1IX8A

Aspartate aminotransferase active site mutant v39f/n194a
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGFYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational change in aspartate aminotransferase on substrate binding induces strain in the catalytic group and enhances catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Aspartate Aminotransferase
total genus 147
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1ix8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1ix8A01
4NOGA 5I92A 1UU1A 5LHAA 1AHEA 1ZC9A 4XJPA 1GC0A 4F5GA 1I43A 4J5UA 3H14A 1GC3A 2CTZA 1D7VA 2CH2A 3QGUA 1G4VA 4ZSWA 4E77A 4JEVA 4TMRA 1M6SA 3NYSA 3B1DA 3EI8A 1M0NA 3QI6A 4OBUA 1GEYA 2VIAA 4J8LA 4WB0B 3HDOA 2AY4A 1LC8A 3EIBA 3JW9A 4MSOA 5J8QA 2FYFA 4R5ZA 3ZZKA 2OGAA 2GMUA 4JEZA 3QBOA 1TOKA 2VMTA 1ARSA 3BCBA 1CQ6A 1V2FA 2AEUA 5DB5A 5BJ3A 1TOGA 1XEYA 3WCNA 1YNUA 4W91A 1OHVA 1W3UA 2W7GA 3KE3A 4JF1A 4ZDOA 4OBVA 2O7CA 2AY7A 2ZUKA 1Z7DA 3RUYA 4KXKA 1FG3A 2EGYA 4GRXA 4W8IA 1DTYA 1WYUB 2FM1A 2FQ6A 4IYOA 2PO3A 2D66A 1PG8A 2VMVA 1PFFA 3CQ4A 4O6ZA 5F8VA 4R2NA 3ACZA 4B9BA 1C9CA 4LNJA 4OMAA 2BI3A 1ARTA 1MAQA 1VJOA 3FCRA 3G8MA 1JS3A 3ELEA 4MKJA 4UQVA 5EAVA 3RBFA 1ASMA 1CL2A 2WKAA 3HL2A 4RLGA 2PB0A 2AY6A 3RBLA 3VAXA 1D7RA 1JS6A 2WK8A 2EZ1A 2Z67A 3FQ7A 3WX9A 1QISA 4U2HA 4WYAA 3G0TA 5G4IA 3LWSA 3ATHA 2VMOA 2HZPA 2E7IA 3OKSA 3AOWA 4RIZA 1KMJA 3BC8A 1BJWA 4MY5A 5DJ9A 3MADA 3USFA 2DOUA 4ZASA 1H0CA 2HOZA 1MDOA 1U08A 3BCAA 1TOIA 2DGMA 1ORDA 2G6WA 3PDXA 4M2JA 5HXXA 1H1CA 1S07A 3GZCA 3PGYA 5EUDA 1C4KA 4W1VA 5C6UA 1AMQA 2OGEA 2VI8A 1S09A 3NDNA 4EFFA 2WK9A 1ASCA 4RAEA 3BN1A 3WCOA 4WLJA 4F5IA 2YCTA 2CH1A 3L44A 1AHGA 4PFFA 1IAXA 1D7UA 1OATA 3ZZJA 2OATA 3BWNA 4IX8A 1CL1A 1KMKA 4HF8A 3PPLA 2CANA 4R8DA 3FRKA 3AEOA 2EZ2A 2BI1A 3I5TA 1BQDA 3VK4A 1AKCA 2W7KA 3EUCA 5D95A 1RV4A 2QLRA 4XAUA 4B98A 1OHWA 2D7YA 3DC1A 1JG8A 4W1XA 1UU0A 4ADCA 1CZCA 1TOEA 1ZOBA 3FZ7A 3PJ0A 3FQAA 2BYLA 2GMSA 3E2ZB 1ASLA 2W8JA 1BT4A 4E1OA 1ARHA 2X8UA 2YKUA 3DR4A 1B9IA 2CJDA 4Y0DA 2GQNA 4ADEA 4MKKA 1E5FA 1EJIA 1SZKA 2W7DA 3NTJA 2V0YA 3AEMA 3MAUA 3K28A 2XBNA 4TV7A 4OT8A 1GD9A 3AATA 5EFSA 4N0WA 5BJ4A 4MQQA 1CS1A 2AY8A 3BS8A 2ZSLA 1TOJA 1RVYA 3AENB 3B1EA 1FG7A 3GJUA 4RM1A 1YJYA 4WXBA 4WYGA 3E2YA 3UWCA 3EZ1A 1ASEA 3K40A 2EO5A 4Q6RA 1MLYA 3AEJC 3FKDA 3WKRA 1IVRA 3FD0A 2VIBA 3AENA 2VMPA 1ARIA 3GZDA 1N31A 2V1PA 2Z1YA 3AEJA 1B8GA 2HUFA 3EZSA 5G2PA 5LH9A 2D64A 3NUBA 2OKKA 4ZWMA 1W7NA 2QA3A 3KGXA 5D5SA 3CAIA 2Z9WA 1AIBA 1IUGA 3PDBB 2VMUA 3TQXA 2PB2A 2QMAA 4IXZA 5FT5A 3PAAA 2CB1A 5HDMA 1W23A 4F5KA 1MAPA 1M4NA 2DR1A 2BHXA 4XJOA 2QB2A 1Y4IA 1BW0A 4FFCA 5FT6A 3VOMA 4E3RA 3BB8A 2ZY3A 2Z1ZA 5TF5A 4IW7A 5G2QA 2BIGA 4DGTA 3TCMA 4K2MA 5G09A 1MLZA 4JE5A 2AY1A 2BI5A 4GEBA 1T3IA 3E77A 3BWNC 2D61A 3HT4A 4UOYA 3RQ1A 4WP0A 2VGVA 1GCKA 1WKGA 2HOYA 2R2NA 3KKIA 3ELPA 2ZY4A 1C0NA 1LK9A 2JGTA 4F5MA 4WYDA 1WYTA 3N5MA 4ZWVA 1CZEA 2Z9VA 1SFFA 4AH3A 3F6TA 3IF2A 4IXSA 1AKAA 1LC5A 1M7YA 2BKWA 5F9SA 2FNIA 3F9TA 1GEWA 3VP6A 3E2ZA 4AOAA 3AELA 3EI9A 2JJEA 2W8TA 3W1JA 4F5FA 3JWBA 5M49A 1YIYA 1AIAA 1B9HA 4A6TA 2D63A 3B8XA 1QIRA 1M0PA 1V72A 2Z61A 3FVUA 1AJSA 1J32A 1X28A 3BWOA 3DYDA 3DZZA 5EQCA 2VMSA 4A0HA 1J04A 4UHNA 4JEWA 4F5JA 1PMMA 3RCHB 1O62A 1TASA 2JISA 2VLFA 2HOXA 1G7WA 1AX4A 1IX8A 5K8BA 4K2IA 2TPLA 1GC4A 5DX5A 2ORDA 1TPLA 4XJMA 1VEFA 1M0OA 1PMOA 2VMNA 4RKCA 3E2FA 3JTXA 4RJYA 3CQ6A 4LW4A 1AKBA 2CJHA 3JU7A 2YOBA 3HQTA 1D2FA 1LW5A 4LC3A 5EUEA 4A6RA 3P1TA 1IJIA 4HVKA 2BIEA 1QZ9A 3D6KA 3M5UA 2ZY5A 5EUNA 1AHYA 4BHDA 3N0LA 3NYTA 1QGNA 1JF9A 1RVUA 4ZAHA 4WBTA 1YIZA 4AZKA 4E3QA 1AMSA 2RFVA 3T32A 7AATA 5DJ1A 1IX6A 1SVVA 1ZODA 2JJHA 4AO4A 4BMKA 2NMPA 2QB3A 3AV7A 1TATA 4ADBA 4JEYA 1GC2A 3DXVA 1VP4A 3VK3A 2YKXA 1UKJA 2X5DA 3CBFA 1I48A 1QJ5A 4JE5D 3AEPA 3ZRPA 2C44A 1ASNA 2OKJA 5E3KA 2AATA 4N0BA 1DJUA 3WGBA 3EIAA 3GSBA 1SF2A 2D5YA 1G7XA 3MAFB 4QGRA 3NU8A 2JJFA 4GDYA 2ZC0A 3DU4A 3COGA 3QM2A 8AATA 1LKCA 3E6GA 4XQ2A 2W7IA 4CBSA 5E5IA 2ZP7A 2BI9A 3NNKA 4XEWA 3JWAA 4A0FA 4EU1A 2R5CA 2DKBA 3Q8NA 4F5LA 2VGZA 4ATQA 1KL2A 1CQ7A 1AJRA 3WY7A 1DGDA 3LY1A 1AY5A 1ASAA 1SZUA 3EI6A 4EB5A 1X0MA 2C7TA 4ISYA 4I8AA 3NU7A 4UHMA 5AX8A 1AAMA 4KYOA 4R5FA 4ZSYA 2VMQA 4WLHA 3HMUA 4ZLVA 4JEXA 4F5HA 4M2MA 1O4SA 3OP7A 4WYCA 2HORA 4ZM3A 3EI5A 2FN6A 5EIGA 2JJGA 1MDZA 3ISLA 4WYFA 3MKJA 3DRDA 1DJEA 4IXOA 4RKDA 4Q31A 5M4DA 1AJSB 3K7YA 3LV2A 3P6KA 2YCPA 2FNUA 2EH6A 4CVQA 4A0GA 1DGEA 3FFRA 5EIGB 2F8JA 3LVLB 4DQ6A 5G0AA 1LS3A 3B1CA 4PFNA 3A9ZA 4RJ0A 3A8UX 3ZRRA 3I16A 4OYTA 3GBXA 4UHOA 4CXQA 1WKHA 3DXWA 3HVYA 2YKVA 1CJ0A 4KAMA 4Y0HA 2BWNA 3FVXA 1YOOA 1MDXA 3NX3A 1BS0A 4ITXA 4CBRA 1YJSA 3ASAA 3MBBA 2HUIA 2VMXA 2VMZA 3TATA 2E7UA 4K2BA 4DBCA 3LVKA 3B46A 4Y0IA 1S08A 2OQXA 2YKYA 4ITGA 4WXGA 3PD6B 1BJNA 4A00A 3R9AA 1BJOA 1WYTB 4GE4A 1WYVB 4TN4A 1LC7A 3UE8A 5G4JA 1X2AA 2E7JA 2BI2A 4AO9A 1YJZA 2D65A 3GZDC 4PIWA 5M4BA 1S06A 3W1HA 1EQBA 2Z20A 3II0A 1KL1A 3FQ8A 4JF0A 1ASFA 3PDBA 1DFOA 1OXOA 3PA9A 4ATPA 1KKJA 2AY3A 4A0RA 4CXRA 2VGSA 1OHYA 2VGWA 4P3MA 5IWQA 1M32A 1BJ4A 2CFBA 2GSAA 4A6UA 1C7OA 4OTLA 4H51A 4GSAA 2W7JA 2ZY2A 4MGRA 3HBXA 4WYEA 3UAKA 1QITA 4WXFA 1O69A 9AATA 2BIAA 3L8AA 1ASDA 3TFTA 2GB3A 1IBJA 1QJ3A 3H7FA 3LG0A 3FFHA 4OCAA 4OC9A 1RV3A 2WK7A 4BA5A 2ZSMA 4ZM4A 3R4TA 2DGLA 2VGUA 2VMRA 1TARA 2VYCA 1AHXA 3A9XA 2Q7WA 1DJ9A 4L0OA 2AY9A 2YRIA 1V2EA 2BWPA 3BV0A 1Z3ZA 3GETA 2X5FA 1ARGA 4RITA 4A72A 4ADDA 4U1TA 3PD6A 1B5OA 2C0RA 3AOVA 4Q75A 1BJOB 2O0RA 1O61A 1D7SA 3EI7A 2W7FA 1ASGA 2W8VA 1GBNA 4FL0A 1XI9A 4MQPA 1SPAA 2JG2A 3FDDA 1E5EA 1AMRA 2W7MA 2W8UA 1MGVA 3MEBA 3CQ5A 2HP1A 3RCHA 1WSTA 2ZJGA 3HLMA 3MC6A 4BA4A 2O1BA 1N2TA 1I29A 3G7QA 2VMYA 2AEVA 3IHJA 3LVMA 4LNMA 3MC6C 3GR9A 1W7LA 3NUIA 1V2DA 1ELUA 1AY4A 3A2BA 5EAAA 3QPGA 2XH1A 1IAYA 2W8WA 3NYUA 5E4ZA 3LVJA 1DKAA 1C7NA 3WKSA 2YCNA 1X29A 4WB0A 2YRRA 1WYVA 5JAYA 3DODA 1CQ8A 1AAWA 1AICA 3FZ8A 3JZLA 4W5KA 1GEXA 2VI9A 5FT8A 4P7YA 4PVFA 1ELQA 4XJLA 1B5PA 4ZDLA 2DKJA 4F4EA 3FZ6A 3I4JA 4XK1A 2D7ZA 2CJGA 1N8PA 4ZDPA 3W1IA 2AY5A 2CY8A 1S0AA 4GE7A 4LW2A 2W7HA 2E54A 1AY8A 2CSTA 1BKGA 2W7LA 3N75A 2R0TA 4MQRA 1BQAA 1YAAA 1AHFA 1I41A 1ASBA 4EB7A 2AY2A 2VLHA 3ZRQA 4W1WA 3PIUA 4GE9A 3MAFA 1UU2A 4Q76A 3NRAA 3WGCA 2Z9XA 4LNLA 2CINA 2HUUA 1P3WA 3KGWA 2QBTA 3FDBA 2DGKA 2R5EA 1FC4A 2VGTA 1C7GA 4AZJA 1M0QA 2Z9UA 5HHYA 5M46A 1OXPA 3TFUA 3A9YA 3ASBA 3QN6A 4BQ0A 1EG5A 2EPJA 1GDEA 4IY7A 3VK2A 1IX7A 5FT4A 3QHXA 1G4XA 2ZYJA 3RI6A 4WD2A 3ECDA 2X3LA 1KKPA 1LW4A 1SZSA 3DR7A 3FSLA 3FVSA 1WYUA 2HP2A 4M2KA 4IYOB 2YHKA 2BYJA 3BCXA 4EMYA 3E9KA 2BWOA 3WZFA 3AEMC 2C81A 1B4XA 2VMWA 3F0HA 3WLXA 1ECXA 2R5CB 2W7EA 3FTBA 1W7MA 1AMAA 3GWPA
