A 5B1BB 3X1GA 3DTUB 1KBVA 4KO6A 3IE9A 3WNJA 1OE2A 4HCFA 4CSZA 3NT0A 4PAZA 1F56A 4NAJA 3OMNB 3FU7B 2NRDA 1V10A 4A2GA 4JHVA 2PPFA 2W8CA 1JZGA 2PCYA 4KNUA 2GI0A 7PCYA 2BP0B 2EINB 1RCYA 3QJTB 1ETJA 2GB2A 1NIAA 3IN0A 1XB8A 2YAFA 1NZRA 4M3HA 2B08A 1AACA 3FSZA 4A68A 1KCWA 4YSPA 5I5MA 1AS7A 4G7SB 1OV8A 3EH4B 2IWKA 2GBAA 2FNWA 1XMEB 3FT0A 2YAMA 4AI7A 1V54B 4G72B 4NB7A 3TU6A 1GY1A 1WS8A 3BVDB 3QJUB 4KNTA 5I5IA 3AG1B 1J9SA 3AG3B 3CVBA 5B7EA 3SBQA 4AKPA 2PLTA 5B7FA 1AZUA 2W88A 1RKRA 4JHUA 1AZNA 3PPSA 4KO5A 1NWOA 1TEGA 1V55B 7PAZA 2X88A 1M56B 1JZFA 4F2EA 1KV7A 3NJFA 1MZZA 2VSKB 4DP1X 3C75A 1WA2X 3SBRA 1B3IA 2IDSA 4A2FA 3NYKA 3MX0B 2CJ3A 1J9RA 1ET7A 3H4HA 1AZCA 2XX0A 1A3ZA 3HEIB 1SF3A 1XB3A 1AOZA 1BYPA 1GSKA 2I85A 1JZJA 3QJQB 1CYWA 3T9WA 2H5UA 4AKOA 1NIFA 4HHGA 3N2JA 2RACA 3WG7B 1BQ5A 5I6LA 2I7OA 3FPXA 4F2FA 4YSSA 2BZ7A 2CCWA 1N70A 2FTAA 2GC4C 1AG6A 5F7AA 2BWIA 2FT8A 4YSUA 5B7MA 4YSEA 5E9NA 2B3IA 4EF3A 1GY2A 2IDQA 2WO3B 3T71A 5PCYA 5I28A 4ENZA 1L9SA 3QJSB 2ZWNA 1A4AA 3BQVA 4N4YB 4QKTA 2YXVA 5F7BA 1QLEB 4BDVB 1ASOA 1BQKA 2H47C 4PCYA 4A2DA 2PPDA 2ZONA 2YAPA 3ABKB 4YSOA 1PZBA 1HAUA 1M9WA 3DKHA 3NJLA 5ANHA 1MG3C 4YSCA 3IBOA 3JT2A 3S3BB 2WO2B 2XU9A 3DIVA 1CURA 1BQRA 2HZHA 1NWPA 1IBYA 2IDUA 1IC0A 3FQ1A 1GW0A 3PAZA 5PAZA 1EHKB 1PMYA 1KDIA 2TSAA 4YSTA 1PNCA 3FSAA 2YAHA 1GS8A 1W6LA 1SDDA 2VN3A 4HCGA 5LDUA 4A2HA 3X1EA 3FYEB 5B1AB 1SFDA 6PAZA 3WIAA 4F7KA 2IDFA 4A2EA 4WKXA 2PPEA 2XV0A 2XX1A 1E30A 3OQRA 3CDZB 3ABGA 1FA4A 2VSMB 1WAEA 1WA0X 1DYZA 2JXMA 4AX3A 3D12B 4BWUA 2UX6A 1JOIA 2TSBA 2IWFA 3PXLA 1JXDA 2XYBA 1T5KA 2EIKB 1NINA 4P5RA 2DYRB 1ASPA 1XB6A 1NIDA 1OE3A 2BWDA 1J9QA 1ET5A 3S8FB 2UXTA 3FU8A 4HALA 2AZUA 3L45A 8PAZA 4KO7A 1BEXA 1ILSA 6PCYA 4DP2X 3H4FA 2BHFA 1NIBA 4Q8BA 5I26A 1AG0A 2ZOOA 1PLBA 5AKRA 4YVNA 4BWTA 2FT7A 2XLLA 5I6NA 1A8ZA 3WNIA 1MZYA 3TASA 3EF4A 4UAHA 1L9OA 2OV0A 1FWXA 2OCCB 2Q9OA 2BW5A 1ILUA 2WSDA 3AZUA 3FSVA 2QT6A 4M4RB 1KDJA 1WS7A 3H56A 1AS6A 3S3CB 2GHZA 1SF5A 3MBWB 3NSCA 3X1FA 9PCYA 4CSPA 1IUZA 1L9QA 4X4KA 2DWSA 1PY0A 2UXGA 3GDCA 4E9QA 3UABA 5TK2A 2QPEB 1L9PA 3S3DB 1ASQA 3IEAA 1TEFA 1W8EA 3AY2A 2BO0A 4FAAB 2CAKA 2VW4A 4KNSA 4E9RA 2DY2A 3QQXA 4GY4A 1ADWA 2FT6A 1YLBB 3FYIB 3RYMA 4A66A 5IY5B 2A3TA 1BXUA 4KOCA 1NPJA 3NJKA 2I7SA 1E67A 2FQDA 1BXAA 1QHQA 2YXWA 3ABLB 2P80D 4DP6X 3NJHA 5A7EA 2XV3A 2LLNA 2UXVA 2VMJA 5AFAA 1AS8A 2XUWA 3KW7A 4HCIA 2GSMB 2XXGA 4UANA 1MDAA 3QJVB 2XVBA
chains in the Genus database with same CATH superfamily
3WKQA 3U1SH 3MJ9L 5EEUA 3AB0C 1QSVA 1PVHA 4K8RH 1AGEB 5I74B 4LVNB 1Z5LA 4N8CL 1E4HA 5CEXA 2V37A 3HI6H 3LZRA 3WN5C 3ZL2A 3RUGB 3UDWA 3IF1A 2NY6B 2XDHA 3X1NA 2RGSA 2YAOA 4XVJH 3NESA 4YDIH 2O72A 1U3YA 4NJ9L 4K23L 5TD4A 1WFUA 3H55A 4IHOB 4JFQB 1JVOA 3P0VL 3EGSA 3U6RA 5IHZB 2EQDA 3BH8A 4X6FA 3TGXA 4BZ2A 2PP8A 2D2OA 4WTQA 3DV6B 3UACA 4PTTA 2KH2B 5FUCC 4WCYL 4R0LB 1YMMD 1L9RA 4QGYA 5I8OH 3IGLA 2W65B 4Z7OB 5M7QA 2P44B 4XBPB 2MWCA 3RL1A 3EUDA 4KI5C 1TZGL 5C0IA 3HR5A 3QUYA 4G70B 4NUMA 5C8JB 4LCYA 1MCBA 1LO2H 4PJEE 5FGCB 4U7MA 2EEXA 1A3LL 1P4BL 1RIUL 2UWEA 1SJVA 1MFCH 2YGVA 1RP8A 3QIUB 4DERA 4GI6A 1SJXA 4ZUUB 5AQ0A 2Y7OA 3RIFF 3JWOL 4N28A 1UEYA 3IBEA 3FHAA 5IVXA 5I15L 3L2MA 1F90L 5D1ZC 2Y36H 1C1EL 1JK9A 3DYMA 4XVSL 3HUJA 3T8XA 5ICYA 3EXLA 5KYWB 2UXFA 4OIBA 3DSFL 1TJGH 5A16A 5MENA 4MMXC 5CCHE 2G5BA 4AMKL 1KPVB 2IVFC 3L5JA 3S8WA 1JUFA 1HSAA 2IG2H 5JHAA 1QPPA 2QZ5A 5I1HL 2YXFA 5E8EB 1P1ZB 4PJ5D 1CK0H 2KS0A 2XZAH 3L5HA 2UV3A 1DLFL 1T66C 3DX2A 4OZGE 4ZBJA 4RAHA 1CYXA 2Q76B 2ARJA 1I9RH 2V5TA 4O5LL 2F7RA 1T7VA 1Q9KB 2VZTA 2EH8L 1UM6L 3CTTA 2Y4SA 1Y18B 4GRWH 1IM9D 3CVHA 4L9LB 2VXSL 1AKJA 2YA1A 1AANA 5FHAH 1BIHA 3BJ91 4QRPD 2CKBH 3P9MA 2J8UB 5T3XH 3V4PL 1GH7A 1FGVH 3IFPA 4JRXB 4AGQA 5E5MA 2F7QA 5KW9H 3LV3B 3OKLA 1EHAA 1D5MB 3OHXC 3QEQB 5T1LB 5DFAA 2WY3B 1ROWA 4HUWB 3JV6B 1NPNA 2WD0A 1T5XA 3EO9L 1I1AC 1H6EA 1KJ2B 2QPDB 4CSSA 2R69A 4Y5YC 2R2BB 1CLZH 4K9EH 4F2ME 3GSUA 4NP4L 3JYBA 2OSLB 2MQ0A 2D31A 3FSOA 3NEOA 3MGTB 2VDRH 2Q5BA 2EXSA 3UZEA 1GJIA 2CSPA 1NMCB 3O3DA 5D96C 5B1JA 3RA7L 1JYVA 4X6CE 4H0IA 1WFMA 4G6JH 3G5ZB 4L1LA 3VGAC 5E0FA 4GUOA 1DLHA 1PTZA 1ZPUA 2AFNA 2FD6L 1OW0A 2HRGA 1RUAL 2ZUUA 4KDVA 2YUXA 1DFBH 4IRJA 3DWTA 3FRUA 1WPCA 1D7DA 4JPIB 1DSFH 2NXZC 3NSDA 4PU2A 2VERA 1JFQH 1RY7B 4U6XA 4ELKB 4PRPE 3ULUH 4TQIA 3N44B 2DTML 3ZMNA 3UTTE 5B3JF 2X2UA 3OZ9L 2CIKA 4UTBL 2HX8A 4LIQH 2BVPB 1J9TA 2NR6C 4MMXA 1EK3A 4B3VA 3HC3H 4A7TA 5SV3A 4QLWA 3T0EE 3GBNL 2YSSB 4UOQA 2N0MA 5D7JA 3T0BA 4E9YA 5JHMA 4YXKH 3U6XS 1T21A 2XY1A 3LZFL 1VCBC 1CFNA 4HIEB 4FXKA 1EZSA 1NM4A 1E4XL 1KB9K 1OP5H 2NUTB 3O8XB 3IK2A 2YK1H 1NEZG 5GGSB 3GJFH 1MN4A 1TFPA 3TYGL 1NUGA 2ROYA 1EZVX 1F4HA 3PJNA 5B3NA 4OGQC 3IDYB 4U31A 5DVOA 2Z7YA 1X5YA 3I2CL 1OSZB 3PWNB 3GS0A 