1IX9A

Crystal structure of the e. coli manganase(iii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures at 0.90 A resolution of the oxidised and reduced forms of the Y174F mutant of the manganese superoxide dismutase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Superoxide Dismutase
total genus 80
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ix9A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ix9A02
4F6EA 4X9QA 4JZ2A 1P7GA 1Y67A 2RCVA 1VARA 1LUVA 1XREA 2QKAA 1GN6A 3KKYA 1ZTEA 1I08A 1LUWA 1BSMA 1MNGA 1SZXA 4E4EA 1GN2A 5AG2A 2AW9A 3EVKA 1D5NA 2P4KA 1AP5A 1MMMA 1WB7A 3C3SA 1BT8A 1WB8A 4FFKA 3TJTA 1XILA 3CEIA 1IX9A 1IDSA 1PL4A 3MDSA 4YIPA 1KKCA 3AK2A 3AK1A 3OT7A 4JYYA 3C3TA 1EN4A 3DC5A 1B06A 2CE4A 1ZSPA 2QKCA 1EN5A 1AR5A 1BS3A 3LSUA 1ZUQA 3RN4A 2CDYA 1GN4A 1N0JA 1AR4A 4C7UA 1I0HA 1AP6A 1AVMA 1GN3A 1EN6A 3QVNA 4YIOA 1QNMA 1VEWA 1N0NA 1IXBA 1EM1A 3AK3A 3BFRA 4GUNA 1JR9A 1MA1A 3IC9A 5A9GA 1PM9A 1MSDA 3DC6A 2GDSA 3K9SA 4JZGA 1ZLZA 4BR6A 1XUQA 1XDCA 2ADPA 1JA8A 2ADQB
chains in the Genus database with same CATH superfamily
5GW7A 4JI4O 1P7BA 1K73W 4J7JA 3CCEV 1O9HA 1MZEA 2JEUA 2VQEO 4GT1A 5GONA 1HNZO 2GUZA 4X65B 4LF4B 4YJ2A 5LHHA 3CRMA 1VQ5V 4MT8A 5CB4B 3R66A 2DW4A 3UQ8A 3F5WC 1Y76B 4I4TB 3K58A 3JALA 1HDJA 3JAWB 1HWYA 2CTPA 3ZHUA 4FM2A 5B1NA 3P32A 1IBMB 4P30A 3LDEA 2XNDG 4DXWA 1XILA 3RYFB 4F4LA 4BAYA 3J7AU 3K0DA 2E3CA 3CCLV 1NKDA 1PPJH 4ZHQA 3HKEB 4KUMA 4WFGA 3OT7A 4Q6GA 3CSXA 5KHHA 5EYPB 3JASB 4H13B 2XAFA 5DN6G 4NVPA 5LHGA 2ZM6B 1VQ8V 4FK5C 5E1AC 4NXMO 1M56B 5LXTA 2ZINA 3A0RA 3N2GA 4LF9O 5IJ9A 3JATA 4X62B 2NLJC 1HNWO 4DV7B 2ZE5A 4WFFA 1EN6A 2YEVA 2E75B 3G67A 3K57A 2ZDIC 1R3KC 5B1BC 1ROPA 2QGNA 2Q0OC 3OE7G 2BOCC 1PD3A 4WBNB 3OGCC 3AK3A 5LBQA 3RWRD 5IWAO 4MVSA 4DR5B 1MA1A 1XMQB 2Q0AA 1N8RW 4J9YB 4TV9A 4J9ZB 3APOA 3SYPA 1XNRB 2M7WA 4DUZO 5IYBO 3AEIA 4D7TA 2X6AA 2Z3YA 1DF5A 1P7GA 1HR0O 1FD9A 2XAHA 2HHHB 1OCOB 3DGEA 3ZMSA 4MVOA 2CGNA 1N36O 2OWOA 2KQXA 3JCZA 1BMFG 5B1AC 1US6A 3T1CA 3W7WA 3JATB 1DK1A 2LGWA 1KC8W 2OCHA 2GTAA 4B3TO 1CEZA 1WB7A 3C3SA 5L3GA 1JFFB 4FLYA 3RYHB 4JYAB 5JQGA 2UUBB 2HKOA 1OV9A 5GTHZ 1K3EA 1H2GA 4FPPA 3EHBB 5EC2C 1KQSU 3CC4V 3OR7C 2QR4A 1VQ9V 5B1BB 3ZMUA 4CH5A 1QLEB 3WFVA 1NS1A 5KHKA 1BQZA 3JD4A 2UXNA 1RPOA 4JPRA 1F23A 1JQ0A 4NTYA 5LGTA 1EN5A 2UXBO 3LDDA 1YHQV 2H8PC 3RN4A 4GKJB 3K59A 1K8AW 4G2KA 3ZRXA 4PD4F 4TT3G 3SPGA 2GHYA 1KECA 4FFBA 4C7UA 1BHAA 2WLLB 4DV1O 4FLZA 3CP1A 4ICGA 4EFBA 3ABKC 4MTOA 4U7NA 2DE0X 1ZWIC 1YI2V 4YIOA 3JASA 1M4UA 1QCEA 1N0NA 2EX3A 5K1PA 4LP8A 1K33A 1GTOA 2HFEC 1XHZA 5EZYB 4NTXA 4XDJA 1JFFA 3KG2A 1SQFA 4DR4B 2UU9O 2Q7HA 3IC9A 1MG1A 4UCOA 5EC1C 1AROP 3HKBA 1OCOC 5CN0A 5LOVA 4DYLA 4GKKO 2JS5A 2W0FC 5BXZA 4I55A 1H8EG 4LF8O 1YEWA 1GN6A 3ZCCA 4YY3B 1HW7A 3HKDA 3G6EV 3JAMN 3STZC 3CRQA 3WB0A 3CCMV 5AG2A 2BTQA 2Z0AA 3RYIB 4ASUG 1S77D 4QIWF 2IU3A 3OM3B 1Y4MA 3K03A 3CHXA 1FAFA 1YIJV 1NH2B 3AG2C 4I0XA 1R73A 2JDIG 5IWAB 3K5NA 4DR5O 3LNMB 5EZYA 2NR5A 5KMGB 2IH3C 3ZIAG 1NTKH 2BTOA 3WB2A 2YICA 5JCOC 2NNUA 3O65A 4O4HA 1WPXA 3AG7A 3HKBB 4LFBO 1JJOA 1AR5A 4O4LB 3FYEB 5B1OA 4DV1B 4O2AB 1QVGU 1SF9A 1XOUA 4G28B 3RYCA 1YCIA 2P67A 1N36B 4R7CA 1TA8A 4LFCB 2Q7GA 2F1MA 3LSQA 2D2CB 4O2BB 2PI5A 1W59A 4YXWG 2UUAO 4L87A 4P9PA 2P7TC 5EIBC 1VEWA 2B1GA 2WLJA 3HKDB 3F7YC 1S76D 1WAZA 2ZDIA 2Q5ZA 4JYAO 3UO2A 5IJ0B 4GUNA 1NVPD 3ZRWB 1KP3A 1OHHG 1YDXA 4LF4O 2QTSA 4RQEA 3H1LH 3K9SA 4JZGA 4KFMA 5CBFA 4LWSA 4FZ0A 1ZAUA 2HVJC 1O9GA 4X89A 3T4DA 4F6EA 2D3OW 4LF5O 3OD4A 1S0VA 1Y67A 1LUVA 2AHZA 5GTIZ 2Y48A 4X8AA 2QKAA 1TAEA 4JTCB 2BE3A 3ZHTA 2YIAA 3CJHB 2KSDA 4ABMA 5J2TA 3P30A 4E4EA 2AZ0A 1SQQH 3FB8C 2XASA 1N33O 5HFMA 1VQ7V 1F4MA 5H6QA 2DYRB 4UCSA 3A8TA 4Q20A 4KXRA 5L3BA 1IBLB 4FFKA 1S5JA 3WG7C 1GM7A 1IXMA 1H2LA 2ZR2A 2EILB 5BR8O 3JARA 1S5LZ 3OMAB 1KKCA 3AK2A 1IBKB 4ZI7B 5JVDA 3C3TA 1WA8B 3RYFA 4R8CA 2AZ2A 4X62O 1VQ6V 2ZXWC 1Q3EA 3TETA 2CE4A 5IJ0A 1Z2GA 2ZXWB 1BCCH 4GX2A 3BEHA 4PI2A 1J95A 3SJQC 3I56V 2X7RB 3SJCC 2W6JG 4KHPB 4DK1A 5A2QN 4YHHB 4LNUA 1NR7A 1XL6A 3ZEDA 5IYDO 1K7DA 1OCZC 4OX9O 2H3OA 3B8NA 5IY5B 3ETQA 3KZIZ 5DM6V 