chains in the Genus database with same CATH superfamily
4NOGA 5I92A 1UU1A 5LHAA 1AHEA 1ZC9A 4XJPA 1GC0A 4F5GA 1I43A 4J5UA 3H14A 1GC3A 2CTZA 1D7VA 2CH2A 3QGUA 1G4VA 4ZSWA 4E77A 4JEVA 4TMRA 1M6SA 3NYSA 3B1DA 3EI8A 1M0NA 3QI6A 4OBUA 1GEYA 2VIAA 4J8LA 4WB0B 3HDOA 2AY4A 1LC8A 3EIBA 3JW9A 4MSOA 5J8QA 2FYFA 4R5ZA 3ZZKA 2OGAA 2GMUA 4JEZA 3QBOA 1TOKA 2VMTA 1ARSA 3BCBA 1CQ6A 1V2FA 2AEUA 5DB5A 5BJ3A 1TOGA 1XEYA 3WCNA 1YNUA 4W91A 1OHVA 1W3UA 2W7GA 3KE3A 4JF1A 4ZDOA 4OBVA 2O7CA 2AY7A 2ZUKA 1Z7DA 3RUYA 4KXKA 1FG3A 2EGYA 4GRXA 4W8IA 1DTYA 1WYUB 2FM1A 2FQ6A 4IYOA 2PO3A 2D66A 1PG8A 2VMVA 1PFFA 3CQ4A 4O6ZA 5F8VA 4R2NA 3ACZA 4B9BA 1C9CA 4LNJA 4OMAA 2BI3A 5KTBA 1ARTA 1MAQA 1VJOA 3FCRA 3G8MA 1JS3A 3ELEA 4MKJA 4UQVA 5EAVA 3RBFA 1ASMA 1CL2A 2WKAA 3HL2A 4RLGA 2PB0A 2AY6A 3RBLA 3VAXA 1D7RA 1JS6A 2WK8A 2EZ1A 2Z67A 3FQ7A 3WX9A 1QISA 4U2HA 4WYAA 3G0TA 5G4IA 3LWSA 3ATHA 2VMOA 2HZPA 2E7IA 3OKSA 3AOWA 4RIZA 1KMJA 3BC8A 1BJWA 3N4RA 4MY5A 5DJ9A 3MADA 3USFA 2DOUA 4ZASA 1H0CA 2HOZA 1MDOA 1U08A 3BCAA 1TOIA 2DGMA 1ORDA 2G6WA 3PDXA 4M2JA 5HXXA 1H1CA 1S07A 3GZCA 3PGYA 5EUDA 1C4KA 4W1VA 5C6UA 1AMQA 2OGEA 2VI8A 1S09A 3NDNA 4EFFA 2WK9A 1ASCA 4RAEA 3BN1A 3WCOA 4WLJA 4F5IA 2YCTA 2A1VA 2CH1A 3L44A 1AHGA 4PFFA 1IAXA 1D7UA 1OATA 3ZZJA 2OATA 3BWNA 4IX8A 1CL1A 1KMKA 4HF8A 3PPLA 2CANA 4R8DA 3FRKA 3AEOA 2EZ2A 2BI1A 3I5TA 1BQDA 3VK4A 1AKCA 2W7KA 3EUCA 5D95A 1RV4A 2QLRA 4XAUA 4B98A 1OHWA 2D7YA 3DC1A 1JG8A 4W1XA 1UU0A 4ADCA 3H9XA 1CZCA 1TOEA 1ZOBA 3FZ7A 3PJ0A 3FQAA 2BYLA 2GMSA 3E2ZB 1ASLA 2W8JA 1BT4A 4E1OA 1ARHA 2X8UA 2YKUA 3DR4A 1B9IA 2CJDA 4Y0DA 2GQNA 4ADEA 4MKKA 3N4XA 1E5FA 1EJIA 1SZKA 2W7DA 3NTJA 2V0YA 3AEMA 3MAUA 3K28A 2XBNA 4TV7A 4OT8A 1GD9A 3AATA 5EFSA 4N0WA 5BJ4A 4MQQA 1CS1A 2AY8A 3BS8A 2ZSLA 1TOJA 1RVYA 3AENB 3B1EA 1FG7A 3GJUA 4RM1A 1YJYA 4WXBA 4WYGA 3E2YA 3UWCA 3EZ1A 1ASEA 3K40A 2EO5A 4Q6RA 1MLYA 3AEJC 3FKDA 3WKRA 1IVRA 3FD0A 2VIBA 3AENA 2VMPA 1ARIA 3GZDA 1N31A 2V1PA 2Z1YA 3AEJA 1B8GA 2HUFA 3EZSA 5G2PA 5LH9A 2D64A 3NUBA 2OKKA 4ZWMA 1W7NA 2QA3A 3KGXA 5D5SA 3CAIA 2Z9WA 1AIBA 1IUGA 3PDBB 2VMUA 3TQXA 2PB2A 2QMAA 4IXZA 5FT5A 3PAAA 2CB1A 5HDMA 1W23A 4F5KA 1MAPA 1M4NA 2DR1A 2BHXA 4XJOA 2QB2A 1Y4IA 1BW0A 4FFCA 5FT6A 3VOMA 4E3RA 3BB8A 2ZY3A 2Z1ZA 5TF5A 4IW7A 5G2QA 2BIGA 4DGTA 3TCMA 4K2MA 5G09A 1MLZA 4JE5A 2AY1A 2BI5A 3N7NA 4GEBA 1T3IA 3E77A 3BWNC 2D61A 3HT4A 4UOYA 3RQ1A 4WP0A 2VGVA 1GCKA 1WKGA 2HOYA 2R2NA 3KKIA 3ELPA 2ZY4A 1C0NA 1LK9A 2JGTA 4F5MA 4WYDA 1WYTA 3N5MA 4ZWVA 1CZEA 2Z9VA 1SFFA 4AH3A 3F6TA 3IF2A 4IXSA 1AKAA 1LC5A 1M7YA 2BKWA 5F9SA 2FNIA 2FKIA 3F9TA 4H63Q 1GEWA 3VP6A 3E2ZA 4AOAA 3AELA 3EI9A 2JJEA 2W8TA 3W1JA 4F5FA 3JWBA 5M49A 1YIYA 1AIAA 1B9HA 4A6TA 2D63A 3B8XA 1QIRA 1M0PA 1V72A 2Z61A 3FVUA 1AJSA 1J32A 1X28A 3BWOA 3DYDA 3DZZA 5EQCA 2VMSA 4A0HA 1J04A 4UHNA 2QSRA 4JEWA 4F5JA 1PMMA 3RCHB 1O62A 1TASA 2JISA 2VLFA 2HOXA 1G7WA 1AX4A 1IX8A 5K8BA 4K2IA 2TPLA 1GC4A 5DX5A 2ORDA 1TPLA 4XJMA 4K05A 1VEFA 1M0OA 1PMOA 2VMNA 4RKCA 3E2FA 3JTXA 4RJYA 3CQ6A 4LW4A 1AKBA 2CJHA 3JU7A 2YOBA 3HQTA 1D2FA 1LW5A 4LC3A 5EUEA 4A6RA 3P1TA 1IJIA 4HVKA 2BIEA 1QZ9A 3D6KA 3M5UA 2ZY5A 5EUNA 1KAFA 1AHYA 4BHDA 3N0LA 3NYTA 1QGNA 1JF9A 1RVUA 4ZAHA 4WBTA 1YIZA 4AZKA 4E3QA 1AMSA 2RFVA 3T32A 7AATA 5DJ1A 1IX6A 1SVVA 1ZODA 2JJHA 4AO4A 4BMKA 2NMPA 2QB3A 3AV7A 1TATA 4ADBA 4JEYA 1GC2A 3DXVA 1VP4A 3VK3A 2YKXA 1UKJA 2X5DA 3CBFA 1I48A 1QJ5A 4JE5D 3AEPA 3ZRPA 2C44A 1ASNA 2OKJA 5E3KA 2AATA 4N0BA 1DJUA 3WGBA 3EIAA 3GSBA 1SF2A 2D5YA 1G7XA 3MAFB 4QGRA 3NU8A 2JJFA 4GDYA 2ZC0A 3DU4A 3COGA 3QM2A 8AATA 1LKCA 3E6GA 4XQ2A 2W7IA 4CBSA 5E5IA 2ZP7A 2BI9A 3NNKA 4XEWA 3JWAA 4A0FA 4EU1A 2R5CA 2DKBA 3Q8NA 4F5LA 2VGZA 4ATQA 1KL2A 1CQ7A 1AJRA 3WY7A 1DGDA 3LY1A 1AY5A 1ASAA 1SZUA 3EI6A 4EB5A 1X0MA 2C7TA 4ISYA 4I8AA 3NU7A 4UHMA 5AX8A 1AAMA 4KYOA 4R5FA 4ZSYA 2VMQA 4WLHA 3HMUA 4ZLVA 4JEXA 4F5HA 4M2MA 1O4SA 3OP7A 4WYCA 2HORA 4ZM3A 3EI5A 2FN6A 5EIGA 2JJGA 1MDZA 3ISLA 4WYFA 3MKJA 3DRDA 1DJEA 4IXOA 4RKDA 4Q31A 5M4DA 1AJSB 3K7YA 3LV2A 3P6KA 2YCPA 2FNUA 2EH6A 4CVQA 4A0GA 1DGEA 3FFRA 5EIGB 2G7JA 2F8JA 3LVLB 4DQ6A 5G0AA 1LS3A 3B1CA 4PFNA 3A9ZA 4RJ0A 3A8UX 3ZRRA 3I16A 4OYTA 3GBXA 4UHOA 4CXQA 1WKHA 3DXWA 3HVYA 2YKVA 1CJ0A 4KAMA 4Y0HA 2BWNA 3FVXA 1YOOA 1MDXA 3NX3A 1BS0A 4ITXA 4CBRA 1YJSA 3ASAA 3MBBA 2HUIA 2VMXA 2VMZA 3TATA 2E7UA 4K2BA 4DBCA 3LVKA 3B46A 4Y0IA 1S08A 2OQXA 2YKYA 4ITGA 4WXGA 3PD6B 1BJNA 4A00A 3R9AA 1BJOA 1WYTB 4GE4A 1WYVB 4TN4A 1LC7A 3UE8A 5G4JA 1X2AA 2E7JA 2BI2A 4AO9A 1YJZA 2D65A 3GZDC 4PIWA 5M4BA 1S06A 3W1HA 1EQBA 2Z20A 3II0A 1KL1A 3FQ8A 4JF0A 1ASFA 3PDBA 1DFOA 1OXOA 3PA9A 4ATPA 1KKJA 2AY3A 4A0RA 4CXRA 2VGSA 1OHYA 2VGWA 4P3MA 5IWQA 1M32A 1BJ4A 2CFBA 2GSAA 4A6UA 1C7OA 4OTLA 4H51A 4GSAA 2W7JA 2ZY2A 4MGRA 3HBXA 4WYEA 3UAKA 1QITA 4WXFA 1O69A 9AATA 2BIAA 3L8AA 1ASDA 3TFTA 2GB3A 1IBJA 1QJ3A 3H7FA 3LG0A 3FFHA 4OCAA 4OC9A 1RV3A 2WK7A 4BA5A 2ZSMA 4ZM4A 3R4TA 2DGLA 2VGUA 2VMRA 1TARA 2VYCA 1AHXA 3A9XA 2Q7WA 1DJ9A 4L0OA 2AY9A 2YRIA 1V2EA 2BWPA 3BV0A 1Z3ZA 3GETA 2X5FA 1ARGA 4RITA 4A72A 4ADDA 4U1TA 3PD6A 1B5OA 2C0RA 3AOVA 4Q75A 1BJOB 2O0RA 1O61A 1D7SA 3EI7A 2W7FA 1ASGA 2W8VA 1GBNA 4FL0A 1XI9A 4MQPA 1SPAA 2JG2A 3FDDA 