1KCRL 4BK8A 4LEXH 5TJWK 1LWHA 2D9CA 5D4JA 5ERWA 3LOWA 4WFEE 4GBXA 5GS1B 3B2UC 2NQ3A 3RVXD 3BUYB 1GCYA 3NA9H 2UUDH 2ZF9A 3WJJC 3LKQA 4FFYL 4HPYL 2CMRH 4KO6A 4HJIA 3HIZA 3D3VB 2R2CA 3K80A 5D5MA 5G4MA 1WF5A 5DC0A 2GBVA 3LEXB 3CHOA 3ME0A 5I1EH 5IP4A 5LLIC 2H2PD 3QH3B 4P3CL 5HYFA 3MNZA 5I8KL 2DB8A 5C0BD 1P1VA 1PZSA 1TT6A 4LSSL 1A7RL 2DQUH 2I32A 1EH9A 4P5MB 4P04A 1ETA1 1LL1A 3D2UD 4P4RA 4NC2B 2BZDA 4GW5A 1S5HA 1WIPA 4ZD3L 4A39A 3SE9H 2Z91B 1F4WH 1JI1A 1CR9H 1NGZA 4I3GA 4QCIB 1ZTXH 4GQ9L 3I02B 2AQ2A 4NDMB 1FVDA 4Y0GA 1VADB 4BFJA 2AKRA 1OALA 3HMWH 5INDA 2EE9A 4R7NB 1JXKA 5LCVL 4FD0A 2AQPA 1FV1B 2ADJA 4JJHA 5EN3A 3DUSA 4FA8A 1UWFA 3QXWA 4YDLC 4KJQD 3L3OB 4AKPA 3FULA 4V2BA 1A4JA 4X7TB 5L2JB 3EFFB 1O7DC 4W70A 3FQXA 1T89C 4H1LB 1KXVC 3MRCA 3LTVA 4M9PA 1OK8A 3RWJA 3QIWA 5JHLA 4FQ2H 3MKGA 3C5ZC 4M7LT 5IMKA 4IBWA 4N0RA 3BGFC 3IU3B 1NDMA 2UZIH 3NJFA 1WCBA 5IQ9A 4OBRA 1BGXH 4NZRL 1S7VA 4XMWA 3R7QA 2YD9A 3V6BR 4PJFE 5GSRB 2PCPB 5DMGD 2AMUA 4YO0A 3BP7A 3TVMD 1BM3H 1BQLL 5GRUL 1QMUA 4G6FD 4XPHL 3KM1A 1J0IA 5HJBA 2WTPA 1MI5A 4ILDA 4ZPTA 5LBSA 3CC5A 1TZHA 4X8CA 4DW2L 5HHOB 3QXDA 5GRVK 4AYEC 5JIDA 3QUZC 4KX7A 3GKWL 4U6TA 1PSKH 3SE6A 4DWHA 3PUUA 3RWHA 4C56A 4HWUA 5ACZA 4I77H 4LVEA 3SPHA 3WJJA 3J27A 1XAUA 3A21A 1WBZB 3DMMD 4W9KC 2IAMB 1T0NA 1W91A 3QYCA 4NQSB 1F3JB 4QHUA 4JFTA 5GZNA 5HDBB 2VMFA 2P24A 3V4VA 2XTSA 3KJ6L 3NSXA 4RQQA 4AIZA 1EFXB 1WC7A 5AD0B 2OJEB 2YFOA 5CHNA 2X4TA 5PCYA 5TDPB 1N2RB 5IHUH 3MFFA 1ITBB 2VXTH 3CFQA 1WGVA 4ZUVB 1KPRA 3UCQA 4ZMVA 1BFVL 3TT1H 4YXHH 1F4YH 2XQYG 3DHUA 3VW3H 4P57A 2JKIS 1PZBA 2Q6WB 4MNHB 3EUUA 4MJJA 4XMTA 3BVUA 3DX7A 4AIXA 3IJHB 3CDCA 1KIRB 4I1NB 4U1KB 3TEWA 3S3JA 5FLVA 4HH8A 3WJMA 2R0ZH 5D7IE 4ODWA 3F6IA 1OPGH 2ZG3A 5JW5A 4G7VH 1GC1H 1E9PB 3UC0H 3WHXA 1BIIA 4LGSB 1GAFH 1A6TB 1OARL 1UOLA 4OJFH 1KDIA 5EZLB 2QV2A 3V0DA 3X3GH 2X28A 2XCMC 3LH9A 1MCSA 4M8QB 1E7UA 1NFDF 1I7ZA 1KXQE 2P7TA 1I8AA 4C83B 3MRHB 3F5WB 1Z0MA 3EH2A 3MLXH 3PJLA 4L1TA 2EC8A 2WWNA 1F4XL 5DGQA 3V6FB 4IBSA 3ZDXF 3QO0A 5AB1A 3L16A 5IR1A 2HKFL 2QV4A 2QPFA 2PPEA 2GAZB 4KROD 1GSMA 2D4DA 3TO4D 5SWSA 3HZ3A 1VKXA 5GGTH 3ABGA 3A4FA 1MLBA 3IMRA 1FNEA 5FFGA 1CD1B 1IAOA 3AAZB 3SE4C 5KVGE 5DRZA 3P4MB 3QCTH 1SEQL 3QUMH 4BFNA 3BSHA 3BP4A 1ASPA 1NOLA 3HLKA 4N20A 5C0GB 3UBXA 2ENPA 2R59A 2BWDA 3HS0A 3BKCH 3HZVA 1J18A 3VI4F 4ADIA 5HHXH 5AW3B 5ISZD 2UWEE 4EZJA 4ZFQA 5IK3B 3KPOB 2NX5B 4F7MA 4M1GH 1BZQK 3IJ8A 4QMEA 1F45A 1AXSB 1R3LA 2X1XR 3SE8H 4FL4C 4HFWB 4D2NA 2V0AA 5IVXE 1BX2A 2X2IA 2AEWA 4WU5B 4MNGB 4PBWD 3G08B 3N50A 1NIBA 5ETUB 5ESVA 2ISDA 3HUJE 2WYZA 2ZKHH 3MV7A 4UAHA 5EZPA 1LO4H 3VFRA 5MENE 1H8LA 1AQDA 1G9HA 5HHPB 1QR1A 3RWDA 2NSMA 2R1YA 2WLJA 3V5DB 2E74C 4APQD 5T1DL 5EUKA 1BOYA 3H56A 1P69B 4KI5D 4NYLB 3SOBL 3O45A 4A7SA 2Y06L 4KV5E 4M43H 4BFEA 1NC2A 1QUNA 4V1DA 3X1FA 4RGOL 4YDMA 3V0VB 1KACB 5E94A 3KXFD 1FF5A 5A2JH 3CE1A 1CXEA 4ZUWB 3WFCL 4E9LA 4XOCA 5CKAA 1D5ZA 4HCRH 1S7TA 1HNGA 2PABA 3HOGA 3LQAC 3VMPA 2OP4L 1EAJA 4RGNB 1S9YB 1IGFH 2H0FA 3N0PB 5D1ZD 5C0RH 5BZDB 3DRQA 4OQTH 1BD2A 1HKFA 5CP7B 3JWNH 3CXDH 2YPLA 3EHBC 3SJVA 5EU6B 1FH5L 1EGJL 4KZCA 1LD9B 3BKJL 4WW2C 1X7TA 32C2A 4D0DB 1EEQA 5KZCD 1IE5A 3DPBA 1CLYL 2WNXA 4OQ1A 4O58L 1S7XB 2J8HA 4DP6X 5GS0D 1GIGH 3MA9L 5F21B 4MCMA 2GJ6B 1NCDL 2XZQH 3NZ8A 2VMJA 3MJWA 1T66D 3FT2B 3MV9B 3O0RH 1YYMH 5T5NG 5JXAH 2BFVL 4NQQA 1MFMA 1RIVL 5CNHA 3DBXA 3ZDZB 5GXBB 4Q9RH 4MCYA 2FLBT 1DR9A 1T1YB 5JHBA 1L9MA 4HK3N 4M7LL 3S96B 5J11B 3NN8A 1W8OA 3BIKB 4KQ4H 2JJUA 4PJAB 4ZDHA 2A38A 2CNZA 1ZTMA 3IAQA 3ZL1A 2EIJB 5AWNH 3UAJA 5C0CD 4R96B 5DJ6A 1LXMA 4HUVB 4XX1G 2EDBA 3TA4D 2X41A 5EOCL 2CUAA 3WUWB 1S8DB 5DD5L 5BV7L 2R83A 3ULVH 1DVSA 1Z9MA 1I1AD 2WGNB 1F02I 1BQSA 1BBJA 1HX0A 3OMIB 5GJSL 5L4IA 2IALB 5E95B 2H7WA 1MNUH 2B0SH 4H5SB 5E1AA 2QQLL 3E3QE 4BZ2L 2AAVA 2CUMA 4KGLA 1IKOP 4JQIH 4TL5A 2DQCL 1F5WA 3G6AA 4PS4H 3UTOA 4NN5B 1XH0A 1WEJH 1OLZA 3V0AC 1K9TA 2F0CA 2VUOA 2CK2A 3KLKA 4R5TA 43CAA 5LXGH 4G82A 4ZUTA 3BD5A 4ZW8A 1E6JL 2ZOUA 4XPBL 5KVGL 1Y6KR 3OQ3B 2IPUK 2GIMA 4NQUA 5IIEB 4ZK8A 4R8WH 2EEBA 2VN4A 2K8MA 4JFOB 2Q3XA 1NBVL 1UA6H 1E28B 2HVJA 2JSFA 2NXZD 3N9GH 4X7SH 3GM0A 3M1BB 2K6ZA 3HBGA 2D3LA 3O2VH 4TUOA 1BMZA 2C7FA 1XAKA 4OCRH 1DSWA 2KDYA 2NR6D 5CUSL 3MLZH 3CN0A 4XP1L 4F27A 4PGJA 4XE5B 4HYTB 4P9ML 2QKIB 5D5ME 4W9FC 3B37A 1VIWA 2D7TL 4G42A 5EORH 4LAQH 5F9OH 5EF1A 2OX5A 4YK4B 5IFHL 1BQHB 4GT7A 5I1GL 2C9XA 4DGVL 1WWAX 5KANG 5MEPB 2DEWX 3KJ4B 4HSQA 1AE6H 3MNVB 3L3IA 4U1MB 1HAWA 3UYPB 4BSJA 4V2CB 4Z95L 3KS0H 4FDWA 3GMQB 4Q97A 2J1ZA 2VISB 3S88L 3UGUA 3N04A 4AG4H 4Z5RB 4QY8B 4ZI8A 5I1KH 2VW6A 4MZ3A 4QRRA 4Z7AA 3JTSA 3ESPA 1IFHL 3PL6C 1NQBA 4HLZH 4HBCL 3B2UD 3IGKA 4BK5C 1NCGA 4WAFA 3MRLA 3TPUB 3FQRA 4BBWA 3GDBA 4YHLL 1ZLSL 4S0TD 4BDVA 1F58L 4FCAA 