1XNRO 4FLXA 1EBOA 1K5QA 4XDLA 2HLDG 5L3FA 1JMKC 2ODMA 2YIDA 2Q8VA 1THZA 4LF6B 2ITDC 2R72A 3SYOA 1YJWV 1N34O 1ZLZA 1Q43A 3TXQA 4DR7B 4CH6A 2OTLV 4IIJA 2VQEB 3ABLC 1VP7A 1WN7A 5CA1B 3ZHQA 4UVBA 2QWQB 4MTXA 4ZI7A 1QR9A 1ZTEA 1P49A 4J7ZA 1LUWA 1MNGA 2PYJA 3JAKA 3E35A 3CCRV 3ZMZA 1AP5A 4EEQA 4O4IA 3CXHF 1RP3B 3RBZA 1SKVA 4AI8A 1K97A 2DYRC 1WB8A 3JSLA 1XBLA 2QWNB 4J7KA 1Q6IA 5KHIA 1IBKO 5IYZA 3QTCA 3K08A 4JV5B 4X1KB 2YSUB 5B5EZ 4JGSA 4FLVA 4U3FH 2V4DA 2JIZG 1Z5VA 1FPOA 3CMAV 3SPIA 1H2KA 1H8HG 2HP8A 3ZX6A 5J9PC 4K3AA 2UUCB 3IC7A 1AI5A 4FVMA 3L75H 2PF4E 5JWPA 4WFAV 3DXRA 1AB3A 4GYCB 2Y0IA 3ZMTA 4TQFA 1GM9A 4J42A 1SA0B 1G1XB 2WLIA 4OX9B 3WB1A 5LP6B 3JD2A 5KAFZ 1KP2A 5CA1A 2DJVA 3SYCA 5KUKA 4LR3A 5EK0A 2IBZH 3ICXA 1F51A 2Q6AA 3BY6A 3E8BA 3I55V 2E5LB 3D3QA 1BE3H 2KG7B 3U11A 3CX5F 3IAYA 4YY3O 3ZN0A 3SGIA 4B7KA 2A9HA 1HNXO 4MVZA 4B3MO 2K1EA 2RN9A 1PKXA 1PL0A 1Q82W 1WP8A 2YEVB 2QKSA 2ZT9B 1SQPH 2YIBD 1M90W 4FLUA 1UFIA 1FJGB 4B3SB 3CYOA 2RMKB 1SZXA 1GO3F 2MW2B 4I55B 4NXNO 4X64B 1BZKA 4DK0A 4DR4O 4U3JB 3G71V 4DR6O 2VWKA 2UXXA 1FXHA 2BCCH 4LFBB 3HKEA 4FFBB 3FB5C 1QHTA 1VQMV 1VF5B 4YIPA 2QDOA 2OIEA 3T2MA 1V9PA 2VQFB 5KX5A 3Q4HB 2VRZA 2P6JA 4PELA 5FPOA 4BW9A 3G80A 3B09A 2GSMB 2N74A 2G38A 5KHJA 4MVQA 3N2KA 3A0BZ 4H33A 3CXCU 4GKJO 4X1YB 5KA6A 3AG1C 4K35A 1M5IA 3CJHA 3MHSC 3T4ZA 3FAVA 1AR4A 4LFAB 1AR1B 1L0LH 3LUTB 1TUBA 1QU7A 2E74B 2ZNJA 1SERA 4U7OA 5FNVB 1H38A 2PZSA 4MVMA 5CBGA 1JCHA 2XAJA 3LNNA 4IYIA 5L3CA 2OIGA 3E89A 4UCUA 3M99B 4P9OA 4JV5O 4JI3O 1AJPA 1PM9A 4I50A 3VBBA 3RVYA 1ENVA 2BSKA 3DC6A 1YITV 1HNWB 1EZVH 1VF7A 2P4VA 1I5YA 2QM4A 3ZRWA 2DMXA 1FFTB 3E8FA 4LF8B 1VQLV 4J10A 1AI6A 3ASOC 1FXVA 2OT5A 1I08A 2IM9A 2LW7A 3FB7C 1LR1A 3GB7C 4LC1A 1V54C 3RYHA 3N2KB 1K4DC 2ILMA 1GK9A 1K4CC 2Z5UA 4JTDB 2L6LA 1L8DA 2VQFO 5EBWC 3KCXA 3ABKB 2DQ0A 5B3SC 2Q69A 1FKAO 2JS3A 3CRRA 4AQYB 2QEXV 4GCZA 1EN4A 2CTQA 1Y6XA 4FM0A 4KP4A 2A7WA 2RNBA 1H5WA 5EBMC 4QGPA 2EIKC 2CTWA 3EFFK 2BSKB 1AI7A 3D3IA 2CDYA 5HFLA 2NN4A 1XHXA 1FJGO 4B3SO 1VQOV 4DV4B 5BY1A 4DV2O 3JAKB 4WF9V 1AVMA 1K9MW 4RUFA 3APQA 3HPLC 4D7SA 1NU1H 2R9IA 4TV8A 4I9WA 5BMVA 3BA8A 3P3NA 3H9VA 2LO1A 3JD3A 2HVKC 1TGOA 4ZBMA 3TGUH 2JGUA 1JOYA 4DR6B 1NBMG 1LNQA 2QM7A 1N32B 3SYQA 4GX5A 2R9RB 3H1IH 5A9GA 1MSDA 1YVWA 4UUJC 3QF7A 4UFZA 4BR6A 2ADPA 3BABA 3H1HH 1S3JA 4MTFA 4UV8A 4R50A 3STLC 2CGOA 2ZIOA 2BTQB 1FYJA 4PJ0Z 2X6BA 5LGUA 2YDEA 1G8MA 2AXTZ 4H44B 2X6CA 1N33B 4ZOLB 4JI8B 1Q8IA 4Z1VA 3HKCB 1GH6A 5J2UB 1D5NA 1BGYH 1UPGA 4CH3A 1OCCB 4HNAA 5LXTB 1K34A 4BIOA 3L72H 4EFEA 2UXCO 3E2EA 1H2NA 3IJ4A 3I5DA 2CUGA 1RM1B 2K9PA 1NR1A 3K04A 3M8AA 2CTRA 4CH4A 1G6UA 1TVKB 3ABTA 1R6NA 4HZ3A 4IT5A 3HR0A 4YJ2B 2XTAA 1XL4A 5IT9N 3K06A 2QSAA 3LSUA 3GVMA 5FPRA 2QJ1A 4WFHA 4DV4O 1KU9A 4KHPO 3SJBC 3BCCH 2WWWA 1Y76A 3RFRA 4FM1A 1VQ4V 2F66C 2ATKC 1V55B 2WLIB 4N23A 4GX0A 4DR1B 4JI6O 4N21A 2FL4A 2ZD9A 1MSWD 2DWEC 3ETEA 5FLXN 4K8ZA 3JYCA 4W4LA 4JI0B 4RQFA 3U10A 3BFRA 2MK3A 4B08A 3TCUA 1ZL8B 4NB5A 4Z1MG 3FFQA 4AQYO 4JTAB 2ZKOA 1PNKA 5JH7A 4JYCA 4O4HB 5H6RA 2OCCC 2RJZA 3MAQA 3ML0A 3OUFA 1XREA 1I94O 1OZ0A 1P84F 5D5QA 2R9AA 5F2VO 2YC0A 2WLMA 3OEHG 4NKGB 3FKSG 1UJWB 2F43G 3OTFA 4LF5B 3RW0A 2P90A 3IFXA 4NR1A 2IW5A 5B3SB 4GX1A 1QLNA 4PA9A 3W7UA 4LF9B 2Q68A 3ABMB 1GRJA 3MDSA 4DV5O 3AG4C 1Y66A 3SJAC 4CS3A 2HJFC 2Y4TA 2EZOA 1RSOB 1Q90D 2Q67A 3DC5A 2PYLA 4CS4A 4JI1B 5JJJB 1S5HC 3SPCA 2W0XA 2N04A 1VQKV 2CAZC 4QNHB 5BR8B 1NH2D 5JH7B 1F4NA 5JQGB 1MZFA 4OXSA 2A06H 3T1HB 4PI0A 1T5EA 4I4TA 4JI0O 1TUBB 1IZ3A 4DV3B 1FOUA 4W4KA 5K1XA 2AHYA 1H2MA 1D5AA 3MD0A 4B3MB 5LMNO 1WA8A 2PI4A 3OGIB 2LFSA 4QPJA 2QWRB 5D5PA 1WNSA 3GWOA 1I94B 2UUBO 4LWSB 1CXZB 2GTSA 4A5UB 2ZE7A 5H2FZ 3VQXA 1MABG 2JRIA 4BIUA 2EZPA 3ZBHA 1RPRA 1BSMA 4DUYO 2PUSA 2IH1C 4HAMA 4EB6A 1Q7YW 1Q5OA 2GBOA 4UCRA 4I5SA 5J2TB 3QO8A 3UM7A 1AJNA 2F93B 1AJQA 4LBEC 3JD0A 1VQPV 1IX9A 4PA6A 1SQGA 5C8YA 1XMOO 1HR0B 3CC7V 2HG5C 1V54B 3ASNB 4DRXA 1L0NH 3UT5B 2B5UA 2YXHA 1B04A 3CWBH 3OFNG 2YI8A 3DXRB 4FIPC 1KMIZ 3RYIA 2IJIA 1ZUQA 5CA0A 2IJHA 1YTFB 1NVPB 2EJ7A 4LFAO 1P4RA 3CCQV 2ZE6A 4D6TH 3PJSK 1PV0A 1VF6A 3ASOB 2EINC 3BPZA 3TXSA 