1IX9A

Crystal structure of the e. coli manganase(iii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
205
structure length
205
Chain Sequence
b'SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide Dismutase
publication title Structures at 0.90 A resolution of the oxidised and reduced forms of the Y174F mutant of the manganese superoxide dismutase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 80
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ix9A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ix9A02
1ZUQA 2ADPA 1XREA 1Y67A 1ZSPA 1XUQA 3DC5A 1EN4A 4YIOA 1JA8A 1MNGA 1SZXA 3BFRA 1XDCA 4BR6A 5AG2A 3EVKA 4JZGA 1AVMA 3DC6A 3IC9A 1MMMA 1PM9A 2RCVA 1PL4A 2QKAA 3KKYA 4C7UA 2GDSA 3K9SA 1GN2A 1LUVA 1QNMA 3CEIA 3OT7A 1ZLZA 4YIPA 4JYYA 1XILA 3QVNA 1WB8A 4JZ2A 5A9GA 3AK1A 1GN3A 1JR9A 1IX9A 3AK3A 2P4KA 1D5NA 1EN5A 3C3SA 3TJTA 3AK2A 1B06A 1AR4A 1VARA 1BT8A 1KKCA 1IDSA 4GUNA 3C3TA 1BS3A 1N0JA 1MA1A 4E4EA 4FFKA 1AP6A 1I0HA 1N0NA 3LSUA 2AW9A 2CDYA 2QKCA 3RN4A 1VEWA 1I08A 4X9QA 1EN6A 1LUWA 1AR5A 1GN4A 1AP5A 2ADQB 3MDSA 1MSDA 4F6EA 1P7GA 1GN6A 1WB7A 1ZTEA 1EM1A 1BSMA 1IXBA 2CE4A
chains in the Genus database with same CATH superfamily
1VQOV 3DC5A 3K79A 1NI8A 3ABKB 1U97A 1V55B 1MSWD 2HR3A 1RM1B 4MVQA 1ZX3A 4LF4B 1AJPA 1JJOA 4C7UA 1DLBA 3SPIA 4TV8B 3ZMSA 2E5LB 4JI1O 1QU7A 2OCHA 4MTGA 4P9PA 3H1LH 4PV1B 3CE2A 5J2UB 2AZ2A 2PY5A 1A32A 2IJIA 1ZLZA 4TOIA 4DR4B 5KHHA 1Y4MA 4GX0A 4WF9V 5L3CA 3DXRA 4O4JB 1XMQO 3OW2U 1XNQO 1D5AA 4DV6B 3FD9A 1QVFU 3ABLB 3U10A 4U7NA 2HKOA 2ITDC 4BW5A 2JRIA 2JK5C 5B1NA 1NS1A 4JAVA 5C8YA 2QWPB 1GKFA 4E4EA 4O4IB 4PA6A 3A0BZ 3BAAA 4OX9O 3AG3C 2LP7A 3OEHG 2P06A 2A06H 4GKKB 3A0HZ 3W7XA 2QKCA 3CB2A 3UQ8A 3CC2V 4JI0O 4X64O 5LHGA 3EXAA 1OCOB 3WG7B 1V54B 4BIOA 4BW9A 4FLXA 4X62O 2ZKOA 4KL1A 4B3TB 2VQFO 3K9AA 1N36B 5FL7G 1BSMA 3CCSV 3CPWU 1NR7A 1ZSPA 1BQ0A 2HLDG 1XUQA 4DUZO 2QR4A 4ZBMA 5LXTB 5EZYA 3X2QC 4I4TA 1OCCC 2YICA 1N32B 4CC6A 3P32A 2P67A 2WPDG 1VF7A 2FYUH 3G6EV 4DR2O 3W7WA 1S5JA 4P2ZA 4IHJB 3K06A 4H33A 1VF6A 2Q67A 1GM8A 3J7AU 4KHPB 1PL0A 2CK3G 2LQTA 4Q6GA 2LGQA 2YEVB 4LFCB 5JVDA 3ABKC 2P5OA 4X66O 1V55C 2ZNIA 1HWYA 1M1KW 4FLYA 5DEDA 2UU9O 4MVSA 3T1YO 4LH7A 4ZKIA 4FMTA 4AILC 5BXZA 3N2GB 4U3JA 4MVMA 3ZMVA 3UM7A 1VARA 5BZBA 3P3PA 1QCEA 5JCOC 4HBNA 2EINB 4MVOA 4PA4A 3RWRD 2FKXA 2DJVA 4WFAV 4XDKA 3T1HO 3HKCB 1AI5A 5LA6B 2ZQMA 1K73W 1Q81W 5CBGA 4JI4O 1KECA 2YC0A 2K1EA 4LF7B 4K3AA 1IBLO 4DW0A 1R6NA 1K34A 4DR5O 1GN4A 4U3FH 1ZWIC 1CP9A 1MSDA 1FXKA 5H9CA 4EEQA 1WB7A 1SQVH 4DV0B 3APOA 4D7SA 3UKMA 4ZOLB 3HKDB 3JATB 4F6RA 3OGCC 1PNMA 5LMUO 1NTMH 1K5SA 4DR3B 1HNXO 1OCOC 3E86A 3EVKA 3JSNA 1YTFD 3RGBA 1MMMA 1Y74B 4O4HB 4DW1A 2A0LA 2Y0IA 4JI6O 5GW7A 1SESA 4IGGA 1ROPA 4LR3A 3UT5A 1AI7A 2FTKA 2UXCO 1Q5OA 1URFA 5DECA 4NB5A 4RQEA 1LUVA 4DV5O 4MTXA 1M90W 1KC8W 2QDOA 2XAFA 4I5SA 1ZL8A 3JAWA 5CB4B 2EIMC 3AG7A 3GWKC 2JS3A 4DRXB 1VQ5V 5FLXN 5JQGB 4I0XA 4CH5A 1TUBB 4J11A 3K59A 3STLC 3QF7A 4O2BA 4W4KA 4QE9A 5K1PA 1RPOA 2GUZA 3CS5A 1P49A 3K5OA 2EX3A 4W4LA 1N0JA 1P84F 4D6TH 1U96A 1Q86W 1AILA 4TQDA 2Q68A 2ZIOA 2EIJB 1BZKA 4BIZA 2MW2B 2WAMA 1UJWB 2MK3A 1EN6A 3FB6C 1AR5A 3TXSA 1AP5A 2QWNB 2QA4V 1VQ4V 1TUEB 4X65O 3CJHB 4QE7A 5GTHZ 4LF9O 4DR1O 4JV5O 3VQYA 3R65A 1J5EB 1ZUQA 3F5TA 4QPJA 2ADPA 1Y67A 1IURA 2VQFB 4I50A 3CRCA 1S5HC 3ML0A 1JA8A 1M5IA 5CBFA 3ETQA 3EFFK 1L0LH 3B77A 4KP4A 4WBNA 3RVYA 4X20A 1PP9H 4AI8A 3BA8A 2CGNA 1PD3A 1M93A 5JWPA 2EZPA 3JD2A 3W7UA 2ZIMA 2VWJA 2HVJC 5EK0A 2HG5C 2L6LA 3JARB 1GRJA 3C90A 5LP6A 4LF4O 4RUEA 1BMFG 2BOBC 1F4NA 2HVKC 1ZAUA 3K58A 2E5LO 2ZDIA 1IZ3A 1K4DC 2LJ2A 5LHIA 4DR6B 1WAZA 2ETNA 3CCLV 2ZCEA 4CS4A 3ZRWB 2R9IA 2ZT9B 4BWAA 4RWUA 1SQFA 4DR4O 2DMXA 3K0DA 4Z1MG 2JDIG 4K0KB 1H2NA 1SQPH 3AG2C 1VQKV 5FPRA 1BS3A 5CN0A 5IWAB 4CH6A 3P3NA 3K57A 3H01A 3ZBHA 5IY5B 1NTZH 4Z1VA 2DQ3A 5IYBO 2N04A 1WLEA 4HZ3A 4B3SB 2WA4A 4O2AA 2XAHA 3QO5A 5H6QA 3BPZA 1KUQA 3K5LA 4IYHA 1XHXA 2JVDA 4PDVA 2DE0X 3CRQA 2YDEA 3N2KA 1THZA 5L3EA 4LNUB 4B3TO 1W0KG 1F51A 1Q8IA 4FLWA 5J2UA 1HDJA 4UUJC 3PN1A 3GB7C 4IL6Z 2YXHA 1QBZA 3FYIB 3T4ZA 4BR6A 2XAGA 4JZGA 1K33A 4H0LB 