4DVRL 5J6SA 1FVEA 1XIWA 2XG5A 4OM1L 1ZS8A 3EYOA 4E9WA 2DWTA 1I8LC 3VE0B 1JRHH 3EDEA 1VLXA 4WDIB 2DQTL 2FHBA 3GRGA 2CUHA 3DTXB 4L9DA 4X6DB 1ZIBA 1DEDA 2WJ7A 2AC0A 1NGWB 3QB7C 4F7TB 2QHRH 4ENEC 1KWGA 1NLDL 1YMMB 2VDMH 1GJWA 1FPTH 2ZF8A 2F18A 4DCQB 4G7QB 1S7WB 1GGTA 3RU8L 1Q94A 2VL5A 2ZZUT 2VWEE 5HYEA 1JS4A 4OJDH 4GKSA 1OY3B 1BLNA 1SXAA 1DCEA 3O4LD 4R84A 4XMLH 1OT2A 5C0DB 3EG9A 4ZW7A 1JZEA 4PIBA 1M7XA 4C56E 1WHPA 4QHMA 5L8LB 3H9SD 1AXIB 4I1RA 4AY0A 2FR4A 2NY3C 3WIIH 5LG6A 3C5ZD 3UGEA 3QEHA 1QSEA 2BJMH 3B2PA 4I13B 4XMKL 2X87A 5BRPA 2IANB 4XNQA 5I8EB 3D87B 4ZXBB 3TA3C 3VD4A 5I6XC 4LCUA 2QJDA 3PLYA 2A4CA 2VDKH 4LSTL 2K8QA 4R7DB 4MJIB 5IQ7H 2WOBA 5D70L 1QVOB 1NFDB 4UMSA 3LNGA 3NTCH 4PJ5B 3EGXB 3KR3L 1U95B 3QUZD 1IEHA 1NAKL 5JOEA 2YLKA 5CU5A 3EF7A 4N85A 3ZDXB 4EO5A 2HKHL 2Y07H 1YJDC 4ADGA 3ZE0B 3UTPD 3O4LE 1IM9B 4H20L 1PCXA 4K5PA 3TBSA 2DJ4A 4Z7WA 3QDMB 3RDTA 2Z65C 1UOVA 4QRPB 3DOSB 2HJKA 1MRDL 2LTQB 3QZBA 5G5DB 3KPMB 1HJCA 2R2EB 5DQDH 5HHNB 5B1BB 2V17L 4NEHB 1N4XL 3X1GA 1OTTC 3VFOB 4UT9A 4CSZA 1Y1UA 4UIMA 4FQJH 5F7DA 4KI5F 2OLDA 2QPSA 5KOMC 3OHMB 4L4TD 1U2CA 5I9QC 1P5UC 1OB0A 3VI4B 4N25A 2Y5TB 3LZNA 1N5YL 4UYPA 5AOZA 2OMNA 4XCYB 5LGHL 3SO5A 4MDIA 2BP0B 4O02B 2BCKB 4FQ1H 1RCYA 4LB8A 5JTWA 1ETJA 1D5IH 1FYTA 2PMZA 4KRLB 3WEXA 1JPFB 4U1HB 1Z6JT 2ZWKA 4WVRA 4P9HC 3F58L 3B3IB 4JM2A 4YSPA 5F89B 1CXHA 4KQ0A 4AEFA 3T2OA 3BGAA 2YZ8A 2HVKA 4K73A 5CEZD 3RX7A 3ARQA 2APFA 3VXTB 3AG3B 1M71B 3ZK0A 1G9MH 3FQTB 3KHOA 4X80L 2WXQA 3MOBL 4JL1A 1JNNL 1C5DA 4KTEL 3TA3A 2A2QT 1XD0A 4GSXA 2H6PB 2X70A 5JHLL 2VZ3A 2H1LM 5MHSE 2AQNA 5JHDA 2P8PB 5B8CA 2AEIT 5JXEC 4NRYA 1MAMH 2H0PA 5DHVB 4F2EA 1G9NH 4LCIL 2DWDA 3DX8B 1IGML 5FGBA 2A1WH 1YN7A 3V55A 2G3MA 5LBSL 2DQFB 2CJ3A 4XMPL 1CQKA 4QJ4B 2FATH 2P5ED 4OFDA 4O51A 1F11A 4R4BB 1HEZA 1QLEH 4OZIF 1AR2A 1ZCRA 1JTOA 3WNMA 2PN5A 4AXWA 3SGEH 1CVSC 1ZEAL 5EU7C 5ILTH 5DA4A 4FQHA 5F1OB 3QI9C 3N1QC 5EF3A 2EEDA 3BE1H 3NPSC 4YSSA 1A47A 2FTAA 4B5ZA 4GEIA 5EWIH 1NL0H 1QWHA 3VXUD 2MPAH 4G7YL 5BOPA 1HILA 2JQZA 1BD2E 3VFTB 3LD8C 1G7QB 2YPLE 4NO0B 3SJVE 1XF3B 3QJXA 1KNOB 2ENQA 1TU2B 3KS0J 4EOWL 4ODTH 4IK6A 5CLTA 1ZLWH 4F7PA 5C0BB 2BSRA 2DQIL 3CVIH 4LPCA 1QUPA 3MVSA 1Z9PA 3MJ8B 3D2UB 1N6QH 4D8OA 4OFKA 1TZIB 5BCAA 2DDQL 5DEGB 2YEQA 4IBZA 3NCYP 1LYQA 2QVKA 4PI0A 3BT2L 2X2HA 4ZMZA 1XGPB 3TT3L 5C0JB 1A1NB 5ADOL 3VFVA 1MCLA 4S1SH 1S9VB 3D06A 5K59F 4GKOA 4UINL 5PAZA 4MA1B 1PEZA 4OCWL 5K9QG 4U6HA 1UZ8B 3GSVB 3KPRD 4J7RA 3EHBD 1NBZB 1G7PB 2BNRD 3PWPA 4KGJA 1JWMB 1AO7D 3NK4A 5JXEA 3WNLA 1A6ZA 1K8IB 2RHEA 1KLUA 4Y2NA 1U8QB 1FNFA 1SDDA 5D6CB 5FLUA 3BP5A 1NEUA 3LRKA 3X1EA 2BSSB 4OCXL 4M7KL 2ITCA 3WO3B 6PAZA 5E51A 2F5AH 4IDLA 4TSAL 2B1HH 3CZSA 4E2OA 1UYWL 5H94A 4XP5H 1EUTA 3TVMB 5I24A 1W16A 1MW2A 1N5AB 2WLNA 4P5TC 2DJSA 3MODL 5AAMC 1DYZA 1RZFH 4QR7A 5JMRA 3QI9A 3X11A 2UX6A 3Q5OA 4D0CB 4MQSB 3VWJA 4DFHA 1TTUA 1J0YA 5EN2A 4FJ6A 3V0WH 1E9OB 4GAFB 3RHWF 1BVKB 4P5RA 3QDGD 1JHTB 2F54A 1QI5A 4Y4HC 2WB7A 1FSKC 2VDPH 3DMMB 1CLOL 1QSFA 2VITB 4GG6A 5I1DB 3KPRE 4HALA 2BNRE 1INDL 4EUPG 2X4UB 3WV0A 3CBJB 3DVGA 4PJ9B 3LN9A 2DMHA 2XRAL 1E4WL 4WUUA 4BE6A 1BMWA 4B5EA 2QEJA 2NZ1A 3DX6B 3HMXH 4IKIA 1JPGA 2EIZA 3TXAA 4Q4EA 1A6AB 2OTUB 2FVNA 3DIFB 4G9FD 2H6OA 4DSYA 2JI2A 3S5LG 3GS4A 1IKFH 1ZT7A 3HBPA 3N91A 5T5NF 1ONQA 3MRPA 4WU7A 3O4OC 2VDQB 3MBWB 3O3AB 4CDHA 4HOWA 3H0TB 1FNGA 2HFFB 4R26H 5EC1A 1RUKH 1DQQB 1F00I 3W39A 1QW9A 2A83A 3VQMA 1UD4A 2XPGA 4GW1B 1FYHB 4M1CD 4QRRE 5JZ7D 3CDGA 3SDAD 1EEZB 3BVXA 3UTZA 1IBBA 3QWOB 4ZFZA 3DUHA 4WWOA 1KYOJ 1D6VH 2IBZX 3TURA 1UZ6E 5IKCB 4N0UA 3SDCB 1QFWL 1C12B 4IRSD 2UY6A 3BPNC 3D09A 2ED7A 2EVIA 2YIHA 4NQED 3ZYJA 1U21A 1V7ML 1UJ3C 3BLPX 4LDEB 1QHQA 2ATPB 5M94B 4PJHF 3EH1A 2NY5C 2OQJA 4MYPA 4G8EB 4KROB 2NNCA 3TO2B 4WFGD 2DBLH 2D8KA 1FFNA 4X98A 4C4KT 3BGMA 4AMXA 3TNMB 2H32B 1B9ZA 4ESKA 3PL6D 4OT1L 2KZBA 5D2LA 2LW3A 2OTWA 4OCLC 3VXSE 4P46A 1X4ZA 4GMTL 2DIAA 2O6EA 5IB5B 4L0ZA 3G3LA 3SKMB 5KVFE 4OZFH 3EFDL 4LZKA 2N7BA 25C8L 3WTYA 5EU3B 3L4ZA 5K9JL 3D0LB 4PFEA 4D8PA 4HV8A 2VNCA 4G6KL 2Z6FA 1BZDA 1KB5A 3KL0A 2VZSA 5ALBL 3SCMC 5KYNA 1UXWA 3NFSH 2ETWA 3BZEB 3FB7B 3W81A 4WKZA 3BVWA 2VL4A 3V2AR 1U42A 4HAGA 3I9PA 1FC1A 2R0LL 1QSEE 1QFUL 5F9JB 5FO8B 4ENED 3L5WB 4HXBH 5D6DA 2DM4A 1AAJA 3PP4H 1CTOA 4JO4H 4P23A 5D2NA 4RSVA 1FGNH 1NICA 1ND0A 4OCSH 2I9TB 1HH6B 4NHUB 1HL4A 4K8RC 1A4BA 3VI3F 5ALCL 5EOQL 4APQB 3P1VA 1M2VA 4MAYA 4UT7H 3L3HB 4X8XA 1XHHA 3O9WD 2AJVH 5TDOA 3LQAL 2B2XL 2NTFB 3KXFB 3QYMA 4FXTA 4GUCA 3SBPA 2B4CC 2JFCA 4KJPC 2X4OB 2E4FA 4CMMA 4BWWA 1UM4L 2F7OA 1A7PL 5EOTB 4D7PA 4Y5VB 2VR7A 5E2TL 2PW2B 2NY3D 3N43F 5TF1L 3KCWA 4N2DA 1OGAA 4GUPB 3HI5L 1C8PA 3FHQA 1U8MB 2H26B 3TBVB 4DOHB 2C9AA 4UUJA 4UOZA 1EX0A 3H42H 1X5JA 1ZE3H 2G2RA 4NX0A 5E08H 