3TK1A 4E2LA 2JJ1G 3WG7B 4DO2A 1FXKC 3R65A 3SR2C 3BA9A 4G27B 4CC6A 1R1BA 3W7SA 2UXBB 4JAUA 5BMVB 4JI3B 3ZMVA 4FLWA 3L74H 4X1KA 5LMUO 2DQ3A 1YSCA 2QA4V 2LW1A 4X66O 4DR2O 4I7ZB 4MSWC 2HEPA 2IJJA 5C93A 1KBHA 3RVZA 4JI1O 2EINB 3E83A 1J5EB 1FXKA 3E86A 3A0HZ 4R6ZA 1BHBA 2OYQA 4DW1A 4DV2B 1Y74B 4LF7O 4DUYB 2EIJB 2W6IG 3KKYA 1SETA 3B40A 2ZQMA 1R6KA 4JI4B 1X4TA 2QWPB 3AG1B 3JD1A 3QNEA 2WA4A 4JI7B 1N32O 4YJ3A 1BQ0A 2UUCO 4ZOLA 3CEIA 4O4JA 3ASNC 4DV3O 1WPBA 3J80N 4LFCO 4X1IA 3L73H 4QE7A 2N05A 1JJ2U 4J80A 5CA3A 3N27A 2UUAB 4UV9A 3O9OA 1N4CA 4NXNB 2EIJC 3QG5A 1U96A 2YIBA 1KD1W 2EIKB 2QWOB 5L3EA 1X59A 3GWKC 3E8HA 5H5NA 1QVFU 1TVKA 1K92A 3K9AA 1BS3A 4UB8Z 3BRCA 1SRYA 4CBCA 1PNMA 4DRXB 1Z5WA 1CP9A 1ZX3A 3BHPA 2F4VB 3F5TA 4QJFB 1FS0G 2ZM6O 2Q73A 3OUSA 5CBHA 1IXBA 2XT9A 1EM1A 2CH7B 2DYSC 2YUAA 1VIBA 4HYOA 1YF2A 2QE7G 4OGQB 3ZS8C 5KLVH 2V7QG 3HKCA 1WLEA 3AG3C 5KX5B 5LYJB 2LP7A 4B3RO 3PN1A 2LQTA 1M57C 4HBNA 2UXDB 4RWUA 4JZ2A 4LF7B 4IHJA 4I0XB 3DTUB 2WA3A 1TUEB 4UCTA 4MTGA 2M6YA 4WFEA 2FMLA 4O2AA 4JI8O 1GN2A 4MW8A 2HHHO 4O4LA 4O2BA 2A79B 4PA4A 1E79G 5H9CA 3RYCB 1BT8A 2QTOA 1OCZB 2P22C 3TJTA 3OAAG 5CMUA 1OJHA 5JJNB 3ABMC 3FX7A 3CMEV 2FTKA 3H1KH 4FMTA 5LL6Y 4DV7O 2EJRA 4BWAA 1OCRB 4J41A 4X20B 5DECA 4FLTA 2PY5A 2ITCC 4F6RB 3CCJV 2WSSG 3X2QB 1XNQB 2XAGA 2H94A 2LFRA 3RT3C 1M93A 3LDCA 3K5MA 1ZL8A 1SESA 2PGGA 3OTOB 1FFXA 2EILC 1Q6UA 4FJCC 1I0HA 1GN3A 4FZ1A 4RO2A 3CE2A 4DUZB 2XAQA 3T1YO 2WAMA 1PNLA 3D8CA 3OR6C 5C8YB 2HJDA 4NYKA 5JJEB 4DV0B 1CPYA 1KB9F 3M7MX 3BVOA 2Q9LA 1KYOF 1MOFA 2A0LA 2Q4PA 2OCCB 3OMNB 2XHBA 2ZCEA 1M57B 4P2ZA 1L1FA 1SA0A 5LHIA 4NTWA 4L8JA 3G6BA 1AILA 4JI2B 5BZBA 3K5OA 3VQWA 3S3XA 4HNAB 2F4VO 1N34B 2JVDA 4GLXA 2JEXA 4TV8B 2F23A 1R6TA 3AG3B 4DR7O 1DLBA 2XOKG 1KKDA 3OEEG 2YXLA 5LMNB 1GMGA 1YJ9V 2E76B 4DV6O 3OW2U 3N2GB 4DR3B 4DV5B 1URFA 4PA7A 3L9DA 4UXNA 3FAVB 3K5LA 5KUMA 5IY5C 2FYUH 1NJIW 1B6QA 1R3LC 4OPAA 2WLNA 4X88A 2Y69C 2UXDO 3JALB 5LGNA 1EZJA 1YZBA 1NTZH 3W7TA 5LP6C 1B3QA 4U3JA 1I7FA 4TV9B 4IIJB 1AP6A 5JVDB 1HNZB 2GV9A 3BAAA 1W0KG 3E22A 3ABLB 4H0LB 2QM8A 5IE9A 2VWJA 4JAVA 3H1JH 4YJ3B 1JX9A 2CH7A 1QNMA 1YJNV 3ZJZA 4CC5A 1GKFA 2Y4UA 4UB6Z 1NTMH 2JK5C 4CZZA 1JR9A 4IL6Z 5B1AB 4PDVA 4JAAA 5IDJA 4EB6B 5IYZB 1XI1A 3FB6C 3ETGA 3DSQA 4LNUB 3B4SA 1XUQA 3B77A 4EKWA 2Q7EA 4IYHA 5KHGA 4X9QA 2BOBC 5DEDA 1DF4A 3IGAC 1NI8A 4JI7O 2RCVA 3JCUZ 1KUQA 3G4SV 3QO7A 1JNBA 4J11A 5FNVA 4GZRB 5FL7G 3JAWA 3SPHA 2ZIMA 2KKWA 3QO5A 1JVMA 1DGSA 4NXMB 2YI9A 2WPDG 3EVKA 2DOSA 2XUMA 2O57A 1K5SA 1H2SB 5B66Z 2WLKA 5LP6A 2VS0A 4I50B 1F7YA 1IVSA 1MMMA 4B3TB 2OTJV 3J81N 4DV6B 3NR7A 4DR3O 4TUYA 4K0KO 4LCUC 5ITZA 3ZHVA 4DR2B 3AG4B 1PL4A 1I5XA 2ZR3A 3SDLA 2P5OA 2ARHA 1Q6HA 1E1QG 1M1KW 2KG7A 3AK1A 1IBLO 3CRCA 4JI5O 2DN9A 1DTOA 2WLHA 1ZSPA 1EFRG 4PA3A 1BL8A 1W2BU 3SYAA 1NT2B 5GONB 4BW5A 1WP7A 4JI6B 4DR1O 1W0JG 3UO3A 1SQBH 3AG2B 2YXYA 1FXKB 3OMIB 4B3RB 3A2FA 1Y74A 3CD6V 1M9NA 3VOUA 1PP9H 4LH6A 4YHHO 4OPHA 2DYSB 5L3DA 3VQYA 3JARB 4UVCA 1QBZA 3U0ZA 4QPKA 2JGDA 4JF3A 5EBLC 4ZIBA 2HR3A 4TUYB 3L71H 3Q4HA 4IGGA 4JYBA 1VF6C 3CCVV 5LYJA 4K8XA 2LGQA 4H37A 2IU0A 3B2EE 1XMQO 5JCOA 1FFXB 1JPXA 1Q81W 4O4IB 3K3WA 4DW0A 2AW9A 3WU2Z 2ZE8A 3ZN1A 1VQNV 2P4KA 3CRAA 2JJ2G 5KAIZ 1COWG 4XDKA 4WCEV 5TISZ 3UT5A 1R3IC 1IDSA 1IJGA 1XNQO 1D2DA 3C90A 5IYCO 4JI5B 2Y0PA 3CC2V 4QE9A 3H01A 1XEQA 4JASA 5E79Z 1B06A 2UU9B 2X0LA 4MW3A 2B1IA 3T1HO 1G4YB 1RSOA 4X65O 2V1DA 1E1RG 4TSFG 3ZRVA 5ITZB 2WLLA 2ZNIA 4UCVA 4I9QA 1GN4A 1N0JA 2ETNA 4XBFA 5LA6A 1QLEC 4LF6O 4Z2WA 1S72V 3VQVA 3ZHSA 3D36C 1GAXA 1HP8A 2FB5A 3X2QC 1AI4A 5IJ9B 2LJ2A 3K79A 1GM8A 1QR8A 1IURA 2A3QA 4K0KB 1SQVH 2GUZB 3JSNA 2C2AA 4MVUA 3ZHRA 2AGAA 3P3PA 4TOIA 5LOVB 4JI2O 1A32A 3D36A 2GDSA 2DWDC 1SQXH 1JA8A 3HB3B 2ADQB 3E8GA 3F7VC 1NQTA 5EIBD 3EXAA 2P06A 4TQDA 4KL1A 4PDLA 4PHZA 1OCRC 4AHCA 3K0GA 3CCUV 1VARA 4WFBV 2RDCA 3KCYA 1VMGA 3CCSV 3FD9A 3SPJA 4LH7A 1RM1C 3ABUA 4RUEA 4AILC 1XMOB 4PDMA 2JGDB 2KB1A 4PV1B 4X20A 2Y69B 4X66B 3RGBA 1YTFD 2CK3G 4O4JB 2L35A 3CS5A 1QQCA 2PTMA 4GKKB 5EYPA 4DV0O 4ZKIA 5KA5A 2R70A 5KMGA 4IHJB 1SS3A 2EIMB 3UKMA 1NZ6A 4BIZA 3NXSA 1IBMO 3MHHC 4TWKA 4X64O 2RQ6A 2EULA 2FKXA 4JYYA 1R3JC 2F95B 3L70H 4MS2A 4X1YA 2EBOA 3KDRA 3CB2A 2QKCA 3UCSC 4WBNA 2E5LO 5CB4A 1RFYA 3OTOO 3ETDA 1M56C 3ZRSA 4B7EA 2UXCB 4MVRA 3LSSA 2EIMC 3B8MA 4RAIA 5CA0B 1HNXB 1U97A 3THOA 4CS2A 1OCCC 5LMUB 2B9ZA 3W7XA 3QVNA 3T1YB 1ORQC 4PDRA 4F6RA 5J2UA 1V55C 1Q86W 1YXBA 3E22B 4UVAA 3CPWU 4ZHQB 1J5EO 5LA6B 4X1IB 1XQ8A 2IJKA 1WJZA 2YS8A 1SC5B 3S3WA 1XDCA 3FYIB 1SZTA
