1IUZA

Plastocyanin
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
98
structure length
98
Chain Sequence
b'AQIVKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETVVRKLSTPGVYGVYCEPHAGAGMKMTITVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Novel insight into the copper-ligand geometry in the crystal structure of Ulva pertusa plastocyanin at 1.6-A resolution. Structural basis for regulation of the copper site by residue 88.
pubmed doi rcsb
molecule tags Electron transport
total genus 23
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1996-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1iuzA00
3FQYA 3ZBMA 4E9SA 1JZEA 2PPCA 3GDCA 2ZOOA 4CSPA 2DYRB 2FT8A 4YVUA 1MZZA 2GC7C 1PZBA 2MTAA 3KW8A 3T6ZA 1NZRA 1AZRA 2UX7A 2B08A 1PZCA 2GBAA 2QPDB 2W88A 2CCWA 1UATA 2FQFA 2IWEA 2JKWA 3TU6A 2YXVA 2QDVA 2I85A 4UF7C 3H4FA 3PAZA 5AKRA 2Q5BA 2AZAA 5B7EA 4N4YB 2BHFA 3S3DB 4AZUA 2TSBA 4DP5X 1QLEB 3FS9A 2GC4C 3FSZA 3WI9A 5D4IA 1RZPA 1AG0A 3HEIB 3CVDA 4Q89A 1J9SA 4E9TA 2BP0B 3CVBA 4ENZA 2YAHA 3QQXA 2HZHA 1AS8A 1V10A 3UGEA 4L0PB 1OE1A 1OE2A 1SF5A 1V55B 5AZUA 3ABMB 1XB3A 4G7SB 1TEFA 4TXVB 5F7BA 2FQDA 3WKQA 2CBPA 1J9TA 2HRHA 1GW0A 5B1KA 1NDTA 2IDTA 3RYMA 2VMJA 1AS6A 3AZUA 3FPYA 1IKOP 4F7KA 3FU8A 2BW4A 4F2EA 3NSDA 4G71B 4NERA 1PZAA 1RKRA 4E9YA 4Q8BA 5I5JA 2H5UA 5B1AB 4KO6A 3FSAA 1ZPUA 1GS6X 3QJQB 3JTBA 1CURA 3WNIA 1AANA 4HCGA 1L9TA 5AFAA 5FC9A 3TBBA 1ASOA 1QNIA 3QJVB 4E9VA 1HFUA 2FTAA 2IH8A 4KO9A 1GY2A 2AFNA 3BVDB 1J9QA 1JVLA 4FA7B 5B7MA 1KCWA 1JERA 3FU9A 1GY1A 1OCOB 2R7EB 3DTUB 1JOIA 4W9ZA 1TEGA 1A8ZA 2IWKA 3WIAA 1CYXA 1L9SA 5ANHA 4A2EA 4E9QA 2CJ3A 1PNDA 1HAUA 2BWIA 1NWPA 1GS7A 1KBVA 1SNRA 3QJUB 4F2FA 3CDZB 4KOBA 1SFHA 2Y1AA 4HCIA 7PCYA 1DZ0A 3D12B 1J5DA 4RH4A 4KNUA 4AKOA 3G5WA 2XLLA 1AZCA 3OMIB 3FSWA 2I7OA 5B3SB 1NICA 2YAEA 3ZIYA 4HALA 1ADWA 4HHGA 3N55A 2H47C 1RZQA 2IH9A 4X4KA 5B1JA 2GHZA 1NINA 2DY2A 1EHKB 2CUAA 1KCBA 2DV6A 2IWFA 2X88A 1GSKA 1E5YA 2XUWA 3CVCA 3DKHA 2BP8A 1OCZB 4A66A 1EZLA 1OV8A 1ZDQA 2XV3A 1AACA 1L9RA 2GIMA 3IE9A 4KO5A 1XB8A 1PLBA 1IUZA 6PCYA 3S8FB 2PPDA 4G72B 2FT6A 1PF3A 3IN0A 5E9NA 5D4HA 3AG4B 2QT6A 1OF0A 2YARA 3MBWB 1L9QA 1WA0X 1ILSA 1PY0A 2PPEA 2XVBA 2PCFA 3V9CA 4KNSA 3AY2A 3ABLB 3CG8A 1E30A 3AG1B 2HX9A 3EH4B 3ERXA 1JZHA 3X1FA 2PP9A 5IY5B 2XX0A 4P5SA 4YSCA 4P5RA 3FU7B 3NP4A 3UACA 4A2FA 1PLAA 2GB2A 3ABKB 1AAJA 1JXDA 3UAAA 1PNCA 3FQ1A 5F7AA 1KV7A 1BYOA 1W8EA 4AKPA 1E67A 4YSDA 1AOZA 3T6VA 5I5IA 1JXGA 4A2GA 4KOCA 2PPFA 2Y69B 1XB6A 2AVFA 3JT2A 2ZXWB 1F56A 3TASA 1NPJA 4DP8X 2W8CA 1SDDB 3NJHA 4BK5C 1I53A 5I6NA 1AR1B 4YSQA 4WKXA 1NIDA 5I6PA 2LLNA 2NRDA 2PCYA 2WO2B 3PPSA 1OCRB 3N2JA 1IBYA 3PAVA 2DWTA 3PXLA 3ZX1A 2QDWA 2MRYA 1BXVA 4BWWA 2J5WA 1TKWA 1A65A 4JHVA 1L9OA 2E86A 5PCYA 3T6XA 1N70A 2VM3A 3NJFA 5EHFA 4CSZA 4DP6X 1ET7A 4DP2X 1IBZA 4ZK8A 1ET5A 1MZYA 3NJKA 1FFTB 2JXMA 1ZV2A 4BDVA 7PAZA 5B1JC 3FYEB 5I6MA 3QJSB 4YSSA 3NT0A 1RCYA 1SJMA 4E9RA 4DPAX 1ASPA 1E65A 5TK4A 2ZONA 1ZDSA 3ASNB 3OD3A 2EIMB 2HRGA 1MG3C 1KYAA 1PMYA 3TBCA 2YAOA 4BWUA 4M4RB 2VSMB 3FYIB 1MDAA 3GXUB 2PLTA 9PCYA 2B3IA 1AS7A 1SF3A 2CAKA 2PP7A 1BXUA 1JVOA 3AW5A 4GP4B 1JZJA 4HIPA 4BXSV 3H4HA 4YVNA 3NJLA 2IAAC 3OMNB 4M3HA 4W1TA 1AQ8A 4K9JA 3L45A 5LDUA 2BP0A 2XWZA 1AG6A 4KO7A 3OM3B 1ET8A 2EIJB 1W6WA 2H3XC 3ZDWA 3PCYA 1ASQA 1BQ5A 3FT0A 2EILB 1A4CA 1DYZA 4GY4A 4QKTA 3PAUA 4UAHA 4E9XA 1GYCA 2J56A 2J55A 1ILUA 4YSPA 1NIBA 3WNJA 1SHXA 4N8UA 1NIEA 2VW7A 3EF4A 4NAJA 4YSRA 1NTDA 2OCCB 4DP9X 3S3BB 2YAMA 5D4JA 3EH3B 3NJGA 5PAZA 4GP8B 4GP5B 1V54B 2IDFA 2YAQA 2IDQA 1NIAA 4KNTA 3QJTB 2XU9A 2XV2A 3X2QB 3V9EA 2FNWA 3EHBB 3SBPA 3IN2A 4G70B 1BXAA 1E5ZA 1R1CA 2AANA 2R7EA 3X1GA 1AZUA 2PPAA 2XV0A 5I6LA 3NJNA 1QHQA 2UXTA 5I26A 3FQ2A 4AKQA 3NSCA 1WAEA 1X9UA 4YL4A 3CDZA 1WS8A 1W6LA 2UXVA 3NJJA 4GYBA 5B1BB 4WTQA 2BZ7A 2VW4A 4NB7A 5I6KA 1L9PA 2DYSB 2FJSA 3UAEA 1YLBB 3S8GB 1BQRA 2UXFA 2VSKB 5A7EA 1ZIAA 1WA2X 1HAWA 3WKPA 2OV0A 2GI0A 1PCSA 3ABGA 4QLWA 3UABA 1A4BA 4A67A 3FSVA 4DP0X 4JKNA 3T6WA 1NWOA 1PAZA 1AIZA 2IDUA 1TU2A 2UX6A 4DP4X 5I6OA 2HX8A 4MFHA 3BQVA 4HCFA 1KGYE 3NJIA 2CALA 2VM4A 4JHUA 1M56B 2BP8B 1BYPA 4HAKA 1VLXA 2BW5A 4YSOA 4A2DA 1ZIBA 2HX7A 4YSUA 1IC0A 1WS7A 6PAZA 2IDSA 1JXFA 1B3IA 1J9RA 3CZUB 3EH5B 3T9WA 4HZ1A 3AG3B 3X1EA 1BQKA 1OE3A 2XYBA 4AI7A 2VW6A 2YAFA 1A3ZA 2BWDA 5I28A 3IBOA 3SQRA 2UXGA 2OJ1A 1A4AA 1JZGA 4DP1X 2XXFA 3U25A 4G7RB 3WG7B 4DP7X 4FAAB 3FU7A 5TK2A 4BWTA 3NJMA 1J5CA 2TSAA 3T71A 4YSTA 3NP3A 1ETJA 1CYWA 3PLYA 1FWXA 2X87A 3S3CB 2FWLB 3X1BA 1PLCA 3UADA 1M9WA 2VN3A 2XX1A 4GXFA 3H56A 2WO3B 4PAZA 5I5MA 1OCCB 3OQRA 1OOWA 3MX0B 3OMAB 4G7QB 1NPNA 2HLEB 2QPEB 1KDJA 2BO0A 4UANA 2PP8A 4BXVA 1JZFA 1SDDA 1URIA 2GSMB 3KW7A 3QPKA 3QJRB 1GR7A 2BZCA 4YSEA 4HHWA 4YSAA 2HXAA 3X1NA 4A68A 1ID2A 1SFDA 3NSYA 2J57A 2DWSA 1KDIA 2RACA 1T5KA 3C75A 4PCYA 8PAZA 2AZUA 1MG2C 1BEXA 2N0MA 2YXWA 4EF3A 2JFCA 2FQGA 1GS8A 1JZIA 1AZNA 3SBRA 4A2HA 3HB3B 1SHWA 1WA1X 3ASOB 1BAWA 2P80D 3IEAA 3NSFA 4AX3A 1CUOA 2FQEA 1CC3A 1KBWA 1NIFA 3TA4D 1N68A 2EIKB 1FA4A 2XXGA 1M57B 2A3TA 3AG2B 2I7SA 4DPBX 3DIVA 1X9RA 2ZWNA 3FPXA 2FT7A 1AZBA 2YQBA 1XMEB 2EINB 3SBQA 4E9WA 3NYKA 3GYRA 5B7FA 2Q9OA 4DPCX 2WSDA 2P80A 2YAPA 4BDVB