1E5EA 1AMRA 2W7MA 2W8UA 1MGVA 3MEBA 3CQ5A 2HP1A 3RCHA 1WSTA 2ZJGA 3HLMA 3MC6A 4BA4A 2O1BA 1N2TA 1I29A 3G7QA 2VMYA 2AEVA 3IHJA 3LVMA 4LNMA 3MC6C 3GR9A 1W7LA 3NUIA 1V2DA 1ELUA 1AY4A 3A2BA 5EAAA 3QPGA 2XH1A 1IAYA 2W8WA 3NYUA 5E4ZA 3LVJA 1DKAA 1C7NA 3WKSA 2YCNA 1X29A 4WB0A 2YRRA 1WYVA 5JAYA 3DODA 1CQ8A 1AAWA 1AICA 3FZ8A 3JZLA 4W5KA 1GEXA 2WB6A 2VI9A 5FT8A 4P7YA 4PVFA 1ELQA 4XJLA 1B5PA 4ZDLA 2DKJA 4F4EA 3FZ6A 3I4JA 4XK1A 2D7ZA 2CJGA 1N8PA 4ZDPA 3W1IA 2AY5A 2CY8A 1S0AA 4GE7A 4LW2A 2W7HA 2E54A 1AY8A 2CSTA 1BKGA 2W7LA 3N75A 2KFPA 2R0TA 4MQRA 1BQAA 1YAAA 1AHFA 1I41A 1ASBA 4EB7A 2AY2A 2VLHA 3ZRQA 4W1WA 3PIUA 4GE9A 3MAFA 1UU2A 4Q76A 3NRAA 3WGCA 2Z9XA 4LNLA 2CINA 2HUUA 1P3WA 3KGWA 2QBTA 3FDBA 2DGKA 2R5EA 1FC4A 2VGTA 1C7GA 4AZJA 1M0QA 2Z9UA 5HHYA 5M46A 1OXPA 3TFUA 3A9YA 3ASBA 3QN6A 4BQ0A 1EG5A 2EPJA 1GDEA 4IY7A 3VK2A 1IX7A 5FT4A 3QHXA 1G4XA 2ZYJA 3RI6A 4WD2A 3ECDA 2X3LA 1KKPA 1LW4A 1SZSA 3DR7A 3FSLA 3FVSA 1WYUA 2HP2A 2EYQA 4M2KA 4IYOB 2YHKA 2BYJA 3BCXA 4EMYA 3N4SA 3E9KA 2BWOA 3WZFA 3AEMC 2C81A 1B4XA 2VMWA 3F0HA 3WLXA 1ECXA 2R5CB 2W7EA 3FTBA 1W7MA 1AMAA 3GWPA
chains in the Genus database with same CATH topology
4NOGA 5I92A 1UU1A 5LHAA 1AHEA 1ZC9A 4XJPA 1GC0A 4F5GA 1I43A 4J5UA 3H14A 1GC3A 2CTZA 1D7VA 2CH2A 3QGUA 1G4VA 4ZSWA 4E77A 4JEVA 4TMRA 1M6SA 3NYSA 3B1DA 3EI8A 1M0NA 3QI6A 4OBUA 1GEYA 2VIAA 4J8LA 4WB0B 3HDOA 2AY4A 1LC8A 3EIBA 3JW9A 4MSOA 5J8QA 2FYFA 4R5ZA 3ZZKA 2OGAA 2GMUA 4JEZA 3QBOA 1TOKA 2VMTA 1ARSA 3BCBA 1CQ6A 1V2FA 2AEUA 5DB5A 5BJ3A 1TOGA 1XEYA 3WCNA 1YNUA 4W91A 1OHVA 1W3UA 2W7GA 3KE3A 4JF1A 4ZDOA 4OBVA 2O7CA 2AY7A 2ZUKA 1Z7DA 3RUYA 4KXKA 1FG3A 2EGYA 4GRXA 4W8IA 1DTYA 1WYUB 2FM1A 2FQ6A 4IYOA 2PO3A 2D66A 1PG8A 2VMVA 1PFFA 3CQ4A 4O6ZA 5F8VA 4R2NA 3ACZA 4B9BA 1C9CA 4LNJA 4OMAA 2BI3A 5KTBA 1ARTA 1MAQA 1VJOA 3FCRA 3G8MA 1JS3A 3ELEA 4MKJA 4UQVA 5EAVA 3RBFA 1ASMA 1CL2A 2WKAA 3HL2A 4RLGA 2PB0A 2AY6A 3RBLA 3VAXA 1D7RA 1JS6A 2WK8A 2EZ1A 2Z67A 3FQ7A 3WX9A 1QISA 4U2HA 4WYAA 3G0TA 5G4IA 3LWSA 3ATHA 2VMOA 2HZPA 2E7IA 3OKSA 3AOWA 4RIZA 1KMJA 3BC8A 1BJWA 3N4RA 4MY5A 5DJ9A 3MADA 3USFA 2DOUA 4ZASA 1H0CA 2HOZA 1MDOA 1U08A 3BCAA 1TOIA 2DGMA 1ORDA 2G6WA 3PDXA 4M2JA 5HXXA 1H1CA 1S07A 3GZCA 3PGYA 5EUDA 1C4KA 4W1VA 5C6UA 1AMQA 2OGEA 2VI8A 1S09A 3NDNA 4EFFA 2WK9A 1ASCA 4RAEA 3BN1A 3WCOA 4WLJA 4F5IA 2YCTA 2A1VA 2CH1A 3L44A 1AHGA 4PFFA 1IAXA 1D7UA 1OATA 3ZZJA 2OATA 3BWNA 4IX8A 1CL1A 1KMKA 4HF8A 3PPLA 2CANA 4R8DA 3FRKA 3AEOA 2EZ2A 2BI1A 3I5TA 1BQDA 3VK4A 1AKCA 2W7KA 3EUCA 5D95A 1RV4A 2QLRA 4XAUA 4B98A 1OHWA 2D7YA 3DC1A 1JG8A 4W1XA 1UU0A 4ADCA 3H9XA 1CZCA 1TOEA 1ZOBA 3FZ7A 3PJ0A 3FQAA 2BYLA 2GMSA 3E2ZB 1ASLA 2W8JA 1BT4A 4E1OA 1ARHA 2X8UA 2YKUA 3DR4A 1B9IA 2CJDA 4Y0DA 2GQNA 4ADEA 4MKKA 3N4XA 1E5FA 1EJIA 1SZKA 2W7DA 3NTJA 2V0YA 3AEMA 3MAUA 3K28A 2XBNA 4TV7A 4OT8A 1GD9A 3AATA 5EFSA 4N0WA 5BJ4A 4MQQA 1CS1A 2AY8A 3BS8A 2ZSLA 1TOJA 1RVYA 3AENB 3B1EA 1FG7A 3GJUA 4RM1A 1YJYA 4WXBA 4WYGA 3E2YA 3UWCA 3EZ1A 1ASEA 3K40A 2EO5A 4Q6RA 1MLYA 3AEJC 3FKDA 3WKRA 1IVRA 3FD0A 2VIBA 3AENA 2VMPA 1ARIA 3GZDA 1N31A 2V1PA 2Z1YA 3AEJA 1B8GA 2HUFA 3EZSA 5G2PA 5LH9A 2D64A 3NUBA 2OKKA 4ZWMA 1W7NA 2QA3A 3KGXA 5D5SA 3CAIA 2Z9WA 1AIBA 1IUGA 3PDBB 2VMUA 3TQXA 2PB2A 2QMAA 4IXZA 5FT5A 3PAAA 2CB1A 5HDMA 1W23A 4F5KA 1MAPA 1M4NA 2DR1A 2BHXA 4XJOA 2QB2A 1Y4IA 1BW0A 4FFCA 5FT6A 3VOMA 4E3RA 3BB8A 2ZY3A 2Z1ZA 5TF5A 4IW7A 5G2QA 2BIGA 4DGTA 3TCMA 4K2MA 5G09A 1MLZA 4JE5A 2AY1A 2BI5A 3N7NA 4GEBA 1T3IA 3E77A 3BWNC 2D61A 3HT4A 4UOYA 3RQ1A 4WP0A 2VGVA 1GCKA 1WKGA 2HOYA 2R2NA 3KKIA 3ELPA 2ZY4A 1C0NA 1LK9A 2JGTA 4F5MA 4WYDA 1WYTA 3N5MA 4ZWVA 1CZEA 2Z9VA 1SFFA 4AH3A 3F6TA 3IF2A 4IXSA 1AKAA 1LC5A 1M7YA 2BKWA 5F9SA 2FNIA 2FKIA 3F9TA 4H63Q 1GEWA 3VP6A 3E2ZA 4AOAA 3AELA 3EI9A 2JJEA 2W8TA 3W1JA 4F5FA 3JWBA 5M49A 1YIYA 1AIAA 1B9HA 4A6TA 2D63A 3B8XA 1QIRA 1M0PA 1V72A 2Z61A 3FVUA 1AJSA 1J32A 1X28A 3BWOA 3DYDA 3DZZA 5EQCA 2VMSA 4A0HA 1J04A 4UHNA 2QSRA 4JEWA 4F5JA 1PMMA 3RCHB 1O62A 1TASA 2JISA 2VLFA 2HOXA 1G7WA 1AX4A 1IX8A 5K8BA 4K2IA 2TPLA 1GC4A 5DX5A 2ORDA 1TPLA 4XJMA 4K05A 1VEFA 1M0OA 1PMOA 2VMNA 4RKCA 3E2FA 3JTXA 4RJYA 3CQ6A 4LW4A 1AKBA 2CJHA 3JU7A 2YOBA 3HQTA 1D2FA 1LW5A 4LC3A 5EUEA 4A6RA 3P1TA 1IJIA 4HVKA 2BIEA 1QZ9A 3D6KA 3M5UA 2ZY5A 5EUNA 1AHYA 4BHDA 3N0LA 3NYTA 1QGNA 1JF9A 1RVUA 4ZAHA 4WBTA 1YIZA 4AZKA 4E3QA 1AMSA 2RFVA 3T32A 7AATA 5DJ1A 1IX6A 1SVVA 1ZODA 2JJHA 4AO4A 4BMKA 2NMPA 2QB3A 3AV7A 1TATA 4ADBA 4JEYA 1GC2A 3DXVA 1VP4A 3VK3A 2YKXA 1UKJA 2X5DA 3CBFA 1I48A 1QJ5A 4JE5D 3AEPA 3ZRPA 2C44A 1ASNA 2OKJA 5E3KA 2AATA 4N0BA 1DJUA 3WGBA 3EIAA 3GSBA 1SF2A 2D5YA 1G7XA 3MAFB 4QGRA 3NU8A 2JJFA 4GDYA 2ZC0A 3DU4A 3COGA 3QM2A 8AATA 1LKCA 3E6GA 4XQ2A 2W7IA 4CBSA 5E5IA 2ZP7A 2BI9A 3NNKA 4XEWA 3JWAA 4A0FA 4EU1A 2R5CA 2DKBA 3Q8NA 4F5LA 2VGZA 4ATQA 1KL2A 1CQ7A 1AJRA 3WY7A 1DGDA 3LY1A 1AY5A 1ASAA 1SZUA 3EI6A 4EB5A 1X0MA 2C7TA 4ISYA 4I8AA 3NU7A 4UHMA 5AX8A 1AAMA 4KYOA 4R5FA 4ZSYA 2VMQA 4WLHA 3HMUA 4ZLVA 4JEXA 4F5HA 4M2MA 1O4SA 3OP7A 4WYCA 2HORA 4ZM3A 3EI5A 2FN6A 5EIGA 2JJGA 1MDZA 3ISLA 4WYFA 3MKJA 3DRDA 1DJEA 4IXOA 4RKDA 4Q31A 5M4DA 1AJSB 3K7YA 3LV2A 3P6KA 2YCPA 2FNUA 2EH6A 4CVQA 4A0GA 1DGEA 3FFRA 5EIGB 2G7JA 2F8JA 3LVLB 4DQ6A 5G0AA 1LS3A 3B1CA 4PFNA 3A9ZA 4RJ0A 3A8UX 3ZRRA 3I16A 4OYTA 3GBXA 4UHOA 4CXQA 1WKHA 3DXWA 3HVYA 2YKVA 1CJ0A 4KAMA 4Y0HA 2BWNA 3FVXA 1YOOA 1MDXA 3NX3A 1BS0A 4ITXA 4CBRA 1YJSA 3ASAA 3MBBA 2HUIA 2VMXA 2VMZA 3TATA 2E7UA 4K2BA 4DBCA 3LVKA 3B46A 4Y0IA 1S08A 2OQXA 2YKYA 4ITGA 4WXGA 3PD6B 1BJNA 4A00A 3R9AA 1BJOA 1WYTB 4GE4A 1WYVB 4TN4A 1LC7A 3UE8A 5G4JA 1X2AA 2E7JA 2BI2A 4AO9A 1YJZA 2D65A 3GZDC 4PIWA 5M4BA 1S06A 3W1HA 1EQBA 2Z20A 3II0A 1KL1A 3FQ8A 4JF0A 1ASFA 3PDBA 1DFOA 1OXOA 3PA9A 4ATPA 1KKJA 2AY3A 4A0RA 4CXRA 2VGSA 1OHYA 2VGWA 4P3MA 5IWQA 1M32A 1BJ4A 2CFBA 2GSAA 4A6UA 1C7OA 4OTLA 4H51A 4GSAA 2W7JA 2ZY2A 4MGRA 3HBXA 4WYEA 3UAKA 1QITA 4WXFA 1O69A 9AATA 2BIAA 3L8AA 1ASDA 3TFTA 