1IUZA

Plastocyanin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
98
structure length
98
Chain Sequence
AQIVKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETVVRKLSTPGVYGVYCEPHAGAGMKMTITVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel insight into the copper-ligand geometry in the crystal structure of Ulva pertusa plastocyanin at 1.6-A resolution. Structural basis for regulation of the copper site by residue 88.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 23
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1996-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1iuzA00
5B1JC 3ABKB 1BYOA 2BHFA 1OOWA 4KNUA 4E9VA 3UABA 1QNIA 3S3CB 1V10A 1WA0X 1CURA 3JT2A 2YAPA 1AAJA 1PLCA 4G70B 1TKWA 1MDAA 1NZRA 2MTAA 4GXFA 2BZCA 4DPCX 4JKNA 1X9RA 3QJQB 4YSOA 3AG1B 1NIAA 3NJNA 4HAKA 1IUZA 1CUOA 2TSAA 1SHXA 2VN3A 1AZRA 2H47C 2IDTA 1ZPUA 1RKRA 2XV0A 3D12B 4AKQA 4FA7B 1F56A 1BQRA 4HCGA 1V54B 3CG8A 5E9NA 2XLLA 2FT6A 3SBRA 1GS8A 2IDSA 1AZCA 1GR7A 2GB2A 1XB3A 2XUWA 1B3IA 4GP8B 5D4IA 2FT7A 3H4HA 5I28A 1NWPA 2IWFA 2DYSB 3FU9A 3NJIA 1JZEA 1SF3A 2VSMB 4E9WA 3ABLB 1NIDA 1ASOA 1JZHA 1AZUA 5B1KA 4DP6X 4QLWA 2AZUA 3NT0A 1OV8A 1KDJA 4DP7X 1JXDA 2FQDA 1ZIBA 3FPXA 3JTBA 3SQRA 2PP9A 4F7KA 1E65A 4A2DA 1QLEB 1KYAA 1J5CA 1PLAA 2FT8A 3FU7A 5AFAA 5IY5B 4BWTA 2ZONA 2RACA 2QDWA 3FYEB 3X1FA 4DP5X 4KOCA 3GYRA 1SDDA 8PAZA 2A3TA 4E9QA 1ZV2A 1ILSA 4TXVB 4AKOA 3X2QB 4AX3A 1OE2A 4M4RB 4ZK8A 1AIZA 3S8GB 2BW4A 3TA4D 2J56A 1EZLA 3TBBA 1W6LA 2OJ1A 7PAZA 2R7EA 3NJLA 2GIMA 4KO6A 1L9QA 1A4BA 4KO7A 2EINB 1OCOB 2HXAA 2AANA 2BP0B 3X1EA 4ENZA 1DYZA 2QPDB 3QQXA 3T71A 2FQGA 4F2EA 4A67A 2QT6A 3MBWB 4E9RA 1ZDSA 2FWLB 2VM3A 1SDDB 2QDVA 3BQVA 4YSEA 2PCYA 1TU2A 1OCCB 3OQRA 1A8ZA 1AG6A 2AFNA 5I6LA 1L9PA 1T5KA 3NSCA 4HALA 2PCFA 3DKHA 4QKTA 4W1TA 5I26A 3EH5B 5I5MA 3IE9A 3ZX1A 3QJUB 1WS7A 1BQKA 1MZZA 3C75A 3U25A 3FPYA 4KOBA 2I7OA 3L45A 3V9CA 3ZBMA 1OCRB 2YAFA 4G7QB 2AZAA 2UX7A 1ZIAA 2HRGA 3DTUB 3NJHA 2B08A 1J5DA 3IN0A 3WNIA 1AS6A 4UAHA 1ET7A 1SJMA 2FJSA 1A4AA 1GS6X 3AG4B 1E5YA 1JZJA 1W6WA 4JHVA 2XXGA 1ILUA 3TU6A 2BP8B 2HZHA 2ZWNA 3FQ1A 2H5UA 2IDFA 4AZUA 1E5ZA 1M9WA 1AOZA 4WKXA 5I5JA 2VM4A 4Q89A 1NIBA 1X9UA 3SBQA 1IC0A 3NSFA 5TK4A 3AG2B 1ASPA 1BYPA 3UAAA 4YVNA 4E9YA 1KDIA 2VW4A 5B7MA 2BO0A 4YSTA 2BP0A 4HHGA 4F2FA 3NYKA 1HAUA 1JVLA 5PAZA 3WI9A 3WKQA 3ASOB 1KGYE 5F7BA 3PXLA 1V55B 2FQEA 1PLBA 3AW5A 1NDTA 1TEGA 1M57B 2HLEB 4RH4A 3UGEA 1AQ8A 4BDVB 4YSSA 3FSAA 1BXVA 1SNRA 5B7EA 5I6MA 1PZAA 3QJVB 3HB3B 2HX9A 1KBVA 2YAEA 1GY2A 2IWKA 5AZUA 2UX6A 1GSKA 2XV2A 3FS9A 3S3DB 4BXSV 4YSCA 2LLNA 5A7EA 4WTQA 2BWIA 3NP4A 4BDVA 2XYBA 2PPAA 1NINA 3T6VA 4BXVA 5B1AB 2PPFA 1BEXA 3OMNB 3WIAA 3CVDA 1MG3C 4DP2X 2DWSA 2HX8A 1ZDQA 4G71B 4A68A 3FSZA 3QJTB 4KO9A 2QPEB 1JZGA 2P80D 2PPEA 2FNWA 4HCFA 1BXAA 4CSPA 2X88A 1L9RA 1NWOA 1WA2X 1AZBA 1JERA 1JVOA 5I6KA 2BWDA 2I7SA 1A65A 3WNJA 4UANA 2FTAA 5B7FA 1QHQA 2VW7A 1YLBB 5PCYA 2GC4C 5I5IA 1GY1A 2CAKA 3NJGA 4NERA 3FSWA 1AS8A 1CYWA 4DPBX 2WO2B 4CSZA 3GDCA 1SF5A 3WG7B 3PAVA 3SBPA 1OCZB 6PAZA 2YAQA 3AZUA 4GP4B 4G7SB 2WSDA 4DP4X 2YXVA 3ERXA 1FFTB 2IAAC 1KBWA 4YSAA 9PCYA 3IEAA 2YQBA 5ANHA 3PAZA 4YSDA 3GXUB 1L9OA 1XMEB 1JXFA 4L0PB 4P5SA 2CUAA 4E9TA 5F7AA 2PP8A 4UF7C 5I6OA 1JZIA 2GI0A 1KCBA 1RZPA 3NSYA 3IBOA 1ET5A 1N68A 5I6NA 1CYXA 1R1CA 1SHWA 4DP8X 1L9SA 3HEIB 3TBCA 1GW0A 1JZFA 3T9WA 2EIJB 1DZ0A 2DV6A 3QJSB 4AKPA 3ZDWA 5TK2A 1NPNA 2CALA 3CDZB 4Q8BA 3DIVA 5B3SB 2JKWA 7PCYA 2UXVA 1GYCA 3EH3B 3H56A 4YSUA 4JHUA 3CZUB 2BP8A 1NTDA 4GP5B 3QJRB 2GSMB 1WS8A 2GBAA 3QPKA 4YVUA 2PP7A 3S3BB 2WO3B 2N0MA 3CVCA 3X1NA 3ABGA 2IWEA 1AZNA 2EIMB 2P80A 1SFDA 1CC3A 2R7EB 1MG2C 5D4JA 2PLTA 2TSBA 2IH8A 1IBYA 3H4FA 2OV0A 1PMYA 2UXGA 2GC7C 1GS7A 3UACA 1M56B 3OM3B 2Y1AA 2Q5BA 2IDUA 4KO5A 2ZOOA 4N4YB 3X1BA 1AR1B 1BXUA 1ETJA 3EHBB 5FC9A 1URIA 4DPAX 2UXFA 3CDZA 1AG0A 4GYBA 4YSPA 4BK5C 1XB6A 3FU7B 2J55A 2Y69B 5B1JA 1AACA 2UXTA 2MRYA 2PPCA 3CVBA 4DP1X 1IBZA 1E67A 4FAAB 3T6ZA 2EIKB 3ASNB 3PLYA 3KW7A 1ADWA 4YSQA 1J9SA 2YAOA 1TEFA 4K9JA 5I6PA 1OE1A 3UAEA 3FU8A 1W8EA 4BWWA 1RCYA 3MX0B 1XB8A 3NJMA 1I53A 1HFUA 4N8UA 1EHKB 1A3ZA 1JXGA 2XX1A 1RZQA 3PCYA 3FQYA 4PCYA 1PZBA 2XVBA 4GY4A 4YL4A 1J9TA 2XWZA 3S8FB 1IKOP 1PNDA 6PCYA 1AANA 3NJFA 1PZCA 4HCIA 2W8CA 1JOIA 3EH4B 2CJ3A 2E86A 3OD3A 4NAJA 2IDQA 4P5RA 2B3IA 3G5WA 2X87A 1NIEA 3NJJA 3NP3A 2H3XC 1PNCA 1ID2A 3OMAB 1AS7A 3T6XA 1NICA 3FT0A 1MZYA 3UADA 4AI7A 2I85A 2YXWA 3NSDA 5LDUA 4M3HA 1KV7A 3AY2A 1VLXA 2XXFA 1J9RA 2VMJA 4MFHA 4G7RB 2CCWA 2FQFA 2BZ7A 1L9TA 2DY2A 3KW8A 4G72B 5EHFA 2ZXWB 3NJKA 1NIFA 4YSRA 3PAUA 1N70A 3FSVA 1UATA 2IH9A 2XX0A 1FA4A 1ASQA 4E9XA 2HX7A 1OE3A 4DP9X 4KNTA 4HHWA 3V9EA 2J5WA 2Q9OA 3PPSA 3WKPA 3N55A 4A66A 1NPJA 3AG3B 3EF4A 3ABMB 1OF0A 1E30A 3OMIB 4A2FA 1A4CA 4A2HA 1BAWA 2BW5A 2OCCB 5B1BB 3ZIYA 3IN2A 4A2EA 4W9ZA 1FWXA 5D4HA 4X4KA 1ET8A 4HIPA 2VW6A 1SFHA 2AVFA 4NB7A 3BVDB 2XV3A 2W88A 2JFCA 2YAHA 3RYMA 4PAZA 1HAWA 1KCWA 2XU9A 3X1GA 2JXMA 5AKRA 2NRDA 2YARA 2VSKB 4A2GA 1PF3A 3TASA 2J57A 1WA1X 4HZ1A 3FQ2A 1WAEA 1PCSA 4EF3A 4DP0X 2DYRB 2CBPA 1PAZA 2DWTA 4BWUA 4KNSA 2EILB 3FYIB 3N2JA 2GHZA 3T6WA 4E9SA 2YAMA 1BQ5A 2PPDA 1PY0A 2HRHA 1J9QA