chains in the Genus database with same CATH topology
4F6EA 4X9QA 4JZ2A 1P7GA 1Y67A 2RCVA 1VARA 1LUVA 1XREA 2QKAA 1GN6A 3KKYA 1ZTEA 1I08A 1LUWA 1BSMA 1MNGA 1SZXA 4E4EA 1GN2A 5AG2A 2AW9A 3EVKA 1D5NA 2P4KA 1AP5A 1MMMA 1WB7A 3C3SA 1BT8A 1WB8A 4FFKA 3TJTA 1XILA 3CEIA 1IX9A 1IDSA 1PL4A 3MDSA 4YIPA 1KKCA 3AK2A 3AK1A 3OT7A 4JYYA 3C3TA 1EN4A 3DC5A 3KDRA 1B06A 2CE4A 1ZSPA 2QKCA 1EN5A 1AR5A 1BS3A 3LSUA 1ZUQA 3RN4A 2CDYA 1GN4A 1N0JA 1AR4A 4C7UA 1I0HA 1AP6A 1AVMA 1GN3A 1EN6A 3QVNA 4YIOA 1QNMA 1VEWA 1N0NA 1IXBA 1EM1A 3AK3A 3BFRA 4GUNA 1JR9A 1MA1A 3IC9A 5A9GA 1PM9A 1MSDA 3DC6A 2GDSA 3K9SA 4JZGA 1ZLZA 4BR6A 1XUQA 1XDCA 2ADPA 1JA8A 2ADQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F6E A;  4X9Q A;  4JZ2 A;  1P7G A;  1Y67 A;  2RCV A;  1VAR A;  1LUV A;  1XRE A;  2QKA A;  1GN6 A;  3KKY A;  1ZTE A;  1I08 A;  1LUW A;  1BSM A;  1MNG A;  1SZX A;  4E4E A;  1GN2 A;  5AG2 A;  2AW9 A;  3EVK A;  1D5N A;  2P4K A;  1AP5 A;  1MMM A;  1WB7 A;  3C3S A;  1BT8 A;  1WB8 A;  4FFK A;  3TJT A;  1XIL A;  3CEI A;  1IX9 A;  1IDS A;  1PL4 A;  3MDS A;  4YIP A;  1KKC A;  3AK2 A;  3AK1 A;  3OT7 A;  4JYY A;  3C3T A;  1EN4 A;  3DC5 A;  1B06 A;  2CE4 A;  1ZSP A;  2QKC A;  1EN5 A;  1AR5 A;  1BS3 A;  3LSU A;  1ZUQ A;  3RN4 A;  2CDY A;  1GN4 A;  1N0J A;  1AR4 A;  4C7U A;  1I0H A;  1AP6 A;  1AVM A;  1GN3 A;  1EN6 A;  3QVN A;  4YIO A;  1QNM A;  1VEW A;  1N0N A;  1IXB A;  1EM1 A;  3AK3 A;  3BFR A;  4GUN A;  1JR9 A;  1MA1 A;  3IC9 A;  5A9G A;  1PM9 A;  1MSD A;  3DC6 A;  2GDS A;  3K9S A;  4JZG A;  1ZLZ A;  4BR6 A;  1XUQ A;  1XDC A;  2ADP A;  1JA8 A;  2ADQ B; 
#chains in the Genus database with same CATH topology
 5GW7 A;  4JI4 O;  1P7B A;  1K73 W;  4J7J A;  3CCE V;  1O9H A;  1MZE A;  2JEU A;  2VQE O;  4GT1 A;  5GON A;  1HNZ O;  2GUZ A;  4X65 B;  4LF4 B;  4YJ2 A;  5LHH A;  3CRM A;  1VQ5 V;  4MT8 A;  5CB4 B;  3R66 A;  2DW4 A;  3UQ8 A;  3F5W C;  1Y76 B;  4I4T B;  3K58 A;  3JAL A;  1HDJ A;  3JAW B;  1HWY A;  2CTP A;  3ZHU A;  4FM2 A;  5B1N A;  3P32 A;  1IBM B;  4P30 A;  3LDE A;  2XND G;  4DXW A;  1XIL A;  3RYF B;  4F4L A;  4BAY A;  3J7A U;  3K0D A;  2E3C A;  3CCL V;  1NKD A;  1PPJ H;  4ZHQ A;  3HKE B;  4KUM A;  4WFG A;  3OT7 A;  4Q6G A;  3CSX A;  5KHH A;  5EYP B;  3JAS B;  4H13 B;  2XAF A;  5DN6 G;  4NVP A;  5LHG A;  2ZM6 B;  1VQ8 V;  4FK5 C;  5E1A C;  4NXM O;  1M56 B;  5LXT A;  2ZIN A;  3A0R A;  3N2G A;  4LF9 O;  5IJ9 A;  3JAT A;  4X62 B;  2NLJ C;  1HNW O;  4DV7 B;  2ZE5 A;  4WFF A;  1EN6 A;  2YEV A;  2E75 B;  3G67 A;  3K57 A;  2ZDI C;  1R3K C;  5B1B C;  1ROP A;  2QGN A;  2Q0O C;  3OE7 G;  2BOC C;  1PD3 A;  4WBN B;  3OGC C;  3AK3 A;  5LBQ A;  3RWR D;  5IWA O;  4MVS A;  4DR5 B;  1MA1 A;  1XMQ B;  2Q0A A;  1N8R W;  4J9Y B;  4TV9 A;  4J9Z B;  3APO A;  3SYP A;  1XNR B;  2M7W A;  4DUZ O;  5IYB O;  3AEI A;  4D7T A;  2X6A A;  2Z3Y A;  1DF5 A;  1P7G A;  1HR0 O;  1FD9 A;  2XAH A;  2HHH B;  1OCO B;  3DGE A;  3ZMS A;  4MVO A;  2CGN A;  1N36 O;  2OWO A;  2KQX A;  3JCZ A;  1BMF G;  5B1A C;  1US6 A;  3T1C A;  3W7W A;  3JAT B;  1DK1 A;  2LGW A;  1KC8 W;  2OCH A;  2GTA A;  4B3T O;  1CEZ A;  1WB7 A;  3C3S A;  5L3G A;  1JFF B;  4FLY A;  3RYH B;  4JYA B;  5JQG A;  2UUB B;  2HKO A;  1OV9 A;  5GTH Z;  1K3E A;  1H2G A;  4FPP A;  3EHB B;  5EC2 C;  1KQS U;  3CC4 V;  3OR7 C;  2QR4 A;  1VQ9 V;  5B1B B;  3ZMU A;  4CH5 A;  1QLE B;  3WFV A;  1NS1 A;  5KHK A;  1BQZ A;  3JD4 A;  2UXN A;  1RPO A;  4JPR A;  1F23 A;  1JQ0 A;  4NTY A;  5LGT A;  1EN5 A;  2UXB O;  3LDD A;  1YHQ V;  2H8P C;  3RN4 A;  4GKJ B;  3K59 A;  1K8A W;  4G2K A;  3ZRX A;  4PD4 F;  4TT3 G;  3SPG A;  2GHY A;  1KEC A;  4FFB A;  4C7U A;  1BHA A;  2WLL B;  4DV1 O;  4FLZ A;  