2GB3A 1IBJA 1QJ3A 3H7FA 3LG0A 3FFHA 4OCAA 4OC9A 1RV3A 2WK7A 4BA5A 2ZSMA 4ZM4A 3R4TA 2DGLA 2VGUA 2VMRA 1TARA 2VYCA 1AHXA 3A9XA 2Q7WA 1DJ9A 4L0OA 2AY9A 2YRIA 1V2EA 2BWPA 3BV0A 1Z3ZA 3GETA 2X5FA 1ARGA 4RITA 4A72A 4ADDA 4U1TA 3PD6A 1B5OA 2C0RA 3AOVA 4Q75A 1BJOB 2O0RA 1O61A 1D7SA 3EI7A 2W7FA 1ASGA 2W8VA 1GBNA 4FL0A 1XI9A 4MQPA 1SPAA 2JG2A 3FDDA 1E5EA 1AMRA 2W7MA 2W8UA 1MGVA 3MEBA 3CQ5A 2HP1A 3RCHA 1WSTA 2ZJGA 3HLMA 3MC6A 4BA4A 2O1BA 1N2TA 1I29A 3G7QA 2VMYA 2AEVA 3IHJA 3LVMA 4LNMA 3MC6C 3GR9A 1W7LA 3NUIA 1V2DA 1ELUA 1AY4A 3A2BA 5EAAA 3QPGA 2XH1A 1IAYA 2W8WA 3NYUA 5E4ZA 3LVJA 1DKAA 1C7NA 3WKSA 2YCNA 1X29A 4WB0A 2YRRA 1WYVA 5JAYA 3DODA 1CQ8A 1AAWA 1AICA 3FZ8A 3JZLA 4W5KA 1GEXA 2WB6A 2VI9A 5FT8A 4P7YA 4PVFA 1ELQA 4XJLA 1B5PA 4ZDLA 2DKJA 4F4EA 3FZ6A 3I4JA 4XK1A 2D7ZA 2CJGA 1N8PA 4ZDPA 3W1IA 2AY5A 2CY8A 1S0AA 4GE7A 4LW2A 2W7HA 2E54A 1AY8A 2CSTA 1BKGA 2W7LA 3N75A 2KFPA 2R0TA 4MQRA 1BQAA 1YAAA 1AHFA 1I41A 1ASBA 4EB7A 2AY2A 2VLHA 3ZRQA 4W1WA 3PIUA 4GE9A 3MAFA 1UU2A 4Q76A 3NRAA 3WGCA 2Z9XA 4LNLA 2CINA 2HUUA 1P3WA 3KGWA 2QBTA 3FDBA 2DGKA 2R5EA 1FC4A 2VGTA 1C7GA 4AZJA 1M0QA 2Z9UA 5HHYA 5M46A 1OXPA 3TFUA 3A9YA 3ASBA 3QN6A 4BQ0A 1EG5A 2EPJA 1GDEA 4IY7A 3VK2A 1IX7A 5FT4A 3QHXA 1G4XA 2ZYJA 3RI6A 4WD2A 3ECDA 2X3LA 1KKPA 1LW4A 1SZSA 3DR7A 3FSLA 3FVSA 1WYUA 2HP2A 2EYQA 4M2KA 4IYOB 2YHKA 2BYJA 3BCXA 4EMYA 3N4SA 3E9KA 2BWOA 3WZFA 3AEMC 2C81A 1B4XA 2VMWA 3F0HA 3WLXA 1ECXA 2R5CB 2W7EA 3FTBA 1W7MA 1AMAA 3GWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOG A;  5I92 A;  1UU1 A;  5LHA A;  1AHE A;  1ZC9 A;  4XJP A;  1GC0 A;  4F5G A;  1I43 A;  4J5U A;  3H14 A;  1GC3 A;  2CTZ A;  1D7V A;  2CH2 A;  3QGU A;  1G4V A;  4ZSW A;  4E77 A;  4JEV A;  4TMR A;  1M6S A;  3NYS A;  3B1D A;  3EI8 A;  1M0N A;  3QI6 A;  4OBU A;  1GEY A;  2VIA A;  4J8L A;  4WB0 B;  3HDO A;  2AY4 A;  1LC8 A;  3EIB A;  3JW9 A;  4MSO A;  5J8Q A;  2FYF A;  4R5Z A;  3ZZK A;  2OGA A;  2GMU A;  4JEZ A;  3QBO A;  1TOK A;  2VMT A;  1ARS A;  3BCB A;  1CQ6 A;  1V2F A;  2AEU A;  5DB5 A;  5BJ3 A;  1TOG A;  1XEY A;  3WCN A;  1YNU A;  4W91 A;  1OHV A;  1W3U A;  2W7G A;  3KE3 A;  4JF1 A;  4ZDO A;  4OBV A;  2O7C A;  2AY7 A;  2ZUK A;  1Z7D A;  3RUY A;  4KXK A;  1FG3 A;  2EGY A;  4GRX A;  4W8I A;  1DTY A;  1WYU B;  2FM1 A;  2FQ6 A;  4IYO A;  2PO3 A;  2D66 A;  1PG8 A;  2VMV A;  1PFF A;  3CQ4 A;  4O6Z A;  5F8V A;  4R2N A;  3ACZ A;  4B9B A;  1C9C A;  4LNJ A;  4OMA A;  2BI3 A;  1ART A;  1MAQ A;  1VJO A;  3FCR A;  3G8M A;  1JS3 A;  3ELE A;  4MKJ A;  4UQV A;  5EAV A;  3RBF A;  1ASM A;  1CL2 A;  2WKA A;  3HL2 A;  4RLG A;  2PB0 A;  2AY6 A;  3RBL A;  3VAX A;  1D7R A;  1JS6 A;  2WK8 A;  2EZ1 A;  2Z67 A;  3FQ7 A;  3WX9 A;  1QIS A;  4U2H A;  4WYA A;  3G0T A;  5G4I A;  3LWS A;  3ATH A;  2VMO A;  2HZP A;  2E7I A;  3OKS A;  3AOW A;  4RIZ A;  1KMJ A;  3BC8 A;  1BJW A;  4MY5 A;  5DJ9 A;  3MAD A;  3USF A;  2DOU A;  4ZAS A;  1H0C A;  2HOZ A;  1MDO A;  1U08 A;  3BCA A;  1TOI A;  2DGM A;  1ORD A;  2G6W A;  3PDX A;  4M2J A;  5HXX A;  1H1C A;  1S07 A;  3GZC A;  3PGY A;  5EUD A;  1C4K A;  4W1V A;  5C6U A;  1AMQ A;  2OGE A;  2VI8 A;  1S09 A;  3NDN A;  4EFF A;  2WK9 A;  1ASC A;  4RAE A;  3BN1 A;  3WCO A;  4WLJ A;  4F5I A;  2YCT A;  2CH1 A;  3L44 A;  1AHG A;  4PFF A;  1IAX A;  1D7U A;  1OAT A;  3ZZJ A;  2OAT A;  3BWN A;  4IX8 A;  1CL1 A;  1KMK A;  4HF8 A;  3PPL A;  2CAN A;  4R8D A;  3FRK A;  3AEO A;  2EZ2 A;  2BI1 A;  3I5T A;  1BQD A;  3VK4 A;  1AKC A;  2W7K A;  3EUC A;  5D95 A;  1RV4 A;  2QLR A;  4XAU A;  4B98 A;  1OHW A;  2D7Y A;  3DC1 A;  1JG8 A;  4W1X A;  1UU0 A;  4ADC A;  1CZC A;  1TOE A;  1ZOB A;  3FZ7 A;  3PJ0 A;  3FQA A;  2BYL A;  2GMS A;  3E2Z B;  1ASL A;  2W8J A;  1BT4 A;  4E1O A;  1ARH A;  2X8U A;  2YKU A;  3DR4 A;  1B9I A;  2CJD A;  4Y0D A;  2GQN A;  4ADE A;  4MKK A;  1E5F A;  1EJI A;  1SZK A;  2W7D A;  3NTJ A;  2V0Y A;  3AEM A;  3MAU A;  3K28 A;  2XBN A;  4TV7 A;  4OT8 A;  1GD9 A;  3AAT A;  5EFS A;  4N0W A;  5BJ4 A;  4MQQ A;  1CS1 A;  2AY8 A;  3BS8 A;  2ZSL A;  1TOJ A;  1RVY A;  3AEN B;  3B1E A;  1FG7 A;  3GJU A;  4RM1 A;  1YJY A;  4WXB A;  4WYG A;  3E2Y A;  3UWC A;  3EZ1 A;  1ASE A;  3K40 A;  2EO5 A;  4Q6R A;  1MLY A;  3AEJ C;  3FKD A;  3WKR A;  1IVR A;  3FD0 A;  2VIB A;  3AEN A;  2VMP A;  1ARI A;  3GZD A;  1N31 A;  2V1P A;  2Z1Y A;  3AEJ A;  1B8G A;  2HUF A;  3EZS A;  5G2P A;  5LH9 A;  2D64 A;  3NUB A;  2OKK A;  4ZWM A;  1W7N A;  2QA3 A;  3KGX A;  5D5S A;  3CAI A;  2Z9W A;  1AIB A;  1IUG A;  3PDB B;  2VMU A;  3TQX A;  2PB2 A;  2QMA A;  4IXZ A;  5FT5 A;  3PAA A;  2CB1 A;  5HDM A;  1W23 A;  4F5K A;  1MAP A;  1M4N A;  2DR1 A;  2BHX A;  4XJO A;  2QB2 A;  1Y4I A;  1BW0 A;  4FFC A;  5FT6 A;  3VOM A;  4E3R A;  3BB8 A;  2ZY3 A;  2Z1Z A;  5TF5 A;  4IW7 A;  5G2Q A;  2BIG A;  4DGT A;  3TCM A;  4K2M A;  5G09 A;  1MLZ A;  4JE5 A;  2AY1 A;  2BI5 A;  4GEB A;  1T3I A;  3E77 A;  3BWN C;  2D61 A;  3HT4 A;  4UOY A;  3RQ1 A;  4WP0 A;  2VGV A;  1GCK A;  1WKG A;  2HOY A;  2R2N A;  3KKI A;  3ELP A;  2ZY4 A;  1C0N A;  1LK9 A;  2JGT A;  4F5M A;  4WYD A;  1WYT A;  3N5M A;  4ZWV A;  1CZE A;  2Z9V A;  1SFF A;  4AH3 A;  3F6T A;  3IF2 A;  4IXS A;  1AKA A;  1LC5 A;  1M7Y A;  2BKW A;  5F9S A;  2FNI A;  3F9T A;  1GEW A;  3VP6 A;  3E2Z A;  4AOA A;  3AEL A;  3EI9 A;  2JJE A;  2W8T A;  3W1J A;  4F5F A;  3JWB A;  5M49 A;  1YIY A;  1AIA A;  1B9H A;  4A6T A;  2D63 A;  3B8X A;  1QIR A;  1M0P A;  1V72 A;  2Z61 A;  3FVU A;  1AJS A;  1J32 A;  1X28 A;  3BWO A;  3DYD A;  3DZZ A;  5EQC A;  2VMS A;  4A0H A;  1J04 A;  4UHN A;  4JEW A;  4F5J A;  1PMM A;  3RCH B;  1O62 A;  1TAS A;  2JIS A;  2VLF A;  2HOX A;  1G7W A;  1AX4 A;  1IX8 A;  5K8B A;  4K2I A;  2TPL A;  1GC4 A;  5DX5 A;  2ORD A;  1TPL A;  4XJM A;  1VEF A;  1M0O A;  1PMO A;  2VMN A;  4RKC A;  3E2F A;  3JTX A;  4RJY A;  3CQ6 A;  4LW4 A;  1AKB A;  2CJH A;  3JU7 A;  2YOB