5ITZA 1Q90D 4G2KA 2RCVA 4LF8B 3G4SV 1JOYA 4ASUG 2VRZA 2ZNJA 1TAEA 1SA0B 4TV9B 1N33O 2Q0OC 4LWSA 2UUCO 4LFBB 3G6BA 1QHTA 1H2LA 4X89A 3ASNC 1R6TA 5EIBD 1XNRB 1JFFA 3QO7A 3QO8A 1G8MA 4X1KA 4JI6B 1XILA 2X7RB 1H2MA 4KHPO 4MTOA 5EYPA 1BGYH 4MVZA 1YI2V 1GN3A 4LFCO 2EJ7A 3RYIB 2IW5A 1GK9A 1HNZB 3E22A 1XQ8A 1QR8A 2W6JG 4J42A 3GVMA 4UCSA 3JALB 4J7ZA 5J2TB 4GX1A 5IJ0B 3SYOA 4R8CA 4DK1A 5E1AC 4NYKA 4LC1A 3LSUA 2QJ1A 1K7DA 2QE7G 1MZEA 1ORQC 1GM7A 4YJ2A 2YIAA 2WLHA 2WLLA 3OE7G 3HB3B 2ZM6O 3NXSA 4LF7O 4UB8Z 2CH7A 2KG7B 2Z0AA 2V4DA 2JEXA 1Y76A 3J81N 4HAMA 4GT1A 1OCCB 1P7BA 3L72H 4DV0O 2IU0A 5EBWC 2QSAA 3CXHF 4ABMA 1IBMO 3CRAA 2H3OA 1YHQV 4E2LA 1P4RA 2R9RB 3E8GA 4QJFB 3DGEA 1PL4A 3M7MX 5E79Z 4DV1B 1FYJA 3JASB 3ASOC 1H8EG 4DR3O 2WA3A 5LGUA 3CP1A 5IJ9A 1VQPV 5GONA 1LNQA 1KBHA 1NVPB 5FNVA 1B04A 2IH1C 5BY1A 2CTPA 4J9ZB 2AXTZ 4I55A 4DR7B 1TVKB 4PA7A 4FVMA 3RFRA 2WWWA 5JH7A 2IJHA 1H2SB 2Y69B 4JI7B 2A9HA 1WA8A 1RPRA 4YJ3B 2E3CA 5CA1A 3L73H 1FFXB 1YITV 4JTCB 2XHBA 5BR8B 4FZ1A 1SS3A 2D3OW 2LW7A 4FPPA 2YIBD 2WLKA 3U11A 2P4VA 4HNAA 4LP8A 3BHPA 2P6JA 5IYZA 4JI2O 3BY6A 5LMNB 2E75B 2XT9A 3ZRVA 3RYCB 4MVUA 5KMGB 4UXNA 1F7YA 2M7WA 1MOFA 1W59A 2RQ6A 4K8XA 4ZI7A 4P30A 4U7OA 1P7GA 4PDLA 3L71H 1FFTB 2OTLV 4R50A 3LUTB 1OCZC 2ZINA 1QR9A 3RYHA 4PI0A 2F4VB 4PJ0Z 5EBMC 3CCJV 4DV2B 1FS0G 1CEZA 4CH3A 1WPBA 3FB8C 2BOCC 1K5QA 4ZHQA 3IC7A 1CPYA 1Q3EA 3SR2C 1OZ0A 2BTQA 2HEPA 4NTWA 1J5EO 2Q9LA 2NN4A 1VQNV 5B1BC 2GTSA 1QLNA 4A5UB 5A2QN 4NR1A 4IIJA 2BCCH 3R66A 5CA0B 3ZIAG 1FXHA 1TUBA 3ZS8C 4DXWA 3OD4A 1K4CC 2EZOA 4DK0A 5CBHA 1JVMA 4OXSA 3ZRSA 4I7ZB 1N33B 2UUCB 3ZHUA 2N74A 2EIMB 1XL4A 2RMKB 2YS8A 4DUYO 1S3JA 4JZ2A 3OR6C 3H1HH 3LDCA 4FK5C 4ICGA 4KXRA 3ZMTA 3AK3A 2W6IG 4XBFA 1G1XB 3JCZA 3E35A 1XMOB 1JPXA 1NTKH 4DR6O 3CXCU 3K04A 3BABA 5EC2C 1SERA 3E83A 3ZX6A 4YXWG 4NXMB 3SPCA 3CJHA 2BSKA 5KHIA 3T1CA 1F23A 4FM1A 2M6YA 4B7KA 1AP6A 3FFQA 4K0KO 5L3GA 1OHHG 2JS5A 3RN4A 5IWAO 1AJNA 3LSSA 2Y69C 3BA9A 2YI9A 1S76D 2ADQB 3HKEA 2RJZA 5KX5B 2V1DA 2EJRA 4OPHA 3CC4V 4B3SO 4NXNB 5JJNB 4DV4B 3STZC 2ZM6B 3VOUA 3HKBA 4UVAA 2CTRA 4WFFA 1S5LZ 1EN4A 1JNBA 1MNGA 2QEXV 3WU2Z 5AG2A 5CMUA 2X6BA 4RUFA 4UV8A 3ZRWA 4MVRA 2QKAA 1KMIZ 1ENVA 3RVZA 3LNNA 3D8CA 5KLVH 2UUBB 2Q73A 5EC1C 5H5NA 4FM0A 1BHBA 4X8AA 1IBMB 1RSOB 3OTFA 1S72V 3ZHTA 2D2CB 2WLIA 1KB9F 1Z5WA 4LF8O 2QWQB 1W2BU 1OCRC 2DOSA 2ZR3A 3OTOB 2DYSB 2YIBA 4LFBO 2YSUB 1H38A 1AB3A 3H9VA 5BMVA 1MABG 2OIGA 3SPJA 1XNRO 2VWKA 4MSWC 4OPAA 2ODMA 2O57A 3ZHSA 3QTCA 4XDJA 5HFMA 2UXDB 1GH6A 2PTMA 4MS2A 4UCUA 4TT3G 1NH2B 2XASA 4UVBA 3AG2B 2IM9A 2QM4A 4H44B 2Y0PA 3JD0A 3RT3C 5KA5A 3L70H 2XUMA 5B1AC 4PDMA 3H1IH 3C3TA 5H2FZ 1MA1A 3ICXA 4N21A 3F7VC 1HNZO 5C8YB 1VQMV 2KQXA 2CDYA 4O4LA 4JF3A 3E8BA 3WB2A 3S3XA 4NTXA 1G4YB 2W0XA 1I94B 1H8HG 3OUSA 1JCHA 3MDSA 4CBCA 2UXBB 5TISZ 1GN6A 4JI2B 1YDXA 1R73A 2WLMA 5KAIZ 1KKDA 5LBQA 4EB6B 1BHAA 1Q43A 4GYCB 1NZ6A 1XL6A 4YY3B 2WLNA 4IYIA 2WSSG 1WPXA 1VQ6V 5EZYB 4G28B 1AVMA 4I4TB 4JYBA 3Q4HA 3CCMV 1M9NA 1KP2A 4J7JA 3KKYA 3VQVA 3APQA 4FLTA 1Y6XA 3RYIA 2EULA 2G38A 3ASNB 2C2AA 4FFBA 1FPOA 3E2EA 3IAYA 3CCEV 1GN2A 3JALA 3FAVB 4PELA 4KFMA 3JAKA 4DV1O 3OMIB 1SQBH 1L8DA 1X4TA 5KAFZ 1FJGB 2AHYA 3H1JH 4JTDB 2ZD9A 3OFNG 3VQWA 3CMEV 2L35A 5DN6G 1XOUA 5JVDB 2X0LA 4BIUA 2OT5A 3B8MA 5LHHA 2GBOA 3SJBC 2ARHA 3ZHRA 1NBMG 5DM6V 1D2DA 1SQXH 3AEIA 2P4KA 2Q0AA 1OV9A 4JTAB 4DUYB 4RAIA 4DR7O 3H1KH 2R72A 4U3JB 1BQZA 1YF2A 3CHXA 2QTSA 2QKSA 3T4DA 2DYRC 4J41A 4JI7O 2DYSC 1WN7A 3WB1A 2FB5A 2CUGA 3L9DA 3A8TA 2A79B 2LO1A 3N27A 1N34B 4FLZA 5BR8O 3SPGA 4UCRA 1QLEC 5KA6A 5LOVA 4LCUC 3SYAA 4B3MO 3TCUA 1YCIA 1FXKB 5LMNO 4X1IA 4H37A 4X1YA 1HW7A 1YZBA 4RO2A 1VQ8V 4J80A 1H2GA 4JASA 4UCTA 3RBZA 4F6RB 2CAZC 1SETA 1NQTA 4GKJB 1DF5A 2ZE5A 2UXXA 2FMLA 3DC6A 3WB0A 3E8FA 5L3FA 2F4VO 2V7QG 4DV2O 3B09A 1V9PA 4TV8A 3ASOB 2EBOA 3U0ZA 4B08A 1S0VA 2ILMA 1GM9A 5JCOA 4YJ3A 1FFXA 3KZIZ 3W7TA 3UO3A 1GO3F 3UT5B 3MHSC 1RFYA 4P9OA 1Z2GA 3BEHA 1WB8A 1FAFA 3LDEA 3CD6V 1ZL8B 3K5MA 4DYLA 3JAWB 4O4JA 4JPRA 4EFBA 2Z3YA 1EZJA 3IFXA 1TA8A 4I0XB 2EIKC 1Z5VA 2NR5A 4GLXA 4O2BB 3BCCH 1IDSA 4AHCA 4O4IA 1VF6C 2GUZB 5IYCO 2HFEC 1TGOA 