chains in the Genus database with same CATH superfamily
1JS4A 3FT1A 3G08B 4LRNL 5DHVA 1F4XH 1UQSB 5E6YA 1QFWL 1A7NL 2VDNL 4ES9A 2GC7C 5DXWA 1MCPL 3GIVA 4P2RA 2BNQB 4XVJL 5D5MB 5ILTH 1X9LA 4N2NA 3OF6A 1T1ZA 2B59B 3VFVA 3ZE2B 1SXSA 2W88A 4QTIL 2WN2A 2UY7B 3GHBL 4WDIB 2W91A 4L4JA 5EBWA 2ICCA 3LS4L 5L6YL 5DK2A 2QDVA 3KPRA 1JZ7A 4ZPTB 3ATBA 5AKRA 1NCOA 4AYEC 5C92A 4M5ZH 2VQ4A 4RMUA 1IAIL 3HZKB 4DP5X 4I48B 1FNEB 3FS9A 2GC4C 4KZDH 2FLRT 1T1YA 4ORGB 3BDXA 5D2NC 2J6EL 3OKDA 4XT1C 1J1PH 3BWAA 4E9TA 3H7LA 5DGQA 2H45A 3TV3H 4GG8B 4HEME 2H1LM 2VAJA 3SPGA 2R8SH 2LT9A 3IFNH 1KTLA 1Q9OB 2YMXH 3QT2A 1Z5LB 2HN7A 1AZZC 2BSRB 1CICA 2G9KA 2CR6A 4P8QA 5FYJH 1JGIA 5AW0B 2ZWZA 3V95A 1NCDL 1ZMYA 2A6IB 4JG0H 4LPXA 1AGBA 2Q1EA 5T1LA 1LEKB 5FF6A 2YA0A 2EVHA 2F54E 3VX1A 1KBGL 1L0PA 2A38A 3P73B 4QHLB 1OXYA 3CFDA 2X1QA 3AZUA 4ZS7H 3RGHA 1YUKB 3FUJA 4HKBB 1EFXB 3T2LA 3SJVA 1ID5I 4PJ7A 4X6EB 5EU6D 3FHAA 4D0DB 5MHSE 1MCOL 4QJ4B 2NYYD 2IQAA 3VD5A 3GC3A 4FDWA 5FCSH 3UZVB 1ANUA 1J5HA 5FECA 3BUYA 3V0WH 4HGWA 2VDPH 3QDGA 4HCGA 1L9TA 3LOWA 1DVFD 2EAEA 1QNIA 5HGAA 4KAQL 4MA1C 1L9MA 2WQWA 3VSUA 4M7KL 4Z18A 3DTUB 4L8SB 2FWSA 2OR7A 2ZPKL 4GQPH 3VU1A 4XPHL 3EYOA 3U2SB 3KPNB 2DJMA 4PJ5E 2WXKA 3VQMA 2AS5M 1I9JH 2CJ3A 2J88L 2ED9A 3NN8A 4IMLB 1VADB 4WI6A 5HHPA 1AO7D 3LVEA 4PJ8D 4N2LA 5LNEA 4LEXL 2WGXA 4ZMNA 1J5DA 3CXDH 4QR7A 5EORH 1ZK9A 3NCWA 4TUJB 2Z8RA 3FSWA 4EVNA 4BZ2H 2FX8H 2ZUVA 1V7NH 4LASH 1HKLL 2F7PA 5LCVL 3MLTB 2H47C 2IH9A 5IG7A 1X5IA 2DY2A 3L3DB 4MNGE 2X88A 5D6CB 3EJSA 2IALB 4JFQB 2W80C 4DKFL 4IKKA 3GLDA 1UT9A 4M7ZB 4ZMZA 5IP4A 3PV6B 3EFFB 3V5HA 4H8QA 1KYOK 2K4WA 1RZGA 3R4DA 3IGFA 4WEMB 1GKOA 3PWPB 1RK0A 4HU2A 5FWRA 2XRAL 3S8FB 1AE6H 3IB4A 1LO2L 1BBDH 1DQQB 1WRFA 2VL5A 3BP6A 1VFAA 5HYSG 5GGVL 5F71A 2BERA 2XZQL 3FCBA 1HEHC 1K8IB 2YBRB 4KQ4L 4P3CH 1VEMA 2OXHB 2YR3A 4BFIA 4UDUA 3ZW3A 3C60A 3ROLA 1CXHA 5G2NA 2PYEE 4XCCL 1H5BC 4NCC2 5BVJA 1N8ZB 3L7FB 4ODVH 4WUUB 3FN9A 4UQ9A 4B27A 3ZY7A 4Z5RB 2QSCH 3FMGH 2VAAB 3IGAB 4TUOB 3SE9H 4AW7A 5ENWA 1UWYA 3OLDA 5GS0L 5KZCD 3PDDA 4XXWA 2NX5D 1RZJL 1JXDA 2CBTA 5F21B 3QEHB 3EHBC 4CU8A 2K4AA 3MV8D 4PRBA 3MRPA 4AYBA 4N2IA 1CLVA 4G6FD 3HRPA 2QR0B 4R0LA 3BPCB 1SJHB 4NQCB 1QSEB 3MUZ1 1D9KA 5GGSY 1IEHA 3O8XC 3W9DA 5FW6A 4FG6D 4NJAH 15C8L 4P23B 2WQAA 3FFOA 3QUYA 3O3DB 1X5LA 1A6AB 1BX2B 1E9QA 1SDYA 3B7SA 4UTAH 4HP5A 2EO7A 5I6NA 3GSVA 5E4IA 1H15B 4HSCX 2EDRA 2NRDA 3VFMB 1FNSL 2BSSB 2XBZA 2YGOA 5H35B 5JQIB 1M1XA 3EO9H 3ZX1A 2NLJB 4JFEB 2FWUA 1U2HA 3BPLB 5DO2C 1WWAX 3IMTA 2YEZB 4D8OA 3VUAA 3RL2A 3ZDYF 4CL7A 4CSZA 1WISA 2FEEL 5CGBA 5GQBA 2E6PA 1ET7A 4DP2X 5L4MA 4R7XA 4EI5D 3NTCL 5KSAB 4ZK8A 3MJ9A 3O3EB 1P0SE 3PDGA 2WKLA 5KJ4A 1KYUA 1B4JH 3HC0B 3C08L 4H2CA 3BUTA 3RWDA 4RIRB 3MLXL 4ELMF 1GMEA 5BS0A 3IYLW 5DSCB 4J3TA 3AY4C 3TN0D 4KQ3H 2JCCA 2ZONA 2AC0A 2FR4B 5I0DA 1MG3C 5JPNB 3TBCA 2WMPA 1SHSA 3EJYD 1LDPL 2EDDA 1M6OA 5JHMA 5JDJA 4TQEL 4KZ0A 4BKTC 2KL6A 2Y5TB 1S7WB 3QH3B 3V6OC 1X5YA 4IRJA 3MCKA 2FEDC 3B9EA 3FQ4A 4RA0C 3BAKA 4XCNA 4AQ1B 1NBVL 4DN4L 5EA0L 5JHLH 1FORH 1JV2A 1U2YA 2WHVA 3MOAL 4FULA 5FHBH 4K5MA 4UDTA 1M1SA 2YPVL 3VD1A 4NI3A 1EHLL 3BSZH 5IESH 4FADA 4PRHE 4J8RA 4NUJA 1AQ8A 5AVXB 1N5AB 4GRLB 1FL5A 1RIHL 1HZHL 5FYKU 1HJCA 4PJ9D 1LK3L 4J2QA 2HVKA 2EIJB 1NC4D 2BS71 1H8OA 3TGXA 5ANMB 3LPWA 4HF5H 1I3RA 5T1KD 3GXIA 4AYID 2C7UA 4ONOA 3DXAA 2JI2A 1JK9A 1AQDB 4PW9A 1CT8A 1FV1A 2NNFA 2GTZB 1ITBB 2ATPB 5MEQA 4UB0L 3K71B 3IGLA 4XP5H 1URZA 2ZUYA 1IFRA 5DJ8A 3LZPA 2EE9A 3RA7L 1Q0YL 1Z32X 4AW4A 3PWLB 2WSPA 4NZUL 3VG9C 3H9SB 2XWTA 2UWEF 1KJ3L 4BUQA 5JOPE 4PD4J 2YFOA 1QEWA 1P5VB 2YPLE 3HS0A 5I1LA 1EEYA 2EZ0D 3THMH 2XZAH 4NO0A 4KKCC 1EJOL 3P4OA 4HSQA 4P4KC 3C09B 3PJLA 1YEJH 2Q3ZA 3LNEA 3P9MB 1W72B 4LVOC 3KLHC 2ZWKA 1CDGA 1KCSL 2F74A 2XV2A 3AUVA 3KPQB 2E9JA 4LDEB 3BQUD 4N3UA 5A2FA 3IT8D 5I1CH 1A47A 4WU5A 4POZD 3GRWH 5IFJA 3SYCA 3NPSB 5DFVC 3CZFA 4Z0BL 1AGCA 2PXYB 3GRGA 1F00I 1FNGA 4GOSA 3SKJL 1QTPA 4F80A 4JHWL 1MCBA 1VEPA 2D9CA 3AU1A 3UDWA 3CDZA 3NJJA 3JWOH 2HMID 3TOPA 1KN4H 1ZLVK 1YY8B 3E6HB 3K5SA 4KJWC 1A7RH 3IDIB 2CR3A 3ATDA 4L3EE 2LTQC 4KXAA 1X44A 3IDNB 4PWEA 5EWIL 1BQHA 3L9RA 1OKEA 1KCVL 1D5BA 5C97A 3BSGA 1QBML 5JQ6H 2ODHA 5I1AA 5GRWA 4LLAA 3ABGA 3FTYA 4MS8C 5F96H 1FYTA 1FFNA 3QWOA 1W0VA 5DD0L 5C0AE 4DP0X 3MFFA 2YK1H 1WITA 1H6TA 1NWOA 2X89D 4DPRA 1N64L 2FBJH 1NSNL 3LNFA 4UV4L 3PGCA 5AKSA 2UX6A 3JWNG 1KXTA 3UTTB 5AKTA 4DETA 3X3GL 4P57A 5I6OA 3L1GA 2YC1A 4NHUA 4HCFA 4FC3E 1QKZH 4HHAA 2VR9A 4M48L 5J6HA 4F7MB 5JIHA 4JHUA 1HWGB 2OI9B 4ZFZA 2C1PA 4HAKA 1YO4A 3MUHL 1ACXA 4IKLA 4PP1D 6PAZA 2IDSA 1J9RA 4PWFA 1LWHA 1F5WA 3K2IA 4RSYA 5DRWA 3LEVH 1I7ZA 3A4FA 3FO0L 4TQIA 3HC4L 4W9KC 3TYFB 1RPKA 4QT5B 4X6DA 1VFBB 5AZ2H 2YKKA 2IH3B 2VDNB 1T1WA 3OXRA 3JVFC 1KLGB 3BFWA 4JY5L 2X6CA 1C5BL 1TJXA 3ECBB 4NQED 4PJBE 3X1BA 3SGJA 1RK1B 5IB4A 4Z3JA 3BIKA 3ZTNH 2EUXA 5KS9E 5C0EA 1L7IL 1UOKA 1NEPA 4AM0B 4A39A 4YNYA 2FZ3A 5E9DB 4WWPA 2N1TE 4WNQA 2HVBA 1HI6B 2EDEA 3DNKA 4MDRA 1X5AA 1T6WA 1UKSA 3DI3B 4LVNB 