3CP1 A;  4ICG A;  4EFB A;  3ABK C;  4MTO A;  4U7N A;  2DE0 X;  1ZWI C;  1YI2 V;  4YIO A;  3JAS A;  1M4U A;  1QCE A;  1N0N A;  2EX3 A;  5K1P A;  4LP8 A;  1K33 A;  1GTO A;  2HFE C;  1XHZ A;  5EZY B;  4NTX A;  4XDJ A;  1JFF A;  3KG2 A;  1SQF A;  4DR4 B;  2UU9 O;  2Q7H A;  3IC9 A;  1MG1 A;  4UCO A;  5EC1 C;  1ARO P;  3HKB A;  1OCO C;  5CN0 A;  5LOV A;  4DYL A;  4GKK O;  2JS5 A;  2W0F C;  5BXZ A;  4I55 A;  1H8E G;  4LF8 O;  1YEW A;  1GN6 A;  3ZCC A;  4YY3 B;  1HW7 A;  3HKD A;  3G6E V;  3JAM N;  3STZ C;  3CRQ A;  3WB0 A;  3CCM V;  5AG2 A;  2BTQ A;  2Z0A A;  3RYI B;  4ASU G;  1S77 D;  4QIW F;  2IU3 A;  3OM3 B;  1Y4M A;  3K03 A;  3CHX A;  1FAF A;  1YIJ V;  1NH2 B;  3AG2 C;  4I0X A;  1R73 A;  2JDI G;  5IWA B;  3K5N A;  4DR5 O;  3LNM B;  5EZY A;  2NR5 A;  5KMG B;  2IH3 C;  3ZIA G;  1NTK H;  2BTO A;  3WB2 A;  2YIC A;  5JCO C;  2NNU A;  3O65 A;  4O4H A;  1WPX A;  3AG7 A;  3HKB B;  4LFB O;  1JJO A;  1AR5 A;  4O4L B;  3FYE B;  5B1O A;  4DV1 B;  4O2A B;  1QVG U;  1SF9 A;  1XOU A;  4G28 B;  3RYC A;  1YCI A;  2P67 A;  1N36 B;  4R7C A;  1TA8 A;  4LFC B;  2Q7G A;  2F1M A;  3LSQ A;  2D2C B;  4O2B B;  2PI5 A;  1W59 A;  4YXW G;  2UUA O;  4L87 A;  4P9P A;  2P7T C;  5EIB C;  1VEW A;  2B1G A;  2WLJ A;  3HKD B;  3F7Y C;  1S76 D;  1WAZ A;  2ZDI A;  2Q5Z A;  4JYA O;  3UO2 A;  5IJ0 B;  4GUN A;  1NVP D;  3ZRW B;  1KP3 A;  1OHH G;  1YDX A;  4LF4 O;  2QTS A;  4RQE A;  3H1L H;  3K9S A;  4JZG A;  4KFM A;  5CBF A;  4LWS A;  4FZ0 A;  1ZAU A;  2HVJ C;  1O9G A;  4X89 A;  3T4D A;  4F6E A;  2D3O W;  4LF5 O;  3OD4 A;  1S0V A;  1Y67 A;  1LUV A;  2AHZ A;  5GTI Z;  2Y48 A;  4X8A A;  2QKA A;  1TAE A;  4JTC B;  2BE3 A;  3ZHT A;  2YIA A;  3CJH B;  2KSD A;  4ABM A;  5J2T A;  3P30 A;  4E4E A;  2AZ0 A;  1SQQ H;  3FB8 C;  2XAS A;  1N33 O;  5HFM A;  1VQ7 V;  1F4M A;  5H6Q A;  2DYR B;  4UCS A;  3A8T A;  4Q20 A;  4KXR A;  5L3B A;  1IBL B;  4FFK A;  1S5J A;  3WG7 C;  1GM7 A;  1IXM A;  1H2L A;  2ZR2 A;  2EIL B;  5BR8 O;  3JAR A;  1S5L Z;  3OMA B;  1KKC A;  3AK2 A;  1IBK B;  4ZI7 B;  5JVD A;  3C3T A;  1WA8 B;  3RYF A;  4R8C A;  2AZ2 A;  4X62 O;  1VQ6 V;  2ZXW C;  1Q3E A;  3TET A;  2CE4 A;  5IJ0 A;  1Z2G A;  2ZXW B;  1BCC H;  4GX2 A;  3BEH A;  4PI2 A;  1J95 A;  3SJQ C;  3I56 V;  2X7R B;  3SJC C;  2W6J G;  4KHP B;  4DK1 A;  5A2Q N;  4YHH B;  4LNU A;  1NR7 A;  1XL6 A;  3ZED A;  5IYD O;  1K7D A;  1OCZ C;  4OX9 O;  2H3O A;  3B8N A;  5IY5 B;  3ETQ A;  3KZI Z;  5DM6 V;  1XNR O;  4FLX A;  1EBO A;  1K5Q A;  4XDL A;  2HLD G;  5L3F A;  1JMK C;  2ODM A;  2YID A;  2Q8V A;  1THZ A;  4LF6 B;  2ITD C;  2R72 A;  3SYO A;  1YJW V;  1N34 O;  1ZLZ A;  1Q43 A;  3TXQ A;  4DR7 B;  4CH6 A;  2OTL V;  4IIJ A;  2VQE B;  3ABL C;  1VP7 A;  1WN7 A;  5CA1 B;  3ZHQ A;  4UVB A;  2QWQ B;  4MTX A;  4ZI7 A;  1QR9 A;  1ZTE A;  1P49 A;  4J7Z A;  1LUW A;  1MNG A;  2PYJ A;  3JAK A;  3E35 A;  3CCR V;  3ZMZ A;  1AP5 A;  4EEQ A;  4O4I A;  3CXH F;  1RP3 B;  3RBZ A;  1SKV A;  4AI8 A;  1K97 A;  2DYR C;  1WB8 A;  3JSL A;  1XBL A;  2QWN B;  4J7K A;  1Q6I A;  5KHI A;  1IBK O;  5IYZ A;  3QTC A;  3K08 A;  4JV5 B;  4X1K B;  2YSU B;  5B5E Z;  4JGS A;  4FLV A;  4U3F H;  2V4D A;  2JIZ G;  1Z5V A;  1FPO A;  3CMA V;  3SPI A;  1H2K A;  1H8H G;  2HP8 A;  3ZX6 A;  5J9P C;  4K3A A;  2UUC B;  3IC7 A;  1AI5 A;  4FVM A;  3L75 H;  2PF4 E;  5JWP A;  4WFA V;  3DXR A;  1AB3 A;  4GYC B;  2Y0I A;  3ZMT A;  4TQF A;  1GM9 A;  4J42 A;  1SA0 B;  1G1X B;  2WLI A;  4OX9 B;  3WB1 A;  5LP6 B;  3JD2 A;  5KAF Z;  1KP2 A;  5CA1 A;  2DJV A;  3SYC A;  5KUK A;  4LR3 A;  5EK0 A;  2IBZ H;  3ICX A;  1F51 A;  2Q6A A;  3BY6 A;  3E8B A;  3I55 V;  2E5L B;  3D3Q A;  1BE3 H;  2KG7 B;  3U11 A;  3CX5 F;  3IAY A;  4YY3 O;  3ZN0 A;  3SGI A;  4B7K A;  2A9H A;  1HNX O;  4MVZ A;  4B3M O;  2K1E A;  2RN9 A;  1PKX A;  1PL0 A;  1Q82 W;  1WP8 A;  2YEV B;  2QKS A;  2ZT9 B;  1SQP H;  2YIB D;  1M90 W;  4FLU A;  1UFI A;  1FJG B;  4B3S B;  3CYO A;  2RMK B;  1SZX A;  1GO3 F;  2MW2 B;  4I55 B;  4NXN O;  4X64 B;  1BZK A;  4DK0 A;  4DR4 O;  4U3J B;  3G71 V;  4DR6 O;  2VWK A;  2UXX A;  1FXH A;  2BCC H;  4LFB