chains in the Genus database with same CATH superfamily
2CO6A 3CU1A 1AI1L 2VIRB 4Z7VE 5T1KA 1JHTB 7TAAA 1MHEA 3ISWA 3NFNB 1MIMH 3ZK0A 3QHFH 4XHJC 5L2JB 3HG1E 4WI0B 3HE7D 4OF5A 3BLKA 2WTOA 2V3EA 5HHQA 5EU7E 3A67H 4N22A 3ZVVA 5FOJA 2HJKB 1BW8A 3BGAA 4W4OA 5FO7B 3BSZL 1JZ2A 4HQQH 3BWSA 3HPLB 4AM0B 5CSZA 1IT9H 1NCGA 3EJZD 3D4GA 4LNVA 2P24A 1BLNB 1NGQL 3IGAB 5HGHB 2G3XA 2IDTA 2ZSVA 1A5FL 2NQDA 1LO4L 5IJCC 3MV9B 1FFNB 3CG8A 4HX1A 4WHCA 2NT0A 3BZ4A 2XLLA 3VQ2C 5EN2A 3PGCB 3ZL2A 1LMKA 2PABA 2X4SA 1JV5B 3ESNA 3RHWK 1K2DA 2RCSH 1CFNB 1XB3A 3HPJA 1TVBA 4PJGB 5GXBB 3TYFA 1Q9WA 2FO1A 5E8EB 4LLQB 5IJVA 1BPVA 1I1AD 2D0HA 2GABA 4CC0A 5AKVA 1IAMA 4FG4A 3RUGF 4BZ1H 4JM2F 4PP1C 1VGEH 2EDKA 2Z7ZA 2X7LA 1OCWL 4KQ0A 1KB5L 2DQGL 4G7VL 1T20B 4EUPG 3VMOA 3V0IA 3V4VL 5TQ0H 2MOVA 3Q5YA 5BMFL 1HL9A 3KPRD 4FXKA 1L7TH 2JK5B 4A2DA 3BO8B 4F93B 1XGPA 4N90E 3MRNB 1ACXA 1Y0LB 1QBLL 2BERA 3QORC 1WGVA 4N68A 1JRHI 2DYPA 2E47A 4X6DF 2AGJL 1HU8A 1MIML 2QQNH 4NWUH 3IDNB 4I1RA 5IB2A 1GZHC 1NGZA 1AI1H 3M7OA 1JGUH 1F42A 1PQZA 5DJ8A 1DVUA 3H9SD 4Q6IB 5E4IA 2HRLA 3QORB 4OLWH 4OLVL 3VDBA 3B83A 1J8HA 3ZGIA 3RGVD 3E2HB 2FBRA 3D18A 1AIZA 5IF0B 1XR9A 1Q0YH 3U4EB 2ESVE 4KY1H 5E8OA 4HULB 2HWZH 4K9EH 4BA0A 3IJEB 3C6LD 2WWOA 3V7MA 4ZPTA 3WMQA 2NT1A 2BCKA 2W65B 3QT2A 5D1XA 4BFOA 1CL7L 3O11B 3QGVA 5C1MB 1EZSA 3E8VA 1N5YH 3VYPA 1DQKA 2I07B 3H1ZA 1TZGL 4KROD 4KK8C 3BZ5A 4Y1AB 5GGTH 4G5AA 4MVBD 5TJWK 3TO2A 2HXAA 1CI3M 1IBGL 3DSFH 2BOLA 3GPEA 1GZQB 4A63A 5KEZA 1IGCL 2Y23A 5TD4A 3TT1H 1WVZA 4OLUH 5FHAH 1WT5C 1HWGB 4LSVL 2ZUSA 4D3CL 1YRKA 43CAA 3GNMH 4LPXA 3OZKA 4PJ8A 3CSYB 4FJ6A 1DFXA 3LEXB 2FO8A 2WNXA 3VFPB 5EC1A 3GIVB 1T03H 2AJVL 3NIGE 4JHAL 4NQEA 3VM7A 5ISZB 1WO2A 3F5WB 1NL0H 3HRZB 3NDZE 3EJQA 5CP7A 1W8OA 1H6FA 3IMUA 1FZOA 5KSVB 3BGMB 3EH5B 4XMKH 3PWVB 4OCWL 2R2HB 5DJYB 2CLRB 2UX7A 2I60L 4X6BB 5J4MA 2FZ3A 4PTUB 2C9XA 4X9FA 2BSTB 3I6LD 1AS6A 1JF5A 2WVSA 4XH2B 4G9FA 1A4AA 2AJXL 1JZJA 1YAZA 3LEYL 3RWFA 2VLRB 4L8SC 5IR1B 2DJUA 3O9WC 5HHNA 3VSVA 1ILUA 2GJZB 4XCNB 4JB9H 4QTIH 2ZWNA 2EXWD 3BSZH 4MJIE 4YIQA 1NEZA 3PWNB 4PI2A 1ZHBB 5DRNB 3DLQR 5I5JA 3SDXE 5FYJE 1VHPA 2IOIA 1K72A 3S35H 5H37G 1JSYA 5BVPL 4YE0A 3KWWA 4G8GD 2KL6A 1U8CB 1DQJA 1EGJL 1T2JA 2C7UB 3KNBB 4P05A 3U1PA 4PLNC 5M94B 3SGKC 4WUKL 1Q0XL 5D71H 5IMOB 4DVRH 1LL1A 3A24A 2P5WD 4CN1A 4Z18A 5AVVB 3DGDA 2FHCA 2HTKD 4X9HA 3JWNH 2GT9A 2CIKA 2IPKB 3F05A 4UNTA 5JW4R 4UQAA 5D2LB 2KI6A 5H37A 3RZWA 1L0PA 3EXLA 3STBA 4ZMZA 3IAGC 2A0LD 3FB5A 4HDIA 3DRQB 2CGRH 3FQXA 3QH3A 3DYOA 3QORA 1ZTXL 3PUCA 5C97A 5KW9H 1B88A 5BOZG 4NXKA 1A6WL 1G7HA 3H3PH 4ZSOB 4RSYA 4NZ8A 1EO5A 1ITBB 3QJVB 3QJZA 3NABH 4H13C 2NDGA 3T0XA 4OLZL 4JKMA 3GTTA 4NUJB 2LLLA 5EZOH 4JZJB 5AZ2L 1CQYA 1HDMB 4F1SA 4BDVA 2XYBA 3UTZA 1FNHA 4D7PA 3VFMB 1KCRL 4GAYB 5JR1H 5HGDB 3G6JA 2BVQA 2OMTA 3NIDB 2Y3AA 3CUPA 4NKOA 3QC6X 3X12A 4PJ5E 1MG3C 2CMRL 4BEIA 4YQXL 3FSZA 4WSKA 3HOGA 1PY4A 4KO9A 4ZS6D 5EUKB 4Z5RA 4RAVA 5JUEL 3CMOH 1R3HA 1J12A 3W1ZA 5T5FL 5HD8C 4PJCB 1R3IH 4MSWB 3X13A 1LO0L 2Z7WA 5MENE 1Z5LB 2ENJA 4WY7L 5FGBC 3BD3A 3VWKB 1MCWW 4YHZH 4J39A 1A25A 2H4EA 5ESVA 3L5WB 3V6BR 3VGFA 2R15A 5KSAD 3U4BH 4EXKA 1G43A 3QUMA 1NFKA 4M1DL 3UTTD 3FOLA 3F7VB 1NANI 2NY6D 5E5UB 3PAVA 3SBPA 3R0NA 4EI6B 3CSTA 4IJ3B 3KDMA 5DRWB 4BKLB 2H0FA 3HS0C 5GRJH 3IMRA 3SDAD 4DK5A 1KOAA 3D09A 4NKIL 3HC3H 3O8XD 4RIRA 4A04A 2E7HA 3EXJA 1QR1A 4MTMA 1N12A 2FZ3B 1MEXH 3GD1C 1SLWA 2WZPD 1QP1A 2GCYB 4WI7A 5CU9A 3JSSA 4YSDA 5I6XC 5MEND 2FAUA 1VB9A 4E9TA 2UYLA 3CDFA 3MV01 1N59B 2GI0A 1TNNA 3D2UD 4GW4B 1KCBA 2A9CA 3VJ6A 3GSUB 3D85A 5FGCE 5ESAB 2YQGA 4XR8C 5I6NA 2KZBA 5F9AC 2D7TH 4MWFA 4DP8X 5LNDA 2J72A 2VN5A 1R19A 1QVOA 4AE1A 2OI9C 2E6PA 4HUCA 3WDHA 1NOLA 2WC7A 4M3KB 3NIFB 1KELH 4OZIA 4MA7L 5I74C 4G5ZL 4Y4HD 4J3OF 4K2UL 5F7LB 4MCYA 4QXTA 1HILA 2C1PA 1VIWA 3C5ZD 3EH2A 1P1ZA 5JA9A 3IDYC 1WZMA 4HD9A 4LKCA 5MHSE 2OULB 2NW3B 4JKPH 2CKBH 3TC9A 2OK0L 4IBZA 3ML8A 1MJ8L 2HLFD 4U0RC 1OARL 3CVCA 3APMA 5BZWB 5AAWC 3FT3A 4L8BA 3K46A 1WFJA 2VZTA 1H3VA 2GBTA 2AV7A 1M05B 4JY5H 3FZUC 5J3HD 4YHPB 1AE6H 2R7EB 3AB0C 1DSYA 3R7QA 1L5GB 1QTSA 3C5SB 2HTKC 3WS6A 2VAAA 3EGDA 3QUXC 4XPAH 3TIEA 5I0WA 4C4UA 1RVFH 4MDJA 1RMFH 4XMPH 1H8OA 3ZDZB 3V0WL 3QCTH 5IJVB 5GJSL 1TCRA 1KPVB 1FG9C 5EH1A 1TNMA 2CMRH 1HSAA 1AY1H 1SEBA 4KPHH 3FH5A 5I8OH 1BXUA 2DTML 5D1QC 4PGBA 3ECBB 1MF2L 2K7PA 4XZUA 4ZFGL 2H32H 3FF7A 4PIRF 1UA6L 4PRPB 1XB6A 3S48A 5EU6E 4XMXA 2J55A 4YE4L 1T66D 2MQ0A 3LKQA 3BP4B 3L9BA 4NQED 3NABL 5DO2C 3VXUB 1HE7A 3H6JA 4HH8A 1RU9H 2EDRA 1XGPB 5DHVB 5F7FA 1OLZA 3V6OE 4EIBA 1CI5A 1CT8A 3EGSB 3UX9B 1U92B 5D7JA 5HGBB 2J4WL 2WTRA 2KQMA 3LYRA 3VWKA 5I30L 2V17H 2UVFA 3HZKA 5KYXB 4IRZL 1R17A 1I53A 1U3JA 2HN7A 3NTCL 4N0RA 3T3ME 2GIXA 1INEH 2G9KA 1JVKA 2XX1A 3VTAA 3INUH 4DWHA 3DX7B 5ILTH 2IXQB 4HZLA 4IIQC 4F37K 4L4VD 4NSKA 1DQVA 3WHE0 1RJZA 4PJBE 3PWNA 1XZ0B 1WBXB 4TTGA 1AANA 1T7ZA 4YHNA 2M26A 4U2YA 4HD5A 4LARH 2NYYC 3QIUD 1UB6A 3S7GA 5L8JB 3NCYP 2B4CC 1ESOA 1DUZB 3D39E 5JW5B 3EJYD 4JM2C 4Y1AA 5LXGL 