4NBXB 1D5ZB 3QYNA 2BOBB 3IFOA 4PJAE 2BSEA 1GR7A 2IPTL 4KJPD 3CZEA 1F11A 3D48R 1O9ZA 1SFDA 3BI9X 4GSDL 4NO5A 1QTYT 5M95B 4OGAC 4OCXL 1N7ML 4UQEA 4JJHA 4PWKA 4P48A 3VI4F 1YPZB 4XNQB 2KZ1B 1BVKA 1QASA 4PRDA 1G9EA 3DX7B 2GUYA 3M1OA 1IEBB 5D7JC 3TEYA 2ZOWA 4X6BA 5I8EA 4KZCA 1IEAA 4YEFA 3AITA 5DZOA 4OM1H 4ACPA 2MCG1 1CUOA 5A2BA 3I02A 4NNXB 3WY2A 2GPZA 4GXVL 5SWSB 3LIUA 4XWGL 5F0LB 3SGEH 4C56A 1FLTX 2JJTC 3H9HB 4KKBC 4HYTB 3CLFH 3O11A 1G7MA 2ALAA 4PREB 5DLML 5TDPA 3MRDB 5GRUL 3DMMC 1OB0A 4ODTH 5IK3B 2ZAHA 1EQWA 5FYJE 4JHBA 5EU5A 3K6FA 1UWXK 1XCQA 2GJPA 5F7KC 2IO5A 4R96A 3MRCA 4BDVB 1O9WA 2AAVA 3INUH 2NUPA 3OLGA 4UM9D 5C3IA 2TAAA 2CIIA 5HJDA 4HPYL 4TQHA 2GT9B 1YEDB 1JFQL 4NSKA 3KW8A 5GGTH 5E00B 5EZOH 1CLZH 2B1AL 2ICWI 4P46A 1IC7L 2MPAL 1TVDA 4O9HL 5DVKA 2QQQA 4KH2A 4Q6IA 5JQHC 2HT2D 4EO5A 5IW1A 1TJHH 4BGDA 1DVTA 2FL5A 1PG7L 3P30H 4K3EL 1QMUA 3TJEH 5IEKA 7FABL 3EBHA 2BC4A 4U6YA 2IAMC 1CG9A 4OZHA 1HSBA 4Z7QB 5ACZA 2CKBH 2PW1B 3IRZA 3O6KL 4LL1A 2VLKD 2FIKA 1PGRB 2Y72A 3KPTA 4DGWC 1NKOA 1PX8A 3BVNA 4I1NB 4YXKL 5AB0A 3U4KA 1HC1A 1GIGH 4HULB 3CHSA 2BNRE 5A2IH 2X40A 1Y0LB 4Q89A 1J9SA 3UBHA 4UV7L 5BRPA 5IWLC 4A04A 3UTPE 3DK2A 2YAHA 5F9JB 1AS8A 1FLRH 3EJZC 5F7UA 3JWDC 4WW2C 5DMGC 2DMHA 3PF2A 5KBMA 2QVTA 1A6TA 2AJYH 2E75C 3QNZB 1CFQA 4X50A 2FECI 3D0VB 2P8PA 1UYWH 3BUBA 3EYVA 3MA9L 2LLGA 2V8LA 4O51B 5DUBB 5EU3A 3TCLB 5EO0A 4PJ6A 1IGYA 1E5BA 3BAJA 3CXHJ 4XAWH 2EXYD 1BW8A 1MCSA 3HTLX 4KVNL 3TIDB 4ZAKC 4KV5F 2V2TB 1A5FH 2FRGP 4KWUA 2I27N 4HMDA 2LVCA 3QWNA 1SLUA 5HDQL 1SY6L 4GXUN 3S34H 8FABA 1QW9A 2ROXA 4KO6A 5MENE 3RLSA 1OAZH 3GSNH 3FUHA 4PTTB 1CURA 1U8JA 1YY9C 3ESOA 4RFNC 3U0WL 3MRNB 3KWUA 3RUGB 1GY2A 4LKXB 2BS9A 2GY7B 1IX2A 1E9PB 3F04A 3QXDB 2ORBH 4NT6B 4ZUSB 3RVXC 4XMKH 3AM8A 4NWUL 4HLEA 2A7BA 3NBNA 1EAQA 3MLZH 2OMUB 1L9SA 4R5XA 1J8HD 3OKKB 5ANHA 2FSEB 3LZQA 4D0CA 1JHKL 1NGYA 3PP3H 4N0UE 3WJLA 5I1GL 4Y2NA 3SGKA 4OQ1A 5I0VA 3D69A 3PHOB 5CLYA 1E6OH 2X4NB 4Y16B 5HDWA 3U0TA 4S10A 1IFHH 3W38A 2Q76A 4J2XA 5JXAL 2OMTB 4K23H 2R2BB 4OFYD 2VYRE 2AEOA 3CK0H 2YO3A 1KIQA 4PRPB 4DW2L 3RZCA 3VH8A 4PEEA 4QRRB 5IV2B 3L3KA 5ACLA 1DFXA 5E24E 2IPUG 2F18A 4Y7MA 5DQ9B 4ZSOE 4KHTH 4FQXC 2X2IA 5C86A 5DJAB 1AACA 2GIMA 2JLPA 1IBHA 3OJVC 3JWNH 3N44B 4MXWH 1L7TH 3WKML 4X5WB 2H2PD 1IUZA 1CBJA 3F7QA 1BZQK 2N7BA 3SGDI 3BH8A 3QIUD 4QRSB 4EUPA 3K8LA 4DEPC 1E6JL 5FKAB 4Y89A 4DQOH 2QT6A 4PFEA 3LXBA 3VWKA 4TPRH 1WA0X 5FUZL 1CICC 3GSQB 3NCJL 3B4NA 3ZRCC 2CMRL 3VGAB 3EG9B 5IJBC 5DHYA 3O3UN 4OUUA 2IG2L 3BW9A 4PJXA 3ZT5A 4PUBH 3MAWA 3LZFH 3GPEA 1MAKA 3QIWB 4NGHL 3WNOA 4IU2A 1NUNB 1CE6B 1EJ6A 1SOKA 3QFJD 3V6ZB 1BLNA 3GFUA 2P8MB 4NM4H 4PJEB 4BZ1L 4Y4HA 2A1WL 4E41A 4HS3A 3WIHA 3S35X 4NQDD 1E67A 3OKNB 4ZUUA 2ZF9A 4N26A 3PWJB 5BRZA 4OIIL 2E9GA 5I1DA 4OI8A 3JTSA 1DO6A 4J4PA 4KBPA 1PEZA 1QATA 3P2DA 5D7LA 1AR2A 3FFCE 1DCLA 1T0PB 2APXA 4XCEA 4AT6A 4FJYA 1KY7A 4WEUD 4IIQA 3KYOB 1HJBC 3WTUA 5IMLB 2ERJB 5CFAA 4O02H 4FI7A 1TQSA 3S3SA 1IBYA 3EYUL 3PAVA 4DKTA 2AMGA 3AS3A 3Q2VA 5EU6E 3W82A 2VZ3A 1UM4L 3SDXB 5KTEH 2OJZL 1A65A 5F97E 1KNOA 5IMOA 4C47A 2A99A 2E86A 3K80A 1NAKH 1CGUA 1LQSR 5EC1B 3NJFA 3MNZA 4DVBA 4OI7A 3RRQA 2HCZX 1L0YA 2BNQD 2D2CC 4Y8AA 3RWFA 3JV4A 1SUJA 3N04A 5TH2A 2P5PA 4RESB 1JCKA 1OPOA 5CINL 4I5BA 4X4XA 4H8HA 1C12A 4LSQL 1T0MB 4HK3J 3ZE1E 4LEOA 3NQKA 3HZYA 4KMTH 5KAQG 1EMTH 3HG4A 5T1MA 4YPJA 1CYGA 4WW2F 3RY5A 4M62H 2IJ0C 1OB1A 1WO2A 1FSKC 1AO7E 1G7IB 2BHYA 2HJLB 4G8FA 3FFDB 4Y5VB 4JO8A 4LF3A 4L18A 3ZZQA 1R5IB 5DA4A 1ZLSL 5F7EL 3SB3A 1R9FA 3NMEA 4PJHA 3S36H 3CFCH 5IM7B 3UEQA 4G6JL 5ICZB 4JZOA 2IADA 1UZ6F 1FL6A 3HI6L 5DO8A 3RGBA 3U82B 4FYRA 1HHGA 2MCPH 3K4AA 3H53A 1WTLA 3C60C 4PP2A 1G1YA 3UBXB 2TRHA 1M42A 2Y2WA 3H0TB 3OMNB 3VFGH 2P8LB 4OQTH 3KPPB 5KSUA 2EEAA 2EVFA 1IKNA 1P69B 4S2SA 1GGYA 1HSAB 2VOTA 3U6XS 4ZNCD 4X80H 1U8NB 3OPZL 4AIZB 2NOYA 5CFHA 2PTUA 4IOFC 2P3YA 2YBGA 4I8DA 1CDBA 3PL6A 3ZMRA 1EFXD 4WZ9A 1EUUA 4XXWC 5C70A 1QD0A 1G6RA 4YK4C 1CFBA 1PYWA 4HS6B 1MY7A 3F65A 1BM3H 4XNZB 5B3NA 2YWYA 3ESUF 3F7VA 4NRYB 4RZCA 2R2HA 1GYCA 2J56A 1CE1L 4R0LC 1CQYA 4YR6B 3O9WA 3U6RB 1TIUA 4WKZB 2EE3A 4FNTA 2G5BA 1J1XL 3QUYC 2E7BA 1CJYA 4PJFA 4Y19A 2BSTB 4YSRA 4OR1A 2DF3A 4W4OA 3S3BB 5E8DH 1EZVY 3SE4C 3I50L 3AROA 1WQVT 2BFVL 1EZVX 3MLUH 4U6HB 5FDWA 4KXCA 4NYLA 2WAQA 2F19L 3FJTA 5BZDB 2IDQA 3FUFA 1VPOL 2YUXA 2WLIB 2Y6TE 5DQDL 5C0FA 3Q8EA 3ULVL 4FCAA 3SDYH 3LKPA 4JJ5B 4AC2A 1B2YA 2ZKHL 4LSRL 4X7DC 5C9JB 2UV3A 4QRQA 3QPQD 3A23A 5BVPL 4PSRA 4YQXL 5I1HL 3A6BH 4D0BA 5TGBA 5JMRA 1F4HA 1MHPL 2JMRA 3ARDB 2Z4TA 3NGBB 5B1BB 4QXUL 3UAJD 4I2XB 4LSPL 3IDJA 3VSVA 3KGTA 3SKNB 2BVYA 1CGTA 5E08L 1NOAA 3L7EB 3L48A 1IAKB 5HVHB 5I19L 3SBWA 3QC5X 4HQQH 1I8MA 4UOZA 2H3NB 2I60H 3KYMA 4IRJC 2X9ZA 1U8HB 3UPRB 4FMFA 1A4BA 2R1XA 3QDJB 2P44B 4YHNB 4YBLB 1OGSA 4FXKB 1G7PA 3LRKA 4PJ7F 4TN9A 4Z7VA 1GPOH 4H7VA 2E27H 2WBJB 3P0GB 1ETZA 4W9EC 3QHZL 4EZJA 4DP4X 4M5YH 4GBXA 1U8PA 5F7DB 3I9GH 2ICEA 4NDMA 5G5DA 2BIHA 4ABUA 3AQXA 4WWOA 4KROC 3MRFB 2P48B 3FCTA 3WTSA 1JGDA 4QHKI 5HDBF 2BVOA 2DTSA 1SQMA 4JFDE 2XWBA 5LBSA 3S4SG 3GMLA 3GJFB 4BUGA 3T9WA 3DX6B 1FPTL 