B;  3HKE A;  4FFB B;  3FB5 C;  1QHT A;  1VQM V;  1VF5 B;  4YIP A;  2QDO A;  2OIE A;  3T2M A;  1V9P A;  2VQF B;  5KX5 A;  3Q4H B;  2VRZ A;  2P6J A;  4PEL A;  5FPO A;  4BW9 A;  3G80 A;  3B09 A;  2GSM B;  2N74 A;  2G38 A;  5KHJ A;  4MVQ A;  3N2K A;  3A0B Z;  4H33 A;  3CXC U;  4GKJ O;  4X1Y B;  5KA6 A;  3AG1 C;  4K35 A;  1M5I A;  3CJH A;  3MHS C;  3T4Z A;  3FAV A;  1AR4 A;  4LFA B;  1AR1 B;  1L0L H;  3LUT B;  1TUB A;  1QU7 A;  2E74 B;  2ZNJ A;  1SER A;  4U7O A;  5FNV B;  1H38 A;  2PZS A;  4MVM A;  5CBG A;  1JCH A;  2XAJ A;  3LNN A;  4IYI A;  5L3C A;  2OIG A;  3E89 A;  4UCU A;  3M99 B;  4P9O A;  4JV5 O;  4JI3 O;  1AJP A;  1PM9 A;  4I50 A;  3VBB A;  3RVY A;  1ENV A;  2BSK A;  3DC6 A;  1YIT V;  1HNW B;  1EZV H;  1VF7 A;  2P4V A;  1I5Y A;  2QM4 A;  3ZRW A;  2DMX A;  1FFT B;  3E8F A;  4LF8 B;  1VQL V;  4J10 A;  1AI6 A;  3ASO C;  1FXV A;  2OT5 A;  1I08 A;  2IM9 A;  2LW7 A;  3FB7 C;  1LR1 A;  3GB7 C;  4LC1 A;  1V54 C;  3RYH A;  3N2K B;  1K4D C;  2ILM A;  1GK9 A;  1K4C C;  2Z5U A;  4JTD B;  2L6L A;  1L8D A;  2VQF O;  5EBW C;  3KCX A;  3ABK B;  2DQ0 A;  5B3S C;  2Q69 A;  1FKA O;  2JS3 A;  3CRR A;  4AQY B;  2QEX V;  4GCZ A;  1EN4 A;  2CTQ A;  1Y6X A;  4FM0 A;  4KP4 A;  2A7W A;  2RNB A;  1H5W A;  5EBM C;  4QGP A;  2EIK C;  2CTW A;  3EFF K;  2BSK B;  1AI7 A;  3D3I A;  2CDY A;  5HFL A;  2NN4 A;  1XHX A;  1FJG O;  4B3S O;  1VQO V;  4DV4 B;  5BY1 A;  4DV2 O;  3JAK B;  4WF9 V;  1AVM A;  1K9M W;  4RUF A;  3APQ A;  3HPL C;  4D7S A;  1NU1 H;  2R9I A;  4TV8 A;  4I9W A;  5BMV A;  3BA8 A;  3P3N A;  3H9V A;  2LO1 A;  3JD3 A;  2HVK C;  1TGO A;  4ZBM A;  3TGU H;  2JGU A;  1JOY A;  4DR6 B;  1NBM G;  1LNQ A;  2QM7 A;  1N32 B;  3SYQ A;  4GX5 A;  2R9R B;  3H1I H;  5A9G A;  1MSD A;  1YVW A;  4UUJ C;  3QF7 A;  4UFZ A;  4BR6 A;  2ADP A;  3BAB A;  3H1H H;  1S3J A;  4MTF A;  4UV8 A;  4R50 A;  3STL C;  2CGO A;  2ZIO A;  2BTQ B;  1FYJ A;  4PJ0 Z;  2X6B A;  5LGU A;  2YDE A;  1G8M A;  2AXT Z;  4H44 B;  2X6C A;  1N33 B;  4ZOL B;  4JI8 B;  1Q8I A;  4Z1V A;  3HKC B;  1GH6 A;  5J2U B;  1D5N A;  1BGY H;  1UPG A;  4CH3 A;  1OCC B;  4HNA A;  5LXT B;  1K34 A;  4BIO A;  3L72 H;  4EFE A;  2UXC O;  3E2E A;  1H2N A;  3IJ4 A;  3I5D A;  2CUG A;  1RM1 B;  2K9P A;  1NR1 A;  3K04 A;  3M8A A;  2CTR A;  4CH4 A;  1G6U A;  1TVK B;  3ABT A;  1R6N A;  4HZ3 A;  4IT5 A;  3HR0 A;  4YJ2 B;  2XTA A;  1XL4 A;  5IT9 N;  3K06 A;  2QSA A;  3LSU A;  3GVM A;  5FPR A;  2QJ1 A;  4WFH A;  4DV4 O;  1KU9 A;  4KHP O;  3SJB C;  3BCC H;  2WWW A;  1Y76 A;  3RFR A;  4FM1 A;  1VQ4 V;  2F66 C;  2ATK C;  1V55 B;  2WLI B;  4N23 A;  4GX0 A;  4DR1 B;  4JI6 O;  4N21 A;  2FL4 A;  2ZD9 A;  1MSW D;  2DWE C;  3ETE A;  5FLX N;  4K8Z A;  3JYC A;  4W4L A;  4JI0 B;  4RQF A;  3U10 A;  3BFR A;  2MK3 A;  4B08 A;  3TCU A;  1ZL8 B;  4NB5 A;  4Z1M G;  3FFQ A;  4AQY O;  4JTA B;  2ZKO A;  1PNK A;  5JH7 A;  4JYC A;  4O4H B;  5H6R A;  2OCC C;  2RJZ A;  3MAQ A;  3ML0 A;  3OUF A;  1XRE A;  1I94 O;  1OZ0 A;  1P84 F;  5D5Q A;  2R9A A;  5F2V O;  2YC0 A;  2WLM A;  3OEH G;  4NKG B;  3FKS G;  1UJW B;  2F43 G;  3OTF A;  4LF5 B;  3RW0 A;  2P90 A;  3IFX A;  4NR1 A;  2IW5 A;  5B3S B;  4GX1 A;  1QLN A;  4PA9 A;  3W7U A;  4LF9 B;  2Q68 A;  3ABM B;  1GRJ A;  3MDS A;  4DV5 O;  3AG4 C;  1Y66 A;  3SJA C;  4CS3 A;  2HJF C;  2Y4T A;  2EZO A;  1RSO B;  1Q90 D;  2Q67 A;  3DC5 A;  2PYL A;  4CS4 A;  4JI1 B;  5JJJ B;  1S5H C;  3SPC A;  2W0X A;  2N04 A;  1VQK V;  2CAZ C;  4QNH B;  5BR8 B;  1NH2 D;  5JH7 B;  1F4N A;  5JQG B;  1MZF A;  4OXS A;  2A06 H;  3T1H B;  4PI0 A;  1T5E A;  4I4T A;  4JI0 O;  1TUB B;  1IZ3 A;  4DV3 B;  1FOU A;  4W4K A;  5K1X A;  2AHY A;  1H2M A;  1D5A A;  3MD0 A;  4B3M B;  5LMN O;  1WA8 A;  2PI4 A;  3OGI B;  2LFS A;  4QPJ A;  2QWR B;  5D5P A;  1WNS A;  3GWO A;  1I94 B;  2UUB O;  4LWS B;  1CXZ B;  2GTS A;  4A5U B;  2ZE7 A;  5H2F Z;  3VQX A;  1MAB G;  2JRI A;  4BIU A;  2EZP A;  3ZBH A;  1RPR A;  1BSM A;  4DUY O;  2PUS A;  2IH1 C;  4HAM A;  4EB6 A;  1Q7Y W;  1Q5O A;  2GBO A;  4UCR A;  4I5S A;  5J2T B;  3QO8 A;  3UM7 A;  1AJN A;  2F93 B;  1AJQ A;  4LBE