A;  3HQT A;  1D2F A;  1LW5 A;  4LC3 A;  5EUE A;  4A6R A;  3P1T A;  1IJI A;  4HVK A;  2BIE A;  1QZ9 A;  3D6K A;  3M5U A;  2ZY5 A;  5EUN A;  1AHY A;  4BHD A;  3N0L A;  3NYT A;  1QGN A;  1JF9 A;  1RVU A;  4ZAH A;  4WBT A;  1YIZ A;  4AZK A;  4E3Q A;  1AMS A;  2RFV A;  3T32 A;  7AAT A;  5DJ1 A;  1IX6 A;  1SVV A;  1ZOD A;  2JJH A;  4AO4 A;  4BMK A;  2NMP A;  2QB3 A;  3AV7 A;  1TAT A;  4ADB A;  4JEY A;  1GC2 A;  3DXV A;  1VP4 A;  3VK3 A;  2YKX A;  1UKJ A;  2X5D A;  3CBF A;  1I48 A;  1QJ5 A;  4JE5 D;  3AEP A;  3ZRP A;  2C44 A;  1ASN A;  2OKJ A;  5E3K A;  2AAT A;  4N0B A;  1DJU A;  3WGB A;  3EIA A;  3GSB A;  1SF2 A;  2D5Y A;  1G7X A;  3MAF B;  4QGR A;  3NU8 A;  2JJF A;  4GDY A;  2ZC0 A;  3DU4 A;  3COG A;  3QM2 A;  8AAT A;  1LKC A;  3E6G A;  4XQ2 A;  2W7I A;  4CBS A;  5E5I A;  2ZP7 A;  2BI9 A;  3NNK A;  4XEW A;  3JWA A;  4A0F A;  4EU1 A;  2R5C A;  2DKB A;  3Q8N A;  4F5L A;  2VGZ A;  4ATQ A;  1KL2 A;  1CQ7 A;  1AJR A;  3WY7 A;  1DGD A;  3LY1 A;  1AY5 A;  1ASA A;  1SZU A;  3EI6 A;  4EB5 A;  1X0M A;  2C7T A;  4ISY A;  4I8A A;  3NU7 A;  4UHM A;  5AX8 A;  1AAM A;  4KYO A;  4R5F A;  4ZSY A;  2VMQ A;  4WLH A;  3HMU A;  4ZLV A;  4JEX A;  4F5H A;  4M2M A;  1O4S A;  3OP7 A;  4WYC A;  2HOR A;  4ZM3 A;  3EI5 A;  2FN6 A;  5EIG A;  2JJG A;  1MDZ A;  3ISL A;  4WYF A;  3MKJ A;  3DRD A;  1DJE A;  4IXO A;  4RKD A;  4Q31 A;  5M4D A;  1AJS B;  3K7Y A;  3LV2 A;  3P6K A;  2YCP A;  2FNU A;  2EH6 A;  4CVQ A;  4A0G A;  1DGE A;  3FFR A;  5EIG B;  2F8J A;  3LVL B;  4DQ6 A;  5G0A A;  1LS3 A;  3B1C A;  4PFN A;  3A9Z A;  4RJ0 A;  3A8U X;  3ZRR A;  3I16 A;  4OYT A;  3GBX A;  4UHO A;  4CXQ A;  1WKH A;  3DXW A;  3HVY A;  2YKV A;  1CJ0 A;  4KAM A;  4Y0H A;  2BWN A;  3FVX A;  1YOO A;  1MDX A;  3NX3 A;  1BS0 A;  4ITX A;  4CBR A;  1YJS A;  3ASA A;  3MBB A;  2HUI A;  2VMX A;  2VMZ A;  3TAT A;  2E7U A;  4K2B A;  4DBC A;  3LVK A;  3B46 A;  4Y0I A;  1S08 A;  2OQX A;  2YKY A;  4ITG A;  4WXG A;  3PD6 B;  1BJN A;  4A00 A;  3R9A A;  1BJO A;  1WYT B;  4GE4 A;  1WYV B;  4TN4 A;  1LC7 A;  3UE8 A;  5G4J A;  1X2A A;  2E7J A;  2BI2 A;  4AO9 A;  1YJZ A;  2D65 A;  3GZD C;  4PIW A;  5M4B A;  1S06 A;  3W1H A;  1EQB A;  2Z20 A;  3II0 A;  1KL1 A;  3FQ8 A;  4JF0 A;  1ASF A;  3PDB A;  1DFO A;  1OXO A;  3PA9 A;  4ATP A;  1KKJ A;  2AY3 A;  4A0R A;  4CXR A;  2VGS A;  1OHY A;  2VGW A;  4P3M A;  5IWQ A;  1M32 A;  1BJ4 A;  2CFB A;  2GSA A;  4A6U A;  1C7O A;  4OTL A;  4H51 A;  4GSA A;  2W7J A;  2ZY2 A;  4MGR A;  3HBX A;  4WYE A;  3UAK A;  1QIT A;  4WXF A;  1O69 A;  9AAT A;  2BIA A;  3L8A A;  1ASD A;  3TFT A;  2GB3 A;  1IBJ A;  1QJ3 A;  3H7F A;  3LG0 A;  3FFH A;  4OCA A;  4OC9 A;  1RV3 A;  2WK7 A;  4BA5 A;  2ZSM A;  4ZM4 A;  3R4T A;  2DGL A;  2VGU A;  2VMR A;  1TAR A;  2VYC A;  1AHX A;  3A9X A;  2Q7W A;  1DJ9 A;  4L0O A;  2AY9 A;  2YRI A;  1V2E A;  2BWP A;  3BV0 A;  1Z3Z A;  3GET A;  2X5F A;  1ARG A;  4RIT A;  4A72 A;  4ADD A;  4U1T A;  3PD6 A;  1B5O A;  2C0R A;  3AOV A;  4Q75 A;  1BJO B;  2O0R A;  1O61 A;  1D7S A;  3EI7 A;  2W7F A;  1ASG A;  2W8V A;  1GBN A;  4FL0 A;  1XI9 A;  4MQP A;  1SPA A;  2JG2 A;  3FDD A;  1E5E A;  1AMR A;  2W7M A;  2W8U A;  1MGV A;  3MEB A;  3CQ5 A;  2HP1 A;  3RCH A;  1WST A;  2ZJG A;  3HLM A;  3MC6 A;  4BA4 A;  2O1B A;  1N2T A;  1I29 A;  3G7Q A;  2VMY A;  2AEV A;  3IHJ A;  3LVM A;  4LNM A;  3MC6 C;  3GR9 A;  1W7L A;  3NUI A;  1V2D A;  1ELU A;  1AY4 A;  3A2B A;  5EAA A;  3QPG A;  2XH1 A;  1IAY A;  2W8W A;  3NYU A;  5E4Z A;  3LVJ A;  1DKA A;  1C7N A;  3WKS A;  2YCN A;  1X29 A;  4WB0 A;  2YRR A;  1WYV A;  5JAY A;  3DOD A;  1CQ8 A;  1AAW A;  1AIC A;  3FZ8 A;  3JZL A;  4W5K A;  1GEX A;  2VI9 A;  5FT8 A;  4P7Y A;  4PVF A;  1ELQ A;  4XJL A;  1B5P A;  4ZDL A;  2DKJ A;  4F4E A;  3FZ6 A;  3I4J A;  4XK1 A;  2D7Z A;  2CJG A;  1N8P A;  4ZDP A;  3W1I A;  2AY5 A;  2CY8 A;  1S0A A;  4GE7 A;  4LW2 A;  2W7H A;  2E54 A;  1AY8 A;  2CST A;  1BKG A;  2W7L A;  3N75 A;  2R0T A;  4MQR A;  1BQA A;  1YAA A;  1AHF A;  1I41 A;  1ASB A;  4EB7 A;  2AY2 A;  2VLH A;  3ZRQ A;  4W1W A;  3PIU A;  4GE9 A;  3MAF A;  1UU2 A;  4Q76 A;  3NRA A;  3WGC A;  2Z9X A;  4LNL A;  2CIN A;  2HUU A;  1P3W A;  3KGW A;  2QBT A;  3FDB A;  2DGK A;  2R5E A;  1FC4 A;  2VGT A;  1C7G A;  4AZJ A;  1M0Q A;  2Z9U A;  5HHY A;  5M46 A;  1OXP A;  3TFU A;  3A9Y A;  3ASB A;  3QN6 A;  4BQ0 A;  1EG5 A;  2EPJ A;  1GDE A;  4IY7 A;  3VK2 A;  1IX7 A;  5FT4 A;  3QHX A;  1G4X A;  2ZYJ A;  3RI6 A;  4WD2 A;  3ECD A;  2X3L A;  1KKP A;  1LW4 A;  1SZS A;  3DR7 A;  3FSL A;  3FVS A;  1WYU A;  2HP2 A;  4M2K A;  4IYO B;  2YHK A;  2BYJ A;  3BCX A;  4EMY A;  3E9K A;  2BWO A;  3WZF A;  3AEM C;  2C81 A;  1B4X A;  2VMW A;  3F0H A;  3WLX A;  1ECX A;  2R5C B;  2W7E A;  3FTB A;  1W7M A;  1AMA A;  3GWP A; 
#chains in the Genus database with same CATH topology
 4NOG A;  5I92 A;  1UU1 A;  5LHA A;  1AHE A;  1ZC9 A;  4XJP A;  1GC0 A;  4F5G A;  1I43 A;  4J5U A;  3H14 A;  1GC3 A;  2CTZ A;  1D7V A;  2CH2 A;  3QGU A;  1G4V A;  4ZSW A;  4E77 A;  4JEV A;  4TMR A;  1M6S A;  3NYS A;  3B1D A;  3EI8 A;  1M0N A;  3QI6 A;  4OBU A;  1GEY A;  2VIA A;  4J8L A;  4WB0 B;  3HDO A;  2AY4 A;  1LC8 A;  3EIB A;  3JW9 A;  4MSO A;  5J8Q A;  2FYF A;  4R5Z A;  3ZZK A;  2OGA A;  2GMU A;  4JEZ A;  3QBO A;  1TOK A;  2VMT A;  1ARS A;  3BCB A;  1CQ6 A;  1V2F A;  2AEU A;  5DB5 A;  5BJ3 A;  1TOG A;  1XEY A;  3WCN A;  1YNU A;  4W91 A;  1OHV A;  1W3U A;  2W7G A;  3KE3 A;  4JF1 A;  4ZDO A;  4OBV A;  2O7C A;  2AY7 A;  2ZUK A;  1Z7D A;  3RUY A;  4KXK A;  1FG3 A;  2EGY A;  4GRX A;  4W8I A;  1DTY A;  1WYU B;  2FM1 A;  2FQ6 A;  4IYO A;  2PO3 A;  2D66 A;  1PG8 A;  2VMV A;  1PFF A;  3CQ4 A;  4O6Z A;  5F8V A;  4R2N A;  3ACZ A;  4B9B A;  1C9C A;  4LNJ A;  4OMA A;  2BI3 A;  5KTB A;  1ART A;  1MAQ A;  1VJO A;  3FCR A;  3G8M A;  1JS3 A;  3ELE A;  4MKJ A;  4UQV A;  5EAV A;  3RBF