4HC1A 5IMMB 5GGSB 2CQVA 3CVIL 4NC1C 3WJJA 3HNSL 4NQCD 4QUOA 2WWOA 2NYZA 2XXFA 1E2VA 5F9OL 4M1GH 3TBWA 4P23D 4BYHA 2WY3B 3QIBD 4X5XB 4NO3B 1XGTB 4NZFA 3VXUE 2PCFB 2QQNH 4FP8L 3MRRB 4YDLC 1CYWA 3GM0A 1IE5A 1I1YA 1OLZA 4RETB 3L3JB 4QHPA 3DJRA 3QQNA 1W8NA 1FO0H 1M71A 2DLHA 1IGTB 2ENJA 2YGQA 4JFED 4QRPB 4WK2B 1BVLB 1S9VB 5ABAA 3AT0A 2PP8A 4X83A 5BOJA 1VKXB 1A0QH 1EXUB 4HUWA 5KSAD 3DGCR 3QJRB 3VI3B 4L29A 1SM3H 1EGJA 4FQQA 2BIMA 1DBMH 3V4VL 3NSYA 3ARGA 5GS1A 4CGTA 5IJKA 1KFAH 5I74B 5L2JB 2J12B 3QUGA 4U1HA 1FHGA 1G9NH 1U3HA 3F7RA 3UDWC 5HGHB 3LXAA 2JFCA 4H4NA 4N1CA 5HYJE 3ILPB 3KCPA 3VU2A 1GYAA 5CP7A 2OJEB 5CGTA 3BYTA 1XBRA 3FTGB 2KHAA 2EH8H 4F8TA 4N20A 3C5SB 2G2NA 3NJVA 3ZE0E 3S35L 4R7NB 4JREB 5I66B 2Y6SD 3L3GB 2FJFA 1N68A 4UILL 1AGDB 1DLFH 1WZ1H 1M2VA 1SJVA 5DI8B 3CDGA 4B9GA 2W07B 4Q9RL 4DPBX 1PD6A 4LLQA 4TL4A 5AW7B 2CA3A 4N8VG 2DIJA 4MX7B 4XVSH 1M9SA 4WAFA 1AZBA 3N91A 3OJ2C 4XBMA 3SYOA 5MEPA 5K9KA 4HPHA 2ESVA 4HUMB 4DPCX 2FECL 1LTXA 4KKQA 4HV8A 2PPCA 4CSPA 3CUPB 1UHVA 1G9MC 2R4RH 3GEFA 3B2UD 1PZBA 3UYRL 4MMXA 5KOVC 4LLVA 2Z8SA 2BVQA 4NN5B 1R24A 3NRQA 2NCEA 3X11A 1ERNA 3NZHH 2OS7A 4ZG1A 2XTJC 5I0WA 5IBUG 3O4LB 5SWZA 5EPMB 2WVSA 3BX7C 3TTYA 3ALXA 4M03A 4APQB 4TOYH 3TWYA 4QOKA 4R90L 2YXVA 4H8VA 1JWMA 4HUUB 4TSBL 1QI3A 1PS3A 3LHPH 2OMXB 4IBQA 1G7JA 3PG2A 3H9SD 3OZ9H 3GJEB 5HPOA 2JWYA 3C6LA 3NH7H 4LDCA 4XXDB 5E1QA 4YDNA 3HNTH 1UVQA 4PW3A 2HJFA 2P5WB 3WI9A 4UINL 4FEIA 4DZBB 2AGJL 3KYKL 2A9CA 1GHFL 2DQFB 4HCRA 3FUEA 4HWEL 2OYKA 2VMFA 3GO1L 2XETA 5A2CA 2EYTA 5AAWA 4FHBD 1Z2KA 3HS8A 4QKXB 4U1MB 5DWUL 4CMMB 1JZ4A 2WCGA 3ZTCC 2HFGH 2D4DA 3OB8A 1QUNB 3QCUL 1V55B 4ADGA 1YMHA 2CLVB 4ANXA 2JCCF 5GZND 1P2CB 5TDOB 2PXYD 2L7EA 4L8DB 4UT6A 2MTPA 1TUPA 2WKOA 4HIJA 5CJBA 4ZX4A 1MH5A 4PGBA 4HMEA 4YXLL 4H88L 1DSYA 4Z76B 5HP5A 5JO5A 1JDCA 2ADFH 4ZPVB 4NNYB 5B1AB 4JPQA 4NZRH 5TE6L 4HIXH 5CCJA 1W16A 3H6JA 4HEMA 1WCBA 1EPFA 5IUCA 2W65B 4JB9H 3VFOA 1DEDA 3QWRA 1ASOA 2D9QB 4ICWA 5ICUA 1AHKA 2DH2A 3M7OA 3UJJL 3ZK0A 2WZAA 2PR9A 5AWNL 2NT1A 3S9DB 1FG2B 1YEEH 2V17H 2HT3C 1MREH 1ONQB 1I9IL 3WFCL 3EXLA 2WXMA 5AUMB 3OKEA 1TEGA 2XYCA 3B7RL 3HHRB 5CZXD 3BKJH 1PZDA 4Y9FA 1IBFA 2JTDA 2AKRB 2Y5EA 1MJ7L 3UTTD 3EGXB 4AYFA 4MNHA 1KEMH 4R83A 2VERN 3SDCB 5LWYL 4XN9A 3F12A 1NWPA 2HPOA 1NKRA 3VXMB 1RZ7H 2MQ3A 4YHYB 1ORSA 1XF1A 1XO8A 3QSKB 3Q7JA 2WLMA 3MUGB 4DCQA 4ABWA 4HUVA 1QLEL 4Q97A 1SGKA 3NUKA 1QLFA 4I3SL 3X3FL 5FA4A 1DFBL 2NMSA 1L0XA 4K71B 4Q6IC 2CO1A 4QI3A 3WFEH 1QYGL 4DN3H 5LQBL 4HALA 2VB5A 3ZO9A 2QGDA 5GRYA 4OFKA 4ZO7A 1S7UA 1BM7A 4FNLH 1S9XB 2VMEA 2XWEA 1SQ2N 1AHWA 2R69A 1TTCA 2OMNA 3J7HA 3S6CA 4A66A 2DWXA 3H2PA 3C5ZA 1IKFH 4LLWA 2LOEA 4ENED 1A2YB 1I8IA 2P28B 4KO5A 3OPUA 1RZKH 1JIBA 4PJ5A 3PPEA 3CVHA 1OAYH 4M8UA 5HHVH 1A1OB 2J2ZA 2PPDA 3T2NH 4LHUA 2V5MA 1D6VH 4HK0A 2QQLH 3IJSA 1OZTG 1O6TA 1OSPL 2C9RA 4KKRA 4O2EA 3N41F 3WLWD 1XH0A 4CADB 5E2TH 3P69A 1DQMH 4FTVB 3QCTL 1OF2B 3QR2A 5CLWA 3FB5B 2RH0A 3GSUB 3ERXA 4M1DH 4XP6H 4MNGA 3MOBL 5L4IA 1ACZA 3ECWA 3AGWA 3HBGA 4W68A 2ZX6A 4JVWA 1RUML 4OT1H 1CGVA 4FNPA 3IDYC 2X4SB 4FERA 4RAUB 1NLDH 1RIVL 4QXGL 3FQ1A 3JXAA 1I1RA 2XPYA 5E6RB 4YGAB 1MIML 1FAIH 1NM4A 5EMYA 4LSSL 3TO4B 4AKPA 5EFIB 1KPRA 1JXGA 4MXQC 1E8ZA 1T6VN 4J7RA 2QMKA 3MKKA 5DRXB 5KW9L 2F7OA 1E4HA 1FIGH 3JVGA 3FKUS 2VLLB 4MBOA 2A73A 4DK5A 3L2LA 4YDMA 3U7WL 3KS0H 4FFZA 2PYEA 4PRIE 3NAAL 4POUB 4AEIL 4DP8X 3NIFE 5F70A 1NIDA 2OM5A 4IDLA 5DQJB 4BKSC 1CBVL 5GIRB 3AM8C 5EIIB 2DQMA 4Y1SA 1FVEA 3MCG1 5AVVB 3VWJD 4J39A 4E5XB 5T33L 2AK1L 4GUPA 1TKWA 1U8CB 4NUMA 2FH8A 1XL6A 3WJLC 3BGFC 2CJSA 3SGKC 3HW7A 4ZTPH 2I9LA 1LP9E 4HJIA 4HLZG 4L1SA 5JOEA 4X6DF 4N2FA 2A9AA 3GINA 4HWZB 2VJXA 4J6RH 4NZTL 1BCIA 2VRAA 3OR6A 5ALCL 3ZQ9A 4C58B 3LPFA 3ME0B 1KCUL 1HOCB 4LGRB 4D9QE 2FBRA 2D7NA 5AVTB 3TH4T 2BWQA 5AALA 3GSXA 1TCRB 3FYEB 4FQPA 1JJUA 1JHLL 4HWNA 4H1LB 3O2DA 1FUNA 1TZ8A 5CN2A 4QHKJ 3KVQA 4NHCL 2GEQA 3INOA 1JNNL 4MQ7B 3T4AA 3UO1H 1CGSL 2UYLA 3PQYE 4KGLA 1U91B 1WICA 4MJ5A 5FV2A 3RGVA 4P2OD 3FYIB 2XWXA 1N5YH 1MDAA 4K2UH 3FT3B 3RVWC 1KB5A 3IXTA 3N40P 4MBRA 4ADJA 5KVMC 1PVHA 3LNIA 3ML8A 1CZ8H 2F5BH 1DBJH 4AQ8A 2XG4A 1DUYA 4NLHA 5BMFL 3V0FA 3VWKC 2DYPA 1JPST 1FNHA 1AJ7L 5HYQA 2ARJQ 5BOZG 43CAB 1R17A 3T08A 3CFJB 1A1NB 32C2A 5AG8A 1K5NA 3EDDA 43C9A 2VDKL 4XMLL 3VG0H 4GKNB 3HE7B 2AAAA 2XWZA 2Z92A 4JPIA 4PYGA 1OM3H 1RURH 3I6GA 3OM3B 3HBQA 2CDGA 5IW3A 1Q0XL 1KCRL 4L4VE 3BVWA 4PBXA 3MYJB 4Y4HC 3V0GA 4HG4K 1JWUA 3G7TA 3PAYA 4R8WL 3PJNA 1MJ8H 1DQJA 3T5WA 3ULVE 4EEEA 3ARFC 1YYML 5DS8A 3PAUA 2LW3A 3QARA 3VFUB 1CLOH 5GGRA 5I75B 4WNSA 2R2EB 4KVPA 2GJJA 4XC3L 3GMOB 4XPTH 3B6SB 5JZ7D 1FG9C 3WNPA 2FWOB 2J25A 3WNJA 2B1HL 3KXFD 3X13A 1XZ0B 4FQIL 1M7IB 3GMPB 4PS8A 1Y1UA 4X8JB 4AMWA 1DSWA 3SCMB 1RPUA 5EEXA 5DT1L 4UT7H 3RPKA 4B9YA 3RBSA 3N1PC 3NJGA 1EDQA 2D7TL 4JO3L 2CUMA 5IEHB 2VWEC 2SEBB 3LQAH 2P45B 5IJDC 4A6YH 4G6AC 5CKAA 4IRZL 4HWBA 4JM2A 1R5WB 1Z9MA 4KXDA 1XVSA 4KX8A 1GC1C 5CZKA 2HWZH 3RVUD 2R7EA 4OZHF 4EDWL 3O6ML 3ZTJG 4GG6B 2PPAA 1ML0A 1DUZA 2CK0H 2V5YA 4YHLL 3LKNA 1QHQA 4N3TA 5FK9A 3PWVB 4Z0XA 4ZFFB 2OTWB 4XBEH 2NNRA 5I8OL 