C;  3JD0 A;  1VQP V;  1IX9 A;  4PA6 A;  1SQG A;  5C8Y A;  1XMO O;  1HR0 B;  3CC7 V;  2HG5 C;  1V54 B;  3ASN B;  4DRX A;  1L0N H;  3UT5 B;  2B5U A;  2YXH A;  1B04 A;  3CWB H;  3OFN G;  2YI8 A;  3DXR B;  4FIP C;  1KMI Z;  3RYI A;  2IJI A;  1ZUQ A;  5CA0 A;  2IJH A;  1YTF B;  1NVP B;  2EJ7 A;  4LFA O;  1P4R A;  3CCQ V;  2ZE6 A;  4D6T H;  3PJS K;  1PV0 A;  1VF6 A;  3ASO B;  2EIN C;  3BPZ A;  3TXS A;  3TK1 A;  4E2L A;  2JJ1 G;  3WG7 B;  4DO2 A;  1FXK C;  3R65 A;  3SR2 C;  3BA9 A;  4G27 B;  4CC6 A;  1R1B A;  3W7S A;  2UXB B;  4JAU A;  5BMV B;  4JI3 B;  3ZMV A;  4FLW A;  3L74 H;  4X1K A;  5LMU O;  2DQ3 A;  1YSC A;  2QA4 V;  2LW1 A;  4X66 O;  4DR2 O;  4I7Z B;  4MSW C;  2HEP A;  2IJJ A;  5C93 A;  1KBH A;  3RVZ A;  4JI1 O;  2EIN B;  3E83 A;  1J5E B;  1FXK A;  3E86 A;  3A0H Z;  4R6Z A;  1BHB A;  2OYQ A;  4DW1 A;  4DV2 B;  1Y74 B;  4LF7 O;  4DUY B;  2EIJ B;  2W6I G;  3KKY A;  1SET A;  3B40 A;  2ZQM A;  1R6K A;  4JI4 B;  1X4T A;  2QWP B;  3AG1 B;  3JD1 A;  3QNE A;  2WA4 A;  4JI7 B;  1N32 O;  4YJ3 A;  1BQ0 A;  2UUC O;  4ZOL A;  3CEI A;  4O4J A;  3ASN C;  4DV3 O;  1WPB A;  3J80 N;  4LFC O;  4X1I A;  3L73 H;  4QE7 A;  2N05 A;  1JJ2 U;  4J80 A;  5CA3 A;  3N27 A;  2UUA B;  4UV9 A;  3O9O A;  1N4C A;  4NXN B;  2EIJ C;  3QG5 A;  1U96 A;  2YIB A;  1KD1 W;  2EIK B;  2QWO B;  5L3E A;  1X59 A;  3GWK C;  3E8H A;  5H5N A;  1QVF U;  1TVK A;  1K92 A;  3K9A A;  1BS3 A;  4UB8 Z;  3BRC A;  1SRY A;  4CBC A;  1PNM A;  4DRX B;  1Z5W A;  1CP9 A;  1ZX3 A;  3BHP A;  2F4V B;  3F5T A;  4QJF B;  1FS0 G;  2ZM6 O;  2Q73 A;  3OUS A;  5CBH A;  1IXB A;  2XT9 A;  1EM1 A;  2CH7 B;  2DYS C;  2YUA A;  1VIB A;  4HYO A;  1YF2 A;  2QE7 G;  4OGQ B;  3ZS8 C;  5KLV H;  2V7Q G;  3HKC A;  1WLE A;  3AG3 C;  5KX5 B;  5LYJ B;  2LP7 A;  4B3R O;  3PN1 A;  2LQT A;  1M57 C;  4HBN A;  2UXD B;  4RWU A;  4JZ2 A;  4LF7 B;  4IHJ A;  4I0X B;  3DTU B;  2WA3 A;  1TUE B;  4UCT A;  4MTG A;  2M6Y A;  4WFE A;  2FML A;  4O2A A;  4JI8 O;  1GN2 A;  4MW8 A;  2HHH O;  4O4L A;  4O2B A;  2A79 B;  4PA4 A;  1E79 G;  5H9C A;  3RYC B;  1BT8 A;  2QTO A;  1OCZ B;  2P22 C;  3TJT A;  3OAA G;  5CMU A;  1OJH A;  5JJN B;  3ABM C;  3FX7 A;  3CME V;  2FTK A;  3H1K H;  4FMT A;  5LL6 Y;  4DV7 O;  2EJR A;  4BWA A;  1OCR B;  4J41 A;  4X20 B;  5DEC A;  4FLT A;  2PY5 A;  2ITC C;  4F6R B;  3CCJ V;  2WSS G;  3X2Q B;  1XNQ B;  2XAG A;  2H94 A;  2LFR A;  3RT3 C;  1M93 A;  3LDC A;  3K5M A;  1ZL8 A;  1SES A;  2PGG A;  3OTO B;  1FFX A;  2EIL C;  1Q6U A;  4FJC C;  1I0H A;  1GN3 A;  4FZ1 A;  4RO2 A;  3CE2 A;  4DUZ B;  2XAQ A;  3T1Y O;  2WAM A;  1PNL A;  3D8C A;  3OR6 C;  5C8Y B;  2HJD A;  4NYK A;  5JJE B;  4DV0 B;  1CPY A;  1KB9 F;  3M7M X;  3BVO A;  2Q9L A;  1KYO F;  1MOF A;  2A0L A;  2Q4P A;  2OCC B;  3OMN B;  2XHB A;  2ZCE A;  1M57 B;  4P2Z A;  1L1F A;  1SA0 A;  5LHI A;  4NTW A;  4L8J A;  3G6B A;  1AIL A;  4JI2 B;  5BZB A;  3K5O A;  3VQW A;  3S3X A;  4HNA B;  2F4V O;  1N34 B;  2JVD A;  4GLX A;  2JEX A;  4TV8 B;  2F23 A;  1R6T A;  3AG3 B;  4DR7 O;  1DLB A;  2XOK G;  1KKD A;  3OEE G;  2YXL A;  5LMN B;  1GMG A;  1YJ9 V;  2E76 B;  4DV6 O;  3OW2 U;  3N2G B;  4DR3 B;  4DV5 B;  1URF A;  4PA7 A;  3L9D A;  4UXN A;  3FAV B;  3K5L A;  5KUM A;  5IY5 C;  2FYU H;  1NJI W;  1B6Q A;  1R3L C;  4OPA A;  2WLN A;  4X88 A;  2Y69 C;  2UXD O;  3JAL B;  5LGN A;  1EZJ A;  1YZB A;  1NTZ H;  3W7T A;  5LP6 C;  1B3Q A;  4U3J A;  1I7F A;  4TV9 B;  4IIJ B;  1AP6 A;  5JVD B;  1HNZ B;  2GV9 A;  3BAA A;  1W0K G;  3E22 A;  3ABL B;  4H0L B;  2QM8 A;  5IE9 A;  2VWJ A;  4JAV A;  3H1J H;  4YJ3 B;  1JX9 A;  2CH7 A;  1QNM A;  1YJN V;  3ZJZ A;  4CC5 A;  1GKF A;  2Y4U A;  4UB6 Z;  1NTM H;  2JK5 C;  4CZZ A;  1JR9 A;  4IL6 Z;  5B1A B;  4PDV A;  4JAA A;  5IDJ A;  4EB6 B;  5IYZ B;  1XI1 A;  3FB6 C;  3ETG A;  3DSQ A;  4LNU B;  3B4S A;  1XUQ A;  3B77 A;  4EKW A;  2Q7E A;  4IYH A;  5KHG A;  4X9Q A;  2BOB C;  5DED A;  1DF4 A;  3IGA C;  1NI8 A;  4JI7 O;  2RCV A;  3JCU Z;  1KUQ A;  3G4S V;  3QO7 A;  1JNB A;  4J11 A;  5FNV A;  4GZR B;  5FL7 G;  3JAW A;  3SPH A;  2ZIM A;  2KKW A;  3QO5 A;  1JVM