1OCRB 4MWFB 4OLYH 2FECI 3LIZA 3QHZL 1FL6A 2G60L 1NCOA 4RFNC 1XGUA 2FZ3A 2BK8A 4RMRA 4Q0XL 1L5GB 1IGYB 1N0LA 1AQKL 2X40A 4NWTL 3K5RA 4RCAA 3VXPA 4CMHC 2JIXD 3QXUA 5BVPL 4F7CA 1FYTE 3F7PC 4HC1H 3MCKA 3SGEI 1EEUA 2YPKA 4EVNA 3PG2A 4W9LC 1SHWA 4JO1H 3WYRA 2JB5H 1CU4H 2K70A 1IEBA 3WUZA 3QNYB 4WEBH 1UT2A 2XT1B 2ZWSA 1VACB 4RBPH 2NY0C 2VLRA 3BC9A 2H41A 1NSNL 2OYPA 1OTTD 1A2YB 1HHGB 1N10A 2XQBL 4AYBA 3KPLA 4MD4A 4OZIB 4N22A 4QO1B 2VN6A 3HN3A 3I9IA 1B0GB 1EVTC 2OL3H 4AGNA 2IH3A 4AT6A 4X99A 3OKMB 2YN5A 5DT1L 2FSEA 3M07A 4ZMAT 1IVTA 3UPRA 3KBFA 5FO7A 2VW7A 2Z4QA 1AYOA 3NEEA 3TBCA 1EVUA 3SQBA 1WIUA 4WO4A 4UI2A 1PZCA 3TBYB 3VX1A 1IC4H 3O41B 5J5EA 3EO0A 2V2XB 2W0PA 4FZEH 1SJHA 3MA7A 4HIHB 1XGYH 1KGCD 2VXVL 5J3HC 4OCNC 3FAXA 1XR9B 4AW7A 3L3GA 2ADGA 5JW3L 4MXWL 5D1XA 5F0JB 3FPYA 2NXZB 4JY4A 1ZA6A 3D5OF 4EDWH 1YEKH 1CGSH 4LBAA 4GKNA 2GY5A 3QISA 5DSCB 1FZMA 1PZ3A 4K9EC 1TJIH 4NUGH 4N1EA 5DZAA 2FJSA 3RX9A 3GB7A 1MRFH 3O2WL 2X4RA 1S6NA 3LNHA 4JN1H 3RY4A 3TV3L 1EJFA 1ZIAA 3FFCD 4RA3A 5AENA 3APDA 2O5YL 1I9JL 1BSIA 2G9HB 3FB8B 3GZKA 5IB4B 1KJ3L 4LVOC 3CSBA 4U0RC 2X9ZA 1AY1L 3FUMA 4LKXB 3BX7C 4IU3A 3RFZB 5T1MA 2AMGA 3E9TA 4FULA 4LCWA 4N9GA 4S1QH 4ZSOE 1YEHH 1MCRA 5DJ0A 5EF2A 2BSED 3GHEH 3II2A 4CN1A 5E4EB 3P0YH 4G1MB 2EYSA 3VQ2C 5BW7C 1CG9A 4IMLB 5I66A 3CH1B 1BZOA 3ULUC 1VSCA 1JNJA 3QCUL 5FKPA 3QQ4B 3SPVB 4YAQA 3AY4A 1T2JA 1CDGA 5HGDB 5SWZD 4DP0X 4IBVA 1YMHB 4U7KA 3BZFA 1L7TL 4LHJB 5AVXB 4DN3H 4WGWB 3TN0A 2E9WA 4U1NB 1EEYA 3OG6B 4ZX4A 4N2HA 1GGIH 1YEGL 3IDGB 5GRYA 4H88H 1DQIA 3WXVH 3V5KB 3ZHFA 1B4LA 4LE8A 3B9KD 4N6QA 1OQOA 3ZQWA 4YHZL 3EXJA 2WXLA 3TZVC 4JFPA 2ICWA 4ELMB 1JAEA 1OCWH 5I2IB 4OLUL 4EI5A 4KWUA 4TNVK 5DRWA 5F7UA 3PWUB 2YOAA 3GIZL 1RK7A 1RV6X 3CXHK 4P06A 2R1XB 3T65B 3QJTB 4EDXB 3FQUA 4R90H 3RZCB 1E50A 5FHBH 5CN2A 5ESAB 4BFOA 1U8OA 2EAEA 2K4WA 3AQZA 2GBTA 3CSYB 5FO2A 1DVQA 5E8DH 4F9LC 5IESL 5EEVA 4AI7A 5KS9F 1CBJA 1KIPB 4NSKB 4JHBA 1S78C 4QTHB 4KNTA 4WRLA 5SWZE 3VWKC 4JZOA 1MIML 3WEBA 2F54E 3NH7L 4LHUD 4TSBH 3AVEA 4XN8A 3OKNA 3H9SB 4HXAL 5AW9B 4LSUH 3REVB 1QSFE 4M93B 5AVSB 4TPRH 1HYSC 3Q2LA 4GO8A 2NSQA 4F37F 2VKWA 5ACLA 1OTSC 4JFED 2DM7A 4WSGA 3B2DC 5K39A 4DKEH 4WI3A 3U0PB 3VRLF 2W1NA 2WTOA 1W0VA 3BEWA 4M4PA 2PW1B 3FO9A 5SX5H 2PWEA 4P5KB 1JPEA 3NIDF 5FYJD 4EI6A 3LSOA 1E3ZA 4YEEA 1R0AL 1MWOA 1YJDL 3Q7JA 1H15A 1F41A 3X3FH 2NMSA 2QLVB 4HWBL 5D72H 4YHKH 4QRSA 1W0WA 4BKTC 1YNTF 4R3SB 1CE6B 1R3KA 4AGOA 1SYVA 4PJHB 3LKNB 4Y4HD 5TGBB 2BMKB 1ZHKA 3U4AA 4JMNA 5E9DD 2H0JA 1CGVA 5CP3H 3FQNA 2CCWA 1NM9A 3QW9A 1IT9L 4GKZB 4MD5B 3KDPB 3P4OA 2ORBL 5DC9B 3T3PF 3VG9B 1WFJA 2AEQL 3HZKA 4YSEA 4N0UE 1ES0B 4MA3B 2ATKA 4JUSA 5GGVL 3IFNH 3K2MC 3QQ9C 1KXTB 4YHYC 1L9SA 4F8OA 3L1OH 3TTSA 4N4YB 3ARGA 2VIRA 4ANUA 1CMOA 4P9HL 3KGRA 5T1KA 4X7CC 3O6KL 1ZVYA 3D85A 5IW6A 1GGCL 2A4ZA 3NJLA 4PBXA 4A2LA 4JZJB 3V6ZB 1SMAA 2V5RA 4PJXA 4B96A 1QRNA 3DOHA 3HPJA 1DJYA 1XEDA 2VCOA 3MV8B 4PYGA 4TNGA 5TE7H 1CURA 1UB5A 3C5SA 4UB0L 3P30L 4IGBB 2V7HB 1ZY9A 1XDTT 1ORSA 2H1PH 1NA8A 2XWJA 5FFLA 1A7QL 3L08A 3VI3B 3QAQA 4PG9A 3RWFB 4P8QA 5E6ID 3WJLA 5DCCA 1PNCA 2BVUA 3MNWB 1QOKA 2G4EA 3MREA 1B0RA 2ZXCA 3WSQH 3MV01 1BDYA 1SBBA 5FCSH 1ZHNB 3AREA 3DI2B 5DJDB 1G5GA 5E6RB 5LNGA 1HXKA 4A2HA 1H9VA 4WTWA 4YUEH 4CA4A 3FOMA 5DQ9A 1Q0YL 4I3RL 4I4WB 3N43B 1X5MA 4WKXA 3W9EB 5HGBB 3G5XB 3CQQA 3RTQA 4L3ED 1Y1DA 1A0QL 1GC1C 2P5EB 4WGKA 2WUCL 4DKFL 1MQKH 1T1ZA 3PV7A 4PBDA 4BWUA 3DGGA 2TSBA 5HHVH 1NFAA 1HNFA 2X6VA 3BP6A 3ESOA 5CJXA 1IM3D 1RUPH 3PWLA 1XCQB 5IUCA 3HPLA 3ARFB 5I8CB 3VH8G 4LLYB 3SCMD 4WNSA 5CFAA 2AZUA 2HLFC 3GJEA 2MOGA 3PWVA 3WLBA 1OGAE 4KXBA 4XR8C 3WFEH 4IOSA 2DL9A 1DUYB 3U2SA 1D7FA 1KG0B 4K3EL 4DK3A 5CWSA 4ZOBA 3RIKA 2AJXH 5AKRA 3GRBA 5TH2A 3NCBB 4X4MA 1INEL 1MZYA 2ZNWA 4FFTA 3U7YL 1F42A 1KJ2H 3MUGA 4K8RD 4L4VA 4M4RB 1OAQH 3IDIA 4Y1SA 4LARL 1SXBA 2WXJA 5CKGA 4KJPD 5DJ2B 3VJ6A 3HE6C 3KYNB 1THAA 2AABH 2WWMD 3DROB 3RLSA 2C9QA 3WFHB 1MFVA 1NOAA 1JZ6A 1TVHB 3U46B 3CIQA 3HVDA 4P3WA 4Z8FH 1W8EA 1YN6B 3GSXA 1KZQA 3EBAA 3ULSA 3G6JB 4KK9C 2VLRE 3LRSA 3ZU8A 4HG4J 2E5EA 3DO7A 4AQ1A 2YC1B 1A6WL 2KZWA 3AXLB 4GY4A 3DV4B 4IEFB 3RYMA 1DBBL 3DARA 4A66A 1GZPB 3JVFC 3P0GB 2JKNA 1NPJA 1A7NL 3GSNL 4UM9D 3K6IA 2WVVA 4OGXH 2YS4A 4R9HA 5HXMA 1MCOH 3GQFA 1A9BB 3C8KB 1XSKA 5FX3A 4HS8L 5F7EL 2BNQD 4JCWA 4QUOA 4Y16C 3HR6A 1G7MA 3D50A 3ARBA 3B43A 5E03A 2XVBA 4LCCC 2RBLA 1ZT4B 3QDJA 4ZOCA 3T4AC 5C92A 3BUPA 4FXLA 4L1SA 4HSCX 3BT0A 4RRPA 1M1XB 3LMJL 3W9DB 3RY6A 5BNXD 1E9QA 1TQVA 3JWNC 1ANUA 4TVPE 5D1XE 5B1CA 1I8UA 4KRPC 4PLKC 4M8RA 2ADIB 4BIKA 2OYKA 3HRPA 5JIMA 3TNNB 5JA9A 4EIGB 1SLXA 4G83A 1LEIA 4LK4A 5KSAA 1YEJL 3SQRA 2ZSWB 1IKNA 4H25A 1OB1A 1IQDA 3ARVA 3OJ2C 3VO0A 4PWJA 1CBVH 1U6AH 2G9KA 4ZAKC 1IU1A 5JPNB 1G0DA 3L1FA 1KBGH 