4QRRD 2K8MA 1A7QL 35C8L 3QUMB 2YGNA 4K94H 9CGTA 2YPLA 3TFKC 1I1AA 2EKSA 4Z7NF 2YZ8A 2JKXA 5DMYA 2CU9A 3DIFB 5A7BA 5DUML 4AG4L 2WLNA 2VKWA 1QRNE 4QRAA 2JQZA 5D93B 1BD2D 4GT0A 5HJ3A 1KJVA 1MCIA 4TULL 4P06A 1G94A 5F3BB 3MV7D 5D70H 1AXTH 3V4VB 4GQZA 3IMRA 2YSSA 4NWTH 4LU5L 2ICWB 4WJ5A 4GRWB 1RUPL 3I9PA 4JMXA 5ADOH 5L4JA 1A6WL 1YA5A 2WTRB 5FO8A 2HP4A 1EHAA 2XT1B 1JWSB 2AXJA 4JPVH 1PAZA 4MA8H 1WE5A 2VDRL 5HJGA 3WD5H 3TJHD 5D1XD 3QIWD 4NFDA 5JA9A 1IKNC 4WFFE 4JW3A 3IRPX 3BQVA 1DQKA 4I87A 4XMPL 1CL7H 1GSMA 1JPEA 3UROR 2O5XH 2DQUL 3PL6C 3GXTA 1LHZA 1RQ5A 1VLXA 4L3EA 4PJIE 3MBWA 2WJ5A 1AMYA 3PGDB 1S4IA 4TKWA 2VQTA 3Q2CA 1HIML 2NY6C 4OCNC 4W9FC 4RNRB 1I9EA 2DB8A 2WWMC 3PDOB 3RIFF 2VW6A 1AKJA 5I8KL 4LFHG 3B5TA 4FZ8H 4YHZH 4OZFA 1E3ZA 1FN4A 3O9WC 4CVZB 5FOBA 2Z8VC 5C0AA 1UJ3C 2A0LD 1KGUA 1ODUA 2O5YH 4ONGH 4IS6A 1MAJA 4W4OC 4NRXA 1E28B 3UAFA 3DPBB 3L9BA 2HFFA 1J11A 1F42A 2X10A 4M4PA 1N26A 3NIGB 1A02N 5JPMA 1ESOA 1QO3A 1NH6A 1JRHL 4PGDA 4AQAB 4ILDA 5LXVA 3KPOB 2G4GA 1LDSA 2E7CA 1MCEA 3IF1B 3K6OA 1BZ8A 3U4AA 4CVXB 4I77L 1ZEAL 5JW4N 1A9EB 1ROWA 1I7TB 2X4QA 5D1QB 5LKNA 4AJVA 4LXFA 4FS0A 3C75A 4WSJA 4GEJA 1TQWA 4ALAH 4PJBA 1MY5A 2GSIA 2XG5A 1GGCH 4HJ0D 5I1KH 5KSBE 3HFMH 5KS9A 1D7BA 4AGQA 5C09E 3LQMA 5DRZB 2Q20A 1KLUA 3H8NA 3T65A 1MXDA 1S7SA 1UD6A 2C8NA 3RTQA 4WWKC 4HJEA 3UPCA 4PJXF 3SBWC 1D5XA 1T21A 2FQEA 4RWYL 3RURA 1RU9L 3ZDXE 4BFNA 4XGZB 1YJDC 4OKVA 1FIEA 4HLZH 2OMYA 3VD9A 1HHKB 2LVEA 3O6LH 4LLUA 4PJAA 5E9AA 4Y1AB 4HKXA 1Q1PA 3FPXA 3MODL 1TENA 1JP5A 1AGFA 1QVOA 3QJHB 2DWDB 4TLTA 2JV6A 3L08A 2VXTH 3ESNA 3MBEB 4OFPA 2Q9OA 1EH9A 1OTUC 4GI6A 3CU7A 3LAFA 2EVGA 4GBXC 3F58L 3GDCA 2ICEC 3NPZB 3QUXB 1FDLH 4K3HA 2FT8A 4N5ED 4AV0A 3EFOB 1QLRA 4QF1B 2XZCL 3D30A 2ARWA 3HZMA 4LSUL 4XBPB 2HSIA 1YAZA 4G6MH 1J0KA 3WNKA 2NXZB 5EZPA 2FQFA 5E6IB 3WJJC 5FYKL 1BZDA 2IGFH 2V5SA 3JV0A 5E2JA 5AD0B 2AZAA 4BK8A 1BQUA 3MLYL 5ADPH 2B4CH 1XQ4A 5TF0A 4RDQG 1QLEB 4HKJB 4LARH 1F4WH 3HHMA 3QORA 1HILA 3MXWL 3QFDB 2RFXB 3U0PB 1H8LA 3G5VB 1WC7A 2C3GA 3BZ4A 3FO9B 3GHEH 2XQ0A 3QQXA 4FL4B 1OGAB 3L3IA 5LGJA 1GZPB 4FNSA 1O5DT 3MA7B 1V3KA 4OLUH 1OAUH 3KH4A 2V2WB 4QEGA 2YHGA 2EYSA 3ABMB 4GQQA 5IBLC 3V55A 5C1MB 2HRHA 2J21A 3EO0A 4KTDL 5GS1C 5KYNA 1YYLH 4MYWB 4IKNA 2JKLA 3LKOA 3NTCH 5DJXA 5IJKC 1C8QA 1T5XA 1CK0L 4PB0H 1JYNA 5D72H 3ARDD 3QCVL 4GKSB 1U3HC 3UXFA 5EH1A 1OTTD 4PJHF 1UZ8B 4F7KA 4RGNB 3KLLA 4XR8C 3QRFM 2BNRA 3HUJE 3G6JA 3FB8B 3L6FA 5E2UL 4N0CC 2DQGH 5DHMC 5AAPA 1MVUB 3IGUA 3FUMA 1JGUH 4OLVH 4X5PA 1BJ8A 4E9VA 4M6OH 3IMUA 2Y0SA 2R0KL 1N59A 3HZVA 4OCSH 5A6MA 3C12A 3QDJD 1YN7B 3ZTJH 5F3FA 1GY1A 4KUZH 5CZRA 3FO2B 3V4PH 2V33A 3L5IA 3H54A 5DK0B 4C4KO 2UZXB 2Z31D 3ZU8A 4BZ2A 2DQTL 3QI9B 2YD4A 1ZTMA 3MROA 4HIEB 2BNUB 4ODXA 1MHHA 2NY4B 3K1KC 1YNTA 2BY3A 4FEMA 4YZFE 5ALBL 4LAQH 4Z95H 1PZ5A 2E74C 2WBWB 2OZ4H 4WQOA 1E2ZA 3AMLA 5KVEL 4GW1A 2A6DA 4MMXC 1EEZB 3L9EA 3OAYK 2OYPA 1E43A 3EDKA 1JNHB 4G1MB 3AADB 5K9JL 5MENA 4UYQA 4WTZA 4P5TA 1KTDB 3FT2B 2KZWA 2WWNA 4JO2L 2F5AH 3D07A 1WH0A 4NN7B 4RISL 3N6YA 1HL4A 5D71H 3PJSA 1A6PA 1JPFA 2ZKWA 1XH3B 3P4LA 3WDHA 2I25N 5B39B 1EZUA 1A9BA 1NGXB 2AJXH 2J44A 3C6LC 1E27B 3HCVA 2XV3A 3DHJA 3MRLB 4JY6A 4Q4EA 3CHXA 2MJWA 4N0UA 4RMTA 1ZLDA 3IAGC 4X0NA 1N0LB 3IMVA 3HIZA 3NIDF 1KGJA 1Y6MR 1L6PA 4ZYKB 5AAWC 4OJEH 3VW3L 3T09A 2XWCA 3CCHA 4YGVB 1PY0A 3V9CA 5GSVA 4IM8A 1U6AL 2YOAA 4QRUA 1B4LA 2RCSL 3O41A 3K91A 4UNIA 3WYRA 5ICYB 5DR5L 4F33B 5HD8C 3VD2A 3DRTA 3RIFK 1KCSH 3AG1B 3LN4A 2CPCA 5D8JH 2GFBB 3X1FA 4H5SB 4ZSOA 5TDNA 3ZDYB 3GMQA 1K4CA 1AC0A 4P5KA 1KT2B 2EDXA 3CFKB 5BO1H 5T3ZH 4JY4A 1AQKL 2XN0A 2ZQKA 3HHSA 4EIZC 1DBBH 2JK5B 2ENPA 3RHWF 5KYXA 3QZWB 1KY6A 2EEBA 4GIOA 5E5MA 3EJQA 4QWWC 3V4UH 3ZR6A 1AOZA 5I5IA 3FB7A 3QHFH 3BWZA 5E2WH 1T7VA 4ELMB 1INEH 3LSOA 4U1JB 4Z7VF 2VDKB 4PM1A 2J4WH 1FCCA 3GS7A 3RJOA 1ZANH 2ZXWB 3SY6A 3OV6A 4Q0XL 4QHNA 3HAEG 3P1VA 3UC0L 1SDDB 4AENB 4MRBA 4TVSa 1NC2B 3QXAA 3FRUA 2DWEA 2XJKA 4X7TA 4WKXA 4MJJA 4HUKB 2COQA 3VD7A 1XZWA 3G9VA 3SQBB 3MRBB 4IW4C 1KWGA 2QDWA 5C0JA 1KJ2H 5IFHL 4F7PA 3EDEA 2J5WA 1FGVL 4QHMB 1N8OE 1PIFA 3W9EA 3ZTDC 4JDZB 3GKWH 4OLWH 2QVIA 1Z9LA 4U6VL 1JYWA 3KGUA 3FH5A 4PW4A 2VXVH 3H42H 1IILE 2HUEA 5DEGB 3BKCL 4P9ML 1FZMA 5D2NE 2OTUB 3N85L 3NJKA 4CC1A 3FFCA 3O4LD 4LLYB 1JPTL 4HUNB 2P5EE 4KFMA 5CZVH 5FO2A 5A1AA 2IANB 5IF0A 1MRDL 4MA1B 1M7DA 2XWRA 3QPXL 1SJMA 4B7IA 2V3EA 4OH2A 5FM5O 1AHWC 3T1FA 1KENL 2KLTA 3C5ZC 2EIMB 1Q90A 1T66C 3BSZA 1F45A 1AD9A 2NY7L 4AUUA 1MFDH 5EU6A 1YHPA 4G9DB 2DQIL 2P5WD 1IGJB 3B5GA 4IRSB 5IHZB 1FZOA 3RWCA 3IJ9A 1K85A 2UWEB 5CHNA 3P4NA 3DX4A 1TQVA 4NJ9L 5ESQA 1Z9SA 4DHLA 1G7QB 3IBEA 2CO7B 2IAAC 3CLEH 5IFAL 1JAEA 1PSKL 4BM7A 3TURA 3JWDL 1ZPLA 5INCA 5IB2A 1U95A 2NUTB 4PV9B 5IT2L 4CGUB 3BP7B 5LNGA 2ZWSA 4MZ2A 4PJCE 1H3VA 3TPUA 3ZKND 5EEYA 1AO7A 2PKDA 3IJEA 4ZTOH 5C0IB 1RL1A 1RJLA 2JIXB 3V79C 1A4CA 4S1DC 2RQ8A 4QKTA 1LL1A 4ADIA 3FCGA 3WHXB 3HJEA 5F3HB 1BOGA 3JVGC 3LKRA 3BRDA 2ZCHL 2ED7A 1KGCD 4X98B 2VO8A 5C0DA 3V7AG 2B77A 4NOFA 5JXEA 2FUQA 1ZWIA 1N4XH 2L4OA 1I7RB 1H5BB 3HKZA 4ERSH 2H26A 3B7YA 2BY1A 3BAIA 4RAHA 3B5HA 3GRWA 3M1BA 