A;  1ASM A;  1CL2 A;  2WKA A;  3HL2 A;  4RLG A;  2PB0 A;  2AY6 A;  3RBL A;  3VAX A;  1D7R A;  1JS6 A;  2WK8 A;  2EZ1 A;  2Z67 A;  3FQ7 A;  3WX9 A;  1QIS A;  4U2H A;  4WYA A;  3G0T A;  5G4I A;  3LWS A;  3ATH A;  2VMO A;  2HZP A;  2E7I A;  3OKS A;  3AOW A;  4RIZ A;  1KMJ A;  3BC8 A;  1BJW A;  3N4R A;  4MY5 A;  5DJ9 A;  3MAD A;  3USF A;  2DOU A;  4ZAS A;  1H0C A;  2HOZ A;  1MDO A;  1U08 A;  3BCA A;  1TOI A;  2DGM A;  1ORD A;  2G6W A;  3PDX A;  4M2J A;  5HXX A;  1H1C A;  1S07 A;  3GZC A;  3PGY A;  5EUD A;  1C4K A;  4W1V A;  5C6U A;  1AMQ A;  2OGE A;  2VI8 A;  1S09 A;  3NDN A;  4EFF A;  2WK9 A;  1ASC A;  4RAE A;  3BN1 A;  3WCO A;  4WLJ A;  4F5I A;  2YCT A;  2A1V A;  2CH1 A;  3L44 A;  1AHG A;  4PFF A;  1IAX A;  1D7U A;  1OAT A;  3ZZJ A;  2OAT A;  3BWN A;  4IX8 A;  1CL1 A;  1KMK A;  4HF8 A;  3PPL A;  2CAN A;  4R8D A;  3FRK A;  3AEO A;  2EZ2 A;  2BI1 A;  3I5T A;  1BQD A;  3VK4 A;  1AKC A;  2W7K A;  3EUC A;  5D95 A;  1RV4 A;  2QLR A;  4XAU A;  4B98 A;  1OHW A;  2D7Y A;  3DC1 A;  1JG8 A;  4W1X A;  1UU0 A;  4ADC A;  3H9X A;  1CZC A;  1TOE A;  1ZOB A;  3FZ7 A;  3PJ0 A;  3FQA A;  2BYL A;  2GMS A;  3E2Z B;  1ASL A;  2W8J A;  1BT4 A;  4E1O A;  1ARH A;  2X8U A;  2YKU A;  3DR4 A;  1B9I A;  2CJD A;  4Y0D A;  2GQN A;  4ADE A;  4MKK A;  3N4X A;  1E5F A;  1EJI A;  1SZK A;  2W7D A;  3NTJ A;  2V0Y A;  3AEM A;  3MAU A;  3K28 A;  2XBN A;  4TV7 A;  4OT8 A;  1GD9 A;  3AAT A;  5EFS A;  4N0W A;  5BJ4 A;  4MQQ A;  1CS1 A;  2AY8 A;  3BS8 A;  2ZSL A;  1TOJ A;  1RVY A;  3AEN B;  3B1E A;  1FG7 A;  3GJU A;  4RM1 A;  1YJY A;  4WXB A;  4WYG A;  3E2Y A;  3UWC A;  3EZ1 A;  1ASE A;  3K40 A;  2EO5 A;  4Q6R A;  1MLY A;  3AEJ C;  3FKD A;  3WKR A;  1IVR A;  3FD0 A;  2VIB A;  3AEN A;  2VMP A;  1ARI A;  3GZD A;  1N31 A;  2V1P A;  2Z1Y A;  3AEJ A;  1B8G A;  2HUF A;  3EZS A;  5G2P A;  5LH9 A;  2D64 A;  3NUB A;  2OKK A;  4ZWM A;  1W7N A;  2QA3 A;  3KGX A;  5D5S A;  3CAI A;  2Z9W A;  1AIB A;  1IUG A;  3PDB B;  2VMU A;  3TQX A;  2PB2 A;  2QMA A;  4IXZ A;  5FT5 A;  3PAA A;  2CB1 A;  5HDM A;  1W23 A;  4F5K A;  1MAP A;  1M4N A;  2DR1 A;  2BHX A;  4XJO A;  2QB2 A;  1Y4I A;  1BW0 A;  4FFC A;  5FT6 A;  3VOM A;  4E3R A;  3BB8 A;  2ZY3 A;  2Z1Z A;  5TF5 A;  4IW7 A;  5G2Q A;  2BIG A;  4DGT A;  3TCM A;  4K2M A;  5G09 A;  1MLZ A;  4JE5 A;  2AY1 A;  2BI5 A;  3N7N A;  4GEB A;  1T3I A;  3E77 A;  3BWN C;  2D61 A;  3HT4 A;  4UOY A;  3RQ1 A;  4WP0 A;  2VGV A;  1GCK A;  1WKG A;  2HOY A;  2R2N A;  3KKI A;  3ELP A;  2ZY4 A;  1C0N A;  1LK9 A;  2JGT A;  4F5M A;  4WYD A;  1WYT A;  3N5M A;  4ZWV A;  1CZE A;  2Z9V A;  1SFF A;  4AH3 A;  3F6T A;  3IF2 A;  4IXS A;  1AKA A;  1LC5 A;  1M7Y A;  2BKW A;  5F9S A;  2FNI A;  2FKI A;  3F9T A;  4H63 Q;  1GEW A;  3VP6 A;  3E2Z A;  4AOA A;  3AEL A;  3EI9 A;  2JJE A;  2W8T A;  3W1J A;  4F5F A;  3JWB A;  5M49 A;  1YIY A;  1AIA A;  1B9H A;  4A6T A;  2D63 A;  3B8X A;  1QIR A;  1M0P A;  1V72 A;  2Z61 A;  3FVU A;  1AJS A;  1J32 A;  1X28 A;  3BWO A;  3DYD A;  3DZZ A;  5EQC A;  2VMS A;  4A0H A;  1J04 A;  4UHN A;  2QSR A;  4JEW A;  4F5J A;  1PMM A;  3RCH B;  1O62 A;  1TAS A;  2JIS A;  2VLF A;  2HOX A;  1G7W A;  1AX4 A;  1IX8 A;  5K8B A;  4K2I A;  2TPL A;  1GC4 A;  5DX5 A;  2ORD A;  1TPL A;  4XJM A;  4K05 A;  1VEF A;  1M0O A;  1PMO A;  2VMN A;  4RKC A;  3E2F A;  3JTX A;  4RJY A;  3CQ6 A;  4LW4 A;  1AKB A;  2CJH A;  3JU7 A;  2YOB A;  3HQT A;  1D2F A;  1LW5 A;  4LC3 A;  5EUE A;  4A6R A;  3P1T A;  1IJI A;  4HVK A;  2BIE A;  1QZ9 A;  3D6K A;  3M5U A;  2ZY5 A;  5EUN A;  1KAF A;  1AHY A;  4BHD A;  3N0L A;  3NYT A;  1QGN A;  1JF9 A;  1RVU A;  4ZAH A;  4WBT A;  1YIZ A;  4AZK A;  4E3Q A;  1AMS A;  2RFV A;  3T32 A;  7AAT A;  5DJ1 A;  1IX6 A;  1SVV A;  1ZOD A;  2JJH A;  4AO4 A;  4BMK A;  2NMP A;  2QB3 A;  3AV7 A;  1TAT A;  4ADB A;  4JEY A;  1GC2 A;  3DXV A;  1VP4 A;  3VK3 A;  2YKX A;  1UKJ A;  2X5D A;  3CBF A;  1I48 A;  1QJ5 A;  4JE5 D;  3AEP A;  3ZRP A;  2C44 A;  1ASN A;  2OKJ A;  5E3K A;  2AAT A;  4N0B A;  1DJU A;  3WGB A;  3EIA A;  3GSB A;  1SF2 A;  2D5Y A;  1G7X A;  3MAF B;  4QGR A;  3NU8 A;  2JJF A;  4GDY A;  2ZC0 A;  3DU4 A;  3COG A;  3QM2 A;  8AAT A;  1LKC A;  3E6G A;  4XQ2 A;  2W7I A;  4CBS A;  5E5I A;  2ZP7 A;  2BI9 A;  3NNK A;  4XEW A;  3JWA A;  4A0F A;  4EU1 A;  2R5C A;  2DKB A;  3Q8N A;  4F5L A;  2VGZ A;  4ATQ A;  1KL2 A;  1CQ7 A;  1AJR A;  3WY7 A;  1DGD A;  3LY1 A;  1AY5 A;  1ASA A;  1SZU A;  3EI6 A;  4EB5 A;  1X0M A;  2C7T A;  4ISY A;  4I8A A;  3NU7 A;  4UHM A;  5AX8 A;  1AAM A;  4KYO A;  4R5F A;  4ZSY A;  2VMQ A;  4WLH A;  3HMU A;  4ZLV A;  4JEX A;  4F5H A;  4M2M A;  1O4S A;  3OP7 A;  4WYC A;  2HOR A;  4ZM3 A;  3EI5 A;  2FN6 A;  5EIG A;  2JJG A;  1MDZ A;  3ISL A;  4WYF A;  3MKJ A;  3DRD A;  1DJE A;  4IXO A;  4RKD A;  4Q31 A;  5M4D A;  1AJS B;  3K7Y A;  3LV2 A;  3P6K A;  2YCP A;  2FNU A;  2EH6 A;  4CVQ A;  4A0G A;  1DGE A;  3FFR A;  5EIG B;  2G7J A;  2F8J A;  3LVL B;  4DQ6 A;  5G0A A;  1LS3 A;  3B1C A;  4PFN A;  3A9Z A;  4RJ0 A;  3A8U X;  3ZRR A;  3I16 A;  4OYT A;  3GBX A;  4UHO A;  4CXQ A;  1WKH A;  3DXW A;  3HVY A;  2YKV A;  1CJ0 A;  4KAM A;  4Y0H A;  2BWN A;  3FVX A;  1YOO A;  1MDX A;  3NX3 A;  1BS0 A;  4ITX A;  4CBR A;  1YJS A;  3ASA A;  3MBB A;  2HUI A;  2VMX A;  2VMZ A;  3TAT A;  2E7U A;  4K2B A;  4DBC A;  3LVK A;  3B46 A;  4Y0I A;  1S08 A;  2OQX A;  2YKY A;  4ITG A;  4WXG A;  3PD6 B;  1BJN A;  4A00 A;  3R9A A;  1BJO A;  1WYT B;  4GE4 A;  1WYV B;  4TN4 A;  1LC7 A;  3UE8 A;  5G4J A;  1X2A A;  2E7J A;  2BI2 A;  4AO9 A;  1YJZ A;  2D65 A;  3GZD C;  4PIW A;  5M4B A;  1S06 A;  3W1H A;  1EQB A;  2Z20 A;  3II0 A;  1KL1 A;  3FQ8 A;  4JF0 A;  1ASF A;  3PDB A;  1DFO A;  1OXO A;  3PA9 A;  4ATP A;  1KKJ A;  2AY3 A;  4A0R A;  4CXR A;  2VGS A;  1OHY A;  2VGW A;  4P3M A;  5IWQ A;  1M32 A;  1BJ4 A;  2CFB A;  2GSA A;  4A6U A;  1C7O A;  4OTL