1XMOO 3QG5A 3T2MA 3TGUH 5B66Z 2OTJV 1I0HA 3SYQA 4H13B 2AW9A 1VQ9V 4LF5O 4NXMO 1GAXA 2JJ2G 3KDRA 2Y4TA 1N8RW 3CC7V 2JEUA 3ETGA 2OCCB 3JD3A 3ZMZA 4Z2WA 4FLUA 3E8HA 4BAYA 5IE9A 4DV3B 1OCZB 3TK1A 3ZCCA 3GWOA 3D36A 5IDJA 1I5XA 1NJIW 3CCVV 2DN9A 5LXTA 1YJWV 4FZ0A 2B1IA 2HHHB 2IBZH 5KUMA 4I50B 1B6QA 1E79G 1M57B 1Y66A 5B1BB 3CMAV 3IC9A 4NXNO 2QTOA 4DV4O 1AR1B 1PM9A 1QQCA 4JI5B 4WBNB 1IBKB 4X20B 4IHJA 4YHHB 1WNSA 1FXKC 1M4UA 5LGNA 1K8AW 2ZXWC 1BL8A 2AGAA 2F1MA 2YEVA 5K1XA 5LP6B 1VIBA 2UUBO 3FKSG 4PA9A 2XOKG 3KCXA 3M99B 3OT7A 1G6UA 1O9HA 4WFEA 1KQSU 3HR0A 1IJGA 2YI8A 1XI1A 4I9WA 2XAJA 1WP8A 2EILC 3ZJZA 3K5NA 1HNWB 1JR9A 3OTOO 3N2GA 2LW1A 4CZZA 3ZEDA 4UFZA 3CCRV 3D3IA 3TJTA 4FM2A 4MW8A 5C93A 2CGOA 3DTUB 4D7TA 2UXDO 3HKCA 3RYFB 1NKDA 5LA6A 1DTOA 4AQYB 3CCQV 1PKXA 1WJZA 2OWOA 4JI8B 4CC5A 4JI3B 2XTAA 1I08A 4PHZA 3EHBB 3ETDA 1YTFB 1OJHA 3B8NA 2VQEB 1YIJV 4O2AB 1FXVA 1O9GA 5EBLC 2OIEA 4FJCC 1RSOA 4ZOLA 3HKDA 4R7CA 1I94O 4WFHA 3JATA 3L74H 3MAQA 2X6AA 4TUYB 1UFIA 3D3QA 3IJ4A 2UXBO 1R3JC 2K9PA 3N2KB 4B3MB 2Q6AA 4R6ZA 1NT2B 4CS3A 4YIOA 1I7FA 3ZMUA 1Y74A 2PF4E 2UUAB 3BFRA 2PUSA 4O4HA 3NR7A 1SC5B 2LFSA 3UO2A 1AI4A 2OCCC 2XAQA 4YY3O 5ITZB 2F66C 5F2VO 3OM3B 4KUMA 1S77D 2JGDB 2P90A 5B3SC 4XDLA 5B1OA 4LWSB 3B40A 1OCRB 2BTOA 2RN9A 3FX7A 3OEEG 1Q6HA 3O65A 2DW4A 3BRCA 1JFFB 4QNHB 3AG4B 2GTAA 5CB4A 4JYYA 4X1KB 3IGAC 1M57C 2CTWA 4DRXA 1IXMA 5JQGA 4L87A 3AK1A 1AJQA 3OGIB 2Q7GA 3CCUV 1FJGO 3SDLA 5EYPB 3ZRXA 4GX2A 1LR1A 1K3EA 3AK2A 1R1BA 2DQ0A 5B1AB 2Y4UA 3E22B 4GUNA 5LP6C 2E74B 3SGIA 1CXZB 3LNMB 3OMAB 4JYAB 2WLJA 3S3WA 3ABTA 4FFKA 4EB6A 1VMGA 1N0NA 2ZDIC 1VQLV 1M56C 4JAAA 1LUWA 5IYDO 4MW3A 4LFAB 4YJ2B 4LF5B 2FL4A 2ZE8A 3CRMA 2WLLB 5L3BA 5LYJB 3L75H 1N34O 1ZTEA 3KG2A 3O9OA 1K97A 1VF5B 2YIDA 5LL6Y 2CH7B 4N23A 3CWBH 3FAVA 1R3KC 3ZHQA 2W0FC 4PDRA 3SJAC 1HP8A 3LSQA 1Y76B 1VP7A 2HP8A 4GX5A 1KYOF 4UVCA 5FPOA 1RM1C 3JD1A 2PZSA 4NKGB 3SYCA 3JARA 2Q7EA 4GKJO 3TETA 2GDSA 2P22C 5KHGA 3B4SA 2YXLA 1SKVA 5IJ9B 4LF6B 2F95B 5GONB 2R70A 3K0GA 5FNVB 4DV7O 4IT5A 4I55B 2X6CA 1DF4A 2LGWA 1BCCH 3ABUA 3P30A 1HR0O 1PNKA 5JH7B 3C3SA 2A3QA 4J7KA 2GV9A 3KCYA 2GSMB 2DYRB 1US6A 1WA8B 1KKCA 3ABLC 4B3RB 3ABMB 5CA1B 5HFLA 3AG4C 3CSXA 1NVPD 2E76B 5KHKA 5D5PA 2BE3A 2R9AA 2Z5UA 2LFRA 1VEWA 4EFEA 2F43G 1PPJH 1H2KA 3J80N 2ATKC 4HNAB 3DXRB 1QLEB 1K92A 5IYZB 5KUKA 5LGTA 4CH4A 2Y48A 3WG7C 1V54C 3OMNB 3PJSK 3F7YC 4ZI7B 1AI6A 4WCEV 3G67A 3I55V 1IXBA 4LNUA 2CE4A 2DWDC 3RYHB 1MZFA 3D36C 3I56V 2Q69A 4DV3O 2QWOB 4TSFG 3B2EE 1SZXA 1GMGA 1J95A 2ZE6A 4JI1B 1XDCA 2KSDA 4ZHQB 2Q4PA 2BTQB 1SA0A 4TV9A 2HHHO 3I5DA 2F93B 1XHZA 4IIJB 4MT8A 4JI5O 1COWG 4FIPC 1IBKO 4J9YB 4QGPA 2IU3A 4YHHO 1Q6IA 5D5QA 4G27B 2XNDG 1XMQB 1XNQB 1E1QG 3QVNA 2B5UA 2YUAA 2Q5ZA 1WP7A 2A7WA 2VS0A 3VQXA 4NVPA 1JJ2U 4TQFA 2EIKB 1EN5A 4WFGA 1FKAO 4OX9B 5J2TA 5IJ0A 3LDDA 1BT8A 1F4MA 1HNWO 3JYCA 3ETEA 1N4CA 4I9QA 1E1RG 2QM8A 1FOUA 4X64B 4JI0B 3OR7C 1K9MW 4FLVA 3F5WC 2EINC 2PI4A 3A0RA 2BSKB 4WFBV 4X62B 4B7EA 4F4LA 2UXNA 1NU1H 2AHZA 1VQ7V 3SYPA 4X9QA 2B1GA 3ZN0A 3SJQC 4AQYO 1Q82W 2AZ0A 4JI8O 4JI3O 2F23A 1RP3B 1R6KA 5J9PC 2NNUA 4UCVA 2KG7A 4DUZB 3HKEB 1BE3H 3CRRA 1QVGU 4EKWA 3ABMC 1L1FA 3CX5F 3WFVA 5KHJA 4JGSA 2VQEO 1XREA 3VBBA 3FB7C 3K08A 3G71V 4DR2B 4UV9A 3HKBB 1PV0A 2OYQA 3MHHC 4RQFA 1SQQH 1YSCA 2PGGA 1AROP 3JASA 4K8ZA 3MD0A 3E89A 3JAMN 2ZXWB 1MG1A 2UUAO 3ZHVA 4CS2A 1L0NH 4X66B 5EIBC 3K9SA 5B5EZ 1IVSA 1JX9A 3RYFA 5GTIZ 2UU9B 2WLIB 1SZTA 1QNMA 3CEIA 3T1YB 3AG1B 3UCSC 1TVKA 1KD1W 2EILB 4DV6O 4TWKA 2Q8VA 5A9GA 5BMVB 2ITCC 3G80A 1IX9A 3FB5C 4LH6A 3T1HB 1D5NA 1GTOA 2DWEC 1AR4A 4JI4B 3M8AA 4DV7B 3JD4A 1YJNV 4GKKO 1I5YA 3QNEA 1B3QA 4JAUA 4TUYA 1HR0B 2KB1A 1IBLB 3HPLC 3K3WA 4DR5B 4J10A 2JGUA 2QM7A 2EIJC 1N36O 3RYCA 5KMGA 4O4LB 4JYAO 3ZN1A 4ZIBA 1Q7YW 3TXQA 1YVWA 3K03A 5L3DA 1NH2D 1SQGA 2JIZG 2IH3C 1XEQA 2RDCA 1EBOA 4F6EA 2JGDA 2KKWA 5LMUB 4K35A 4NTYA 4QIWF 4LFAO 5IT9N 3OAAG 2CTQA 1R3IC 1HNXB 1N32O 5H6RA 1EZVH 1SF9A 4PA3A 5JJJB 4X88A 1KP3A 4HYOA 1Q6UA 5CA3A 2H94A 5CA0A 3DSQA 5JJEB 5B3SB 3RW0A 1YJ9V 3Q4HB 2UXCB 4Q20A 4DV5B 2GHYA 3JCUZ 2QWRB 2HJFC 3FYEB 4FFBB 1T5EA 3THOA 4QPKA 2Q7HA 2NLJC 4MTFA 3JAKB 1FD9A 2PI5A 2B9ZA 2IJJA 2RNBA 2P7TC 3SPHA 4YIPA 1W0JG 3AG3B 1UPGA 4OGQB 3W7SA 1JMKC 3CYOA 4LF6O 4UCOA 2ZR2A 4GCZA 4L8JA 4PI2A 2PYLA 1SRYA 4JYCA 3OUFA 1B06A 1H5WA 2HJDA 5LYJA 4LBEC 1NR1A 1DGSA 2N05A 3SJCC 3JSLA 1R3LC 1DK1A 3AG1C 1EFRG 2PYJA 2QGNA 1M56B 2H8PC 3X2QB 4B3RO 1YEWA 4PD4F 4X65B 3A2FA 2ZE7A 5IY5C 4LF9B 4DR1B 1YXBA 4JV5B 1PNLA 5KX5A 3BVOA 4UB6Z 1X59A 1JQ0A 2YXYA 2IJKA 1KU9A 5LOVB 1XBLA 1EM1A 4DO2A 2JJ1G 4X1IB 4GZRB 4X1YB