1HI6B 2VE6A 1AD0A 2HT3C 2MJWA 1Z9PA 3MV9D 4W9EC 5AL8A 5F1IB 5BQ7B 5LDUA 1YNLL 3O6LL 4ZD3L 3NAAH 1YYMH 3T5WA 3U6XS 5SX5H 4MHHG 3RG1C 4HSAC 3QG7L 4MWFB 5DYOB 3VFWA 1XH1A 4G7RB 1SM3L 2CCWA 3BPNC 2B3RA 1ADQA 3VFGL 2CK0H 1OQOA 3KHOA 4OZHA 3DBXA 3PV6A 3UPRA 3HZYA 5I8EB 4Z7QE 5ID1A 1MJJB 2XVGA 2IGFL 4PIBA 2OMVB 2L0DA 2VRKA 2AQPA 3F7LA 3GZQA 2Z91A 3HI5L 5ITFB 4ECNA 3TFKC 5F97E 1FA4A 2HX7A 3TCTA 4QO1A 3MKKA 3IWUA 5IB2B 1CZ8H 3LRGA 1C5BL 3MRFB 5C6TH 2COQA 4R4ND 5AZEH 3R0MA 1RZKC 3IDYB 2ENSA 5DC0A 2WLNA 1KTJA 1E30A 3D7PA 5IQOA 1NMCC 4K3JH 1JF6A 1G9MH 2A74A 2VMCA 3DJRA 4R4FH 5HYQB 2EVFA 3SPIA 2G0KA 3M1BA 1XIWC 4OVVA 4RMRA 2FNBA 3UTTB 2DEWX 4Y2OA 1NFAA 3WFHB 5F1NA 4C56D 4V2CB 4UZGA 1IKFH 5GS1C 4E41B 4M7KH 5AWNH 1TSHA 5F7NC 1U2HA 5FM5M 3KS0J 3KPRE 5DFVC 2VISA 4XVUD 1H6UA 2MEJB 2LW3A 5FO7A 2I69A 2Y06L 4XRCB 2WBJA 3OKOA 4FQ2H 2K4AA 4S1QL 1BFSA 3QEHB 2BRRL 4YX2H 5DYFA 4DP0X 1WZAA 2DYRB 1XGQB 3IDGA 5KBNC 15C8H 4LF3B 5EU3A 4G80B 3D0VB 4P2AA 4KZEH 4XMWA 2GI7A 3SDXA 5A7BA 4OI8A 5EN2B 2ZWLT 1AGEB 4PJ8B 4RIRB 3B5GA 2YA2A 2KQNA 3FO2B 4BUQA 3SPGA 4N2CA 1GYUA 1NA8A 3ROOA 3B2PA 3O6KL 5E0QA 3G5XA 2MPAH 5J8OA 3BP7A 2JJTA 4P57A 5A43C 1GRWA 1F45A 4ZZKA 1MI5D 3JT2A 5E6IB 2NXYB 1AAJA 4WWOA 1IAOA 1D5BB 1NZRA 2HT3D 3S6CA 3V4LA 2P46B 1O6TA 1R3LB 2L7EA 3EYOA 5FUCE 4DPCX 3D2UA 3ES6A 3GBEA 1M2VA 5LHDA 2D9QB 3CAFA 5EZIH 5HSFA 4M6NH 1ICTA 3HE6A 4RETB 4B9PA 1KPRA 2FHFA 5KOVC 5JO5A 2BMKB 3EIFA 3ZZSA 2P1YA 4PJ5A 4IGBA 3IAQA 2QQLL 5DLLA 3LQAL 5IKCA 3PV7A 2XQYK 1BQRA 2O5ZL 3H7BA 2NY3C 3TO4A 3IMBA 1MLBB 1RH8A 3P9LA 4XP9H 1YMMB 4MS8C 1E9QA 1KBPA 3GJFH 4U0RB 5KTEH 1PX3A 2PO6D 4YIQB 5GRVK 2E7CA 1ZANL 3EFDH 3Q6FB 3HR5A 4GP8B 1NLBL 4HIQA 5IV2A 3FJTA 1JJUA 1EEUA 4OSUL 1NBVH 1VEMA 2WUCH 1ND0B 1P84J 3RWEB 3CFCL 4OY9A 2VSMB 1S9XA 5CD5C 5EDSA 3BVTA 5CSZB 1CTOA 2DQJH 2ADIB 5EIQA 3C6SB 3NGBB 3LMJL 4H8UA 4HKZB 2DKSA 1U8NA 1AR2A 1U41A 4HEPG 1PZ5A 4M5YH 4W9GC 1MNUH 5LXVA 3HS9A 1A6PA 2KLRA 4LVHC 3E9UA 5D9SA 3LNGA 4XPFL 5DURB 3L17A 3M8OL 2H8PB 4RDBA 4D9RD 2AXGB 2RACA 3DTDA 2O4EA 3GXTA 3QUZB 5F6HI 4ONHA 4AVKA 5EEVA 3SBWC 4KHXH 4QRRE 2OPCA 3PJNA 5EC1B 3LXAA 1Q72L 4JZJA 4JS7A 4AX3A 1FIEA 2AQRA 1CPUA 1T83C 1JTPA 3GKWL 4V1DA 1OT1A 3O6FC 4NN7B 4G1MA 1GAFL 2XKUA 2WBJB 4WI3A 2E4TA 2UY7A 5LKNA 3MA7B 1JYVA 3T77A 3DX7A 3BDYL 1B0GA 3RKDD 1QFWM 1W6LA 3L9YA 5DGRA 4ERSL 1USZA 5D7IF 2XKNB 5ADOH 2X4TA 4HJGA 1T0MA 3GBNL 2OX5A 3PWPA 4RWHA 2J1ZA 4PBVC 4PB0L 2I24N 4L0ZA 4B97A 1FSKB 1W2KT 4H2AA 3S96A 4TVPE 1GHFH 1I4FA 5CCHE 3S5LG 3C6LB 1WAAF 4FQHB 4EIUA 1KB5A 3HRZC 2AF2A 5FYLL 3VXSD 5HHNB 1UXWA 1JDCA 4WI5A 4HUUA 1YEDB 1JN6A 3A47A 3BZFB 3WFCL 1ZDSA 5DRNA 3TA3C 3KG5A 3GJFA 4P2OC 1IJ9A 4NHUB 1G1OA 4XCCL 3CK0H 2WPGA 3OQRA 2CUHA 2PWFA 2K1MA 4G6MH 5K69A 3K81A 3PV6B 4LESA 3UPRB 1N3NA 4LASH 2EDEA 2EDXA 4A38A 2WLIA 2XCMC 4ZTOH 3FPYA 1RULH 2UYLB 2V5MA 1WPCA 4XNUL 4O02A 1B90A 1J0IA 2WY3B 2VN6A 2P26A 3LRHA 1WFUA 1AXTH 2YPKA 3Q06A 1DBBH 3IN0A 2VLMD 5CJBA 4J8QA 4N2LA 3FQNA 5KUKA 1QQDB 1D6VL 3PQYE 1ZXKA 1A2YA 1P5UA 4Q9CA 4GW1B 4YC2C 3IMTA 3PDDA 2X0VA 3L54A 3UTTA 2PO6B 3EUDA 3O4LE 1LDSA 2CM6A 3P4LA 3FQ1A 2JKLA 1E5ZA 4FNQA 4MS6A 4RMWA 5AALA 5EOCJ 4NLHA 1UXSA 2A6DA 3CC5A 4JFDD 3REVB 4DEWA 1GZPA 3DUUB 3NSFA 2AK1L 3LHPL 4ODXB 4GRLA 3QEHA 4O58L 3ULUE 4K5LA 4UBDC 4LBEA 4AEEA 4FXGA 4HCRL 4N0UE 4F2FA 1G1YA 3BFQG 3QIWB 3DUSA 4NIYE 1A3LH 2FBOJ 3TIEB 2VLJB 1I82A 1JK9B 5F6IB 1ZA3A 4U3CA 1NDTA 1TEGA 3DX2A 2IJ0C 2R4SL 2VITA 2F5BL 1TPXB 3STLB 4RGND 4CVZA 3FQTB 4JREC 1NEZB 3FT2A 2W0KA 5I6MA 3MJ9A 2IANE 3RVWD 3RVVD 3VXRD 4KC3B 5I8OL 3VDCA 2HX9A 1O9WA 4PREB 2WBWB 3JVGA 2NNAB 5IGXL 2DL9A 4JDTH 2ZUQB 2Y7QB 3WMPA 2OMVA 3DUHA 4O9HL 2L7JA 2B14A 2BFVL 3GI8H 5IGXH 2QFRA 1S7XB 1T1XA 2K6YA 2R56H 5I19H 4J6RL 4JQXA 2E76C 2N01B 3ELQA 4NRZA 1I4FB 3SHSA 1EPFA 2FIKA 2PR9A 1P1VA 4KK8D 3X14B 3ZGHA 5ICZA 4HCFA 3WE1A 5CLXA 1BZQK 1F2QA 3SYOA 3AM8A 3SJVB 1KIPB 2OMYA 2IG2L 1A65A 3WTXA 2IBBA 3L4TA 4PRNB 2OZ4A 2EVIA 5B7FA 2XT1B 3L3OB 4NQEE 1IGJA 1K8DB 2JQAA 4OGQC 4CVXA 1HCVA 5LGJB 3MLSH 3FSWA 3QNYB 2F18A 4LSTH 1CYWA 5E4AA 5BO1H 4NKMB 2WWMC 4HWZB 4X99A 4H0LC 3O2DA 3KJ6L 4HIEA 3WKMH 5FFOA 4ZUSB 2WSPA 1C16A 1J1XH 3ARDD 3TVMA 3BUYA 3W9EA 4JFYA 2Y7LA 5DHXB 4F7CA 2AK4E 2CQVA 2CGZA 5GGSB 1RURL 1JHKH 3OGCA 3QWRD 4YSAA 3QHZH 2WYTA 4N2GA 1QD0A 1BOYA 4L3FA 5TFSL 1J88A 4L0PB 5FV2A 2YBGA 4LOUD 5I6OA 3L2NA 1SXSA 4EZLA 2AV1B 5C7XH 3GMQB 3G5XB 1KTDA 2J8UF 5GGRB 1CIDA 3CQFA 1ORSB 5D1ZA 5C3LD 2DV6A 1P5UC 4P2OA 4KKPA 4XP4H 4Z0XB 4L48A 1BBJA 1NEZG 1X9LA 1RUML 4HKJB 2VLKB 5GSVA 4QRQB 5JIDA 3CNKA 3CXHK 4XBPB 2CGYA 4HUWB 4J3OH 4TKWA 3CZEA 1FPTL 1R5IB 2YUZA 2IQ9L 3APDA 1T0NA 4Y1AD 4LKXB 5K1JA 1S9WA 3UROR 2DBLL 4K7PL 1MFEL 1RZ8B 3FCTB 2E27L 3L16A 1EAQA 2PTTB 3QDJA 1F6AB 4EI5B 4DN3H 2IH8A 4UB0L 4KRPC 3PY9A 1FIGH 1YA5A 1QEWB 3BKML 3D9AH 3LB6C 2ICES 1TQCB 2VLRE 4MNGA 3OL2A 1ZVSA 4LKCB 4BFIA 1YJDC 5C71A 5AVWB 3VFOB 3D9AL 1JZ3A 1KYDA 4JG9A 3T0VA 2BCMA 4JFXA 3VSQA 32C2B 3QSKB 5JIKA 2NNFA 3IMWA 5E4OA 4NHCH 1ZTXH 2IMMA 2X5PA 3FMGH 3O2DH 2WUBH 2G60H 2R4SH 3N1FC 1B4TA 1UD5A 3QWNA 2OQJB 4A6YH 3B4NA 5MEPB 3CFIC 4JGNA 1F18A 3JT0A 4KKAD 1DSWA 4LEXL 4N85A 1YNKH 4JHBA 1J9SA 2A0LC 3PREA 1MFUA 5EBMA 2L7QA 1Q4NX 3HE7A 4LSUL 3BRDA 1W72B 5D71L 4N2EA 3NJMA 5L2JA 1T89A 2QKIA 3GMRB 1EHKB 3PWLA 3KYMA 4GAGL 1D5MA 1ZE3C 2NY2C 3IFLH 2CXGA 3E8UH 4PCYA 1IEAA 1IQDA 3AY4C 2AXJA 5AAPA 4ZUSA 6FABH 3DIFA 2W07A 3BP4A 1QI5A 5FF6A 2QKSA 4M6MH 3R06B 2G5UA 1NAML 2SODB 4MD5B 5GRVL 4DKFH 3MXWL 3KPMA 3TO4C 1Z9NA 4F37F 3TBYB 1T2XA 2OMWB 1J8SA 5IFJB 4MRCA 3VI4F 1EJ6A 5EU4B 4EEEA 1TJHH 1UWGL 3HLKA 1OL0A 3BH4A 4RISH 3QQ9D 1S5IL 1EEYB 2GJ6D 4YXHH 3GMQA 4LHQB 1CLYL 5B38B 4Y19B 2ZXBA 3H2PA 4HEME 1TZOA 1XHHA 4YEEA 1HSBB 3CBRA 5DSCA 3T4AB 1LO3L 5I0VA 3GC3A 2ZCZA 4G59C 4JRYA 3GBDA 2HT4D 4Q2ZB 1BVOA 1JXKA 2W0LA 4POYA 1WLHA 2QSTA 4MAUH 1T03L 4DP9X 4IGBD 5JZ7C 3GI9H 4QCIA 1JI1A 2MCMA 2XPYA 5ACZA 2O30A 3W11C 3CZFA 4LL9A 2A9BA 4MMZB 2XFXB 1JNLH 3ALXA 4MJHA 3H9SA 1QI3A 3QYCA 3HE6C 2YGPA 3O8XA 3F7RA 4YDVA 1RUKH 4XCEA 4WW2C 3KWXA 2GBVA 2Z4TA 1KXTA 4OZFB 5I1LA 2WZPA 4HWEH 5B3JE 5JHAA 1JF1B 1OO2A 4ENEC 4NB7A 1A2YB 4UTCA 1T80A 2P24B 3BSGA 1T6VN 3CD4A 2X2YA 3EJJX 3V4VB 4H20L 4GRMA 4APXB 3K72B 3S3SA 3GSRB 5BRPA 2IQAB 2A6IB 2NRDA 3II2A 4N2DA 3UYPA 3FB7A 2FX9L 3B9KA 3NK4A 4JFTA 3WJJC 2J57A 2EDYA 4M7JL 5L8LB 4AEIH 4PRHA 4X4XB 5KBMA 2IEPA 2IIJA 4XC3H 5E6YA 3TP4A 2BRRH 1CFNA 2NR6D 4TQ8A 4XPGH 5AB2A 4PJHE 3U2JA 1T3FA 4U6VL 5A6LA 4HP5A 4DEUA 2F15A 4P9HC 3KEDA 4D0BA 1YMMA 2IGLA 1JGEA 4HIJB 5F96L 1UZ8A 2G2NA 3UYRL 1XGYL 4N3TA 5DWUH 4NHUA 3QZLA 4ODBD 5E99L 3N42B 5LGKA 4E9VA 1E6OL 4I0PC 4NFBA 3SE8H 3OB0H 4CVZB 3GMRA 3MV7A 4OM1H 5A1AA 3SQOL 4PRHE 3ULUL 4PG9B 4X7SH 2NDFA 3QK0A 4PRBA 3TJPA 4JFZL 4WNQA 1VFBA 4ZAKC 3C12A 3IETB 4X7FC 2DN7A 3KCWA 4XZ4A 1K4DA 3F6LA 3IDUA 4HAKA 4NOBA 4Y19D 5HI3C 3S8WA 2J25A 3JWOH 3C6LC 1NLDL 2E4FA 5EZJB 1PGRB 3O3AA 4MZRA 3KWVA 1T21B 1M05A 2ZX5A 3HR6A 3WFBL 4FA7B 5IHUL 4PGZA 5E8OB 2FT6A 4NJAL 3EJUA 3DTXA 5SWZB 3EYUL 3GIZL 3VXUE 2W80C 3OKYA 1GGBH 1GGBL 1NCCL 5HGAA 3ROLB 1U91A 2EDQA 2HA1A 2YJQA 1TCRB 4BD4A 3H8NA 2XZAL 3RWGB 4EVNA 4RFEB 1UVQB 5KVEH 4HMDA 2J1KA 3MXWH 3QRGH 3NJIA 1K8DA 4CVXB 4G3YH 4U6XB 3PWPE 1HL8A 4WGVB 5AW4B 1JZHA 4QLWA 4NZDA 4PJ5B 3T3MB 1I1FA 3PWUB 3QUZC 2YMXL 3S37L 4U3SB 4HEMA 5DUMH 3HAEB 5DQJB 4FOMA 3GS4A 3U2SB 1R9FA 1YN7B 5HBBA 2BIPA 4LXFA 1AXSB 3ULUH 2DQDH 2IPTL 5D5MA 1VZIA 5GGSA 4P0DA 1G87A 1AHKA 3A4DA 4BWTA 1TUPA 1VKXB 5C0AE 3T4YB 4AIOA 3N9GL 4KOCA 3EGXB 4I0PA 4WU5B 4TNWF 1G4RA 2BDNL 3UMNA 3D39B 4AQEB 3CSFA 4YDJA 5E1GA 5I1JH 3ATAA 1BIIB 1TJMA 1U3HC 4FL4C 3PQYD 3VXNB 1GYVA 2BS71 3G6DL 2D31A 4B95C 1FLRH 2P7TA 3HAEH 4LU5H 4B9YA 2DDQL 5KBDA 3MO1A 4HJTA 3IKCB 2OJ1A 4Z7QB 4GBXD 1NGWB 1AY1L 2GIMA 1RV6X 4KO6A 2W0PA 4GW5A 3MNWA 4AITA 5EUKA 2AANA 5BUGA 1QTPA 3CN1A 2Q6WA 5E5MA 3QQXA 1UCTA 4U31A 4HS3A 4YDLC 3ZHLA 3N04A 4AM0Q 1EH9A 3RAJL 1CU4H 2G3ZA 3GHBH 3O3DA 5SX4I 3WNNA 1OKEA 2W0FA 5A3IC 3C6EA 2QDVA 3BQVA 3CZKA 1KEGL 1O9ZA 1UASA 4HPOH 5I1KL 4WV1B 1I7TB 1BLNA 3I9GH 4XCFL 1FORL 3SDAA 3WYRA 5CHNA 3U1SL 4E41E 4EN3B 1J8KA 4HUMB 1T5KA 3EYQD 1I85A 1XEDA 2C9SA 3EBAA 1LP9E 3WN5A 4I4WA 4TYUA 4WFHD 5GS0D 4FNTA 3TIDA 4LAQL 1HQRB 3KGRA 4PLKD 2ZXGA 5F7EL 5J6GA 2ADFH 2IF7A 3V9CA 4A37A 5IB4B 1BOGB 4MYWB 5JLZB 1II4E 3GRBA 2FGWL 4KITB 3JWNE 3QZPA 3HMWL 1BEYL 3B43A 2RHEA 3TN0D 5CXPA 4MXQC 4WW1B 4YJZL 1JGLL 2J73A 2A9MH 4LCWD 1OGAD 4JHVA 2P45B 4JR9H 3OB0K 4QHMA 1JV2B 2NYZA 3CXDL 5LNEA 2VQ4A 2HZHA 4QRQA 1BMZA 1MFCH 4J3TA 5DZOA 2IANA 4URTB 1R6VA 4WSGA 4ONFL 1BJ1H 1EAJA 3JV6B 1JNNH 5EU6B 4JO3L 4R84A 1KCKA 4OFIA 4BH7A 5BW7A 3WY1A 5BZDA 1AFVH 4V33A 4HGWB 5GPRA 5T5NF 1LQSR 4TSAH 2X3CA 3WI9A 5CF3A 2C9QA 4ZXBB 3W0WB 4F58H 2F54A 3ZKQD 3KLDA 1CL7I 5B39A 3E6FA 5BPPA 5BUAA 2NR6A 1R3IL 1FNEB 1OAXL 2E56A 4YHMH 1S7VB 4KMLB 3S5LA 3LPPA 4M5ZH 3U7YH 5JUEH 1HXKA 3RTQB 3WXWL 3QG6A 3OKKB 1PZAA 3EBIA 1BIIA 4OCXL 4Q58C 4CC4C 3TBWA 2VXSH 1THCA 3AT9A 3GMMA 1OPGL 1HSAB 4ES8A 3HC4L 3WNMA 4PY7A 2AQ3A 4NM4H 3Q5OA 4O9HH 2Y25A 4TNEA 3DJZA 2XQ0A 1B0WA 4HUNB 1CE6A 5INCB 4B9CA 1RIUL 4XPAL 4RLDA 2L4OA 5DI8B 2KPWA 2HX8A 1OAYL 2P44B 3HE7B 3FCGA 4UM8B 4JPVH 4P99A 5E95B 5EU7C 3U36B 3K71B 1KTLB 4S2SA 2VKXA 3A6CL 4FFZA 3BMWA 3ARGB 4KJQD 1WFNA 5TE7H 3V5DB 4C59B 2E74C 4OZGA 4XWOC 5DUBA 4IIZA 3T1FB 5AOKA 3F5WA 4WI8A 5I8CB 3MYJA 2P5EE 3HZVA 2DBLH 2YK1L 4WJ5B 4MAUL 4IRJA 2RJMA 4H44C 3WG7B 1H15A 1OCZB 1TVDA 2FCBA 5F0PB 1MCQA 5C0AD 5LN8A 4EUPA 2FJUB 1DBKH 2WIMA 4JG1L 3GK8L 4G7SB 1TITA 4PJBA 3TVMC 4MA1B 4WUUB 1JPSL 1RZKL 3LKRB 2NNRA 3Q1SL 1FQ9C 4KI5D 2YSSA 5ACLA 1COBA 1IC4H 3ARBC 1CLCA 4L4TB 5ANMA 1LE9A 3GXUB 1EZVY 4KFMA 1C5CL 1JXFA 1OAQH 1OP9A 4HWUA 3ZE0B 4XBGB 3FB8A 3PWPD 4XNZB 1YNTB 1R24A 2DOCA 1A1NA 3E2HC 5FOBB 3MREB 5C3IA 2V7NA 3QJSB 1RUPL 3HW7A 3CDZB 2XTJD 2EH7H 1T5WA 3M45A 1ITCA 4Y5YA 1S9VA 1IBBA 3BUYB 1SPDA 3G6AB 1IB5A 3RDTD 3SCMA 3JBG7 3DX0A 3VE0B 2J2ZB 4DZBB 1T6BX 2XFXA 2R0LL 2BP8A 1P6FA 3N42F 3BAYA 2B4CL 3X3GH 4GINA 2D7QA 1S6NA 3CK0L 3X1NA 4XPHH 2J88L 3ABGA 3AITA 4M7LH 4HHAB 1TQCC 3W9DB 1HYSC 4LSQH 3KPOB 1MG2C 5D4JA 4PRIE 3QEGH 4Y16D 5F9WC 2OTWA 1IBYA 3B9KB 4NHCL 4NENB 4AQ8C 2YPVL 4I3SH 4LRIC 1J0YA 5F3BA 3VFMA 4PLJD 1CGWA 1HN1A 3PF2A 3ZSSA 