5PAZA 4L8CB 3CQQA 4KTEH 1BFOB 1YMMB 2AI0H 1YEFL 4JFSA 4L37A 4OZ4A 4LCUB 3U7YH 4IU3A 1U8KA 2G3XA 2IXQA 2AK4B 5CCHE 2ADGA 3SDCD 3CBKB 1JVKA 4PJDE 2N01B 4YE0A 2WXPA 5AOZA 5IQOA 4XO4A 3WTYA 2CO3A 3QZNA 5FW8A 1ZHKB 3CFQA 3PNWB 1LO0L 1K4DA 1NUGA 3EHBB 2CHWA 3R1GL 1ORQB 4Z77B 2AANA 2QHRL 4KKNA 2NNXA 1AIFB 1QSFE 2BRRL 4LCWE 4A7UA 4MA7L 3RKDC 5IHWA 2VR7A 4J1UA 2XBDA 3WFHA 4V11A 4FGMA 3O8XB 2NSQA 2EYRB 1IC7H 3MUJA 1I4FB 1W6LA 3ZMNA 4A55A 3O6FD 4K5OA 1DO5A 4L8BA 1WVZA 3TO2B 2N3JA 2X6UA 2KC0A 2Q10A 2C9PA 4LKCA 1XGPA 3T4AC 3DVNB 4YUEL 3T3PB 5A16A 1P5UA 3RNKA 5EZLA 3RGVC 3OHMB 2XY1A 1UURA 1KTKE 5C0RL 1WIUA 3H1ZA 1D6EB 3O3BA 2A9ML 2EDYA 2XNAA 4AQ8C 3F6LA 4B9CA 2WKOF 2MQ0A 4JDEA 4E5XG 2V8MA 5INDA 2CDFA 4FTVD 3VXQB 4BQ9A 3I75A 3U9PL 4CA4A 3I2CL 4LIQL 2OMWB 1F6FB 5KJ7E 5HYSA 5EF2A 1DN2A 1YEHH 2D0GA 1R3JB 4MCZA 1HHJB 5FXCH 4TSAL 4ACTA 1AP2B 2VM4A 4FQHA 1IJNA 4MDJA 2B39A 1U8QB 1GZQA 3EDFA 5BXFB 4PRAA 4UWQB 3VTMA 4WI3A 2GTWB 5ESAA 1NM9A 3TEXA 4OIFA 2J7LA 4XHJC 3BVTA 5C6TH 2GTQA 1N0XH 3TO4D 3KM1A 5IIEB 4EI5A 3IFPA 1AH1A 4KUCF 4H1LG 4F3FA 2AQ3A 3VI4B 2W0PA 3DOSB 5KJRL 1RP9A 4H26B 2EO1A 3WG7B 2Z9TA 4DP7X 2AXFA 3KJ6H 1JNJA 3DETC 3VYPA 1WAAE 4RMSA 4XN7A 5IB3A 3WS6A 2JJUA 1HINH 2ZCLH 5BJTA 3S3CB 3BIBX 5E5UB 3TN0A 3NEOA 3DOHA 3LY6A 4A1RA 1IVLA 1J8RA 5I18H 3MV11 4S1RH 3OWEA 4XCFH 5IUSA 3D2UB 4ODWB 2HKFL 3ASWA 2AJZB 5CIPB 1JMXA 4Y2DA 2PO6A 3SZKC 2NSXA 3UGXA 4DAGL 4NKOA 5LHDA 2KT6A 4JFDA 4PVNA 3RHWK 4K4KA 1IT9L 4Z3IA 1OD9A 3QO0A 3RWGB 1MFAL 3CSFA 2ZSVA 4G7VH 5KVFH 3WHE1 2IOMA 2YD6A 1QG3A 5LGYA 2FGWL 3VFWB 3KXFE 5C6WH 3K46A 3QQ4A 4HXAH 4QMEA 3VE0A 3V6OE 3H6AA 3HAEH 3BPOC 4QAWA 5IVZB 2AZUA 2R1YA 3VG9B 1RFDL 4KJYB 1THAA 2FQGA 1F8TH 3ISWA 3LH9A 4H8WH 1RZIA 2Z7YA 3FO1B 1SJEB 3MR9A 4M8VA 2Q3XA 5DUPL 4A2HA 4HG4J 1PBYA 3FRPA 4UIMA 5T1KA 1XF5A 3FCSA 1WAPA 4KK6C 1GGIL 2PCPB 5CJQL 2R39A 6CGTA 3ZL1A 4LVOB 1MCRA 4EN3A 5JLZB 2YPKA 4KI5E 5HPMB 2AJ3B 5FYKE 3G6DL 3WIIH 1U8OB 2A3TA 5GGTA 4E0RA 1Z1WA 3LB6C 4UBDD 5ERWB 5IROD 4HGKC 3D51A 3WN5A 1SOXA 5HVFB 1CFSA 1V8HA 4M3KB 1NGWB 2I69A 3D25B 4U7SA 3GGWA 3S37X 3L4UA 1IC4H 2KH2B 3EADA 4G9FB 1BJ1J 4IJ3C 3DX0A 4OI9A 2P80A 1MFEL 4EQ2A 4Y5XB 3S88L 3FQYA 3BFQG 1R3IH 3HE7D 5GGQL 3TPKA 3ZBMA 5HYJA 2EDQA 1HWHB 2DKMA 4XPBH 1S78D 3ALWA 4KX9A 4XN2A 3STLA 5J11B 3BD3A 1BD2E 3P0YL 2CKBA 4XPGL 3IXAA 4EMZA 1A3RL 1P53A 3KPSD 3MV7E 4JM4H 3T6QC 3CAFA 2LTQB 1KB9K 2MSPA 2ZT9C 3BQUA 1B0RB 4TNWF 3KZ8A 3IDXL 3SDAB 3ISYA 1A6ZA 1XF3B 1S7RB 1Z0NA 1N6QH 2DLFL 5J1AB 5M7QA 5HHXL 3RWIA 1G0XA 2C3VB 1C5CH 1JPGB 1TCMA 5D1XE 5JYMA 3RNQB 4FFYH 4L9DA 4M3JA 5LAXB 5CCKH 1T20A 1FBIL 5JDSA 1RMFH 5CR1A 1XCTB 1IIKA 4OZGB 3RWEB 4Y9EA 1D5MB 3JYCA 3QUZA 5MERA 2ZYIA 1QFUL 1SDAB 5T5FH 1P9MA 1GA2A 4WI2A 2HZHA 4XX1G 3K6NA 1MI5B 2DD8L 3EYUH 5JPMC 1KMGA 3C5JA 4QNPE 1KG0A 4OVVA 1H3UA 3O0RH 5LG1A 3J07A 1AR1C 1MJUL 3IDMA 5BV7C 5C7XL 1ZGLM 4N9GA 3ZKMD 4KV5E 3MGTA 2X89A 1I85A 3LEYH 2QQKH 4G80A 2F61A 4GQ9L 4I18A 4WWID 2VM9A 3ALPA 4HBCL 3VXSB 1UD8A 3MJ9L 1J05A 4MQSB 4NERA 5TPWH 5IHLB 2GAZA 4FFVD 5GSRA 4PS7A 2RQEA 3S48A 4QHUB 2CHXA 7TAAA 1CFVL 3RTQC 3K6DA 2O61B 5DC2A 4XC1L 5F1KC 1RHHB 3U83A 2AFNA 3GZOA 3O45B 3D05A 3VRJA 3Q5TA 3UTSE 4OLYL 1CO1A 2J8UE 3IU4L 1NBYB 1HCYA 3DX9B 4HXBH 4KK5C 3O2VH 4NFCA 4UQ3A 5FYLH 2HVJA 1K72A 1KN2H 4GS7C 4X5RA 4PV1C 1ZT1B 3KJ4C 1CU4H 4NQEA 4DOHB 4BSVB 1I3GH 4H25B 3VXNA 3T3ME 5HHMB 5AKVA 3UYPA 5T3ZE 5CWSA 3APNA 5JHDB 2ZE0A 4M93C 3HS9A 3FONB 4MA3B 4QLRA 2EDTA 5D7JB 1ZHBA 2EXTA 4ZFGH 1WGOA 2WOBA 1GCFA 3GBML 5DRNA 2ZYSA 2A9NH 2PTTA 3M8OL 1J12A 2Q7NA 4LQFL 2AW2A 1DJYA 1T2XA 1NAMH 1FE8H 5FYJU 4Z78A 1PZSA 3OGCA 1EZLA 3AC0A 3DMMB 3TH3T 4JM2F 1L9RA 2H0FA 3CZLA 3HI1B 3VFNA 4UM8A 4X6FB 6PCYA 3HA0A 5IVXE 4YHML 4IOIA 4G1EA 4O2CA 4HAFA 5E9NA 4N85A 1NFIA 1OF0A 4YLBA 1WSST 2H1XA 1BZ9B 2F19H 4G5AA 2B16A 1SXNA 2PMZA 5J12C 3WY1A 4D7BA 3RP1A 4XX5A 4H1LH 2WXLA 4U6XB 5D1QD 5DJZA 2DLTA 3UERA 1EAPA 1DEEB 1OL0A 2ZAIA 4OZIE 3MX0A 4EBQL 1V3MA 1DQVA 4M7JH 1YC7A 5T1DH 1U92B 3IAPA 4BZ1A 4U1SB 2DAVA 1IC5H 2ZX5A 3DSFL 4O02A 3TBTA 4G43A 4L1DA 1OAJA 3TTSA 4MJ2A 3B2PA 4U1IB 3AXHA 4HJUA 3WNLA 5FW7A 3F5WA 1WP6A 3EBGA 4GRMB 4WW2B 2ZX7A 3IM1A 3BAWA 2C4FU 4ETQA 2A4CA 1P1ZB 5J6GA 1KIRB 5BZZA 1T0OA 4ANWA 3GI8H 1IM9D 2ZKXA 4Y1AD 3V52H 2Q8BL 2Q86A 1PU0A 2AABH 2VDOL 2W9DH 5B4MC 4AYMC 3VSQA 4XNUH 1NGZA 3KPLB 3MBED 5ISZB 5DZPA 5E1HB 3UG5A 1L9OA 1EVTC 2G2PA 4D9LL 4PG2A 1F3JA 3T6XA 2VXQH 1V27A 3DLQR 5EOQL 3DV6B 4MYPA 5EV7A 3UIYA 4YLQT 2UZYA 1T3FB 1T2QL 2N59A 4XO9A 1KPVA 3MJGX 5D1ZI 2J1ZA 3BN9D 4P5TC 1MOEA 2FATH 2JXMA 2NXZD 4MHHI 2R4SL 4PRIA 4IYKA 2IPKA 5E6ID 4RFNB 3OXSA 4DGUA 5IQ7H 1G9ML 4M6MH 5I17B 2X4TA 4X2UA 1IAOB 3HI5H 4WENB 1X5MA 4Z23A 1FH2A 4BH8A 5EO1A 1CFTB 3H7BA 4CMHC 1A7BA 4XP4L 2W38A 5KBKA 2OL3B 4OQTA 3C8KA 1RJZB 1PX3A 3D9AL 3Q8FA 2IMMA 3OC5A 4JZNA 1TTGA 1F86A 4G8GE 1SF3A 5HGBA 5KN5A 2EKJA 1CD0A 2G0LA 3BKYH 1LP9A 4OW6A 1DDHB 1LO3L 5DHVB 5AW2B 1N18A 3GIVB 4P2RB 4JO1H 4RMBA 4Q52A 3CLWA 3QUMH 3QR0A 5FM4A 1HEZA 1T1ZB 4XNXL 5AW5B 4PJBF 3KYAA 1U58A 3WUWG 4W6WB 1LD9A 5DZ9A 5KS9F 1CR9L 4PPTA 5CN3A 1KIPA 5EBWB 4FKKA 4ZX6A 