chains in the Genus database with same CATH topology
1ZUQA 2ADPA 1XREA 1Y67A 1ZSPA 1XUQA 3DC5A 1EN4A 4YIOA 1JA8A 1MNGA 1SZXA 3BFRA 1XDCA 4BR6A 5AG2A 3EVKA 4JZGA 1AVMA 3DC6A 3IC9A 1MMMA 1PM9A 2RCVA 1PL4A 2QKAA 3KKYA 4C7UA 2GDSA 3K9SA 1GN2A 1LUVA 1QNMA 3CEIA 3OT7A 1ZLZA 4YIPA 4JYYA 1XILA 3QVNA 1WB8A 4JZ2A 5A9GA 3AK1A 1GN3A 1JR9A 1IX9A 3AK3A 2P4KA 1D5NA 1EN5A 3C3SA 3TJTA 3AK2A 1B06A 1AR4A 1VARA 1BT8A 1KKCA 1IDSA 4GUNA 3C3TA 1BS3A 1N0JA 1MA1A 4E4EA 4FFKA 1AP6A 1I0HA 1N0NA 3LSUA 2AW9A 2CDYA 2QKCA 3KDRA 3RN4A 1VEWA 1I08A 4X9QA 1EN6A 1LUWA 1AR5A 1GN4A 1AP5A 2ADQB 3MDSA 1MSDA 4F6EA 1P7GA 1GN6A 1WB7A 1ZTEA 1EM1A 1BSMA 1IXBA 2CE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUQ A;  2ADP A;  1XRE A;  1Y67 A;  1ZSP A;  1XUQ A;  3DC5 A;  1EN4 A;  4YIO A;  1JA8 A;  1MNG A;  1SZX A;  3BFR A;  1XDC A;  4BR6 A;  5AG2 A;  3EVK A;  4JZG A;  1AVM A;  3DC6 A;  3IC9 A;  1MMM A;  1PM9 A;  2RCV A;  1PL4 A;  2QKA A;  3KKY A;  4C7U A;  2GDS A;  3K9S A;  1GN2 A;  1LUV A;  1QNM A;  3CEI A;  3OT7 A;  1ZLZ A;  4YIP A;  4JYY A;  1XIL A;  3QVN A;  1WB8 A;  4JZ2 A;  5A9G A;  3AK1 A;  1GN3 A;  1JR9 A;  1IX9 A;  3AK3 A;  2P4K A;  1D5N A;  1EN5 A;  3C3S A;  3TJT A;  3AK2 A;  1B06 A;  1AR4 A;  1VAR A;  1BT8 A;  1KKC A;  1IDS A;  4GUN A;  3C3T A;  1BS3 A;  1N0J A;  1MA1 A;  4E4E A;  4FFK A;  1AP6 A;  1I0H A;  1N0N A;  3LSU A;  2AW9 A;  2CDY A;  2QKC A;  3RN4 A;  1VEW A;  1I08 A;  4X9Q A;  1EN6 A;  1LUW A;  1AR5 A;  1GN4 A;  1AP5 A;  2ADQ B;  3MDS A;  1MSD A;  4F6E A;  1P7G A;  1GN6 A;  1WB7 A;  1ZTE A;  1EM1 A;  1BSM A;  1IXB A;  2CE4 A; 
#chains in the Genus database with same CATH topology
 1VQO V;  3DC5 A;  3K79 A;  1NI8 A;  3ABK B;  1U97 A;  1V55 B;  1MSW D;  2HR3 A;  1RM1 B;  4MVQ A;  1ZX3 A;  4LF4 B;  1AJP A;  1JJO A;  4C7U A;  1DLB A;  3SPI A;  4TV8 B;  3ZMS A;  2E5L B;  4JI1 O;  1QU7 A;  2OCH A;  4MTG A;  4P9P A;  3H1L H;  4PV1 B;  3CE2 A;  5J2U B;  2AZ2 A;  2PY5 A;  1A32 A;  2IJI A;  1ZLZ A;  4TOI A;  4DR4 B;  5KHH A;  1Y4M A;  4GX0 A;  4WF9 V;  5L3C A;  3DXR A;  4O4J B;  1XMQ O;  3OW2 U;  1XNQ O;  1D5A A;  4DV6 B;  3FD9 A;  1QVF U;  3ABL B;  3U10 A;  4U7N A;  2HKO A;  2ITD C;  4BW5 A;  2JRI A;  2JK5 C;  5B1N A;  1NS1 A;  4JAV A;  5C8Y A;  2QWP B;  1GKF A;  4E4E A;  4O4I B;  4PA6 A;  3A0B Z;  3BAA A;  4OX9 O;  3AG3 C;  2LP7 A;  3OEH G;  2P06 A;  2A06 H;  4GKK B;  3A0H Z;  3W7X A;  2QKC A;  3CB2 A;  3UQ8 A;  3CC2 V;  4JI0 O;  4X64 O;  5LHG A;  3EXA A;  1OCO B;  3WG7 B;  1V54 B;  4BIO A;  4BW9 A;  4FLX A;  4X62 O;  2ZKO A;  4KL1 A;  4B3T B;  2VQF O;  3K9A A;  1N36 B;  5FL7 G;  1BSM A;  3CCS V;  3CPW U;  1NR7 A;  1ZSP A;  1BQ0 A;  2HLD G;  1XUQ A;  4DUZ O;  2QR4 A;  4ZBM A;  5LXT B;  5EZY A;  3X2Q C;  4I4T A;  1OCC C;  2YIC A;  1N32 B;  4CC6 A;  3P32 A;  2P67 A;  2WPD G;  1VF7 A;  2FYU H;  3G6E V;  4DR2 O;  3W7W A;  1S5J A;  4P2Z A;  4IHJ B;  3K06 A;  4H33 A;  1VF6 A;  2Q67 A;  1GM8 A;  3J7A U;  4KHP B;  1PL0 A;  2CK3 G;  2LQT A;  4Q6G A;  2LGQ A;  2YEV B;  4LFC B;  5JVD A;  3ABK C;  2P5O A;  4X66 O;  1V55 C;  2ZNI A;  1HWY A;  1M1K W;  4FLY A;  5DED A;  2UU9 O;  4MVS A;  3T1Y O;  4LH7 A;  4ZKI A;  4FMT A;  4AIL C;  5BXZ A;  3N2G B;  4U3J A;  4MVM A;  3ZMV A;  3UM7 A;  1VAR A;  5BZB A;  3P3P A;  1QCE A;  5JCO C;  4HBN A;  2EIN B;  4MVO A;  4PA4 A;  3RWR D;  2FKX A;  2DJV A;  4WFA V;  4XDK A;  3T1H O;  3HKC B;  1AI5 A;  5LA6 B;  2ZQM A;  1K73 W;  1Q81 W;  5CBG A;  4JI4 O;  1KEC A;  2YC0 A;  2K1E A;  4LF7 B;  4K3A A;  1IBL O;  4DW0 A;  1R6N A;  1K34 A;  4DR5 O;  1GN4 A;  4U3F H;  1ZWI C;  1CP9 A;  1MSD A;  1FXK A;  5H9C A;  4EEQ A;  1WB7 A;  1SQV H;  4DV0 B;  3APO A;  4D7S A;  3UKM A;  4ZOL B;  3HKD B;  3JAT B;  4F6R A;  3OGC C;  1PNM A;  5LMU O;  1NTM H;  1K5S A;  4DR3 B;  1HNX O;  1OCO C;  3E86 A;  3EVK A;  3JSN A;  1YTF D;  3RGB A;  1MMM A;  1Y74 B;  4O4H B;  4DW1 A;  2A0L A;  2Y0I A;  4JI6 O;  5GW7 A;  1SES A;  4IGG A;  1ROP A;  4LR3 A;  3UT5 A;  1AI7 A;  2FTK A;  2UXC O;  1Q5O A;  1URF A;  5DEC A;  4NB5 A;  4RQE A;  1LUV A;  4DV5 O;  4MTX A;  1M90 W;  1KC8 W;  2QDO A;  2XAF A;  4I5S A;  1ZL8 A;  3JAW A;  5CB4 B;  2EIM C;  3AG7 A;  3GWK C;  2JS3 A;  4DRX B;  1VQ5 V;  5FLX N;  5JQG B;  4I0X A;  4CH5 A;  1TUB B;  4J11 A;  3K59 A;  3STL C;  3QF7 A;  4O2B A;  4W4K A;  4QE9 A;  5K1P A;  1RPO A;  2GUZ A;  3CS5 A;  1P49 A;  3K5O A;  2EX3 A;  4W4L A;  1N0J A;  1P84 F;  4D6T H;  1U96 A;  1Q86 W;  1AIL A;  4TQD A;  2Q68 A;  2ZIO A;  2EIJ B;  1BZK A;  4BIZ A;  2MW2 B;  2WAM A;  1UJW B;  2MK3 A;  1EN6 A;  3FB6 C;  1AR5 A;  3TXS A;  1AP5 A;  2QWN B;  2QA4 V;  1VQ4 V;  1TUE B;  4X65 O;  3CJH B;  4QE7 A;  5GTH Z;  4LF9 O;  4DR1 O;  4JV5 O;  3VQY A;  3R65 A;  1J5E B;  1ZUQ A;  3F5T A;  4QPJ A;  2ADP A;  1Y67 A;  1IUR A;  2VQF B;  4I50 A;  3CRC A;  1S5H C;  3ML0 A;  1JA8 A;  1M5I A;  5CBF A;  3ETQ A;  3EFF K;  1L0L H;  3B77 A;  4KP4 A;  4WBN A;  3RVY A;  4X20 A;  1PP9 H;  4AI8 A;  3BA8 A;  2CGN A;  1PD3 A;  1M93 A;  5JWP A;  2EZP A;  3JD2 A;  3W7U A;  2ZIM A;  2VWJ A;  2HVJ C;  5EK0 A;  2HG5 C;  2L6L A;  3JAR B;  1GRJ A;  3C90 A;  5LP6 A;  4LF4 O;  4RUE A;  1BMF G;  2BOB C;  1F4N A;  2HVK C;  1ZAU A;  3K58 A;  2E5L O;  2ZDI A;  1IZ3 A;  1K4D C;  2LJ2 A;  5LHI A;  4DR6 B;  1WAZ A;  2ETN A;  3CCL V;  2ZCE A;  4CS4 A;  3ZRW B;  2R9I A;  2ZT9 B;  4BWA A;  4RWU A;  1SQF A;  4DR4 O;  2DMX A;  3K0D A;  4Z1M G;  2JDI G;  4K0K B;  1H2N A;  1SQP H;  3AG2 C;  1VQK V;  5FPR A;  1BS3 A;  5CN0 A;  5IWA B;  4CH6 A;  3P3N A;  3K57 A;  3H01 A;  3ZBH A;  5IY5 B;  1NTZ H;  4Z1V A;  2DQ3 A;  5IYB O;  2N04 A;  1WLE A;  4HZ3 A;  4B3S B;  2WA4 A;  4O2A A;  2XAH A;  3QO5 A;  5H6Q A;  3BPZ A;  1KUQ A;  3K5L A;  4IYH A;  1XHX A;  2JVD A;  4PDV A;  2DE0 X;  3CRQ A;  2YDE A;  3N2K A;  1THZ A;  5L3E A;  4LNU B;  4B3T O;  1W0K G;  1F51 A;  1Q8I A;  4FLW A;  5J2U A;  1HDJ A;  4UUJ C;  3PN1 A;  3GB7 C;  4IL6 Z;  2YXH A;  1QBZ A;  3FYI B;  3T4Z A;  4BR6 A;  2XAG A;  4JZG A;  1K33 A;  4H0L B;  5ITZ A;  1Q90 D;  4G2K A;  2RCV A;  4LF8 B;  3G4S V;  1JOY A;  4ASU G;  2VRZ A;  2ZNJ A;  1TAE A;  1SA0 B;  4TV9 B;  1N33 O;  2Q0O C;  4LWS A;  2UUC O;  4LFB B;  3G6B A;  1QHT A;  1H2L A;  4X89 A;  3ASN C;  1R6T A;  5EIB D;  1XNR B;  1JFF A;  3QO7 A;  3QO8 A;  1G8M A;  4X1K A;  4JI6 B;  1XIL A;  2X7R B;  1H2M A;  4KHP O;  4MTO A;  5EYP A;  1BGY H;  4MVZ A;  1YI2 V;  1GN3 A;  4LFC O;  2EJ7 A;  3RYI B;  2IW5 A;  1GK9 A;  1HNZ B;  3E22 A;  1XQ8 A;  1QR8 A;  2W6J G;  4J42 A;  3GVM A;  4UCS A;  3JAL B;  4J7Z A;  5J2T B;  4GX1 A;  5IJ0 B;  3SYO A;  4R8C A;  4DK1 A;  5E1A C;  4NYK A;  4LC1 A;  3LSU A;  2QJ1 A;  1K7D A;  2QE7 G;  1MZE A;  1ORQ C;  1GM7 A;  4YJ2 A;  2YIA A;  2WLH A;  2WLL A;  3OE7 G;  3HB3 B;  2ZM6 O;  3NXS A;  4LF7 O;  4UB8 Z;  2CH7 A;  2KG7 B;  2Z0A A;  2V4D A;  2JEX A;  1Y76 A;  3J81 N;  4HAM A;  4GT1 A;  1OCC B;  1P7B A;  3L72 H;  4DV0 O;  2IU0 A;  5EBW C;  2QSA A;  3CXH F;  4ABM A;  1IBM O;  3CRA A;  2H3O A;  1YHQ V;  4E2L A;  1P4R A;  2R9R B;  3E8G A;  4QJF B;  3DGE A;  1PL4 A;  3M7M X;  5E79 Z;  4DV1 B;  1FYJ A;  3JAS B;  3ASO C;  1H8E G;  4DR3 O;  2WA3 A;  5LGU A;  3CP1 A;  5IJ9 A;  1VQP V;  5GON A;  1LNQ A;  1KBH A;  1NVP B;  5FNV A;  1B04 A;  2IH1 C;  5BY1 A;  2CTP A;  4J9Z B;  2AXT Z;  4I55 A;  4DR7 B;  1TVK B;  4PA7 A;  4FVM A;  3RFR A;  2WWW A;  5JH7 A;  2IJH A;  1H2S B;  2Y69 B;  4JI7 B;  2A9H A;  1WA8 A;  1RPR A;  4YJ3 B;  2E3C A;  5CA1 A;  3L73 H;  1FFX B;  1YIT V;  4JTC B;  2XHB A;  5BR8 B;  4FZ1 A;  1SS3 A;  2D3O W;  2LW7 A;  4FPP A;  2YIB D;  2WLK A;  3U11 A;  2P4V A;  4HNA A;  4LP8 A;  3BHP A;  2P6J A;  5IYZ A;  4JI2 O;  3BY6 A;  5LMN B;  2E75 B;  2XT9 A;  3ZRV A;  3RYC B;  4MVU A;  5KMG B;  4UXN A;  