3UACA 3QC5X 3QCUH 1QOKA 2VL5A 4LB8A 2X89A 2K7QA 5GRUL 1Q1JL 1AD0B 3CN3A 1TJXA 1I7TA 1XGZA 1UZ8B 3PHQB 2RB8A 4A2LA 3QQDB 2HKHL 2X4NB 2VDML 1SXZA 4YHKL 5CILL 2ZXAA 1IM9D 1P84K 5AL0A 4GRLC 3T09A 3W5NA 4X5XB 3J2PA 2C4FU 4RGOH 1J9CT 1UFGA 1P5UB 5JLZA 2ODHA 1RK0B 3PLYA 1ZLSL 4N0UB 1ADWA 3OKMA 3RI5F 4HAFA 4WNQB 2VLJE 1D5ZA 2BNRD 2CIIA 4R96B 4F91B 4XPFH 5TGBB 3F85A 3KPQA 1CDGA 1QSFD 2BOCA 2KKQA 3CN4A 3EOYG 1TTGA 1V7NH 2IANB 2AEPL 4LFHG 4XODA 2K9UA 2VTFA 3JV4B 1IM3A 3CFNA 6PCYA 1CLVA 2B0SL 2DYPD 1QBML 3MVSA 2BSEA 2W8CA 3RY4A 1JOIA 5EU6A 1BF5A 3FFCD 1HNGA 2FE0A 3LEYH 2WINA 3TPUB 1XL6A 3L7EA 3NP3A 3H7BB 3PWJB 5D72L 4QRRB 3OKLA 2WUCL 3VCLA 5DEJA 1DVSA 2VDQB 4O4YH 5IBTH 4AI7A 3FT4B 5EUOA 5JHLH 1S7WB 2VXQA 2C9AA 4M5TA 1A1NB 5EEZA 1J9RA 2WOBA 4APXA 3UP1A 1A6VL 1DLFH 5JTWA 5DS8B 2D3LA 2XWBB 3RVUD 2H7WA 1NL0L 4GS7C 5D7LE 2QQLH 1ZSDB 2DMBA 5IQ7L 3VO0A 3UG4A 1F4AA 4ZUTB 3G6JE 3EYVA 4ZTOL 1YN6B 4N8CL 4JQVA 1PG7L 1OE3A 2CK2A 2VRQA 2Z4QA 3KLAA 1YPZF 3WNPA 5HHXH 1X5MA 2BRQA 1BFOA 5DJXA 4MNHB 1F8TL 5DGQA 2WVUA 1EZUA 2ZWKA 4GQ9H 1QPKA 2NTFA 2YZ1A 4TOYL 1UADC 5T3ZE 2OJEA 3WIHA 1SYVA 4TULH 4ONHB 4G6AC 2K8QA 3ZL1A 1XQ4A 5LAXB 2WLHA 4BZ1A 3HHSB 1BD2A 5LGJA 1ZGLA 4PSRA 4Z3EA 4PLJC 4NENA 1SEBB 5EC2A 5FA4A 1R5WB 1Z66A 5IW6B 3V6FA 2MH4A 1LEGA 2ENPA 5FHBL 4HJJH 2R29H 3RL2B 2VQTA 5ABZA 5HXMA 4JM2B 2WXMA 2DQCL 4Y9FA 2D03H 3GB7A 3FUMA 5KANI 4NC1E 1PCSA 3WELA 3OHXA 3FUIA 2X1OA 3SODB 5MEOA 1QNZL 3RPIB 1GPOL 1ZVNA 4ESKA 2R59A 3H54A 1VESA 2YAMA 1E6JL 4JAMA 4X7CC 2EEXA 4PJGA 3BAEH 1VCAA 3EO9L 2Y36L 5F0JB 3WLBB 3ZT5A 5JHDA 1A6TA 4DGIH 3MYZA 4OFKA 1S7QB 1N64L 4PVLA 3CBKB 1YEDA 4X8JB 3DURB 2XRAH 3UABA 4BM7A 4G83A 1WA0X 4GRWF 5JOPE 2BOCB 4I77H 4XO4A 3VRIA 1QAWA 2EEAA 1J0ZA 4PHZA 4OZGE 4AIXA 3M86A 3ZE1F 1GH7A 4X42A 4OI7A 1SOQA 1OGTA 4FXKB 3DHJA 3QJQB 1N3NB 2GK0A 4N8CH 5H2BA 1RLWA 2W1NA 4L23A 1NAKL 3NIGF 4HV8A 1CUOA 1E4WL 2VC2B 4QY8B 1ZHKA 5JDJA 4GKZB 1RZ8A 3ZE0F 5INCA 3PWJA 1EHLL 4TLKA 1U3HB 4FL4B 3THML 2E7LC 2MTPA 2R1XA 1QTYT 1T7VA 4DQOL 5C09E 5F89B 2EUWA 1G7MB 4YDJB 3QUXB 4FFTA 1VFAB 2VZOA 4HK3N 3QUKB 4H25A 4L4JA 2BVEA 4FI7A 3IJYA 4KI1A 3WKYA 1RULL 2NY1C 4NO0D 4NRXB 2XFGB 3FU9A 4U1KB 1XCXA 4LASL 2NSQA 5DD6B 4GMSH 3LJ3A 2VDLL 3S4SB 1KTRL 1ASOA 3Q8CA 4DVBB 2JCCF 4TMPA 5FWRA 4ETQB 1C08B 3MRPA 2AZUA 5IVXF 1JPTH 3VFRB 2F54B 3DPBB 5D1XE 2CBOA 3QHFL 2WKOA 4POUB 3FTWA 4AUJA 2J6EH 2XRAL 4N2HA 1WG3A 5MEPA 1M1XB 2CLZA 5JYMA 5JMOC 1TQWA 2X2IA 1TLKA 5C07A 4DGUA 1E3XA 4NZJA 3VXOA 4G8GE 2A4ZA 3DYMA 2TRYA 3BSZA 4JQIA 4QYOA 2MPAL 5INDA 8PAZA 4PBXA 2B2XL 1HDMA 3CLFH 1E2VA 5DZPA 3GMLA 4KU1A 1EEZA 1U4FA 2Z65C 1SMDA 2NR6C 3CX5K 5J57B 3K5SA 4FHJA 2WVVB 4UQBA 3QNXB 4NQVA 5D2NA 4BHUA 1P2CB 2J56A 4ZXBC 4BUHA 2AK4B 1X5AA 4JG0H 2R2BA 4PJXE 4NUMA 1QSVA 5H37H 4HJJL 4KJQC 3PDOB 2ARJQ 4XXCC 4H88L 3SKNB 4Z7IA 1Q1JH 2R7EA 4GSDH 3ARGA 3FO0L 1T1ZA 1NUDA 4ENED 1U93B 1X4YA 1OD7A 3EG9B 4ZQKB 1XXFC 2PXYC 1SHSA 4G8AC 2VJXA 4M7KL 3X1EA 3RA7L 3LXUX 4U1HB 3AXLB 2ATAA 5C0CD 1YEFH 4G8FB 5CEXB 1TTFA 1XEUA 3MJ7B 4Z7VB 3OPZH 4NNPH 1M3JA 3UJJL 4FHKA 3MMEA 4PGBB 4YSEA 3BN9C 5DRXB 1BP3B 1UACH 1G9NL 2X6UA 4G8IA 4N2MA 4PJ6A 4PWFA 4QHLA 2WBXA 3UTSB 1HHGA 3F6JA 4W6YB 3VXQB 1BG1A 2CKBL 1TJIL 4TUJB 5IG7B 1KGUA 2WVTA 1X5XA 4IS6B 3QJUB 4OJFH 1ULVA 1Z3RA 4X4ME 1MCIA 1N59A 2I7OA 3N50A 3VI4E 5J9PB 1B2WH 1EO8L 3UDWA 3FTZA 3OGCB 1QW9A 1S3RA 2R39A 2Y1ZA 5I0ZA 3T6QC 4HK0A 4OD3L 1PKQA 2DD8H 5TE4H 3S36X 1ROWA 5ECGA 1PL3A 1XIWB 3LN9A 4OBSA 3VWJC 2ZNXA 3PGFH 1LK2A 4X6DB 1SLVA 3AG4B 1GS6X 3FH8A 2Y22A 4PUBL 2KS0A 3X3FH 1K9TA 1IT9L 3TBWB 1FZKA 2ZOLB 1BD2B 2Y24A 4NZTH 2JB5H 4OCSL 4WV1A 3SDAB 4KI5C 4X4YA 1RIHL 4AQOA 2BP8B 3NCJL 3DDGA 4XO5A 2OXHB 4KX7A 5F7KC 2QEJA 3GS7A 2DH2A 3W57A 3LN4A 5MI0B 1MRDL 2QADC 2JWYA 5IW1B 3PE9A 1BYPA 5DJ2A 1CGSL 2WNKA 4QJ4B 3MLRL 1JXJA 4JM4H 1H19A 1L5GA 4RAUA 5A40E 3KPOA 4ANKA 4GQRA 2CLZB 5GGVH 3INUL 3P0VL 4R26L 3WV0A 5DYOA 1FFPB 1MKFA 1LE5B 1XO8A 1DQQB 1ZLSH 3IJ9A 2ADGA 1MH5A 3V8CA 4Z77B 3GTVA 2Y7NA 4Z7UB 4OZHB 3IPBA 4LLYB 1RUAH 2EVJA 1SY6L 4H5SB 4XB7A 4BGLA 3BD4A 1T7XA 1R5VB 4RH4A 4DOHB 3PS6A 5GGTA 1AQ8A 3GRWL 4KZEL 4NFDA 2HKFL 4M03A 3MBXH 5MERA 3MTXA 1S7QA 3PHQA 1QWNA 1EIBA 3QEQB 5J1TC 1A66A 1SYSA 1KG0A 3AWFA 4G11A 2UX6A 1DQTA 3FS9A 2EH8L 3TBSA 4V1DD 3WJJA 2ZXEB 5FW6A 2X9WA 3VGGA 4JW3A 2ESVB 2X53A 2YQ3A 4L05A 4WFED 4F8QA 5CFAA 1ZPLA 2NOYA 5ENWB 5IROA 5J12C 3LB6D 2EIDA 1NFDE 1WTGT 4I3SL 4PGDB 1KGCE 3I84A 1UT1A 4DP2X 2PO6C 1QSEB 3B3BA 1HE8A 2DICA 4GT7A 4A68A 3QFDB 2LAGB 2DBJA 4K3JL 2GW5A 2VUOA 5AOLA 3RWGA 1ECZA 4UINL 3IJ8A 3AREC 4R0LB 3HNTL 3WNJA 5L4FA 1QWHA 4FGMA 4U6XA 4K23L 3J07A 2GC4C 3EBHA 4KX9A 5CN2A 1PG7H 1CXIA 5C0AB 4UQEA 4ADJA 1P7QB 1IZJA 2CNYA 4Y5YB 4U1GC 3SCMB 2VSDA 2VXVH 5EF2A 5IQ7H 4QF1A 2G3MA 2Y5TA 1AQHA 1O6VA 4HLEA 4EOWL 4LVNB 1CGSH 2ALWA 2J7LA 4FLRA 2X6VA 1AGDA 2R8SL 1YN7A 2XTJE 2RQEA 1PCXA 2WZ5A 4X0KB 5LB1A 2AJYL 2X9YA 4HKXB 3TYGL 1DCLA 2H9GB 3FUNA 1XAUA 2HMIC 1XMEB 5DQ9A 3HZYB 2MNJB 4U33A 5I8EA 4XN9A 1D5IH 3VNZA 3IBOA 2XZQL 2CNZA 3ES6B 1X44A 3VXNA 3I85A 3EJCA 4JRYD 4JBSA 3QNFA 3GLDA 4U1NA 1HEHC 3MJWA 4GRLB 4H8WC 