5DK2B 3KPRB 4O5LL 1LE5A 4JUSA 4MD0A 5AYUL 1O6VA 3S37L 1J8HA 1QBLL 4FABL 1B2WH 1DBAH 1H8SA 3PQYA 5GZOD 2D73A 4RGND 1MUJA 4AV5A 2EILB 4PJAF 5KVDH 4ZW8A 1T1YB 4LB8A 3QDHA 1P4IL 3JTTA 2DKSA 3OKDB 4DEPB 3BWAB 5B39G 2J55A 4M8QA 5GXBB 4OFYA 4HS8H 4MXVF 2E47A 4ZXBA 1KTLB 2CXGA 3SQOH 2HN7B 2XPZA 4M02A 4NRZA 5H37G 1CICB 1XWVA 2EEDA 4RAVA 3BT0A 2QV4A 2E9WA 4X42A 2WUBH 3QI9D 5FF6B 5T1LB 1AGBB 1LM8V 4GP5B 4MNQE 4FQ2H 1H3TA 2NY4D 4XMZA 4Q9RH 5J3HC 1ZA3A 3CFDB 2VERA 4L4VA 3LRLA 3RVTD 5KEZA 3V0IA 4Z7UE 3QIUA 5CEYA 5DURB 3N1FC 3SJVB 4PJ7B 5HVGB 2FNWA 3SBPA 4YBQD 5TTRA 2GJ6D 1RUQL 2B0SL 2IQAB 3HKFA 2GCYA 1NCBL 1X4ZA 5TE4L 2XV0A 5FECB 3BUYB 4HGWB 4Z8FH 3QDGB 4PS4L 4DNLA 2IWGA 2GBUA 2JB6A 3ARPA 3FT4A 5I26A 4O4YL 5HGAB 5HDBB 1O5PA 1U3ZA 4EOWH 2DH3A 1DQDL 3P9LB 2BZ7A 3QFJA 4G5ZL 5SV4A 2D7OA 4JRYD 4F7EA 2Z35A 3MJ7A 5L88L 4DKEL 1XL4A 2APBA 2F8VA 1ND0A 4DKDC 3EYOB 1QUPA 2Z0BA 3ARWA 3U30C 5AB9A 1EDHA 4YHPA 3WKPA 3NN8B 5HHPB 4MB5A 4TVPD 1SVBA 3V8OA 3L8QA 3LRSA 1SXBA 3UABA 3RIAF 3IFLL 1USZA 3DYOA 4CILA 2CBOA 3B9VA 4JKNA 2VH5L 4TTDD 5CUSL 2JB5H 3VYOA 5JW5A 4EVNB 2P7TA 2CGRH 2D03L 2O5ZH 1AIZA 4IHOB 4W9GC 5KVFE 2XKNB 1BHGA 1J48A 3G6JF 3GLAA 2WWKO 5IG7B 3UEZA 3B2VH 1QNZL 4LOUC 3EO1A 3DDFA 3P02A 1CWVA 3A22A 5ITBL 3HG1D 1QRNA 5C2UB 4DGIH 3IKKA 3ZYJA 3W2DH 2IOOA 4YSOA 1IC0A 2VN6A 1ADQH 2XQYK 3V5HB 1FSKB 4PJ8C 4GUQA 4Z3GA 1LE9A 3EH5B 2XZZA 1RZGB 3FZUC 3RU8L 1FO0A 1N6VA 1UC6A 1RK0B 5TJWK 2BWDA 2VL5B 3BP6B 3K7UA 1VFAB 4BFGA 1DJHA 2ZCZA 2ZXGA 1YNTF 3BO8A 3CBJB 3SKMA 3LXUX 4WDIA 4BFIB 4UDUB 4ONFH 3C60B 5JXEC 3ROLB 1NC2D 1XXFC 4L3CA 4OBRA 5BVJB 2WB1A 4K9EH 4NFBA 1PLCA 4I0PA 4PLJD 2EDBA 4UQIM 3SGDH 4CNIA 5L0QC 2JI1A 2DQHL 3OG4B 4OM0L 5J1TC 1GKEA 5IGXH 4IHBA 1E4XI 5ENWB 4PJIA 3CH8A 1HQRA 2ROYA 4UANA 3HRZA 3JWOC 2FE0A 2Y06H 4YK4B 5EUKA 3V0JA 1JZFA 1G7LA 4PCKA 3WSQL 2MWCA 3BE1H 4PRBB 3MRPB 4XAKE 2XY2A 1SLXA 4HHWA 3DSNA 4Y2LA 3RQ3A 3PIQA 3AACA 1WZMA 4R0LB 4OJFL 1D9KB 5DTFA 3W9DB 1ETB1 5CO1A 2IIJA 1NMCB 3QUYB 5IBTL 4F15C 3D18A 3L2NA 3UZQA 3WEXA 1E9QB 3LQZA 1OANA 2K3HA 3HMXA 3GSVB 3VB9A 4BCXA 2YWZA 2DI7A 1BF8A 4X6EA 5K93A 5TD4A 4I9WD 1SHWA 4DJMA 1M1XB 1BAWA 1EK3A 2DICA 1P5UC 4IRSD 3FH8A 4XRCA 5B8CA 5I0YA 1NDGA 2E7DA 2X4RA 1JF1A 4XTRC 3QEGL 1KBWA 2BVPA 1TTRA 3FAXA 3RL2B 3VCLA 6FABL 2NQDA 1FRGL 3DIVA 1TQCB 3FTWA 3PP4H 4OB5H 4YXHL 1TTUA 3U46A 3RY6A 5I15L 3HR5A 3RWDB 1JZEA 5C0GA 5KSBA 1PKQE 5BS0B 1OAXL 3TXAA 3V7AE 5DYFA 4XPFH 1DJIA 1PY9A 4XWOC 5C09A 2EDKA 2Q0ZX 3MOBH 1NZRA 3B9DA 5E1AA 3WTTA 3UTZA 2JIXD 4JDVA 1KV3A 2WMPB 5I16B 2D3JA 1M6OB 4I3RH 2FD6H 4TRPL 3WMQA 1KJMA 4EI5C 5KBPA 2CPUA 4U0RC 1LO5A 1BZ7A 3N0PB 4PWGA 1G5GA 4IRJB 3MCKB 1BEYL 5KYUA 4XCNB 2EC9U 3GK8L 1JV2B 3S8WA 3BPNB 3H2QA 4KPHH 2R0LL 2YLHA 4UDTB 3WS6C 3ZZ1A 2IALA 4DUWA 4UQDA 4J8RB 3Q43A 3TNMA 3TN0C 4I1RA 4WI7A 3VGEA 4NUJB 3HVDA 1AG0A 4XNBA 1TJGH 1FL5B 5FYLE 3K6SB 2AK4D 1OCWL 2AQPA 4RMVA 2PO6C 4KROB 4MMZA 2HVKB 5GJTL 3WTXA 1TTFA 2Q2EB 3EHBD 2JCCE 1I3RB 4XOBA 2C7UB 1YNLL 4FQJH 5ECJE 3DXAB 1JK9B 2K0RA 4XOAA 4DERA 4C4KT 1CT8B 1MW3A 2AHIA 3GSWA 5MEQB 1XIWD 4TLSA 4APXA 4MKTA 3ULSA 4BQCA 5DJ8B 5JORA 4FNQA 1N6UA 4YWGH 1GC1L 1BWWA 5F9WC 2XWTB 1FH5L 3T2QA 4YDLB 4TVPH 1QEWB 3NSDA 5I1LB 3HS0B 2BDNL 4G71B 1JZ8A 3E8UH 1EEYB 5I5JA 1DR9A 4NO0B 5J89A 3P4OB 4I4WB 3QEHA 2RGSA 4HMCA 4LPTA 4OFDA 4C54A 4YHZL 3ZE1F 1IGIL 4EN3C 4Q6YA 1VFOA 4KO9A 1BG9A 1WV7T 4CBPA 5TE7H 1J9QA 2F74B 3VVVA 2GUOA 3FF7A 4GLRH 3OR7A 1JOIA 5E03A 1SBSL 3QIBA 1T5WA 3KD4A 4WU5B 3WN5C 1H3GA 2XN9E 5IFJB 2K45A 1F6LL 3NRFA 1AGCB 2YXFA 3WDIA 1CYXA 1FNGB 3P11L 4XP1L 3FN0L 4IDJL 4NC1E 5BMFH 3AB0C 2EZ0C 5SV3A 5CILH 1UJTA 3AU1B 4MJHA 5TFSL 3N41B 1DJGA 5CF3A 4F2FA 3CDZB 2E8ZA 4AL8H 3V0HA 2VXSL 4PGCA 4RMWA 2VDOB 5D96C 25C8H 3Q2WA 2H4EA 1BQHB 3BQUC 2KBGA 3C2SA 3L9RB 3EGDA 2CLRA 4X9YA 1ADWA 5CJOH 1D5BB 2FEDD 4POZC 2X05A 3Q2LA 4KKLD 5I1AB 2OZNA 3QJFA 1KCBA 4WI8A 4NM8H 5L2KE 3RIAK 1G6RL 3GT6A 1FYTB 1FFNB 2BP8A 3ARVA 1W0VB 5C07E 3S4SA 3U9WA 2HG0A 1G4RA 3MFFB 4LK4A 4M61A 1PL3A 2HMIC 3E6FA 3MXVL 2QPFA 1XB8A 2EDHA 2ZXBA 4XPAH 4FNUA 1UWGH 3PGCB 1OY3B 3QRGL 4YIQA 1KXTB 5GRJL 1JF6A 2BIIA 4PTUA 3M6DA 1EAJA 4NHUB 2YC1B 3QUZC 4P57B 4DO5A 4HHAB 5JPNA 3ECUA 3KPSE 5J6HB 4CKQA 3PREA 1P7QD 1MHEA 5A6LA 1MF2L 2H1PL 4JHAH 4UOJA 5C71A 2AJUL 1ILSA 5BW7C 3Q01A 5ICXA 4QCIA 4KNSA 1F4YH 3WCYA 3F05A 3EYSH 5DRWB 3CU1A 4AE1A 4RBPK 3GBNH 4ONHA 1I7ZB 1I85C 3DK0A 2JKIS 2X38A 2QSTA 1BF2A 1A3LH 4X6DB 2NZ1A 4WK4B 1T1WB 4A2FA 4A37A 2YA1A 3VM7A 3OXRB 3LS5H 4PB9L 4UTCA 4NQXA 4MLIA 3ULAB 3ML9A 4JCMA 1CGYA 2OK0L 5IB4B 3R19A 3BIKB 5B3JE 4KKCD 4A2GA 5C0EB 1MRFH 3OWRA 1KB9J 3CFIC 2MH4A 1UXWA 3GLEA 4PP1C 4ZX3A 4R4FH 2FZ3B 4WHTA 3P0VL 4YNYB 4ZUWA 4WNQB 3ARBD 3W3BA 5E56A 4NN6C 3KLHD 1QR1A 1O6SA 3TASA 4HOWA 1I8KA 4OFVA 1I53A 2UVFA 1DVYA 3C2AH 3UCRA 4JRFA 2Q8AH 1F11B 5DFVD 5FGRA 4PJGE 3WE6A 4GAJH 4G9FD 2DWTA 4NO5B 1YJDL 5D7KD 2WQSA 4YC2C 4XNDA 1G4MA 3MLVH 4N2DA 3BGMA 3DYPA 5LJYH 4BINA 4N8VA 2RR3A 4RX4A 1MPAL 2MCMA 3DVFA 2O6CA 4MJID 1ZS8A 1BVKB 1Q1JH 2R1WA 4KJWD 1DL7L 4PRDB 1JTOA 5E2VL 1BFTA 3JWNC 4N90E 3KPQA 2XPGA 4X6BB 5I8EB 3SOBL 4UU9A 