1F7Y A;  2M7W A;  1MOF A;  1W59 A;  2RQ6 A;  4K8X A;  4ZI7 A;  4P30 A;  4U7O A;  1P7G A;  4PDL A;  3L71 H;  1FFT B;  2OTL V;  4R50 A;  3LUT B;  1OCZ C;  2ZIN A;  1QR9 A;  3RYH A;  4PI0 A;  2F4V B;  4PJ0 Z;  5EBM C;  3CCJ V;  4DV2 B;  1FS0 G;  1CEZ A;  4CH3 A;  1WPB A;  3FB8 C;  2BOC C;  1K5Q A;  4ZHQ A;  3IC7 A;  1CPY A;  1Q3E A;  3SR2 C;  1OZ0 A;  2BTQ A;  2HEP A;  4NTW A;  1J5E O;  2Q9L A;  2NN4 A;  1VQN V;  5B1B C;  2GTS A;  1QLN A;  4A5U B;  5A2Q N;  4NR1 A;  4IIJ A;  2BCC H;  3R66 A;  5CA0 B;  3ZIA G;  1FXH A;  1TUB A;  3ZS8 C;  4DXW A;  3OD4 A;  1K4C C;  2EZO A;  4DK0 A;  5CBH A;  1JVM A;  4OXS A;  3ZRS A;  4I7Z B;  1N33 B;  2UUC B;  3ZHU A;  2N74 A;  2EIM B;  1XL4 A;  2RMK B;  2YS8 A;  4DUY O;  1S3J A;  4JZ2 A;  3OR6 C;  3H1H H;  3LDC A;  4FK5 C;  4ICG A;  4KXR A;  3ZMT A;  3AK3 A;  2W6I G;  4XBF A;  1G1X B;  3JCZ A;  3E35 A;  1XMO B;  1JPX A;  1NTK H;  4DR6 O;  3CXC U;  3K04 A;  3BAB A;  5EC2 C;  1SER A;  3E83 A;  3ZX6 A;  4YXW G;  4NXM B;  3SPC A;  3CJH A;  2BSK A;  5KHI A;  3T1C A;  1F23 A;  4FM1 A;  2M6Y A;  4B7K A;  1AP6 A;  3FFQ A;  4K0K O;  5L3G A;  1OHH G;  2JS5 A;  3RN4 A;  5IWA O;  1AJN A;  3LSS A;  2Y69 C;  3BA9 A;  2YI9 A;  1S76 D;  2ADQ B;  3HKE A;  2RJZ A;  5KX5 B;  2V1D A;  2EJR A;  4OPH A;  3CC4 V;  4B3S O;  4NXN B;  5JJN B;  4DV4 B;  3STZ C;  2ZM6 B;  3VOU A;  3HKB A;  4UVA A;  2CTR A;  4WFF A;  1S5L Z;  1EN4 A;  1JNB A;  1MNG A;  2QEX V;  3WU2 Z;  5AG2 A;  5CMU A;  2X6B A;  4RUF A;  4UV8 A;  3ZRW A;  4MVR A;  2QKA A;  1KMI Z;  1ENV A;  3RVZ A;  3LNN A;  3D8C A;  5KLV H;  2UUB B;  2Q73 A;  5EC1 C;  5H5N A;  4FM0 A;  1BHB A;  4X8A A;  1IBM B;  1RSO B;  3OTF A;  1S72 V;  3ZHT A;  2D2C B;  2WLI A;  1KB9 F;  1Z5W A;  4LF8 O;  2QWQ B;  1W2B U;  1OCR C;  2DOS A;  2ZR3 A;  3OTO B;  2DYS B;  2YIB A;  4LFB O;  2YSU B;  1H38 A;  1AB3 A;  3H9V A;  5BMV A;  1MAB G;  2OIG A;  3SPJ A;  1XNR O;  2VWK A;  4MSW C;  4OPA A;  2ODM A;  2O57 A;  3ZHS A;  3QTC A;  4XDJ A;  5HFM A;  2UXD B;  1GH6 A;  2PTM A;  4MS2 A;  4UCU A;  4TT3 G;  1NH2 B;  2XAS A;  4UVB A;  3AG2 B;  2IM9 A;  2QM4 A;  4H44 B;  2Y0P A;  3JD0 A;  3RT3 C;  5KA5 A;  3L70 H;  2XUM A;  5B1A C;  4PDM A;  3H1I H;  3C3T A;  5H2F Z;  1MA1 A;  3ICX A;  4N21 A;  3F7V C;  1HNZ O;  5C8Y B;  1VQM V;  2KQX A;  2CDY A;  4O4L A;  4JF3 A;  3E8B A;  3WB2 A;  3S3X A;  4NTX A;  1G4Y B;  2W0X A;  1I94 B;  1H8H G;  3OUS A;  1JCH A;  3MDS A;  4CBC A;  2UXB B;  5TIS Z;  1GN6 A;  4JI2 B;  1YDX A;  1R73 A;  2WLM A;  5KAI Z;  1KKD A;  5LBQ A;  4EB6 B;  1BHA A;  1Q43 A;  4GYC B;  1NZ6 A;  1XL6 A;  4YY3 B;  2WLN A;  4IYI A;  2WSS G;  1WPX A;  1VQ6 V;  5EZY B;  4G28 B;  1AVM A;  4I4T B;  4JYB A;  3Q4H A;  3CCM V;  1M9N A;  1KP2 A;  4J7J A;  3KKY A;  3VQV A;  3APQ A;  4FLT A;  1Y6X A;  3RYI A;  2EUL A;  2G38 A;  3ASN B;  2C2A A;  4FFB A;  1FPO A;  3E2E A;  3IAY A;  3CCE V;  1GN2 A;  3JAL A;  3FAV B;  4PEL A;  4KFM A;  3JAK A;  4DV1 O;  3OMI B;  1SQB H;  1L8D A;  1X4T A;  5KAF Z;  1FJG B;  2AHY A;  3H1J H;  4JTD B;  2ZD9 A;  3OFN G;  3VQW A;  3CME V;  2L35 A;  5DN6 G;  1XOU A;  5JVD B;  2X0L A;  4BIU A;  2OT5 A;  3B8M A;  5LHH A;  2GBO A;  3SJB C;  2ARH A;  3ZHR A;  1NBM G;  5DM6 V;  1D2D A;  1SQX H;  3AEI A;  2P4K A;  2Q0A A;  1OV9 A;  4JTA B;  4DUY B;  4RAI A;  4DR7 O;  3H1K H;  2R72 A;  4U3J B;  1BQZ A;  1YF2 A;  3CHX A;  2QTS A;  2QKS A;  3T4D A;  2DYR C;  4J41 A;  4JI7 O;  2DYS C;  1WN7 A;  3WB1 A;  2FB5 A;  2CUG A;  3L9D A;  3A8T A;  2A79 B;  2LO1 A;  3N27 A;  1N34 B;  4FLZ A;  5BR8 O;  3SPG A;  4UCR A;  1QLE C;  5KA6 A;  5LOV A;  4LCU C;  3SYA A;  4B3M O;  3TCU A;  1YCI A;  1FXK B;  5LMN O;  4X1I A;  4H37 A;  4X1Y A;  1HW7 A;  1YZB A;  4RO2 A;  1VQ8 V;  4J80 A;  1H2G A;  4JAS A;  4UCT A;  3RBZ A;  4F6R B;  2CAZ C;  1SET A;  1NQT A;  4GKJ B;  1DF5 A;  2ZE5 A;  2UXX A;  2FML A;  3DC6 A;  3WB0 A;  3E8F A;  5L3F A;  2F4V O;  2V7Q G;  4DV2 O;  3B09 A;  1V9P A;  4TV8 A;  3ASO B;  2EBO A;  3U0Z A;  4B08 A;  1S0V A;  2ILM A;  1GM9 A;  5JCO A;  4YJ3 A;  1FFX A;  3KZI Z;  3W7T A;  3UO3 A;  1GO3 F;  3UT5 B;  3MHS