1PKOA 3BKYL 4J27A 1BM7A 3MC0A 5E9DA 2J5LC 4K8RL 3FK3A 1JHLL 1Q38A 3F7QA 4UILH 2JKWA 1KGIA 3P30L 4MJIA 4NKIH 3EH3B 1VCBC 4TVUA 5CZVL 3WAJA 4X7EC 4M1CC 4I5BA 4Y8AA 1TQVA 3CFEB 4WU7A 3VRLE 3K6IA 5IBUG 4OV5B 3L8QA 4IK6A 4CVUA 3ULVE 1V7ML 1IGTB 3ZUNC 3D4YA 2YGOA 3TJEL 4RGOL 1ETZA 1CTNA 4MMXB 2HN7B 4Z0BL 5TGBA 1YEHL 3EUUA 5FFGA 3MUJA 4LPVA 1T89C 2QKIC 4GKSB 5B8CA 1S9YB 3GJEA 2B15A 3FQWA 2E9BA 2ZP9A 3SZKC 4N5ED 2O72A 2DM7A 3KDPB 3EJTA 3LAFA 4G6AD 4S1SH 3F8UB 1WTLA 3QUMH 3WL9A 4PWHA 3BKCL 4WEEA 4HETA 3ML9A 1HK6A 2EH8H 1OAXH 4Z3FA 3P9MB 5HDWA 1AACA 2HFGH 1AO7D 4A39A 3ZHNA 2NLJB 4GIOA 4RCAA 3TNNB 2HKFH 1A6WH 4TSCL 1L0XA 3ZSTA 2Y2WA 1Z3GL 2F19H 4EZMA 3H2QA 3W0WE 1OARH 3QEUB 1I8IA 3MJ6A 1G94A 5AG9A 1CVSC 4ZS6C 3ZDXE 4KV5F 1PFCA 2UY6A 4J4PA 1BQLH 2ZCKL 3ESUF 4ONGH 4QGTA 2OKMA 1USQA 4R0LC 1H3XA 1NCIA 4JFYB 3ZYIA 1NM4A 3ATEA 2DIJA 4IBTA 4LLUA 2UZXB 3P3YA 1PNDA 2PCFB 1RL1A 3C09C 3QCVL 3EO0B 3NIDF 4N2KA 3HMXH 2ATPB 1OW0C 2LU5A 4RMSA 2QTEA 5DC9B 3Q3GA 5AVUB 2XZQH 4ZSOA 1U8MA 2A74B 5A16A 4JN1L 1U8PA 3LKNB 3RIFK 2VXUH 5FB8A 3BZFA 2A6JB 4PM1A 5FPIA 4LCWE 1H8NA 5K1VA 3ZY7A 3ZU8A 1MWAH 3KVQA 4PCKA 3VM5A 4Z77A 2BNQD 3CVIH 3H85A 4JREB 3B9AA 2X4PB 3FKUS 3Q1SH 3B34A 4JNXA 4AL8L 3THMH 5I0DA 4OH2A 1R5VA 1WZ1H 4W6WB 1G7IB 2DY2A 1H3WM 3MV8B 4LDLB 4S0HA 1EJFA 4KTEH 1NLDH 3VB9A 4S10A 2GFBB 5I1KH 2IH9A 5T1KB 4FYSA 4ZOAA 3V9EA 2J5WA 3P77A 5MEQB 3ARFD 4RWYL 3NA9L 2CHNA 4WY7H 3VXPB 2NUTA 1KJMA 4GW1A 2QSCH 4OBRA 4P59H 5JA8B 1FL5B 4NNPL 3OPZL 3S35X 3DROB 1SMAA 3OGOE 2BNUA 2H26A 25C8H 4X6EB 3EO9H 3GSOB 1R33A 4R0LA 4XPBL 3L7FA 4MJ5A 2NY5L 4ZMPA 1BZ9B 1X9QA 4IHOB 4PAZA 3L2LA 1UGKA 3HE6B 4LBEB 1EO7A 3BH9A 1NSNL 5EIVA 4KNQA 5CD5D 1XH3A 3H2WA 1ZLWH 3H53A 4EF3A 3NZSA 5C8JB 4MYPA 3LN4B 3SO3B 3INOA 2OTUB 2DLIA 5E23A 2DW5A 1YUKB 5HY9A 3GUTA 3IU4H 2DWTA 2J8OA 1E9QB 4U1JB 4EVNB 1JN6B 4X0KA 2GJJA 3Q6FA 3AT0A 4F5CA 2EZ0D 4GKNA 4OJAA 4DK6A 5FOBA 5BNXD 1HILB 1OOWA 3T2PA 4Y9GA 1SN0A 1MJUH 4PJHA 3HAEA 4QRAA 5CNHA 2AJSL 2D2OA 1FRGL 3CHPA 4ALAL 4AMWA 3TNMB 5L0QB 3MRGA 1Y0LA 2GVYA 1WWCA 1LWRA 2P3YA 3KPNA 5HYEA 2V33A 3UTQB 2AXWA 2AV7B 3B2XA 4KRPD 4HKZA 3PIQB 1BFVH 3ME0B 3QQ4A 3WN5B 4BFRA 1MFCL 4OZHF 4KJWC 4E42A 4QWWD 3VB8A 2WAQA 1WD9A 1EFXA 3WXVH 3F04A 4A7QA 2TSAA 4FEIA 2A9ML 3PNWA 4N86A 4OCRL 4OGYH 3PGFL 3G08A 4Q6IC 2H41A 1S5HA 1WCQA 3G5VA 4PJEE 5KS9F 4OV5A 3K4AA 3NFSL 2X10A 2IV9A 3SOTA 5C0GA 2I60H 5F9JB 3KLHC 3BZEB 4DQOH 3NBNA 4ELKB 4H0IA 3TH4T 5MI0C 3TV8A 5I1CH 4OJFL 2ROYA 3GM0A 1WEJH 1S9YA 3MOBH 1LO4H 2TAAA 4J4PC 4JVUA 4LEBA 3ABLB 2XIDA 3NDYE 4KAQH 5SWQB 2IH3A 2GFBA 2N0KA 3L1EA 4XO8A 3PDOA 1A7NL 5KYYA 1IC7H 5C7ZA 1OV8A 1JK9A 1MELA 2P43B 2ADGB 2X1PA 3KBPA 4L18A 2ZG3A 4PJXA 3SQRA 4QNPE 3OR7B 3NSJA 4ZO6A 2LQRA 3VWJB 4BCZA 1KYAA 3ATBA 1XF4A 5JNYB 2XBDA 4IBSA 1F3DJ 3L3GB 4W68A 3MNDA 5FHAL 1JF1A 2XN9A 4PJ7B 2QL1A 5F89A 2DJMA 3HRZA 4FTVD 4ABVA 3DHMA 2ZONA 5JOEA 1HCZA 1F4YH 4OKVA 3SBWA 3GJFB 2A3TA 2AEWA 4YGVA 3TS8A 2JTDA 5ADPL 3HI1A 3UTTE 3KLQA 3BEVB 3CVHH 2WTPA 4N0YL 3T0AA 3SY0B 4HS8L 3P1VA 3WTVA 1BAGA 3RJDA 1QLEH 4JFFE 3WENA 3NFPA 1PKQE 3QFDA 4R7NB 2JKTM 4R3SA 4TQPA 5IQLA 4FQIH 1N5AA 4UQCA 5F6HJ 2D7NA 3LQMA 3WFEH 3LZQA 3OTTA 2VQ1A 3T8MA 4OLVH 3BLPX 4OLWL 1AQDA 4NZRL 1UWEH 5I9QC 1T5XA 2F58L 2AQ2A 3EYFA 4D9LH 1YUHB 3NFNA 3ZTDC 4C83A 3ESMA 1ACYL 1UM6L 4UM8A 3MA7A 5FHBH 4TQEL 4H8HA 1UM4H 4JK0D 3HUJB 4FZEL 5I16B 1PU0A 4ZUWB 1XR9B 3NN8A 1CCZA 4OKDA 3U4EA 3OJDA 1JP5A 2C7UA 2PO6A 3T71A 3ILQC 3PABB 1A6ZB 2LLGA 3LX9A 3PHAA 2DMGA 2E27H 2Y1VA 5LBSA 2BY2A 2VJ0A 4Q6YA 4K3GA 3EO1A 2F2HA 2YMXH 3S37H 5F93C 5LVEA 1F02I 4ZUTA 2X3AA 1MHPH 1OCCB 5E7BA 2WN2A 3IJSB 3KBFA 4IGBC 4HJ0C 2V8LA 3OLIA 4R7DA 2C9RA 5DJXB 1ZHNB 1LO3H 2FRGP 4ZO8A 1GGIL 4ZMLA 1SJHB 5IESH 3MRBA 1SN5A 1KFGA 5DVLA 4AT6A 2EH7L 4FFZH 4ICXA 3VWKD 1OCRB 1QRND 1NUFA 1XBRA 2RCSL 3EYUH 2XNAA 3O41A 1SDAB 4IBQA 1KCVH 3LEVL 1OM9A 3UIZA 3Q9QA 2EDNA 2WWMD 2WLIB 2NY4D 1LEGB 2E5EA 1KACB 2R0WL 2DH3A 3EF7A 4NNXA 35C8H 5CP7B 1E7UA 3CFKB 4MJ2A 3MLTB 5IBTL 2QADB 1NAKH 2YD3A 3FONA 1R3JB 1EMTH 3R06A 2Z31B 1T5WB 2WCGA 5E5RB 1NFIA 1X9UA 3QS3A 4PGCB 4YHOH 2LU7A 1Z5LA 1I1RA 1EJOH 1MFAH 3TV3L 4OZGB 1SVZA 1HS6A 3GMOB 3A6BH 4B7IA 4HHGA 1T2QL 5IVZB 1JVLA 3JWNG 3FO9B 2NUPA 3PUUA 3QXAB 3B56A 1V55B 3MRIB 4WWNA 2DQIH 2P49B 5F9OL 2FX8H 1EAPB 2NSXA 3HZ3A 3N6YA 2DJ4A 1HESA 3OLDA 1NKGA 1ZLWK 4FQXC 2EO7A 4Z7UF 1RZGB 4ZPTB 5HI4D 4YSSA 3C08L 5T3ZH 1QABA 5EIIB 4LDEB 1UOLA 3WIHL 4W9KC 4MA1C 2DQEH 5DJ6B 1OAYH 1DVFC 2C3GA 1I9IL 1GY2A 2MOQA 3QQ3B 3UL4A 4JPKL 1DEEA 2Y6TE 5A2FA 1PDKA 3NP4A 4ZS7H 3MBWA 4ICWA 4YDKL 2DB8A 5CEYB 3QQDA 4C4BA 3K0WA 2X42A 4JE4B 3N1GC 4QMEA 1KJ2L 4BXVA 1Y18B 4NM4L 4B9ZA 3PFUA 3FBKA 2D3NA 4QHKJ 4OF0A 4FQPA 2VLRD 4UB0H 2O61A 1MH5B 1QASA 3M88A 3MREA 1W72A 4P9HL 4Q52A 2FO4A 1O5DT 2X88A 1BQUA 3QP3A 2ZCHL 1JVOA 3S2AA 4NDMA 2BWDA 4H8QA 1S7SA 4G8GB 1RIVL 1D5ZB 1FFOB 1P7BA 4FYTA 5D7LB 1X4ZA 4DZ8B 5PCYA 4CKQA 2P52A 1AGCB 4NP4L 1HIMH 1PFOA 3G6JB 2H32B 2FLRT 2J20A 5IW3A 4XTRC 1INDL 3Q3GB 3FU3A 4M4PA 4QOKD 3RUGB 1E27A 3ARBB 2B9AA 3QJFA 2Z3FA 4AYSA 1DLFL 3LZRA 1UM5H 1JUFB 1NEPA 1W80A 2DRUA 4NYLA 