5KVDE 1IEAB 3T0DA 3SDAD 3FTUA 3MV9B 3HZ3A 4M1CC 1OPGH 4N2BA 3I02B 5GZNA 2B3RA 2ZAGA 4XX1E 4C56B 4MCNA 4JKLA 3WFBL 3NT0A 3SO3C 3O11B 4JR9L 4JFXA 5TDPB 5KYYA 1DE4B 3OLIA 4HC1L 1SLWA 1RULH 4Z3FA 5SWQA 1QX1A 5EU5B 3E6HA 4L9LA 1XCQB 1SEQL 3QA3A 4HJTA 3GXUB 4R96B 5SX4I 2NUPB 4FHJA 1QEXA 4AYDC 3GMMA 4BJLA 2CIIB 4R3SA 4PMFA 3ZL2A 1U9KA 1MEXH 3GI9H 3K3QA 2YQGA 2HYMA 4GJTB 4YZWA 1JZJA 3LIZH 3LH8A 1MI5D 4NSKB 2Y07H 4LCVA 4KK8D 3NA4A 4P46B 5GRVK 2H6UA 4M3HA 2P5EA 4Q6IB 3KR3L 2PWGA 5IW1B 1IGML 1C5DA 2FL5B 4XI5D 5IEKB 2F7RA 2CCLA 1U41A 5E99L 2APSA 2BC4B 4U6YB 1CG9B 3GBLA 3KLAB 4JFFE 4OZHB 1HSBB 3AWGA 1NMBL 3VXSD 3WUZA 4HUXA 5ACZB 3QG6A 4YDJA 2FIKB 1P7BA 1ASQA 4F58H 1EGJL 1OT4A 2VTFA 3BVNB 2K1MA 4IKJA 4KHXH 4UNUA 1UCBL 3G9AB 1FFRA 1YECH 2EIZA 4LL4A 2VO5A 3SYPA 2QMJA 1JPSH 4YFEA 1UD5A 4A6YA 2V37A 4Z7NB 4DKAA 2HT2C 3MACL 1A6TB 1CFQB 4K3GA 1G84A 5FUOL 2P8PB 3RX5A 2CO2A 3TYFA 3UFIA 3EYVB 4EPSA 5C2BL 4PGEB 3LN5A 2E5EA 3LHAA 5EU3B 1NCTA 4O2FA 5EO0B 3S2AA 3T0BA 1IGYB 1UCTA 4JG5A 4TNFA 1A6UH 1C1EL 3AREA 4OD3L 4AWJC 3R06A 3RX7A 5EOTB 5IW6A 1NA8A 3ZE0F 4PJCA 3Q1SL 2L3BA 3G04B 3MODH 2J1YA 2XDHA 3IDYB 3G6AA 5HHMD 3EYFA 4WY7L 5JHDD 5L7XH 2OMZA 3F7YA 3HMWH 3PNRB 1E4KA 1NCNA 1XD1A 4H0IA 1TFHA 4AQZA 8FABB 1QSVA 4XVTL 3RX8A 1IQDB 2BOBA 2J1WA 1U8JB 5I30H 1IGFH 1HL8A 1EVUA 4WGKA 5GGRY 4F5CE 3CN0A 5IZ7A 1X9UA 1ZV5A 4KKBD 1TZHA 4ZFQA 4HEPG 2Z93A 5I6KA 1KYDA 4NQVA 1I1FA 5IQ9A 4HKZA 1Y18A 5A7EA 2EIBA 4FG0A 2MMXA 5IQLA 4RWHA 2QGEA 3ZL4L 4PJDA 1DVXA 1HAWA 3ARQA 3DX7A 5C0CE 1BFVL 2DBLL 3LRMA 4D0CB 2X4OA 3GXMA 1NGYB 1S46A 4KZEL 3BGFB 1F6AA 1E3XA 3PABA 3D69B 4LCWA 1QSFA 5CBEA 1Z9PA 1EUTA 4JKMA 3U0TB 4A67A 2EC8A 1QACA 3BEVA 2Q76B 2R23A 1MCCA 2BINA 2ADJA 3CH1A 5I0ZA 1HWWA 5CJXA 4HW6A 5KVGE 2H8PA 1KIQB 1TU2A 2V9UA 3RZCB 1NL0L 5DVNA 2EDNA 4JFYA 3VH8B 5LXGL 2G3NA 3L3KB 3F00A 2XKUA 2CALA 1G9HA 1MHCA 4ZOAA 3VWJA 5HHQA 4A2DA 2WINA 4L48A 1M05A 2H6PA 4HZ1A 1ZVYA 5E00A 3W81A 1CFNA 2R29H 3BH8B 4UIKH 4EUPB 4L3AA 1S3RA 2QTVA 3VMNA 2BY0A 1LEIA 3I6LD 1RD6A 3SQRA 3V10A 4Q74A 3DROA 4GMTL 4ZXBC 4K3DL 5E2UH 5GJSL 3VWKB 4HPOL 4NP4L 1J5CA 4LCYA 4DK3A 1TEYA 5DHYB 4OUUB 4EI6A 1L0QA 3BW9B 4PJXB 4UZUA 2WTPA 4B60A 2VE6A 5I1IH 2V9QA 1CGXA 1QBAA 4IU2B 2WUCL 5C08E 5ISZD 1BLNB 4P2OA 4FZEH 3VA2C 3VB8A 1MNUH 1UWEL 1Y0LA 2WXGA 3QIUC 4PBDA 4Y4HB 3BHBA 4E41B 4HS3B 4NKIH 5G4OA 3GZKA 4EE2A 4MRCA 3ZDZE 3NK4A 4ZUUB 1R0AH 1MQKL 3HBZA 3QULA 5BRZB 3X1NA 1HYSD 5I1DB 2KKQA 2XA3A 3JTSB 3CN2A 4AT6B 3CDCA 5D7LB 4XCEB 3TT3L 2BRQA 1WAAA 3KG5A 4IIQB 1ZXQA 2EDLA 3HC3H 1YZZA 2HKAA 2L04A 2VR5A 4ZW6A 3RAJH 1GS8A 4JN1L 4LMQE 1JN6A 1G1OA 2ARJA 1Q9KA 1YEIH 2PUQT 4LDOB 1KPUA 3OJMB 4FXGA 5I8CA 1KNOB 2GJ6E 2IGLA 4JBSA 5IMOB 1NIFA 1VERA 4N9OB 2R69L 3WFDH 4QAMB 4DF9A 1A7PH 3MNZB 3QP3A 4I0CC 5TF1H 4DVBB 2ZD0A 4P2RD 2BVTA 3RWFB 3JV4B 5C0BE 1UH4A 5TH2B 3KXFA 3OF6D 3CVHL 2FT7A 3MC0A 1A25A 1WIPA 2JJVA 2Y22A 3VGDA 3FOLA 4I5BB 4X4XB 3SBQA 3POCA 3V6OA 1IZKA 4E9WA 1C12B 4M4RA 1OSZB 3EOTH 4JRYE 3IMSA 1MVFA 5LLIC 4LEOB 3HZYB 3KPRD 1TETH 4PG9A 5DVPA 3CBRA 4YHOH 2O6EA 3DUHA 2O72A 3KE0A 4F20A 5T1MB 3ULUH 4NAMA 3T6ZA 3EZ8A 1K6QL 1OB1B 2PR4L 4TVPE 1XGQA 3E9TA 4LF3B 4DGVH 2VWEE 3D85A 5DJ6A 5SX5K 1NMAH 4PJHB 4P3DB 2BJMH 3QEQE 4JZOB 3PAZA 1FL6B 2ITCA 4DTGH 2PF6A 1YAIA 5CJ5A 2Q5BA 1A4JA 1HHGB 2VUOA 5GS2H 5L9DH 1CICD 4TLUA 2ATAA 1JNLL 5A2KH 1UFUA 2W0FA 5EOCL 4I0PC 4ODHH 5KSUB 2QELA 2AJSL 3HG1E 1OGTA 4S2SB 3HEIB 4GO9A 2AQ2A 1BD2A 2A9BA 4FFZL 3GM8A 1G9NC 1UACH 3NDZE 1OP5K 3MV7A 3PL6B 4P2QE 3UGEA 1L5GA 3TWCH 1TITA 3SJVD 4PLOB 3HRZC 1MLCA 4QY8A 4P05A 1G6RB 3NIFF 4CC4A 1PYWB 2BCKA 4H0GA 2V7NA 2NY6B 3TVMA 2DQJL 2E46A 4P4KA 3GJFK 4MAYD 2WCSA 3QDME 4FHKA 2FQDA 4F27A 3F7VB 1MW1A 1AYOA 2R2HB 2Y36L 3BD5A 5CXPA 2WNXA 3KH3A 4W9LC 1PLGH 3EG9A 4UYPA 5DA0B 5B1KA 5CMAA 3K2KA 3O9WB 5D1XA 1W8OA 1AS6A 4YHIA 1BGXL 4WK0B 2G5BB 3MRHA 4Y19B 4YDVB 3KMDA 4KDTA 4NO2A 1LP9F 3G5XA 4U1LA 1UOLA 3V4PA 3KLSA 3UJIL 4DGYL 4WU7A 4RA3A 1XXDC 2GI7A 5AZEH 3AWFA 1A7OL 1F58H 5CP3H 5FDWB 4PLNC 4NYLB 5B8CC 2NCMA 3VRIA 3DURA 3U36A 3QJVB 4TTGA 3Q8AA 3QW9A 1HFUA 2B15A 2VIRA 1L4IA 3ARXA 3KPMA 2OLDA 5D1ZB 5D7SL 5C0FB 1JVLA 1ACYL 4FA7B 4MQTB 3C87A 1OCOB 5DZVA 5DEJA 3LKPB 2HH0L 4H2AA 1TZGH 3K6IA 2RHEA 3F2LA 4L1BA 1E8WA 3NIDB 4F9LA 1KB5L 4QRQB 3BT2H 3RY6C 2MFNA 4D0BB 5TGBB 2BWIA 1KBVA 3KWTA 1T89A 4JGUA 4I9WE 2VUKA 4PJFE 4X0KA 1E4WH 3REVA 3NFNA 3IDJB 1RJYA 3ARRA 3MLRH 4KNUA 2FEEI 2JQAA 4R7DA 3OMIB 2DL9A 3LXCA 5B3SB 3CNKA 1OO2A 4TM9A 3M17A 1RZQA 5B1JA 3KYMB 4IEFA 3UTSA 1Q94A 2CUAA 4U7MA 2J8UA 4GKOA 2GW5A 3KM2A 2R1XB 2KS0A 3C8HA 3WGUB 3C60D 2X3AA 5DFWH 4BE6A 4BD4A 1EJFA 1G7PB 2WZPD 3ULVF 2Y25A 4Z7VB 3UAJC 5FX3A 1NDMA 1VJSA 3VFRA 2OMVA 3ZN6A 4GBXB 1U8PB 3GHPA 2ICEB 4NDMB 5G5DB 1K2DA 4LQ1A 3D2TA 3PP3K 4MMZC 2P52A 3KGSA 3FCTB 4PVMA 5DF0A 2BVOB 2XWBB 3BH9A 1LXMA 3GMLB 2ZUSA 4GO6B 1JGVH 2P4AB 5EIVA 4AMKL 3FC8A 2GKIA 4OLZH 1LO0H 3EH4B 1UH2A 4GH7B 2OYLA 2QADC 5IJVA 1D9KD 2OL3H 4HWBL 2XQBL 3NOIA 2ZTBA 3TBWB 3D39E 3OAUH 1J1OH 4JPKL 2R0WL 3F62A 3K5RA 5CM1A 5DGRA 3KLDA 1KV7A 1EBAA 2XA8H 1I1YB 3OKYA 3TLRA 2LV4A 4YSDA 3VXRE 2PNDA 5IVXA