A;  4H51 A;  4GSA A;  2W7J A;  2ZY2 A;  4MGR A;  3HBX A;  4WYE A;  3UAK A;  1QIT A;  4WXF A;  1O69 A;  9AAT A;  2BIA A;  3L8A A;  1ASD A;  3TFT A;  2GB3 A;  1IBJ A;  1QJ3 A;  3H7F A;  3LG0 A;  3FFH A;  4OCA A;  4OC9 A;  1RV3 A;  2WK7 A;  4BA5 A;  2ZSM A;  4ZM4 A;  3R4T A;  2DGL A;  2VGU A;  2VMR A;  1TAR A;  2VYC A;  1AHX A;  3A9X A;  2Q7W A;  1DJ9 A;  4L0O A;  2AY9 A;  2YRI A;  1V2E A;  2BWP A;  3BV0 A;  1Z3Z A;  3GET A;  2X5F A;  1ARG A;  4RIT A;  4A72 A;  4ADD A;  4U1T A;  3PD6 A;  1B5O A;  2C0R A;  3AOV A;  4Q75 A;  1BJO B;  2O0R A;  1O61 A;  1D7S A;  3EI7 A;  2W7F A;  1ASG A;  2W8V A;  1GBN A;  4FL0 A;  1XI9 A;  4MQP A;  1SPA A;  2JG2 A;  3FDD A;  1E5E A;  1AMR A;  2W7M A;  2W8U A;  1MGV A;  3MEB A;  3CQ5 A;  2HP1 A;  3RCH A;  1WST A;  2ZJG A;  3HLM A;  3MC6 A;  4BA4 A;  2O1B A;  1N2T A;  1I29 A;  3G7Q A;  2VMY A;  2AEV A;  3IHJ A;  3LVM A;  4LNM A;  3MC6 C;  3GR9 A;  1W7L A;  3NUI A;  1V2D A;  1ELU A;  1AY4 A;  3A2B A;  5EAA A;  3QPG A;  2XH1 A;  1IAY A;  2W8W A;  3NYU A;  5E4Z A;  3LVJ A;  1DKA A;  1C7N A;  3WKS A;  2YCN A;  1X29 A;  4WB0 A;  2YRR A;  1WYV A;  5JAY A;  3DOD A;  1CQ8 A;  1AAW A;  1AIC A;  3FZ8 A;  3JZL A;  4W5K A;  1GEX A;  2WB6 A;  2VI9 A;  5FT8 A;  4P7Y A;  4PVF A;  1ELQ A;  4XJL A;  1B5P A;  4ZDL A;  2DKJ A;  4F4E A;  3FZ6 A;  3I4J A;  4XK1 A;  2D7Z A;  2CJG A;  1N8P A;  4ZDP A;  3W1I A;  2AY5 A;  2CY8 A;  1S0A A;  4GE7 A;  4LW2 A;  2W7H A;  2E54 A;  1AY8 A;  2CST A;  1BKG A;  2W7L A;  3N75 A;  2KFP A;  2R0T A;  4MQR A;  1BQA A;  1YAA A;  1AHF A;  1I41 A;  1ASB A;  4EB7 A;  2AY2 A;  2VLH A;  3ZRQ A;  4W1W A;  3PIU A;  4GE9 A;  3MAF A;  1UU2 A;  4Q76 A;  3NRA A;  3WGC A;  2Z9X A;  4LNL A;  2CIN A;  2HUU A;  1P3W A;  3KGW A;  2QBT A;  3FDB A;  2DGK A;  2R5E A;  1FC4 A;  2VGT A;  1C7G A;  4AZJ A;  1M0Q A;  2Z9U A;  5HHY A;  5M46 A;  1OXP A;  3TFU A;  3A9Y A;  3ASB A;  3QN6 A;  4BQ0 A;  1EG5 A;  2EPJ A;  1GDE A;  4IY7 A;  3VK2 A;  1IX7 A;  5FT4 A;  3QHX A;  1G4X A;  2ZYJ A;  3RI6 A;  4WD2 A;  3ECD A;  2X3L A;  1KKP A;  1LW4 A;  1SZS A;  3DR7 A;  3FSL A;  3FVS A;  1WYU A;  2HP2 A;  2EYQ A;  4M2K A;  4IYO B;  2YHK A;  2BYJ A;  3BCX A;  4EMY A;  3N4S A;  3E9K A;  2BWO A;  3WZF A;  3AEM C;  2C81 A;  1B4X A;  2VMW A;  3F0H A;  3WLX A;  1ECX A;  2R5C B;  2W7E A;  3FTB A;  1W7M A;  1AMA A;  3GWP A; 
#chains in the Genus database with same CATH homology
 4NOG A;  5I92 A;  1UU1 A;  5LHA A;  1AHE A;  1ZC9 A;  4XJP A;  1GC0 A;  4F5G A;  1I43 A;  4J5U A;  3H14 A;  1GC3 A;  2CTZ A;  1D7V A;  2CH2 A;  3QGU A;  1G4V A;  4ZSW A;  4E77 A;  4JEV A;  4TMR A;  1M6S A;  3NYS A;  3B1D A;  3EI8 A;  1M0N A;  3QI6 A;  4OBU A;  1GEY A;  2VIA A;  4J8L A;  4WB0 B;  3HDO A;  2AY4 A;  1LC8 A;  3EIB A;  3JW9 A;  4MSO A;  5J8Q A;  2FYF A;  4R5Z A;  3ZZK A;  2OGA A;  2GMU A;  4JEZ A;  3QBO A;  1TOK A;  2VMT A;  1ARS A;  3BCB A;  1CQ6 A;  1V2F A;  2AEU A;  5DB5 A;  5BJ3 A;  1TOG A;  1XEY A;  3WCN A;  1YNU A;  4W91 A;  1OHV A;  1W3U A;  2W7G A;  3KE3 A;  4JF1 A;  4ZDO A;  4OBV A;  2O7C A;  2AY7 A;  2ZUK A;  1Z7D A;  3RUY A;  4KXK A;  1FG3 A;  2EGY A;  4GRX A;  4W8I A;  1DTY A;  1WYU B;  2FM1 A;  2FQ6 A;  4IYO A;  2PO3 A;  2D66 A;  1PG8 A;  2VMV A;  1PFF A;  3CQ4 A;  4O6Z A;  5F8V A;  4R2N A;  3ACZ A;  4B9B A;  1C9C A;  4LNJ A;  4OMA A;  2BI3 A;  5KTB A;  1ART A;  1MAQ A;  1VJO A;  3FCR A;  3G8M A;  1JS3 A;  3ELE A;  4MKJ A;  4UQV A;  5EAV A;  3RBF A;  1ASM A;  1CL2 A;  2WKA A;  3HL2 A;  4RLG A;  2PB0 A;  2AY6 A;  3RBL A;  3VAX A;  1D7R A;  1JS6 A;  2WK8 A;  2EZ1 A;  2Z67 A;  3FQ7 A;  3WX9 A;  1QIS A;  4U2H A;  4WYA A;  3G0T A;  5G4I A;  3LWS A;  3ATH A;  2VMO A;  2HZP A;  2E7I A;  3OKS A;  3AOW A;  4RIZ A;  1KMJ A;  3BC8 A;  1BJW A;  3N4R A;  4MY5 A;  5DJ9 A;  3MAD A;  3USF A;  2DOU A;  4ZAS A;  1H0C A;  2HOZ A;  1MDO A;  1U08 A;  3BCA A;  1TOI A;  2DGM A;  1ORD A;  2G6W A;  3PDX A;  4M2J A;  5HXX A;  1H1C A;  1S07 A;  3GZC A;  3PGY A;  5EUD A;  1C4K A;  4W1V A;  5C6U A;  1AMQ A;  2OGE A;  2VI8 A;  1S09 A;  3NDN A;  4EFF A;  2WK9 A;  1ASC A;  4RAE A;  3BN1 A;  3WCO A;  4WLJ A;  4F5I A;  2YCT A;  2A1V A;  2CH1 A;  3L44 A;  1AHG A;  4PFF A;  1IAX A;  1D7U A;  1OAT A;  3ZZJ A;  2OAT A;  3BWN A;  4IX8 A;  1CL1 A;  1KMK A;  4HF8 A;  3PPL A;  2CAN A;  4R8D A;  3FRK A;  3AEO A;  2EZ2 A;  2BI1 A;  3I5T A;  1BQD A;  3VK4 A;  1AKC A;  2W7K A;  3EUC A;  5D95 A;  1RV4 A;  2QLR A;  4XAU A;  4B98 A;  1OHW A;  2D7Y A;  3DC1 A;  1JG8 A;  4W1X A;  1UU0 A;  4ADC A;  3H9X A;  1CZC A;  1TOE A;  1ZOB A;  3FZ7 A;  3PJ0 A;  3FQA A;  2BYL A;  2GMS A;  3E2Z B;  1ASL A;  2W8J A;  1BT4 A;  4E1O A;  1ARH A;  2X8U A;  2YKU A;  3DR4 A;  1B9I A;  2CJD A;  4Y0D A;  2GQN A;  4ADE A;  4MKK A;  3N4X A;  1E5F A;  1EJI A;  1SZK A;  2W7D A;  3NTJ A;  2V0Y A;  3AEM A;  3MAU A;  3K28 A;  2XBN A;  4TV7 A;  4OT8 A;  1GD9 A;  3AAT A;  5EFS A;  4N0W A;  5BJ4 A;  4MQQ A;  1CS1 A;  2AY8 A;  3BS8 A;  2ZSL A;  1TOJ A;  1RVY A;  3AEN B;  3B1E A;  1FG7 A;  3GJU A;  4RM1 A;  1YJY A;  4WXB A;  4WYG A;  3E2Y A;  3UWC A;  3EZ1 A;  1ASE A;  3K40 A;  2EO5 A;  4Q6R A;  1MLY A;  3AEJ C;  3FKD A;  3WKR A;  1IVR A;  3FD0 A;  2VIB A;  3AEN A;  2VMP A;  1ARI A;  3GZD A;  1N31 A;  2V1P A;  2Z1Y A;  3AEJ A;  1B8G A;  2HUF A;  3EZS A;  5G2P A;  5LH9 A;  2D64 A;  3NUB A;  2OKK A;  4ZWM A;  1W7N A;  2QA3 A;  3KGX A;  5D5S A;  3CAI A;  2Z9W A;  1AIB A;  1IUG A;  3PDB B;  2VMU A;  3TQX A;  2PB2 A;  2QMA A;  4IXZ A;  5FT5 A;  3PAA A;  2CB1 A;  5HDM A;  1W23 A;  4F5K A;  1MAP A;  1M4N A;  2DR1 A;  2BHX A;  4XJO A;  2QB2 A;  1Y4I A;  1BW0 A;  4FFC A;  5FT6 A;  3VOM A;  4E3R A;  3BB8 A;  2ZY3 A;  2Z1Z A;  5TF5 A;  4IW7 A;  5G2Q A;  2BIG A;  4DGT A;  3TCM A;  4K2M A;  5G09 A;  1MLZ A;  4JE5 A;  2AY1 A;  2BI5 A;  3N7N A;  4GEB A;  1T3I A;  3E77 A;  3BWN C;  2D61 A;  3HT4 