2DIJA 3A6OA 3ABZA 4JO5A 2VAAB 4FNRA 2LLLA 5DRNB 4G9FB 4Z7VF 1G6RA 1VESA 1FAIL 3CX5K 5J3HD 1B2YA 2M26A 3DC0A 2XBDA 5T3XD 4NPYA 4JUTA 1QW8A 4TMPA 1YNKH 1KTJA 1F8TL 1GJUA 1YEFL 4UYQA 2IDTA 3RGVA 2AXGA 4YL4A 1SBSH 3OKDA 1IC5H 4R6UA 5L0QC 3ULVC 2DQHL 1S7SB 3IDXL 3MRGA 1ZGLA 3I75B 4NQVA 3SDAB 2Z8RA 4K3GA 1SY6A 4V33A 4GRMB 3Q3GB 4N6RB 4IRSB 1E5UI 2JB6B 4FP8H 3MX0A 4UIKL 3EH3B 4XCEA 3B2VH 5SWQB 1ZA3B 2NY5L 4PB9L 3LKPB 1QO3A 3EDFA 4IBLT 4MJ6B 2Z31A 3WXWL 5AAPA 1J11A 3PQYD 3LS4L 2D7QA 4PGCA 5KSBA 2FX7H 2HA1A 4H1LH 1BVLA 1J0KA 1XH2A 3BQUC 4U6YB 2E47A 1SJMA 3GMLB 3QUKA 4NFDA 1NMBH 5H35B 2ITEA 4JCLA 4NQCB 1BAGA 5BPPA 5DFTA 5HGHA 2YD5A 1JZHA 1NMAH 4G8IA 2L0DA 3ASOB 3ULUD 4GUQA 5GRJH 4XOAA 3EH5B 3PL6B 1P84K 1CC3A 4X5QA 4S1RL 3SKOB 1X44A 1NBQA 1U3HB 5JQHC 3MRRB 2VLKD 5DTFB 3SHSA 5C08D 1EO5A 5EZIL 2ZIDA 3K6NA 1VFAB 4YQXH 3CK0L 4QYOA 2JELL 5C0AD 3UYRH 4JO2L 4ZW6A 1WDAA 3W0WB 4XAKE 3UBHA 5D7LA 1MW1A 5KBPA 5I1IH 1JMXA 3BFWA 4K7FA 2DIEA 1F2XK 4O2EB 3VXOB 2CNYA 2XPZA 1P7QD 1YNTB 2UY7B 3SD5A 1MWAB 4JFFD 2D0FA 3S35L 1NTDA 3B5TA 3PF2A 4Y4KA 3T09A 1MREH 3B9AA 3TZVD 1YVLA 3QFDB 3KDMA 2WXKA 4K8RL 4AV5A 1TIUA 4MNQD 3K4AA 4FABH 5FOBA 4IS6A 4J8RB 4PHZA 1A6VH 1E5BA 3DX9A 4NNPH 2B4CL 4YDIL 1KBWA 4UOW1 4DGIL 4TUKH 2EVJA 3HA0A 3Q1SL 2YD1A 3O9WB 5E8NB 1AOHA 2ICWJ 2CALA 1S78D 5CM1A 4BE5A 1A21A 1MUJB 4LIQE 3WS3A 5L6YH 4QLRA 2C7UA 2ZSVB 3HZMA 4PJGA 2GEQA 4FKHA 3MKKA 5KSVA 5C0EA 2JKRM 4NZTL 5IOPB 4AUUA 1HYSD 4IW4C 2BY0A 2OXGB 1OTSD 3S35X 2FQEA 3C5JA 4JRYB 2C1OB 5DEFB 2J55A 3CFEB 4K15A 1M53A 2WUBH 1KCVH 4P3DA 4LLUB 5IF0B 1TPXC 1RI8A 4I2XB 3C08H 4P2RA 2DN7A 3QS3A 4PJBF 5C0FB 1HINL 4M00A 4QXTA 2X53A 4GW4A 2WYTA 1LO2L 1K4CA 1QZNA 2MNJB 2WJ5A 2XJLA 2YJQA 3MRKA 3QT2A 4MNQE 4U1GB 4UTAA 1JNHA 3CN1A 4RDQG 5FPIA 3QA3B 4NP9A 4EUPB 1S9WA 2R7EB 2Y7QB 4WTZA 2JIXB 1T7YA 4UOW0 4HEPA 1JGEB 6FABL 2VRAA 2FQGA 2Y36L 4Z77A 1QRNE 3DRTA 2HTLC 2ZUQC 3ZKMC 4Z7UB 3UGXA 4W93A 3S5LB 1HZHH 1UCBH 3H7BB 1AR1B 1LO0H 3CFIC 3MGAA 2ICWI 2V9TA 1T0MA 1MFAH 4PREB 4Y19D 1YNLH 4UWQB 2IG2L 3HG1B 2WNKA 1NGXA 1AXTH 4MJ4A 5BMFH 2H1XA 1W72A 1W2KT 1B2WL 2EE2A 2XZAL 3QQ9D 4LPTA 4ZS6C 5ES4B 1ZSDB 5IVZA 3V8CA 5KN5A 4LPWA 4UQDA 1I9RL 1XD1A 4HKZB 1B0IA 4YFLI 3ZYZA 4Z18A 2ED9A 5FHAL 3FQWA 1J5HA 2PYFA 4UQ2B 1K6QL 5DVNA 5KBKA 4G1EB 2E56A 2CKBL 4WNQA 2FEJA 5EO9A 5J1AB 4JGMA 2YXMA 4GXVH 5KW9L 1HOEA 1TLMA 4FZ8H 4M3HA 2DI8A 2YAFA 5F1IA 1LO5A 1IBFA 2B08A 2VJ0A 3FSZA 4ODVH 2SEBA 5CMAB 4YOKA 3LKRB 3MLUL 1BMGA 4W9GC 1PFCA 1BJ8A 2BXZA 4HMCA 2NY2C 5L88H 4HKBB 1EJ8A 4W6YB 5L2KB 1CLZL 4K9EL 5DURD 2DW5A 4Y8AA 2EKSB 3GHBL 1I4FA 4I89A 3APNA 3OR6A 4K94H 1VGKB 4WY7H 3D34A 1J9SA 4TRPH 4XBGB 2VDRL 3CVBA 1VPOH 3OXSB 2Z8VC 2LHAA 4ONGL 2P5WD 1JDAA 1H8SA 2A9NL 4G8FB 1R3JA 2NNXA 4PSPA 2XN9A 2WVTA 4L3CA 4P4KA 3PPSA 1R33A 4G6JL 1TEGA 3OPZL 1PLGL 5AYUH 4WI8A 1U92A 3S36H 2X88A 1ZMYA 3FFCB 4RZCB 4I8DA 2BHYA 1NGYB 2OXHB 1C5BL 2JLLA 1MZZA 5FECB 2VSKB 4X4ME 4DP1X 1DFBL 5DMIH 4A7UA 2XVGA 3MGOA 4OF6A 1G7IA 3IDMB 5IB2A 5KOVC 1JFQL 3ULUL 3VXQB 4FE9A 4L4VE 3GRWA 4HKXA 1XF2B 5BXFA 4YLCA 2D03L 2N0KA 1LP9A 4HWZA 4LIQL 1NGPL 5E5LA 1S9XA 3QJQB 1G9MC 4C59B 4XZUB 2JI3A 3HC3L 4IM8A 4PW9A 3VRJA 2IGTA 2X44D 4FHBD 1X5FA 5GJTL 3A67H 4HFUH 4YXKL 5JLZA 3NZUA 4JN2A 2N56A 2HLFD 2OSXA 1AG6A 4F24A 4N1HB 1WFOA 3RVUC 1N6UA 1NBYA 3QRGL 5C71A 2P5WE 5A2LH 4GRWF 1PG7H 2YK1L 3K8KA 3CHXA 1T1XA 3H3KA 2LFGA 3IXTB 3R1GH 5IROA 2E27L 5FIEA 3PHQA 3WIFB 4HUUB 2J3SA 3B9KB 3CSGA 2CO4A 1A9EA 2IJ0C 4LVHC 1FG2B 4NZDA 3C60A 1V05A 1Q0XL 1FO0A 2VZ1A 4WI6A 2A73B 1NEPA 3U0TB 3E6HA 3MJGX 1UXMA 2OR9H 5I76B 4JQVA 1CFQA 4W6XB 2AF2A 4PVBA 3DJ9A 4F37K 2GJRA 4GH7B 5HYSA 3NA9L 4XRCB 1NDGB 3D9AH 4PTUA 3S3BB 2OMTB 2WO2B 2CMRL 2ZPKH 2XWTB 3HE6D 1T3FB 4F91B 4OD1H 2B7DT 2HZHA 5I23A 1NWPA 3C9NB 3QDJE 1IBYA 1CQYA 4HJGB 4HK0B 1H3UA 1PYWB 1XGQA 4KK9D 3QIBA 5AZ2L 5EU5B 5CEYB 3RPBA 4DEPB 4P2AA 4FFZH 4L3AA 4WFHD 2DQUL 1QAWA 3F7QA 4DGUA 1YUHA 3VXNB 3L9EA 1MVUA 1MCHA 4WEMB 3ZHLA 1D9KA 5HGAB 4KHTH 3FT4B 4GFXA 3U9PH 1OZUA 3SE9L 1F4WL 1L0XA 1CR9L 4OUUB 5CLYA 3ULUF 5J6GA 3U83A 1BOGA 1MW0A 4ZW5A 2JKTM 3HMWL 4PRHD 3FH7A 4Y16D 3M8OH 1CGUA 5TPWH 4PJ7A 1OAXL 4KK6C 1MJUL 5F1NB 4APXA 4FTVA 1FFQA 4UDUA 1ZWIB 4NFBA 5C6TH 1DDHA 1EZVY 1Y0LB 1W72H 2BIOA 3N06B 4FQ2L 4GJTB 4YMPA 3K6SA 1PQZB 4KRPD 4WUKH 4F7EA 1CTNA 4NS0A 4PLKD 5KTEL 2F8IA 1BGXL 5ID1B 1IBDA 1ET5A 3S8FB 1AHWC 4IMKA 3GBEA 4GKLA 3FO2B 5KSUB 2AP2A 4JM4L 1I1FA 4PJEB 8PAZA 3GTVA 1OTUC 1LK2A 2X3BA 5F9DC 4ZAKD 4HPOH 5DJYB 3UTSD 4G3YL 4JVPA 1U4FA 4YVNA 3CWGA 1T83C 1OPOA 4ALAL 3IYLW 4PRHE 2VXQA 1M6OB 2PTTB 3WDJA 4I77L 4L23A 4X8JA 1IAIH 4MMYB 2XIBA 4XXDA 2EDJA 3MPCA 2RCSL 1GHFL 3B8YA 4NI3A 5B39A 3IVKA 1N8OE 1HK6A 4DN4L 4B41A 5K9OB 3K6FA 43C9A 4NO5B 2FYYA 1XGRB 3QORB 1R75A 