2NSMA 2VO8A 3QJOA 5AD0B 3CFUA 2ALAA 4PJXB 1I7ZB 5FK9B 1TJHL 2XNAB 5BJTB 1FYTD 1W0VB 1BWMA 3WLWC 3MX0A 5EBGA 5LCVH 1F6AA 4B41A 4DGYL 4ZMWA 2ZYIA 3NJXA 1ZLUH 2F8XC 2XV6B 1JZIA 5CCJA 1KCUL 1A1OB 3NSYA 2H45A 5FCUL 4TQHA 1MFDL 5FO9A 2WNGA 3LKQB 3KCPA 4KRMB 4KMQA 1OM3H 3TJHD 4BH7B 2WP3T 4OZFG 5ISZD 2G9HB 1MVFA 1FH5L 5TK2A 1NFIB 4HOXA 3KL5A 3OPUA 4O51B 1W0YT 3KLKA 4MHHI 5BO1L 2G2RA 5E8EA 1H3TA 3MJ9H 1JCKA 4M48L 5C0BD 5CN3A 1CDUA 4KKLD 1QZNA 4TQIA 4XNMB 3BP5B 4H1LB 3ZQWA 1FI8C 2GBAA 1BX2B 3ZO0A 2WO3B 3BEWB 3MLYL 4X7TA 1G7HB 2FBJL 3D5OF 2RALA 2IADA 2ITDA 4WWKB 1AZNA 2EIMB 1MW2A 2JB6B 3VI4B 3W11D 1BZ9A 1PD1A 3RWDA 3BHBA 2YJLA 1JCVA 3HC2A 5EC2B 5FA4B 4PJ7F 2RR3A 3TURA 5D2NC 3QXDB 4F8TA 3ZDYF 1IAIM 3K5RA 2WB1A 4O02B 5HGDA 1ZHLB 2UZIL 4JDTL 2PYEE 4N1CA 4KO5A 2BX5A 2OZ4H 3BH8A 4WFGD 3D06A 4FKHA 3L3OC 2ITCA 4DKEL 3EHBB 1ZK5A 2YZ8A 4NBYB 2BXZA 3MACL 2OA9A 4U1MB 4DPAX 3P4MB 5T3ZL 1S7TB 4X5WB 3S88L 1OY3B 4NBZB 1GAFH 1GJUA 4X50A 4NC0B 4IJ3C 5JHDD 1YEKL 4JAMB 4WSJA 3SKUD 4DP1X 4BKSC 4FAAB 4HA1A 4WCYL 4X9GA 3QIBB 3D25A 1FGVL 1NCBH 4L1HA 4K9JA 3ZMRA 2ZUUA 3MBED 3WHE1 4W70A 4ELMF 3NCCB 4RSVA 3UAEA 1P53A 2P48B 4BSWB 3M8OH 4CMMA 3MV8A 3LNEA 3VRIB 1ZY9A 5EEXA 2DQDL 2W9LA 3QBTB 5DVPA 5HHPA 3RFZA 1MAML 3DUSB 4UBDD 3K80A 4AQAB 2HFTA 5GJTL 3DJSA 2XVBA 2BNQE 3ATDA 1E8WA 2DLFL 4XBEL 2K3TA 3B9KC 4OUOA 4Y2OB 4DQAA 3V0HA 1K5NB 4ZW7A 3OD3A 2E86A 3VXSB 3CX5J 5B4MD 3MFFB 1OGAE 3OF6A 1E5BA 4O02L 5IMLB 2YRBA 4FCAA 1UZ6F 2HH0H 2QZ5A 2LFEA 4RGMC 1YUHA 4FLSA 3CQQA 3CFTA 1HH6A 1KYUA 2W07B 2Z1PA 4KKLC 5LAPA 1OZTG 1QSEE 4OIIH 1VLXA 1TIUA 2XXFA 1WBYB 3LNFA 4I3RL 3ULAB 1Z7JA 4MFHA 1I8KA 4NN7C 4P06A 2PW2A 5EA0L 3K6SB 1CG9B 1G0DA 4G72B 4MNQD 3K6DA 3C60A 3GDBA 2GEEA 3MR9A 5D7JC 2YWZA 2DWEA 4XI5C 5TDPA 3LH8A 5DLMH 3MLWH 5EFIB 5FS5A 2XX0A 4GLRH 4XTRD 4IOIA 5I1GL 3KL3A 3P02A 4Z7WA 5A16B 2YD8A 2VLKE 3EOTH 2VH5L 2DIAA 5IMMB 4WEUD 3D0AA 3ARBD 3FN0H 4OQTL 4XWOD 1F90L 1TZHB 2A83A 4QLRA 3SE8L 1A4CA 4FP8L 4PHXA 2BW5A 2UZYB 4PWJA 2E6QA 1FVDA 5GZOD 1E8YA 1FWXA 5D4HA 1A7PL 3NCYS 1KB9K 2XHNA 3GI8L 2LE9A 3NH7H 4TNFA 5FDWB 4QY8A 2CIKB 3IKCA 1KTKE 3UYRH 5LG1A 1EHAA 3FOMA 1A14H 4J8RB 3WY2A 2WQAA 3AAZA 3DJTA 2DM2A 3TEWA 3QQ4B 1A1MB 2PCXA 2YARA 4R7LA 4UOW1 1ZA6A 2APTA 4TUKL 4WZ9A 5TDOB 3TASA 3ZPDA 5LNGA 4FMKA 5DHVA 1BQHG 1QSED 3N43F 3HR5B 2F5AH 4N8VG 2KZ1B 2H3NA 4PFEA 3VG9C 3KH4A 2WTRB 4WKZA 1PAZA 2Y06H 1FL5A 4NRXA 4U1KA 4X6DE 5CU5A 4KKCC 2C9UA 1UGNA 2BS8A 3HE7C 4FTVA 3FO1B 2X4UB 3L1GA 4LHUB 3QXTA 2XVKA 4UV4H 3TH2T 2BSCA 1RUKL 3OJVC 1HHIA 4XGZB 3GGWB 1KB9J 3S3CB 2BHZA 3D34A 3II1A 5K93A 1JNLL 1RZGA 3TV3H 2A1WL 5D9SB 2CJUH 1JNNL 2LTQB 1UWXK 1F0LA 1N0XL 3GLAA 5DS2A 3NIFF 1F11B 5EN3A 3U9UA 4WDIA 4MJ6A 1A7RL 5DQJA 4GRWB 4GLRI 3L5XL 3RKDC 2BJMH 2JI3A 3BWUF 5I1GH 1AKJB 1JD9A 1LWJA 4LRIA 4Y4KD 4OSUH 1PG7W 3MRKA 1SHXA 4P4KA 1A7OL 2J1WA 1XV8A 5BQDA 1FE8H 2XWDA 3JZ7A 3QYMA 2E7BA 4PVMA 3SN6N 4M56A 1DBBL 2A73B 4FLOA 3VRJA 5C0BA 4PJIA 3FONB 2WLKA 1YYML 1U0QA 3BEVA 4K94H 4NX0A 2NY4B 5CZXD 3BRGC 2ZXQA 4L8DB 2BMKA 3LZPA 5IESL 4Y19E 4MD4A 3QI9D 3PIQA 3P3UA 1KIUB 4PW3A 3DRQA 3MA9H 1AZUA 1OD9A 4UDUA 2WBKA 1QPXA 4F24A 5HPOA 1KDJA 4DP7X 3HN5A 4PRHD 5DFTA 4MXQD 3Q2CA 3TBTA 3IYLW 1GIGH 3GSWB 1BA9A 2P8MA 2XXMB 3LS5H 3F2LA 3AFLA 1MWAB 5FYLH 5CP3H 2E75C 5F9JA 5C0GB 4IRZH 1FLTX 4IDLA 4AG4H 1DQIA 1FV1A 2UZYA 4BSVB 1T22B 3EYSH 4M29A 4OGZA 1ILSA 1KCSH 4PJAF 3OC5A 1RERA 4G1EB 1MVYA 4FNLH 4H26B 4KKCD 3BRFA 1IAIL 1A8JH 5LN4A 4DGWC 1SEQL 5CKGA 5M95B 5ID0B 3ARVA 4YE4H 4NJ9H 2BNQA 2NW2B 2XTJB 1GW6A 4S1QH 2NXYC 4AQ8A 3W5MA 3BOVA 1C5DB 3E80A 2JJUA 4LSPL 4QXGL 1PZ3A 4S1DC 3OAZK 2FO4B 2YBRA 1OP5K 4TVPL 4F9LA 4Y1SA 5D1XC 3MV8E 4M7JH 5T1MB 1FBIL 4NT6B 3G3LA 3PJLA 2C4XA 5AB9A 4ZOBA 1N67A 4OAWB 4MASA 5ETUA 3UTSD 4ABWA 1CDCA 1CDBA 1MHHB 3QCTL 3SE9H 1U30A 2BCKB 3LZLA 2IO5A 3S34H 5KSBF 3QE5A 1RVFL 5DEFB 4ODUA 2B59A 4K5MA 4ADGA 2IPTH 1ECYA 2EO9A 4QHMB 4BE6A 1ROCA 5CSBA 4AJYV 1HHIB 1LLAA 3TJEH 3G5ZB 1I7RB 1WFMA 4K7PH 4E9RA 2Y6SC 1R3JA 2FWLB 1NCJA 2L04A 1SDDB 5T8IA 4DERA 2QVKA 5IHHA 3PXJA 2IQ9H 4NRYA 5AVQB 1IC7L 3CZFB 1KSRA 3ZZ1A 2ZX9A 4UM9B 4QJ3B 1KLFA 4RGNC 2AFNA 3K91A 2FL5A 4LIQE 4KDWA 2HYMA 2Q3XA 4R2GD 3CV5A 5FO2A 1BQKA 3U25A 5IJKC 2UWEE 4PS7A 4Z76B 3L45A 3ZZLA 1OP4A 1U4EA 1T04A 3FN9A 3J27A 3ZBMA 4LIQH 3UPAA 5B39B 3OAUL 4X83A 4ZNEE 4M93C 1J5DA 3ARUA 4L37A 2IQAA 3WNIA 4QHUB 4CU8A 2FJHA 2YD7A 4UTBA 4UQ9A 5I9QB 4UAHA 4PRPD 5DD6A 2ESVA 5HGGS 3S4SA 4AMXA 3T0DA 1TZHA 5BZWA 1WT5A 1P4LB 1Q9OB 1M7IB 3P54A 1SN2A 4XC1H 3WXVL 1GXEA 1FNLA 4IRZA 4JPWL 4D0BB 3TONA 2YD1A 5HHMD 1Z5YD 4KKZA 3T3PF 1PZUB 4JHWL 4KJPC 2AJYH 4Q89A 5LBVA 1HKFA 5CM1A 2OMYB 5T1DL 2ZCKH 2MQGA 4W4OC 3OZLA 2F7PA 4QRPB 3VXME 4WTZA 3BHBB 3E8UL 2IBGA 3IVKA 3LNIA 5PAZA 1MAMH 3BQUD 2ED9A 5AB0A 3PXLA 4KQ4L 2VZUA 4XCYB 4YS4A 1I1AB 1BZOA 5HHQB 4S1DD 3SDYL 4HLJA 1WBZB 2JIXA 2ZOKB 1S8DA 4ZXBD 2HFGL 4K7PX 5FA3B 4PCTA 2A6DB 3CC5B 1A6UH 1P4IH 1NH6A 1DSFL 1P2CA 4LVNC 5DHDA 4HLZH 3WJMB 1A0QL 4G6KH 4F7CB 2IV8A 1IM3D 2X4NA 2J21A 3ZTEA 5EEYA 3RWHA 4JZOA 1P5VB 4RBPH 3O45A 2YAEA 3HNSL 3WSQH 4TUKH 4X5XA 5A7EA 5ES4B 3JV5A 