C;  1RFY A;  4P9O A;  1Z2G A;  3BEH A;  1WB8 A;  1FAF A;  3LDE A;  3CD6 V;  1ZL8 B;  3K5M A;  4DYL A;  3JAW B;  4O4J A;  4JPR A;  4EFB A;  2Z3Y A;  1EZJ A;  3IFX A;  1TA8 A;  4I0X B;  2EIK C;  1Z5V A;  2NR5 A;  4GLX A;  4O2B B;  3BCC H;  1IDS A;  4AHC A;  4O4I A;  1VF6 C;  2GUZ B;  5IYC O;  2HFE C;  1TGO A;  1XMO O;  3QG5 A;  3T2M A;  3TGU H;  5B66 Z;  2OTJ V;  1I0H A;  3SYQ A;  4H13 B;  2AW9 A;  1VQ9 V;  4LF5 O;  4NXM O;  1GAX A;  2JJ2 G;  3KDR A;  2Y4T A;  1N8R W;  3CC7 V;  2JEU A;  3ETG A;  2OCC B;  3JD3 A;  3ZMZ A;  4Z2W A;  4FLU A;  3E8H A;  4BAY A;  5IE9 A;  4DV3 B;  1OCZ B;  3TK1 A;  3ZCC A;  3GWO A;  3D36 A;  5IDJ A;  1I5X A;  1NJI W;  3CCV V;  2DN9 A;  5LXT A;  1YJW V;  4FZ0 A;  2B1I A;  2HHH B;  2IBZ H;  5KUM A;  4I50 B;  1B6Q A;  1E79 G;  1M57 B;  1Y66 A;  5B1B B;  3CMA V;  3IC9 A;  4NXN O;  2QTO A;  4DV4 O;  1AR1 B;  1PM9 A;  1QQC A;  4JI5 B;  4WBN B;  1IBK B;  4X20 B;  4IHJ A;  4YHH B;  1WNS A;  1FXK C;  1M4U A;  5LGN A;  1K8A W;  2ZXW C;  1BL8 A;  2AGA A;  2F1M A;  2YEV A;  5K1X A;  5LP6 B;  1VIB A;  2UUB O;  3FKS G;  4PA9 A;  2XOK G;  3KCX A;  3M99 B;  3OT7 A;  1G6U A;  1O9H A;  4WFE A;  1KQS U;  3HR0 A;  1IJG A;  2YI8 A;  1XI1 A;  4I9W A;  2XAJ A;  1WP8 A;  2EIL C;  3ZJZ A;  3K5N A;  1HNW B;  1JR9 A;  3OTO O;  3N2G A;  2LW1 A;  4CZZ A;  3ZED A;  4UFZ A;  3CCR V;  3D3I A;  3TJT A;  4FM2 A;  4MW8 A;  5C93 A;  2CGO A;  3DTU B;  4D7T A;  2UXD O;  3HKC A;  3RYF B;  1NKD A;  5LA6 A;  1DTO A;  4AQY B;  3CCQ V;  1PKX A;  1WJZ A;  2OWO A;  4JI8 B;  4CC5 A;  4JI3 B;  2XTA A;  1I08 A;  4PHZ A;  3EHB B;  3ETD A;  1YTF B;  1OJH A;  3B8N A;  2VQE B;  1YIJ V;  4O2A B;  1FXV A;  1O9G A;  5EBL C;  2OIE A;  4FJC C;  1RSO A;  4ZOL A;  3HKD A;  4R7C A;  1I94 O;  4WFH A;  3JAT A;  3L74 H;  3MAQ A;  2X6A A;  4TUY B;  1UFI A;  3D3Q A;  3IJ4 A;  2UXB O;  1R3J C;  2K9P A;  3N2K B;  4B3M B;  2Q6A A;  4R6Z A;  1NT2 B;  4CS3 A;  4YIO A;  1I7F A;  3ZMU A;  1Y74 A;  2PF4 E;  2UUA B;  3BFR A;  2PUS A;  4O4H A;  3NR7 A;  1SC5 B;  2LFS A;  3UO2 A;  1AI4 A;  2OCC C;  2XAQ A;  4YY3 O;  5ITZ B;  2F66 C;  5F2V O;  3OM3 B;  4KUM A;  1S77 D;  2JGD B;  2P90 A;  5B3S C;  4XDL A;  5B1O A;  4LWS B;  3B40 A;  1OCR B;  2BTO A;  2RN9 A;  3FX7 A;  3OEE G;  1Q6H A;  3O65 A;  2DW4 A;  3BRC A;  1JFF B;  4QNH B;  3AG4 B;  2GTA A;  5CB4 A;  4JYY A;  4X1K B;  3IGA C;  1M57 C;  2CTW A;  4DRX A;  1IXM A;  5JQG A;  4L87 A;  3AK1 A;  1AJQ A;  3OGI B;  2Q7G A;  3CCU V;  1FJG O;  3SDL A;  5EYP B;  3ZRX A;  4GX2 A;  1LR1 A;  1K3E A;  3AK2 A;  1R1B A;  2DQ0 A;  5B1A B;  2Y4U A;  3E22 B;  4GUN A;  5LP6 C;  2E74 B;  3SGI A;  1CXZ B;  3LNM B;  3OMA B;  4JYA B;  2WLJ A;  3S3W A;  3ABT A;  4FFK A;  4EB6 A;  1VMG A;  1N0N A;  2ZDI C;  1VQL V;  1M56 C;  4JAA A;  1LUW A;  5IYD O;  4MW3 A;  4LFA B;  4YJ2 B;  4LF5 B;  2FL4 A;  2ZE8 A;  3CRM A;  2WLL B;  5L3B A;  5LYJ B;  3L75 H;  1N34 O;  1ZTE A;  3KG2 A;  3O9O A;  1K97 A;  1VF5 B;  2YID A;  5LL6 Y;  2CH7 B;  4N23 A;  3CWB H;  3FAV A;  1R3K C;  3ZHQ A;  2W0F C;  4PDR A;  3SJA C;  1HP8 A;  3LSQ A;  1Y76 B;  1VP7 A;  2HP8 A;  4GX5 A;  1KYO F;  4UVC A;  5FPO A;  1RM1 C;  3JD1 A;  2PZS A;  4NKG B;  3SYC A;  3JAR A;  2Q7E A;  4GKJ O;  3TET A;  2GDS A;  2P22 C;  5KHG A;  3B4S A;  2YXL A;  1SKV A;  5IJ9 B;  4LF6 B;  2F95 B;  5GON B;  2R70 A;  3K0G A;  5FNV B;  4DV7 O;  4IT5 A;  4I55 B;  2X6C A;  1DF4 A;  2LGW A;  1BCC H;  3ABU A;  3P30 A;  1HR0 O;  1PNK A;  5JH7 B;  3C3S A;  2A3Q A;  4J7K A;  2GV9 A;  3KCY A;  2GSM B;  2DYR B;  1US6 A;  1WA8 B;  1KKC A;  3ABL C;  4B3R B;  3ABM B;  5CA1 B;  5HFL A;  3AG4 C;  3CSX A;  1NVP D;  2E76 B;  5KHK A;  5D5P A;  2BE3 A;  2R9A A;  2Z5U A;  2LFR A;  1VEW A;  4EFE A;  2F43 G;  1PPJ H;  1H2K A;  3J80 N;  2ATK C;  4HNA B;  3DXR B;  1QLE B;  1K92 A;  5IYZ B;  5KUK A;  5LGT A;  4CH4 A;  2Y48 A;  3WG7 C;  1V54 C;  3OMN B;  3PJS K;  3F7Y C;  4ZI7 B;  1AI6 A;  4WCE V;  3G67 A;  3I55 V;  1IXB A;  4LNU A;  2CE4 A;  2DWD C;  3RYH B;  1MZF A;  3D36 C;  3I56 V;  2Q69 A;  4DV3 O;  2QWO B;  4TSF G;  3B2E E;  1SZX A;  1GMG A;  1J95 A;  