3ULVD 5IHUL 1BF2A 4N8PA 2APVA 2VXTL 3UABA 1XH1A 1RUML 2WBJC 3I3EA 1MHEB 4OF5A 1LEGA 3VTTA 1U8IB 4UQ9A 2CGRL 2X4SA 3NQKA 5JO5B 4JY5H 1F4YL 2VLJB 1Z9NA 5D7LE 5E6IB 5FDYA 4YX2L 2H3KA 1UA7A 1H5BA 5IMOB 4AQAA 3FZUC 4OY9A 2O5ZH 4QF1A 5DK3A 3ZE1F 3SPCA 1WAAF 1DO5A 3HUJF 3WKML 4DQAA 3DHMA 3FT3B 4H8VA 4HP5A 2R0ZL 3BQUD 3UTSE 5BVJA 4KZEL 1OPGL 4HIIA 5BRZA 3CZNA 4MQ7B 2JQMA 4XCCH 1GC1L 3NJHA 4AQEB 4LGPB 3X3GL 2B59A 1N8ZA 1JGVH 2XUWA 2YPVA 1TFHA 4NQDA 4E0RA 4NJAH 4PJBB 2HXAA 2P8MA 3EBHA 1VFOA 3ULVE 4TUJB 4QT5B 2F19L 1IBZA 3FCTA 4KVNH 4PVMA 2DM2A 4PJ8C 2FX8H 4WWKC 3PP3K 1Q9LA 3I6LE 4KZDL 1IM3B 2E7MA 5ICUA 2OMVA 5HVHC 3GMNA 4S0HA 1DQLH 3P9LA 2F53A 2O6CA 4NOBA 4QDGA 4HOZA 4KHXH 1WBXA 2CCVA 3B6SA 5GGTL 5LN8A 2FIKA 3KEDA 5CLWA 1T83A 4AH2A 1RPQA 3LKSB 2V2TA 5JUEH 1RSFA 3T3MF 3QCTL 4P2RE 3NP3A 1EUUA 1P2CA 3WTVA 1ZANL 4PRPB 5FF6B 3EYFA 5AVVB 3PNWA 4JQXA 4PWEA 1UWYA 1T04A 2ZUXA 2AV1A 5HHXL 4CW1A 1CUOA 1UC6A 3QWRD 5BRQA 1CFTA 3CVDA 2HX9A 5D55A 3C87A 3T0EB 1S5IH 3SE8L 1HHKB 4O02H 2WLZA 4WV1B 1JK8B 2DKSA 4LDCA 3V0EA 2UVFA 4X9HA 4FXGC 3OR7A 3ZZSA 2WCPA 2ZKHL 5DHYA 4JFZH 3F7VA 4KMLB 1LO4L 3EOTH 3B34A 4U1IB 2F74B 3PPEA 2XG4A 3B2MA 4V1DD 3HN5A 1I75A 3FCSB 2X05A 3SOTA 3CFUA 2C9RA 4ONFH 4ZFOL 1FCCA 4M43L 3D69A 3FQYA 3CQFA 5IW1A 1GZHC 4C47A 3GK8H 3SDYH 1E2WA 3ZN6A 4KH2A 4M62L 3IJ9A 4UM9B 4KXAA 1FZJB 1RULH 2Q86A 3PFUA 4HCRL 5FKAB 4X50A 1JNLH 1FBIH 1M2OA 4GSDH 5DHVH 1WGOA 4OQTL 1VA9A 5IJKC 3CXDL 3DVNB 3OVUB 3ZKMD 1NJ9B 1U8HA 5T5FH 2XXCB 4YHIB 3RNKA 4AQOA 4XNZB 1EMTH 1ETB1 3A6CH 4AENB 1G1KA 3I74A 4IOFC 3VGEA 3F00A 4DPAX 2IQ9H 1XF1A 1GIGL 1JGDB 2VDNB 3NPZB 5FM8A 1KGXA 2F2HA 3M86A 4WEUD 5C97A 2XZQL 2YEVB 2VC2B 4ZS6D 1XZ0B 2VR8A 3E9UA 5JXAL 4OB5H 5JW4M 1RERA 2DWXA 3IJ7A 4Q9RL 3QR2A 4EN3B 3L4YA 3TJHC 3INOA 4MRCA 4RMUA 5FR3A 3G9AB 1Q9OA 1MPAL 3TV8A 3WGVB 2GQHA 3DGDA 4IBYA 1H3TA 1QP1A 1M7UA 4RDQF 5AWNL 3I6KA 4JREB 5T8IA 4GRWB 2NY4D 2A99A 4XMVA 5C9JB 1RLWA 3OXRA 1A4CA 5IEHA 1C5CL 4X5PA 3ULVL 1A1MA 4LRNH 4D9LH 3T6ZA 2NY2D 4ZO7A 3Q05A 1TTBA 3KPSD 3MLWH 3ARWA 4MAUH 1ITCA 2B0SL 1LP9E 3PJSB 4GRLA 1JZDC 4DKAA 1LNUA 4FLOA 4CUCA 3B9VA 4LMQE 2RJMA 4PS4L 3WNOA 2Q20A 3DK2A 4YIQA 4Q89A 2JJSA 1P4LA 5LXGL 2FH8A 2FJHB 2Y24A 3NP4A 1GZHA 3KG5A 5CZVH 3GSWA 4G7RB 4GNKB 4E41D 3L3DA 2V3EA 4XN7A 2PXYA 3BZDA 4M6ML 3BRFA 5KJRL 1MEXL 1JPTH 2AK4A 1ADQH 1NAMB 1P0SE 3DJZA 4XI5C 4JGNA 3L3KA 5BQ7A 4RMVA 3PQYB 1OCCB 3HE7A 4J28A 3WNPA 2UZXB 3VH8B 2P9RA 1UT1A 3M17A 1HH9B 2P47B 5E1IA 3CN4A 4MKMA 2PCFA 3PGCB 4ETQB 1IBGL 5IVOA 3LQZB 2WOYA 4GAYB 3T77A 3AU1B 2MKWA 3Q9QA 4F92B 3MRQA 4PRIA 4NO3B 3DVFA 4IDJH 3ETBJ 3D4GA 3FFDA 4Q6IC 5T33H 2I26N 3BPOB 1INQB 3GD1C 2YBRA 4GPVA 5D1QB 1SJEB 2CO3A 3X12B 1MHCB 1H3WM 2XNAB 1J5OH 2AZAA 3TEZA 3MRIA 2ZUYA 3C6LA 5C08B 4JK0D 2VN7A 4AW4A 4B9GA 5EORL 2J88L 4LAQL 3RVUD 5BUPA 2CPCA 3ESUF 3Q0HA 3GSRB 2G2NA 1J05B 2XBTA 1NKGA 3A24A 5TDNA 5I1JH 5D7IB 3DETC 1AE6L 3PV6B 3INUH 5CILH 3WTXA 2IO5A 4HISA 4HCFA 4JFFB 3D4CA 2L7JA 4NT6A 1Z5LB 4PH8A 1KYFA 3ATFA 4AG4L 5I1KL 1LQBC 1MFBL 5AW2B 5CEXB 4Y2DA 5I75C 2DI9A 1IAII 2Y23A 3L2LA 4J3VA 4A2GA 4PR5A 3IF1B 1FIGH 4N9OB 1NANH 4I0PC 3TH2T 1D5RA 1L4IA 2ZWZA 3EJJX 1F3DJ 1JDCA 1D2OA 1JD9A 2WWKO 3PREA 1IGIH 1T4WA 2N3JA 5I1AA 4GS7C 5DVMA 3W57A 4FTVE 3THMH 3EGSB 3U6RB 4X6FB 1J86A 1JRHL 1K85A 1D7BA 1UWXK 2PTVA 1V5JA 2W9EL 3KBEA 3NFNA 5EC2A 4BSWA 2VRQA 4WNJA 5BO0D 4PTTB 5IW3A 1ZLEA 2P46B 2A6DA 2I25N 2E7HA 4W9EC 4BHUA 1CGWA 3E8VA 2QHRL 1HJBC 2Y7MA 2VDML 3RL1B 3SBQA 3ZUNC 2DQMA 2EXYC 1FPTL 2M1KA 2IPKA 3HR5B 2W88A 3QUYB 1AZNA 4LCYB 5KYXA 3ELAT 4JMXA 2OI9C 1YYCA 5JDSA 4ZYKA 2UWEB 1TDQA 4WW1A 4XMLL 1M42A 1ZJAA 3VRIA 4DHLA 5LWYH 2DL2A 4KK6D 2CR6A 4GO9A 5CINL 1U8NA 4LASH 4QNPF 4MA8H 1DVFC 2BINA 1RJYA 3L8QA 3ZE1B 1JK9B 3HEIB 3HUJB 5ICYB 3IJEA 1O7VA 3WIIL 2ZOTA 1R3HA 4MDJA 5DEZA 3UJIH 3WO4C 5A16B 5MENB 1JZJA 2BJML 2G5BB 5DUPH 2H32H 4L1DA 3RWGA 2AEOA 4JHAL 3ZSTA 1HSAB 4BZ1A 2VDKL 3SN6N 2LU5A 3L95A 5EFIB 2XWBA 2PNDA 3WIHH 4F3FA 1U58A 5HI4C 4Y19B 2A6IA 2OYMA 5IQ7L 4OD2B 2DQGL 2ERJC 1TR7A 3FRPA 1OTUD 3WFBL 2ARJB 5E9NA 2DJMA 3IMTA 4KVCH 1N64H 2NT0A 3UC2A 2X1WL 2GCYA 3CVHB 5JA8B 1AKJB 2R2HA 2OA9A 3P9MB 1SHSA 2YXVA 3N42B 3IFPB 3LIUA 1ASOA 5E5MB 2D3JA 1MLCA 2YAPA 2BDNH 1HAUA 4U1SB 3DKHA 3QJFB 2DEYX 4H8WH 3GXTA 3UBGA 4NQDE 2Q8BL 3MLSH 1UB6A 3O2DH 1UADC 3D4ZA 3T3MB 4FQJL 3GSUB 2WBJD 4LVNC 1BAFH 1IC0A 2D31B 4RNRA 3OAYH 4FG4A 1CXFA 3MNDA 5CIPH 4X4YB 12E8H 5EA0L 2NY6C 5KYUA 5DMKB 2WNGA 3V52L 1QHPA 3O3DB 4NNYA 1DUZA 3SEPA 2CU9A 2EXWC 3NG5A 3UMNA 3FZUD 5AOJA 4FKKA 2F53E 1D5IL 5E6YA 3VGFA 3ISRA 3QFJA 4HUKB 3FUNA 2ZCLL 5DS1A 5AUMA 4XC1H 2P3YA 4TQEH 3M1OA 3FRUB 3KL5A 4J2QA 4CKQA 4MJ2A 2IH1B 5EBWA 1OHZA 2NW2A 2EUZA 2VDLB 4FS0A 2V3FA 4R0LC 5I82A 1P7KA 2GABA 3SGKC 2CIKB 5J1TC 