A;  4UOY A;  3RQ1 A;  4WP0 A;  2VGV A;  1GCK A;  1WKG A;  2HOY A;  2R2N A;  3KKI A;  3ELP A;  2ZY4 A;  1C0N A;  1LK9 A;  2JGT A;  4F5M A;  4WYD A;  1WYT A;  3N5M A;  4ZWV A;  1CZE A;  2Z9V A;  1SFF A;  4AH3 A;  3F6T A;  3IF2 A;  4IXS A;  1AKA A;  1LC5 A;  1M7Y A;  2BKW A;  5F9S A;  2FNI A;  2FKI A;  3F9T A;  4H63 Q;  1GEW A;  3VP6 A;  3E2Z A;  4AOA A;  3AEL A;  3EI9 A;  2JJE A;  2W8T A;  3W1J A;  4F5F A;  3JWB A;  5M49 A;  1YIY A;  1AIA A;  1B9H A;  4A6T A;  2D63 A;  3B8X A;  1QIR A;  1M0P A;  1V72 A;  2Z61 A;  3FVU A;  1AJS A;  1J32 A;  1X28 A;  3BWO A;  3DYD A;  3DZZ A;  5EQC A;  2VMS A;  4A0H A;  1J04 A;  4UHN A;  2QSR A;  4JEW A;  4F5J A;  1PMM A;  3RCH B;  1O62 A;  1TAS A;  2JIS A;  2VLF A;  2HOX A;  1G7W A;  1AX4 A;  1IX8 A;  5K8B A;  4K2I A;  2TPL A;  1GC4 A;  5DX5 A;  2ORD A;  1TPL A;  4XJM A;  4K05 A;  1VEF A;  1M0O A;  1PMO A;  2VMN A;  4RKC A;  3E2F A;  3JTX A;  4RJY A;  3CQ6 A;  4LW4 A;  1AKB A;  2CJH A;  3JU7 A;  2YOB A;  3HQT A;  1D2F A;  1LW5 A;  4LC3 A;  5EUE A;  4A6R A;  3P1T A;  1IJI A;  4HVK A;  2BIE A;  1QZ9 A;  3D6K A;  3M5U A;  2ZY5 A;  5EUN A;  1AHY A;  4BHD A;  3N0L A;  3NYT A;  1QGN A;  1JF9 A;  1RVU A;  4ZAH A;  4WBT A;  1YIZ A;  4AZK A;  4E3Q A;  1AMS A;  2RFV A;  3T32 A;  7AAT A;  5DJ1 A;  1IX6 A;  1SVV A;  1ZOD A;  2JJH A;  4AO4 A;  4BMK A;  2NMP A;  2QB3 A;  3AV7 A;  1TAT A;  4ADB A;  4JEY A;  1GC2 A;  3DXV A;  1VP4 A;  3VK3 A;  2YKX A;  1UKJ A;  2X5D A;  3CBF A;  1I48 A;  1QJ5 A;  4JE5 D;  3AEP A;  3ZRP A;  2C44 A;  1ASN A;  2OKJ A;  5E3K A;  2AAT A;  4N0B A;  1DJU A;  3WGB A;  3EIA A;  3GSB A;  1SF2 A;  2D5Y A;  1G7X A;  3MAF B;  4QGR A;  3NU8 A;  2JJF A;  4GDY A;  2ZC0 A;  3DU4 A;  3COG A;  3QM2 A;  8AAT A;  1LKC A;  3E6G A;  4XQ2 A;  2W7I A;  4CBS A;  5E5I A;  2ZP7 A;  2BI9 A;  3NNK A;  4XEW A;  3JWA A;  4A0F A;  4EU1 A;  2R5C A;  2DKB A;  3Q8N A;  4F5L A;  2VGZ A;  4ATQ A;  1KL2 A;  1CQ7 A;  1AJR A;  3WY7 A;  1DGD A;  3LY1 A;  1AY5 A;  1ASA A;  1SZU A;  3EI6 A;  4EB5 A;  1X0M A;  2C7T A;  4ISY A;  4I8A A;  3NU7 A;  4UHM A;  5AX8 A;  1AAM A;  4KYO A;  4R5F A;  4ZSY A;  2VMQ A;  4WLH A;  3HMU A;  4ZLV A;  4JEX A;  4F5H A;  4M2M A;  1O4S A;  3OP7 A;  4WYC A;  2HOR A;  4ZM3 A;  3EI5 A;  2FN6 A;  5EIG A;  2JJG A;  1MDZ A;  3ISL A;  4WYF A;  3MKJ A;  3DRD A;  1DJE A;  4IXO A;  4RKD A;  4Q31 A;  5M4D A;  1AJS B;  3K7Y A;  3LV2 A;  3P6K A;  2YCP A;  2FNU A;  2EH6 A;  4CVQ A;  4A0G A;  1DGE A;  3FFR A;  5EIG B;  2G7J A;  2F8J A;  3LVL B;  4DQ6 A;  5G0A A;  1LS3 A;  3B1C A;  4PFN A;  3A9Z A;  4RJ0 A;  3A8U X;  3ZRR A;  3I16 A;  4OYT A;  3GBX A;  4UHO A;  4CXQ A;  1WKH A;  3DXW A;  3HVY A;  2YKV A;  1CJ0 A;  4KAM A;  4Y0H A;  2BWN A;  3FVX A;  1YOO A;  1MDX A;  3NX3 A;  1BS0 A;  4ITX A;  4CBR A;  1YJS A;  3ASA A;  3MBB A;  2HUI A;  2VMX A;  2VMZ A;  3TAT A;  2E7U A;  4K2B A;  4DBC A;  3LVK A;  3B46 A;  4Y0I A;  1S08 A;  2OQX A;  2YKY A;  4ITG A;  4WXG A;  3PD6 B;  1BJN A;  4A00 A;  3R9A A;  1BJO A;  1WYT B;  4GE4 A;  1WYV B;  4TN4 A;  1LC7 A;  3UE8 A;  5G4J A;  1X2A A;  2E7J A;  2BI2 A;  4AO9 A;  1YJZ A;  2D65 A;  3GZD C;  4PIW A;  5M4B A;  1S06 A;  3W1H A;  1EQB A;  2Z20 A;  3II0 A;  1KL1 A;  3FQ8 A;  4JF0 A;  1ASF A;  3PDB A;  1DFO A;  1OXO A;  3PA9 A;  4ATP A;  1KKJ A;  2AY3 A;  4A0R A;  4CXR A;  2VGS A;  1OHY A;  2VGW A;  4P3M A;  5IWQ A;  1M32 A;  1BJ4 A;  2CFB A;  2GSA A;  4A6U A;  1C7O A;  4OTL A;  4H51 A;  4GSA A;  2W7J A;  2ZY2 A;  4MGR A;  3HBX A;  4WYE A;  3UAK A;  1QIT A;  4WXF A;  1O69 A;  9AAT A;  2BIA A;  3L8A A;  1ASD A;  3TFT A;  2GB3 A;  1IBJ A;  1QJ3 A;  3H7F A;  3LG0 A;  3FFH A;  4OCA A;  4OC9 A;  1RV3 A;  2WK7 A;  4BA5 A;  2ZSM A;  4ZM4 A;  3R4T A;  2DGL A;  2VGU A;  2VMR A;  1TAR A;  2VYC A;  1AHX A;  3A9X A;  2Q7W A;  1DJ9 A;  4L0O A;  2AY9 A;  2YRI A;  1V2E A;  2BWP A;  3BV0 A;  1Z3Z A;  3GET A;  2X5F A;  1ARG A;  4RIT A;  4A72 A;  4ADD A;  4U1T A;  3PD6 A;  1B5O A;  2C0R A;  3AOV A;  4Q75 A;  1BJO B;  2O0R A;  1O61 A;  1D7S A;  3EI7 A;  2W7F A;  1ASG A;  2W8V A;  1GBN A;  4FL0 A;  1XI9 A;  4MQP A;  1SPA A;  2JG2 A;  3FDD A;  1E5E A;  1AMR A;  2W7M A;  2W8U A;  1MGV A;  3MEB A;  3CQ5 A;  2HP1 A;  3RCH A;  1WST A;  2ZJG A;  3HLM A;  3MC6 A;  4BA4 A;  2O1B A;  1N2T A;  1I29 A;  3G7Q A;  2VMY A;  2AEV A;  3IHJ A;  3LVM A;  4LNM A;  3MC6 C;  3GR9 A;  1W7L A;  3NUI A;  1V2D A;  1ELU A;  1AY4 A;  3A2B A;  5EAA A;  3QPG A;  2XH1 A;  1IAY A;  2W8W A;  3NYU A;  5E4Z A;  3LVJ A;  1DKA A;  1C7N A;  3WKS A;  2YCN A;  1X29 A;  4WB0 A;  2YRR A;  1WYV A;  5JAY A;  3DOD A;  1CQ8 A;  1AAW A;  1AIC A;  3FZ8 A;  3JZL A;  4W5K A;  1GEX A;  2WB6 A;  2VI9 A;  5FT8 A;  4P7Y A;  4PVF A;  1ELQ A;  4XJL A;  1B5P A;  4ZDL A;  2DKJ A;  4F4E A;  3FZ6 A;  3I4J A;  4XK1 A;  2D7Z A;  2CJG A;  1N8P A;  4ZDP A;  3W1I A;  2AY5 A;  2CY8 A;  1S0A A;  4GE7 A;  4LW2 A;  2W7H A;  2E54 A;  1AY8 A;  2CST A;  1BKG A;  2W7L A;  3N75 A;  2KFP A;  2R0T A;  4MQR A;  1BQA A;  1YAA A;  1AHF A;  1I41 A;  1ASB A;  4EB7 A;  2AY2 A;  2VLH A;  3ZRQ A;  4W1W A;  3PIU A;  4GE9 A;  3MAF A;  1UU2 A;  4Q76 A;  3NRA A;  3WGC A;  2Z9X A;  4LNL A;  2CIN A;  2HUU A;  1P3W A;  3KGW A;  2QBT A;  3FDB A;  2DGK A;  2R5E A;  1FC4 A;  2VGT A;  1C7G A;  4AZJ A;  1M0Q A;  2Z9U A;  5HHY A;  5M46 A;  1OXP A;  3TFU A;  3A9Y A;  3ASB A;  3QN6 A;  4BQ0 A;  1EG5 A;  2EPJ A;  1GDE A;  4IY7 A;  3VK2 A;  1IX7 A;  5FT4 A;  3QHX A;  1G4X A;  2ZYJ A;  3RI6 A;  4WD2 A;  3ECD A;  2X3L A;  1KKP A;  1LW4 A;  1SZS A;  3DR7 A;  3FSL A;  3FVS A;  1WYU A;  2HP2 A;  2EYQ A;  4M2K A;  4IYO B;  2YHK A;  2BYJ A;  3BCX A;  4EMY A;  3N4S A;  3E9K A;  2BWO A;  3WZF A;  3AEM C;  2C81 A;  1B4X A;  2VMW A;  3F0H A;  3WLX A;  1ECX A;  2R5C B;  2W7E A;  3FTB A;  1W7M A;  1AMA A;  3GWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...