A;  1DGS A;  4NXM B;  2YI9 A;  2WPD G;  3EVK A;  2DOS A;  2XUM A;  2O57 A;  1K5S A;  1H2S B;  5B66 Z;  2WLK A;  5LP6 A;  2VS0 A;  4I50 B;  1F7Y A;  1IVS A;  1MMM A;  4B3T B;  2OTJ V;  3J81 N;  4DV6 B;  3NR7 A;  4DR3 O;  4TUY A;  4K0K O;  4LCU C;  5ITZ A;  3ZHV A;  4DR2 B;  3AG4 B;  1PL4 A;  1I5X A;  2ZR3 A;  3SDL A;  2P5O A;  2ARH A;  1Q6H A;  1E1Q G;  1M1K W;  2KG7 A;  3AK1 A;  1IBL O;  3CRC A;  4JI5 O;  2DN9 A;  1DTO A;  2WLH A;  1ZSP A;  1EFR G;  4PA3 A;  1BL8 A;  1W2B U;  3SYA A;  1NT2 B;  5GON B;  4BW5 A;  1WP7 A;  4JI6 B;  4DR1 O;  1W0J G;  3UO3 A;  1SQB H;  3AG2 B;  2YXY A;  1FXK B;  3OMI B;  4B3R B;  3A2F A;  1Y74 A;  3CD6 V;  1M9N A;  3VOU A;  1PP9 H;  4LH6 A;  4YHH O;  4OPH A;  2DYS B;  5L3D A;  3VQY A;  3JAR B;  4UVC A;  1QBZ A;  3U0Z A;  4QPK A;  2JGD A;  4JF3 A;  5EBL C;  4ZIB A;  2HR3 A;  4TUY B;  3L71 H;  3Q4H A;  4IGG A;  4JYB A;  1VF6 C;  3CCV V;  5LYJ A;  4K8X A;  2LGQ A;  4H37 A;  2IU0 A;  3B2E E;  1XMQ O;  5JCO A;  1FFX B;  1JPX A;  1Q81 W;  4O4I B;  3K3W A;  4DW0 A;  2AW9 A;  3WU2 Z;  2ZE8 A;  3ZN1 A;  1VQN V;  2P4K A;  3CRA A;  2JJ2 G;  5KAI Z;  1COW G;  4XDK A;  4WCE V;  5TIS Z;  3UT5 A;  1R3I C;  1IDS A;  1IJG A;  1XNQ O;  1D2D A;  3C90 A;  5IYC O;  4JI5 B;  2Y0P A;  3CC2 V;  4QE9 A;  3H01 A;  1XEQ A;  4JAS A;  5E79 Z;  1B06 A;  2UU9 B;  2X0L A;  4MW3 A;  2B1I A;  3T1H O;  1G4Y B;  1RSO A;  4X65 O;  2V1D A;  1E1R G;  4TSF G;  3ZRV A;  5ITZ B;  2WLL A;  2ZNI A;  4UCV A;  4I9Q A;  1GN4 A;  1N0J A;  2ETN A;  4XBF A;  5LA6 A;  1QLE C;  4LF6 O;  4Z2W A;  1S72 V;  3VQV A;  3ZHS A;  3D36 C;  1GAX A;  1HP8 A;  2FB5 A;  3X2Q C;  1AI4 A;  5IJ9 B;  2LJ2 A;  3K79 A;  1GM8 A;  1QR8 A;  1IUR A;  2A3Q A;  4K0K B;  1SQV H;  2GUZ B;  3JSN A;  2C2A A;  4MVU A;  3ZHR A;  2AGA A;  3P3P A;  4TOI A;  5LOV B;  4JI2 O;  1A32 A;  3D36 A;  2GDS A;  2DWD C;  1SQX H;  1JA8 A;  3HB3 B;  2ADQ B;  3E8G A;  3F7V C;  1NQT A;  5EIB D;  3EXA A;  2P06 A;  4TQD A;  4KL1 A;  4PDL A;  4PHZ A;  1OCR C;  4AHC A;  3K0G A;  3CCU V;  1VAR A;  4WFB V;  2RDC A;  3KCY A;  1VMG A;  3CCS V;  3FD9 A;  3SPJ A;  4LH7 A;  1RM1 C;  3ABU A;  4RUE A;  4AIL C;  1XMO B;  4PDM A;  2JGD B;  2KB1 A;  4PV1 B;  4X20 A;  2Y69 B;  4X66 B;  3RGB A;  1YTF D;  2CK3 G;  4O4J B;  2L35 A;  3CS5 A;  1QQC A;  2PTM A;  4GKK B;  5EYP A;  4DV0 O;  4ZKI A;  5KA5 A;  2R70 A;  5KMG A;  4IHJ B;  1SS3 A;  2EIM B;  3UKM A;  1NZ6 A;  4BIZ A;  3NXS A;  1IBM O;  3MHH C;  4TWK A;  4X64 O;  2RQ6 A;  2EUL A;  2FKX A;  4JYY A;  1R3J C;  2F95 B;  3L70 H;  4MS2 A;  4X1Y A;  2EBO A;  3KDR A;  3CB2 A;  2QKC A;  3UCS C;  4WBN A;  2E5L O;  5CB4 A;  1RFY A;  3OTO O;  3ETD A;  1M56 C;  3ZRS A;  4B7E A;  2UXC B;  4MVR A;  3LSS A;  2EIM C;  3B8M A;  4RAI A;  5CA0 B;  1HNX B;  1U97 A;  3THO A;  4CS2 A;  1OCC C;  5LMU B;  2B9Z A;  3W7X A;  3QVN A;  3T1Y B;  1ORQ C;  4PDR A;  4F6R A;  5J2U A;  1V55 C;  1Q86 W;  1YXB A;  3E22 B;  4UVA A;  3CPW U;  4ZHQ B;  1J5E O;  5LA6 B;  4X1I B;  1XQ8 A;  2IJK A;  1WJZ A;  2YS8 A;  1SC5 B;  3S3W A;  1XDC A;  3FYI B;  1SZT A; 
#chains in the Genus database with same CATH homology
 4F6E A;  4X9Q A;  4JZ2 A;  1P7G A;  1Y67 A;  2RCV A;  1VAR A;  1LUV A;  1XRE A;  2QKA A;  1GN6 A;  3KKY A;  1ZTE A;  1I08 A;  1LUW A;  1BSM A;  1MNG A;  1SZX A;  4E4E A;  1GN2 A;  5AG2 A;  2AW9 A;  3EVK A;  1D5N A;  2P4K A;  1AP5 A;  1MMM A;  1WB7 A;  3C3S A;  1BT8 A;  1WB8 A;  4FFK A;  3TJT A;  1XIL A;  3CEI A;  1IX9 A;  1IDS A;  1PL4 A;  3MDS A;  4YIP A;  1KKC A;  3AK2 A;  3AK1 A;  3OT7 A;  4JYY A;  3C3T A;  1EN4 A;  3DC5 A;  3KDR A;  1B06 A;  2CE4 A;  1ZSP A;  2QKC A;  1EN5 A;  1AR5 A;  1BS3 A;  3LSU A;  1ZUQ A;  3RN4 A;  2CDY A;  1GN4 A;  1N0J A;  1AR4 A;  4C7U A;  1I0H A;  1AP6 A;  1AVM A;  1GN3 A;  1EN6 A;  3QVN A;  4YIO A;  1QNM A;  1VEW A;  1N0N A;  1IXB A;  1EM1 A;  3AK3 A;  3BFR A;  4GUN A;  1JR9 A;  1MA1 A;  3IC9 A;  5A9G A;  1PM9 A;  1MSD A;  3DC6 A;  2GDS A;  3K9S A;  4JZG A;  1ZLZ A;  4BR6 A;  1XUQ A;  1XDC A;  2ADP A;  1JA8 A;  2ADQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...