4QAMB 1G9ML 3NDYE 5I1CH 4OM0H 3AQYA 2IV9A 3VVWA 5JHDD 1UURA 2JXMA 1Q8MA 2AQ3A 4PJ8D 1BHGA 3D12B 4WHYH 5L9DL 1JOIA 3GMOA 3K8LA 4HSAC 5D7JB 3PXLA 3BLBA 3HI1B 5E4AA 1MAML 3A4EA 3QIUC 4Y2OA 4FXKB 4XB7A 3BWUC 4KFMA 5IBTH 2A6JB 4Z6AT 4G9DA 3EJRA 5CN3A 3MBXH 3ESVF 1X5IA 4XGZA 1N0XH 5C07D 1GXEA 2K0RA 4FQQA 3CMGA 3K2KA 1GZQA 1BEXA 5J12B 3VXRD 4O2FB 4DP2X 5IQNA 2WXMA 3GHPA 1TVBA 4KTDL 3BKML 1MY7A 2ZOOA 5JOFA 2KLRA 1T7WA 4GBXB 2OZNA 2GKIA 5ILTL 2FB4H 1UXLA 1Z9LA 3BE1L 4FG2A 3QUMB 5EWIL 1NL0L 2MPAL 3HG3A 3ZZLA 2CLZA 1JZ5A 3FB5B 5D5MB 5DUMH 4ORGB 4XO5A 2AI0L 3RUGA 5DA0B 3ARZA 1CD9B 4L9LC 1BA9A 5IB1A 2ITDA 2XTLA 4ODTL 4NUJA 4I9WE 4AV4A 3DX3A 4P4RB 4PJDA 2Z35B 4U1LA 2Z34A 2NDGA 4JFQA 3CVIL 4GW5B 4HGKC 1S5HB 5EU4A 3VU2A 3GMPA 1NGZB 1YYLH 4AJVA 2AXFA 1OD7A 5IHHA 3L4UA 1OF2A 4GLRI 4PCKA 1R19A 1FVDB 4XBMA 2AKRB 2NNAA 2HWZL 1OP5K 5INDB 1UD6A 1PL3A 1XT5A 2WO4A 2ZG2A 3GJFK 2I7SA 3IPEA 2EC9T 3P73A 5IM7A 1IC7H 1MKFA 2ADJB 3VXMA 3DUSB 5A2AA 3RPKA 4ISVA 1OAUH 1UH4A 4XBPA 4PGEA 4YLQT 4XN4A 3VUAA 2IOOA 3QPXH 2XV3A 2FIRT 1A4JB 1NMCC 3QZMA 4JANA 2HN7A 4NBYB 1ACYL 4WWNA 3FQXB 1I85C 2QSVA 1MDAA 3MRCB 2XWDA 3QIWB 1E8XA 4P2OA 3FTWA 2UUDK 3V4UH 2VR5A 4IOFD 1S7VB 2EIMB 3QNXA 1PJWA 4OF8A 2MFNA 2BM3A 1W6WA 4JPKH 4YO0B 3BP7B 3S34H 3DNKA 2F5AL 1WWWX 3SKJL 4Z23A 2B1HL 4FQXD 4U49A 5D93B 5JIPA 2C9SA 3HB3D 1HHHA 1MI5B 4ZPTB 3U48A 2WWOA 3CC5B 4XP5L 1TZHB 1CICA 3KYOA 1FJ1A 1U91A 4IRZA 1XMWA 3AW5A 3QXDB 3S5ZA 3TJHD 4G8GA 3MR9B 1IL1A 3O0LA 4KKCD 3RWHB 1KYUA 4FMKA 2IWEA 5ACZB 2BX5A 2PPAA 1K5NA 4FFVC 4F20A 1P1ZA 4YE4H 2ZCHL 1E5ZA 3OLEA 4Z76A 5I5RA 5F0PB 4YH6A 1T0NB 4QHUB 3O8XC 1JGUH 2JI1A 4YVUA 2VDPL 2P24B 3V4VB 4AIZB 4JL2A 4L9LA 2X4TB 4WUUD 1TCMA 3MFFB 2CBPA 3IDYC 2XN2A 4DKDC 4QOKD 3T6VA 1KPRB 2YA0A 5BZXA 2CDFA 2P8LA 4BXVA 2EADA 3OJMB 4Y5XA 1OHQA 4UQBA 2E9GA 4RMQA 3FJTA 5GS1C 3HMXL 4EZLA 4L8BA 3DX7B 4ZODA 5JR1H 5J9PA 4YHPB 5FYKE 3LDBB 2R2BA 4N2FA 3PCYA 2GEEA 4XI5D 1V27A 3WJMB 2OSLA 4ODWB 2X1QA 3MGTA 4KK5C 3QPKA 4R26L 5JW5B 1UKTA 4CN4A 1WBYB 1CTMA 3WHXB 4GAAA 1BIIB 1A25A 1S3RA 4XHJC 5DUBA 4C8XA 5L4FA 4AIOA 2F7PA 4JY6A 1F13A 5IZ7A 4JS7A 1CZ8L 2EILB 2RQEA 5IBLC 1BVNP 1D6VL 1HWGB 1I7ZB 1YPZA 2Z7WA 3T6QC 2P7TB 3L17A 4KJWC 4AGPA 5JQIB 4Y1AA 1T2XA 3HBZA 4OLZL 2GT9B 4ZQTA 3HC0B 3QO0B 4AVJA 4WHDA 3V0HA 3HN8A 3UJTH 5HYJA 4H0LC 2BVEA 4KAQL 4Z7WF 5AZEL 1T5WA 3I6SA 5SWSB 1VKXB 3L3OC 2Z7UA 4KKLD 4OZHF 2BVPA 5DZLA 3DETD 1MLBB 4YDVA 1FNEB 4YBQC 1WFIA 1NLBH 1LDPH 4MFHA 3BUIA 1M57B 2EP6A 5DRZB 2JH2A 4NERA 3BP4B 3QZLA 3OKEA 5LGKA 3N0AA 4I0PD 3HS0B 5GPRA 3HZVB 3QNZA 1T6BX 5CJQL 1EHLL 1E4JA 3CN3A 1FFTB 5C2BH 5EZJB 1JFHA 4TVUA 1BJ1J 4IHBA 1RVFH 1G4RA 3TM6A 3PWNA 1E5AA 5CBEA 4HOXA 1BX2B 3OB8A 3MBEA 2DYPD 1LVEA 5ESVB 2QQKH 1BFTA 2LQRA 4F58H 3GWJA 2ODIA 1AQ8A 4PWFA 3MV7B 2ZUVA 3VFRB 4BQ8A 5FYLH 4K4KA 1AQDB 4ADJA 1W0YT 2WCGA 4FQCH 3RWDB 1QR1B 2R1YB 3PP4L 2R8SL 4DP7X 2IAMC 5EUKB 4AQZA 2EXYD 4D0BA 4W9CC 3IDNA 4CL7A 4PWKA 3O45B 1N7MH 4J8QA 2IBZY 4OCSL 1NC2B 1QUNB 4V1DB 3LEXA 2W81C 3QH3A 5E94B 2NYYD 4UT7L 3NZHH 1NCBH 2AJVL 1D5ZB 5MI0B 4MCZA 2I27N 1L0QA 3ORJA 3TYFA 1SOXA 3VG0L 5K9KA 2Z7ZA 2AK1H 3SGDH 2EIBA 4DUXA 4Y4FA 4AZUA 1DVFD 2EEFA 1MCKA 4PRDA 5GIRA 1BD2B 2AJUH 4IK7A 4NDMA 2YPLB 3SJVB 3UFIA 2YARA 4M6OL 1VEMA 4EQ2A 3H85A 4ZNEA 3X1BA 2Y1YA 4J3OG 32C2B 1CGYA 3H2QA 1CDBA 2WVUA 5IUSA 3DPBB 1UOKA 4NENA 1Q4NX 3H42L 5DJAA 4UT6A 1M05A 5HI4D 5FB8A 2OR7A 4X7TA 1BXXA 4KOBA 5FYKL 5I5JA 5F3HA 1SHMA 4OTXL 2OMYA 3ES6B 1HKLH 1GS6X 1KN4H 5FOJA 1L6XA 3DBXB 3H3PH 2A9MH 3DA0A 4MCYB 4OUOA 2R29A 1U0QA 3ZRFC 3ZT6A 4LDOB 5F44A 3IU3A 4ODUA 1OE2A 1S46A 2EDYA 3X13B 4CGUB 2APTA 4JLRA 3NT0A 3QFJE 4HC1L 3VYPA 3A47A 4JO1L 2JB5L 2FEEL 3BOVA 4Q9QH 4B97A 1JXJA 4JHVA 3U7WL 2CA4A 3FONB 4Y8DC 4WEBL 2DLTA 5F9AC 1JZGA 4JFDD 4K2UL 4F1SA 3DUUA 4BHUI 5H37A 1JWUA 2NY4B 3A22A 2PYEA 4Y7OC 1BBJB 4ZMWA 2K45A 5HD8D 3WN6A 5CCJA 2HRPH 5E1AB 4A68A 1DJXA 2E6PA 1PDKA 1I8IB 3F6JA 4ZO6A 2CD0A 2OL3L 2E7BA 2E3VA 4L8DA 1PD1A 2NY6D 4XXWA 3O81A 1FNSH 3D39A 1V54B 43CAB 3EFOA 5F88A 2AGJL 3BVDB 4ZS7L 2FAUA 2OM5A 2RTTA 4LT7A 2EXWD 4NM8H 2OJEA 4ZUTB 5BZZA 2OSWA 2YBGA 1LLAA 4ZMTA 1N2RA 1ACZA 4UQIM 2M2DA 3ECQA 2R4SL 4E41B 4ZUVA 1IC4L 5TQ2H 5B7FA 3EIFA 4FZEL 3B5GA 2HPOA 2O6FA 3BAJA 2KUTA 4XCFL 3RP1A 2AJ3A 4R4NC 1UWGH 2G3ZA 4L8SA 3ZGHA 2ESVD 2R4RH 2BIMA 2HPTA 3CFCH 3FTUA 2EZ0D 2F5BH 5EUOA 2IV8A 1UVQB 4TUOB 4U1KA 4JFDE 3STLB 2VSCA 3LHAA 2NTSP 1YEKL 1CGSL 4BUGA 4X6BA 4WI0A 1Z9OA 2VDOL 2CHWA 3GSQA 3TJEL 4NUGL 4PRNA 3WMQA 3GI8H 1KB9J 1MRFL 2Q7NA 2E8ZA 4G42B 1A4KB 3QIUD 3RUGE 4JN1L 4EMZA 3DPDA 5BS0A 1CL7H 1UH2A 2JCCF 3QUXA 4P2QA 3KGTA 2W60A 4NKMA 4RGNC 4U0QB 3APFA 1N18A 3K6DA 2CPUA 1MHHB 3F5WA 3HTLX 2W59A 1JCVA 2BWIA 1ZV9A 4GG6F 4K3DH 4YSUA 2VABB 4P48A 4S1QL 3AADB 4EF3A 