2DAVA 4HXAH 5ERWB 1CFBA 2HFEB 2HG5A 3FQRA 4JFEA 4PJEA 5KOMC 1F4XH 4KRLB 4UQ3B 2NY1D 1E4JA 1SLXA 3WL9B 2H6PA 3W39B 4ZS7L 1EA9C 1EBPA 5E51A 3CN0A 3WIAA 4LCWB 1ORSA 4OLZH 2YUWA 2EUVA 2PWDA 3UERA 4G6FB 1YNTA 3VH8G 4CSPA 5CMAB 1A1OA 5AYUH 3DARA 4P59L 3RFZB 3E3QC 4HJ1A 1U58B 3RX9A 2ZZUT 2BIHA 1C5BH 4QHLB 4PJ7E 1K4CA 1CFVL 5KANG 5J0BA 1UCBH 1UB5B 2VW7A 3VXTB 2NNCA 5C0CA 2XOTA 3RFZC 4OT1H 4OLEA 1AS8A 3VW3H 2WO2B 1GCYA 1FPTH 5E2JA 4L8DA 5DLML 3Q01A 1RJCA 2BVTA 5CEYA 3PP3K 4KTEL 2DMCA 4WHYG 4Y2DA 3MRHA 2CR0A 5E2VH 3TA3B 4X80H 3AZUA 5ESVB 3EO0A 3MLRH 3MYJB 5T5NG 3OAZH 4B6ZA 1JYNA 4NUQA 4X8GA 5DFWH 3TZVD 5JNYA 2AK1H 3LHPH 3FQNB 3AWGA 4K4KA 2EDBA 3ZKSD 4CBPA 4KMTL 3NOIA 1FFTB 1CXKA 3EYOB 1AJ7H 5ANHA 2NTSP 4DTGL 5FXCH 3PJSB 1B0IA 3ARZA 4NM8L 2P7TB 2XY1A 5F6IC 1QR1B 4JN1H 1JE6A 3RX7A 3S0PA 3V95A 3PHSA 2IALA 4GBXB 4QRSB 1C16B 1OAZL 5ANMB 1LE9B 4C47A 1OTSD 1ZSHA 3HEIB 2EC9U 2JELH 3P4OA 5AW3B 3HB3D 2XVLA 5CJQL 3MU3A 2CALA 4JFQA 1DBML 5GJTH 1UH2A 3ZMEA 5FYJH 3RTQC 7PCYA 4KVNH 2OJEB 5I66A 2NXZD 1TETL 3KJ6H 3SDDD 2EIZB 4N1EA 2GSMB 1LXMA 1SJEA 3F7YA 4LSUH 3DV4B 3W38A 5F21B 3H9HA 3ISRA 1MHPL 3V0EA 2MSPA 5I2IB 1HIML 1NGYA 2E3VA 1AHWC 3ALWA 4MB5A 2ADIA 3RGHA 1PYWA 5D1ZB 1RU9L 3FOMB 4J8RA 4BH8A 5FO9B 4IBVA 3KPQB 4LSVH 4BRVA 4ETQA 2ICEA 3BQUC 5G5DB 1ZA6B 4UWQB 3S88H 1YMHA 1GL4B 4LLWA 1GC1L 4APQD 5J6GB 4Z95L 1AHMA 4TQEH 4L3CB 4NO5B 2WZ0A 1ES0B 1LP9A 1KJ3H 2XBTA 1G9MC 1NDGA 1F3DH 2FWUA 2OJZH 2Q5BA 4U1SB 5CJ5A 1UQSB 2LU3A 5CZKA 2WZ6A 4P57B 1AR1B 2H6PB 4E0RB 4NNYB 1TQBB 2BC4A 4P2RA 4QYOB 4BKTC 2D9CA 3GUTB 4BK5C 1KFAH 4KRNA 2J8UE 1JV2A 1NGPL 4GAJH 4F33A 3DRTA 1AE6L 4EUPH 4F15B 2ZKHL 3QDGA 3FT9A 2WCPA 3MZGB 3MODL 4TPRH 3KW7A 2B1AH 1DJWA 3N44F 3V0GA 5HHOD 3AVEA 2FJHB 1F11A 4FS0A 4UQDA 1UB5A 5IBUB 4Z3TA 5C0NC 8CGTA 3QXUA 4BWWA 3WE6B 1QYGH 2QR0B 3MJ8A 1H0DA 2Q7AA 4KQ4H 1A6AA 4ONOA 4QXWA 2W5PA 2GIYA 4OD2B 2JQZA 2YEVB 3X11B 3WDJA 1JHLH 4XNBA 1FH5H 1J9TA 2XWZA 3GMOA 1AYOA 4JN2A 1AHWA 2NW2A 2C26A 5D1ZI 3LVEA 1KXTB 4OZFA 2R1XB 2CHXA 3VRJB 3N41F 3AXLA 3LV3B 5FFLA 1IGIL 1UA3A 1VGEL 2DS4A 3H42L 1ODAA 4LLMB 1UURA 1D7DA 4W9HC 3FFCE 5GS1A 4WUUE 1I3UA 2ZP0T 1TQBC 1E4KC 1RSFA 1WISA 3B5TA 5D5ME 5IJDC 2LOEA 4G6JH 2A5UA 5BZXA 1JHKL 1I1AA 4UT9A 4CMMB 1C9SA 5DEFA 3ZE0E 3GHPA 1J0KA 3SDCD 4HSCX 1WZLA 3AAZB 4JCMA 2QZQA 4OCWH 2FQFA 5FKPB 1CMOA 4C4KT 2FB4L 1XGUB 4OGYL 2E6JA 4JJHA 1QLFB 2VLJD 4WRLA 1N70A 5KWYC 4JVWA 2GJRA 4J3VA 1ASQA 5K9QG 2YGVA 1Z2KA 1W0WA 3LNHA 1Q9LB 3RUGE 5JHBA 5EU4A 2JCCE 3UAFA 3J8F7 1VFUA 4HS6B 1MLCB 5E00A 3BUIA 5DT1H 4Y4FC 5GQBA 4JX0A 5KSBE 4YBQD 3OSVA 4KBPA 3GZOA 3DK2A 3WEMA 4UQ2A 4TVPD 4F92B 4HX1B 5M7QA 1HQ4A 3V5KA 3IN2A 4FQ1H 2OX5B 3O6KH 2VC2H 4OCYL 4U6HA 4FEMA 3C6LA 4L4TD 4YFLF 3CH8A 3FNKA 5DQDH 5GZNA 2Q10A 1BM3H 2JXMA 5ETUB 4LBAA 1SY6A 4G6FD 3U1QA 1PF3A 1FL6B 3WFHA 2JJVA 2X05A 2OQJA 4ERSH 3S98A 4W9CC 3QPQC 1RD6A 5DCCA 3HN3A 3LY6A 1UKQA 1YHPA 5TPWL 1W0VA 1Q1PA 3MROB 5T1LA 5EBMB 3ZJAA 5KW9L 2GJ6B 5CLYA 3CDGB 1OK8A 1UVQA 3V4PH 3CFBA 3C5ZA 4Y2DD 3ECWA 5IM7B 1VFAA 1J9QA 4RZCB 4D9RE 5I1HH 3MHZA 4OF8A 3LZFH 1MFBH 4KNUA 3WDIA 3CHQA 1O7DC 1T2QH 3VWKC 1AQKH 1CURA 3C9NA 1A7QH 3U4KA 3QUYC 2CDEA 2V5TA 2XIIA 3QDAA 1VZHA 4UYQA 5TQ0L 3FUDA 1QHOA 2PETA 1TKWA 4QRSA 4UT9H 2MTAA 4M5YL 4GI8A 2Z0UA 4XMUA 4GG6A 4OZ4A 4BQ6A 3BIBX 3W0WD 3LMJH 3W37A 4YH6A 1WAPA 1YEIH 2GBUA 2WANA 4K5PA 4L8CB 1JWSB 4X7TB 4CVWA 2EE2A 2PYEB 1D5BA 3BN3B 1DL7H 1WFTA 1RKRA 3FO1A 1HVXA 3MNZB 1ODUA 4IRJD 4P5TB 2E9IA 4DN4H 2JTYA 5BRZA 4H8WH 2EC9T 1DR9A 1AXTL 3DO4A 3QG7H 3B5HA 4J3OC 2F1EA 1GSMA 1NMCB 4ACPA 4H26A 1JFHA 4KUZL 4MAYD 4ISVB 3L3IB 1GOGA 2Z35A 3C8DA 3OVUB 3IJ7A 4FQJL 2Y3NA 4D9QD 5F7MC 2YXFA 5FW7A 2D7PA 3VI3F 3QR0A 3DX8B 1GGIH 4GUPA 5F9WB 1BVNT 5DURD 2F8VA 3SKNA 4LLVB 5TDNA 1GTNA 3KVDD 3MRKB 4Z3HA 5EO0A 3LIUA 2A9NL 5KYNA 1K3ZA 2RA1A 4PGEB 2XN2A 4AXWB 4XVJL 5C0FB 1E8XA 2DI9A 3O2WL 1DN0B 4L4VA 3SKOA 4F7MA 4PW4A 1L9MA 2Q1EA 4JQVC 1MJ7H 5CS7A 4CBZA 3TT3L 1S46A 1I9JL 3UTOA 2Q76B 3RDTA 5IOKA 3AXHA 4PP2A 3MMEB 4JFSA 4D9LL 4E9QA 2ZF8A 4H88H 3VXOB 1I7UA 4POZD 2IALB 1D6EB 2KMWA 3UBXA 4AYFA 2BSSA 3NZ8B 3T4AC 4APQB 5B3JF 4ZTPH 2LABA 2DQCH 4XI5D 3LH2H 1XTLA 1HTYA 4OLXH 2AEOA 1XVSA 3SB3A 4WI0A 3C60D 4MLIA 4C56E 5AYQA 5C3TA 4F2MA 1JGUL 4JQXC 5DTFA 1IEHA 3T77B 1TENA 2AK4A 1KZQA 1XGTA 5KS9E 2AJZA 5T3XD 4XN1A 1DYZA 3SDDB 3BPLB 1CD8A 4NEHB 2NXZB 5E6ID 3QUHA 4YO0B 4Z0BH 2X4SB 1PW3A 3DO7B 4BCXA 4Y2DC 4UOJA 2E8YA 3VRLF 2EKSB 4XPHL 1TU2A 4FLQA 2ZP8A 3O3AB 5C6TL 4Y9EA 1A8ZA 1UXWB 3A4EA 1BFTA 4RMVA 4CILA 3HBPA 3HFFA 3NSCA 3RPBA 4HALA 2AV1A 3CFCH 2QHLA 3DKHA 3KEHA 1AGFB 4P4RB 1FNEA 5LQBL 1RFDH 3TEZA 1H9DA 4KOBA 1BJ8A 4XVTL 5DMGC 3QULB 4L1DA 1E9OA 1MQKH 1N8OE 4N6QA 5CGBA 1N7MH 3MV9E 3QQ9C 2UZPA 5EB9A 4CJ0A 4L2LA 3KXFA 1XF5A 4OIIL 1A5FH 2JKNA 2QMJA 4X4ZA 1R5IA 5JHDE 4M5SA 1E4WH 1P5VA 3V5KB 3NEXA 4PJGE 1CFTB 3F01A 1WIOA 1NKRA 1O5PA 3BYYA 3SQBB 1QQDA 1U8LB 4BQ8A 1U8MB 3ZKNC 2WXPA 1UKSA 1MUJA 2R0ZL 1NCOA 1P4UA 4JG1H 3T1FA 5D1ZC 4XBEH 4L9DA 1AHWB 5CJXA 3EW3B 5D1XB 4LL1A 3SKOB 3D69A 1N64H 3NYKA 4KDVA 3ESVF 1KBGL 3ARSA 4Q2ZA 2FD6H 2R2EB 3AUVA 4WIQA