2ZE6 A;  4JI1 B;  1XDC A;  2KSD A;  4ZHQ B;  2Q4P A;  2BTQ B;  1SA0 A;  4TV9 A;  2HHH O;  3I5D A;  2F93 B;  1XHZ A;  4IIJ B;  4MT8 A;  4JI5 O;  1COW G;  4FIP C;  1IBK O;  4J9Y B;  4QGP A;  2IU3 A;  4YHH O;  1Q6I A;  5D5Q A;  4G27 B;  2XND G;  1XMQ B;  1XNQ B;  1E1Q G;  3QVN A;  2B5U A;  2YUA A;  2Q5Z A;  1WP7 A;  2A7W A;  2VS0 A;  3VQX A;  4NVP A;  1JJ2 U;  4TQF A;  2EIK B;  1EN5 A;  4WFG A;  1FKA O;  4OX9 B;  5J2T A;  5IJ0 A;  3LDD A;  1BT8 A;  1F4M A;  1HNW O;  3JYC A;  3ETE A;  1N4C A;  4I9Q A;  1E1R G;  2QM8 A;  1FOU A;  4X64 B;  4JI0 B;  3OR7 C;  1K9M W;  4FLV A;  3F5W C;  2EIN C;  2PI4 A;  3A0R A;  2BSK B;  4WFB V;  4X62 B;  4B7E A;  4F4L A;  2UXN A;  1NU1 H;  2AHZ A;  1VQ7 V;  3SYP A;  4X9Q A;  2B1G A;  3ZN0 A;  3SJQ C;  4AQY O;  1Q82 W;  2AZ0 A;  4JI8 O;  4JI3 O;  2F23 A;  1RP3 B;  1R6K A;  5J9P C;  2NNU A;  4UCV A;  2KG7 A;  4DUZ B;  3HKE B;  1BE3 H;  3CRR A;  1QVG U;  4EKW A;  3ABM C;  1L1F A;  3CX5 F;  3WFV A;  5KHJ A;  4JGS A;  2VQE O;  1XRE A;  3VBB A;  3FB7 C;  3K08 A;  3G71 V;  4DR2 B;  4UV9 A;  3HKB B;  1PV0 A;  2OYQ A;  3MHH C;  4RQF A;  1SQQ H;  1YSC A;  2PGG A;  1ARO P;  3JAS A;  4K8Z A;  3MD0 A;  3E89 A;  3JAM N;  2ZXW B;  1MG1 A;  2UUA O;  3ZHV A;  4CS2 A;  1L0N H;  4X66 B;  5EIB C;  3K9S A;  5B5E Z;  1IVS A;  1JX9 A;  3RYF A;  5GTI Z;  2UU9 B;  2WLI B;  1SZT A;  1QNM A;  3CEI A;  3T1Y B;  3AG1 B;  3UCS C;  1TVK A;  1KD1 W;  2EIL B;  4DV6 O;  4TWK A;  2Q8V A;  5A9G A;  5BMV B;  2ITC C;  3G80 A;  1IX9 A;  3FB5 C;  4LH6 A;  3T1H B;  1D5N A;  1GTO A;  2DWE C;  1AR4 A;  4JI4 B;  3M8A A;  4DV7 B;  3JD4 A;  1YJN V;  4GKK O;  1I5Y A;  3QNE A;  1B3Q A;  4JAU A;  4TUY A;  1HR0 B;  2KB1 A;  1IBL B;  3HPL C;  3K3W A;  4DR5 B;  4J10 A;  2JGU A;  2QM7 A;  2EIJ C;  1N36 O;  3RYC A;  5KMG A;  4O4L B;  4JYA O;  3ZN1 A;  4ZIB A;  1Q7Y W;  3TXQ A;  1YVW A;  3K03 A;  5L3D A;  1NH2 D;  1SQG A;  2JIZ G;  2IH3 C;  1XEQ A;  2RDC A;  1EBO A;  4F6E A;  2JGD A;  2KKW A;  5LMU B;  4K35 A;  4NTY A;  4QIW F;  4LFA O;  5IT9 N;  3OAA G;  2CTQ A;  1R3I C;  1HNX B;  1N32 O;  5H6R A;  1EZV H;  1SF9 A;  4PA3 A;  5JJJ B;  4X88 A;  1KP3 A;  4HYO A;  1Q6U A;  5CA3 A;  2H94 A;  5CA0 A;  3DSQ A;  5JJE B;  5B3S B;  3RW0 A;  1YJ9 V;  3Q4H B;  2UXC B;  4Q20 A;  4DV5 B;  2GHY A;  3JCU Z;  2QWR B;  2HJF C;  3FYE B;  4FFB B;  1T5E A;  3THO A;  4QPK A;  2Q7H A;  2NLJ C;  4MTF A;  3JAK B;  1FD9 A;  2PI5 A;  2B9Z A;  2IJJ A;  2RNB A;  2P7T C;  3SPH A;  4YIP A;  1W0J G;  3AG3 B;  1UPG A;  4OGQ B;  3W7S A;  1JMK C;  3CYO A;  4LF6 O;  4UCO A;  2ZR2 A;  4GCZ A;  4L8J A;  4PI2 A;  2PYL A;  1SRY A;  4JYC A;  3OUF A;  1B06 A;  1H5W A;  2HJD A;  5LYJ A;  4LBE C;  1NR1 A;  1DGS A;  2N05 A;  3SJC C;  3JSL A;  1R3L C;  1DK1 A;  3AG1 C;  1EFR G;  2PYJ A;  2QGN A;  1M56 B;  2H8P C;  3X2Q B;  4B3R O;  1YEW A;  4PD4 F;  4X65 B;  3A2F A;  2ZE7 A;  5IY5 C;  4LF9 B;  4DR1 B;  1YXB A;  4JV5 B;  1PNL A;  5KX5 A;  3BVO A;  4UB6 Z;  1X59 A;  1JQ0 A;  2YXY A;  2IJK A;  1KU9 A;  5LOV B;  1XBL A;  1EM1 A;  4DO2 A;  2JJ1 G;  4X1I B;  4GZR B;  4X1Y B; 
#chains in the Genus database with same CATH homology
 1ZUQ A;  2ADP A;  1XRE A;  1Y67 A;  1ZSP A;  1XUQ A;  3DC5 A;  1EN4 A;  4YIO A;  1JA8 A;  1MNG A;  1SZX A;  3BFR A;  1XDC A;  4BR6 A;  5AG2 A;  3EVK A;  4JZG A;  1AVM A;  3DC6 A;  3IC9 A;  1MMM A;  1PM9 A;  2RCV A;  1PL4 A;  2QKA A;  3KKY A;  4C7U A;  2GDS A;  3K9S A;  1GN2 A;  1LUV A;  1QNM A;  3CEI A;  3OT7 A;  1ZLZ A;  4YIP A;  4JYY A;  1XIL A;  3QVN A;  1WB8 A;  4JZ2 A;  5A9G A;  3AK1 A;  1GN3 A;  1JR9 A;  1IX9 A;  3AK3 A;  2P4K A;  1D5N A;  1EN5 A;  3C3S A;  3TJT A;  3AK2 A;  1B06 A;  1AR4 A;  1VAR A;  1BT8 A;  1KKC A;  1IDS A;  4GUN A;  3C3T A;  1BS3 A;  1N0J A;  1MA1 A;  4E4E A;  4FFK A;  1AP6 A;  1I0H A;  1N0N A;  3LSU A;  2AW9 A;  2CDY A;  2QKC A;  3KDR A;  3RN4 A;  1VEW A;  1I08 A;  4X9Q A;  1EN6 A;  1LUW A;  1AR5 A;  1GN4 A;  1AP5 A;  2ADQ B;  3MDS A;  1MSD A;  4F6E A;  1P7G A;  1GN6 A;  1WB7 A;  1ZTE A;  1EM1 A;  1BSM A;  1IXB A;  2CE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...