4YFEA 3H2PA 5C09A 3KM2A 3GHEL 4LLDB 4QRRB 2WO3B 3JTSB 4E5XA 1QYGH 5MERB 3H9YA 2DQEH 3V0JA 4F8LA 2BSDA 3FUHA 4YEFA 4EI0A 3MRLB 2X4PA 1WFTA 3FQRB 4K7PH 4QKTA 5I19L 3AT8A 4YWGH 1QLEB 3TN0D 1IZJA 2Z4TA 3QC5X 3UERA 3VXME 4BDVB 2C26A 1FVEB 1XIWB 2XG5B 4B9KC 5INCA 1T6WA 1VB9A 1ZS8B 2PPDA 3QG6B 4JR9H 5F2FA 3VMOA 1WT5A 3EYOB 2YQ2A 2RH0A 4EIZC 2EYTB 3GBDA 1J8HD 1GGIL 2FDBP 3AU0A 3DDFA 3MJ9A 2QQNH 3Q8CA 5EZOH 5FGCE 5J11C 4H88L 2X6MA 1A14H 4N1CA 2HB0A 2EE6A 1BG9A 2MQGA 3KPOA 1PX3A 4KY1H 5GZOC 4AOFA 4AEEA 1OCWL 3QEQD 4O2CA 5T1LD 1QD0A 3QCVH 1BBDH 2VL5B 4CVZA 1MCDA 2QPUA 2Q2EB 3HRZA 4GKSB 5AKVA 4R90L 1BLNB 1QBMH 2CIIB 4G8GE 2JCWA 5D7KE 4MXQC 5EIVA 3RWCA 3C2AH 3WS6A 3EG9B 4NN6B 4XNUH 2DQJH 3N85H 1KIUA 2HTKC 3FH8A 4HQQH 3V5DA 5E8DL 4JDTH 4NN5C 4CN6A 3BZ4A 3ZZ1A 4QHMB 4JJ5A 4NI6A 1Q1JH 4UU9A 2FR4B 1X7QA 2EIDA 1WUNT 4ZUWA 2HH0H 2XX1A 1IRAY 2C34A 4TKWA 1C7TA 1D6EB 4LSUL 4QXGL 3P77A 2VSMB 3LQMA 3QNFA 3ZKXB 1JHLL 1RK1B 3QP3A 4TPRL 1KTCA 1PAMA 2KDGA 4XNQB 4OCYH 3TOPA 1RZKL 4B9CA 5A2CA 4LCUB 4KPHL 2VH5L 5D2LF 1WE5A 2IWFA 1F1DA 1QG3A 3AS3A 4MLSA 3SDXF 1AI1L 4JRXE 3WHE0 1T1WA 4YLBA 4LBEB 1KGUA 4I87A 4LKCB 3LZOA 4W9JC 3KVDD 3BMWA 4RX4A 4R97B 2YZ1A 3CFKA 4D0DA 4Q2ZA 2COVD 2ZUSA 3DX1A 3L7FA 3NCJH 4YZFE 1MOEA 3X3FL 2HJLB 5D72L 3K2UH 5ID0A 4YHKL 1FFOA 2QKIC 2Q0ZX 1NFIB 1KN2H 3TBSB 4Z7WB 1N9PA 3RDTB 3M7FB 2CO1A 4AQ8A 2HJKB 3E1ZA 4YK4C 3O8XD 2HVBA 1C08A 1OSPL 4LRIC 1AGFA 1WISA 3GSOA 5DD0H 3AZUA 3KJ4C 4TULL 4PS3A 2VSDA 3S96A 3F64A 5CAYB 2LVCA 5DZJA 4UIMB 4LO9A 4OJEH 5F7DB 4GI9A 1IX2A 1PBYA 1SF5A 5FWQA 3IFNL 3VD0A 2V3DA 2W91A 3NAAH 1GOFA 3U2JA 4HF5H 4PJIF 5HYJE 3V4PA 5BUGA 3APMA 1EJOH 1FYTB 1ED3A 5E2UH 1TZOA 3D3VD 4FHKA 3WEMA 4H5SA 1G1CA 1R24A 2Q2LA 4JM2B 4KK5D 2R51A 3Q06A 5C7ZA 3VFGL 3OKYA 2FJGA 5HJ3A 4XXCC 2HVKB 4XHJD 1WICA 5DWUH 2BY1A 5T3ZE 1SMDA 5IBLD 1M1SA 3E38A 2Q8AL 2X6CA 2W5PA 4IBUA 3O6FA 4JFOA 1C5DB 7TAAA 4KJWD 3WDHA 1KPUA 3KW7A 2X70B 4CVXA 4BH7A 4YDJA 1XXDC 3MJ6A 3NDZE 5F7MC 4JGUA 3BFQG 5JHDB 3TTYA 3WSQL 1M7DA 5B8CB 4EUPH 2RAMA 1G84A 3ZKNC 4NRYB 2VB5A 4H44C 1LWJA 4BH8A 2WLLA 2DWDB 1OP3K 1KCSH 3F05A 1YN7B 4YBQD 1B6UA 1YHPA 3WFDH 4HMEA 2OMZA 3SPJA 3D3VE 1NUFA 4O51B 1F11B 4M7ZB 4B9PA 5KVMC 4UTBA 1HEZB 1FVCA 3HNVH 2Q87A 3GZQA 4NKDA 1R3IH 4ZFFA 5I17A 5C07B 4QRTA 4ANXA 3PS6A 3MRFB 4G5ZL 3MROA 3ZDWA 2ZOLA 4ZXBC 3TF7C 2CJTA 2I60H 5MEPA 2WXOA 3HS9A 1CXIA 3BAKA 2CRYA 3MJ9H 5KBNC 2CBQA 4PHXA 1RUPL 1E27A 4IU2B 1HILB 3IETA 5HHOD 2DS4A 4M8VA 3NCXA 3DJRA 1IARB 5JMOC 1J8RA 2AV7B 5E0QA 3WFEL 3NUKA 1TJMA 4ORZC 4IIQA 1ET8A 5ECGA 2KQNA 5EBGA 2I07A 4F7PB 2IAMD 2BSRB 2LTQC 1UD2A 2YRLA 4RWYH 1KJ2L 1MFEH 1RUQL 3VE0A 4FFYA 3FMGH 1EFXD 2VKXA 3T1WA 4Z7OF 2R23A 1E2ZA 4LFHG 1IMHC 1COBA 1NUDA 2LABA 1OAQL 2GIXA 4KDTA 4M61A 4WCYH 1NGWA 4PUBL 5IMMA 1Z2KA 3QHTC 3Q1EA 2CR3A 1CDHA 3VFVB 1YMMA 4HS6B 5AW0B 5HTSA 4GYBA 2GSIA 2UZYA 3FTZA 1RHFA 1RK0B 4DCQA 2BSCA 2D7PA 2YUWA 1S7WA 3BSZH 3LXBA 1GPOL 1MJJA 5EO1A 2MCAA 4U6HB 1DQDL 3T8MA 4KITB 4Z8FL 3V7MA 3J07A 1PLCA 1A3LH 3PWPB 1A6ZB 1KLUB 2XA8L 4KI1A 1PNDA 3M45A 2PYEE 5C0DA 1SDDB 2NQDA 1T03L 3BP5B 1Z3GL 1CL7I 4XWGH 1EZUA 4R5VA 5HPOA 4OFYD 3RI5F 5I15H 1F6FB 1F90H 1CPUA 2J7LA 5LCVA 5I16A 3BCFA 5BJTA 1U41A 4KRMB 2IQAB 1C1EH 3GYRA 4NGHL 4GG8B 4OGXL 4XVSH 5C1MB 4E9SA 5H94B 3H1ZA 3D39E 2OJ1A 3BH4A 4XNMB 3IMBA 1ZLVH 4FQXB 3HB3B 1H3PL 4HJSA 2EDOA 4NKIH 3FU5A 3OAUH 4F2MA 1ZLWK 3OD3A 3VWJB 3IKKA 3AM8C 1IVLA 5EN2B 2CR0A 4UM8B 1XV8A 2OZ4H 1NFDA 2F54B 3WEAA 4QKXB 4XVUD 2J8UF 3EGXA 1NCJA 1QSFB 1UM6H 1RFDL 4GG6B 4DAGH 2VXSH 3G5YA 5K5YA 1ZXQA 2QADB 4F33A 1MCPL 4HH9A 3CZLA 4M5SA 5KSAD 3DVGB 2JTDA 3SY6A 4WTZG 1IM9A 1QA9A 3AWGA 4JDVA 4R2GB 4WUUB 5EO0B 3PDDA 4QRPA 2B1AH 2VMDA 2QVFB 3OB0K 5G5DA 3F7YA 5IEKB 5ANMB 2R2EA 4BUQA 1JWSA 2VZVA 5HHNA 1CBVL 2HLAA 2RB8A 1U6AL 2NX5D 1TKWB 4QAWA 4NZUL 1UHVA 2FX9H 1KBGL 1XBDA 1ZT7B 2IGFL 2ICCA 4GP4B 1ONQB 3D2TA 3MRPB 1KFGA 1QR4A 5DJXA 4QHLB 1FNGB 3OF6D 3ARRA 3VI4A 2Y5TA 4R4ND 4L1HA 3S9DB 3W39B 3CDZA 4W68A 3F2LA 2QSCL 2WQXA 5C09E 1WA1X 1X5HA 1YNKL 2XPGB 1JTPA 3RA7H 1WZMA 3RX5A 3CDGB 2Z92B 1TOXA 2H2PC 4HULB 3KGSA 1SBSL 1IC5L 1JPFA 3SE3A 4PG2C 1T6VN 4JG5A 2YD0A 5A2BA 4N0UB 1B0WA 1EFQA 1KGYE 3QG7H 4L29A 4PV8B 4RFEA 2UY6B 3ZBMA 4O9HL 2VM3A 1QLFA 3VVVA 3WD5H 2RA1A 4IKKA 3FU6A 1JF5A 3TJPA 3D8MA 4J3TA 4LHQB 3STZA 5JPMA 3B2VL 1JF6A 2K78A 1A6UH 4UT6L 1FLRH 1Z9SB 4RGND 2OQJB 1FL5A 3Q2CA 4I7ZC 2C4FU 2FX7L 4MA1C 3P9WB 4LQFL 3GBNH 4OGYH 2M8XA 1FFNB 4X98B 3NIFF 5EU6D 3EJTA 4L0PB 2BC4A 1DBAH 1IBHA 4L8CA 2MNWA 1NMAL 2E9BA 5D2LB 1E4XH 4PY8J 2OTWB 4MS6A 1D2PA 2K6WA 1P9MC 4U6VL 3TYGH 4P46B 3L6FA 1NKRA 2EECA 2B77A 1USZA 2DQFA 3EZ8A 2GJ6D 4JHWL 3OLGA 3E8UH 4DETA 5JOPE 5CJBA 4PVNA 3MV9D 3RZWA 3ULAB 2IDCA 2K7QA 2QVMA 5AW1B 3UYRL 4YQXL 2OK0H 2YRBA