1IX9A

Crystal structure of the e. coli manganase(iii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures at 0.90 A resolution of the oxidised and reduced forms of the Y174F mutant of the manganese superoxide dismutase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Superoxide Dismutase
total genus 80
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ix9A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ix9A02
3K9SA 2ADPA 2GDSA 1I0HA 1SZXA 2CDYA 1AR4A 1ZLZA 1EN6A 3AK1A 1B06A 1PM9A 1XDCA 4F6EA 2QKAA 1MMMA 1AR5A 1MSDA 1WB8A 1AP6A 1BS3A 2P4KA 1D5NA 1XUQA 1JR9A 1GN3A 3RN4A 1XREA 1QNMA 1EM1A 4YIOA 3C3SA 3C3TA 1WB7A 2CE4A 1AVMA 3EVKA 1VARA 1ZTEA 1LUWA 2ADQB 1JA8A 1ZSPA 3CEIA 1ZUQA 4X9QA 3KKYA 3MDSA 4GUNA 1LUVA 1IXBA 1I08A 1N0NA 1VEWA 3LSUA 1AP5A 3OT7A 3IC9A 2QKCA 1N0JA 3DC5A 4JZ2A 3BFRA 1GN6A 4E4EA 1IDSA 1MA1A 3QVNA 1PL4A 3DC6A 4JZGA 3AK2A 4C7UA 1IX9A 1BT8A 3AK3A 5AG2A 1GN2A 1P7GA 4JYYA 5A9GA 1EN5A 1GN4A 1MNGA 1BSMA 2RCVA 4YIPA 1Y67A 2AW9A 1KKCA 4BR6A 1XILA 1EN4A 4FFKA 3TJTA
chains in the Genus database with same CATH superfamily
3T4ZA 4CC6A 4PA6A 2CDYA 3UT5B 4RO2A 3CCQV 1YIJV 4WBNB 5KAFZ 1GKFA 4F6EA 4YHHO 3RYFA 2LFRA 2N04A 3K57A 4MTGA 4IHJA 4J7JA 4X64B 3NR7A 4B3SB 2EIMC 3A8TA 4ZIBA 1G4YB 2R9RB 5LGTA 4FLWA 3K0DA 2F1MA 4PELA 5KHGA 2MK3A 1N32B 3ZJZA 2P06A 3FFQA 1I94B 3FD9A 4LF8B 4JYAB 1PL0A 1ZTEA 5IE9A 4D7SA 3F5WC 4N23A 4X66O 4QIWF 4UB6Z 4XDLA 1Q86W 1OCCC 4DV6O 4JASA 3E8GA 1I08A 2E5LO 3F7VC 4AQYB 1JQ0A 1VF6C 2DYSC 5BMVA 4ASUG 1DGSA 3CSXA 1A32A 5DM6V 1L1FA 3ZMUA 3OFNG 1YJWV 2WLLA 4H33A 1JFFA 3M8AA 1Q82W 3LNMB 4JZGA 4C7UA 1AI4A 5JJEB 1Q43A 4I9WA 2P90A 4G2KA 1AI5A 1TUEB 1MNGA 2W6JG 2RCVA 3JARA 2N74A 2DYRC 4IIJA 4BR6A 3VBBA 2PZSA 3ZRWB 2QA4V 2EZOA 3E8HA 4YXWG 2JEUA 3S3XA 2UUBB 4ZI7A 2KG7A 1YITV 5KA5A 4X1IB 1XMOB 2EIJB 2M7WA 1RP3B 2QKAA 1HNXO 1MMMA 2RJZA 2QM8A 2WAMA 4X88A 1YJ9V 3K9AA 2Y48A 2F95B 4W4KA 3HPLC 1GN3A 4CBCA 1NU1H 4HYOA 1SA0B 4X20A 1WJZA 5IYZA 3W7SA 3ZHTA 5IY5B 3U11A 5LXTB 1HWYA 1XEQA 5ITZB 4P9OA 3HKBA 3ZHUA 4FK5C 3RWRD 2E3CA 5IJ9B 2E74B 3M99B 2VS0A 2JGDA 4JPRA 1VP7A 2QJ1A 2ZE5A 3ML0A 2VWKA 2ZQMA 1MSWD 1ZAUA 3CMAV 5EBWC 1WLEA 2C2AA 1MG1A 4NR1A 1WAZA 2ZNJA 3ZN1A 2ZXWB 3EFFK 2H8PC 4Q6GA 1EFRG 4ZHQA 4UFZA 4GZRB 3DC5A 1V55B 4CH5A 5CA1B 4RUFA 1SKVA 4WFFA 5LL6Y 1IXMA 2UXNA 2KQXA 2BCCH 3ASOC 2Y0IA 5L3EA 1SQPH 1OV9A 4FM2A 1VF6A 1LR1A 3KZIZ 1TA8A 2OT5A 4FIPC 2XHBA 2Q4PA 2RMKB 1Q6IA 3SGIA 1K9MW 1SA0A 5EIBC 2ODMA 1Q90D 4I55A 1WN7A 5HFMA 4ABMA 2EJRA 4O4IB 3ZS8C 4JI5O 1FS0G 2HHHB 1VF5B 2X6AA 3ABKC 4CH3A 2FYUH 2EBOA 1QCEA 4DO2A 1FXVA 2CGNA 3CCUV 4U3FH 3ZMSA 3H01A 1NI8A 3LDEA 2RQ6A 5JCOC 2PTMA 3OW2U 3G71V 3BVOA 4GX2A 4DR1B 3E83A 1K4CC 1QR9A 1XQ8A 4DR6B 3UM7A 3RYIA 1FXHA 4JGSA 3CRCA 3BA8A 4AHCA 1XMOO 1IZ3A 4TV8A 4UCOA 4JYCA 4W4LA 4DK0A 1Q3EA 3LSQA 1K7DA 5L3BA 3GVMA 1T5EA 4X9QA 3MDSA 2HEPA 1OCOC 1LUVA 1JCHA 2EILC 1S0VA 3GB7C 3JALB 1L0NH 3TGUH 4NXMB 2Y69C 1IBKB 3TXQA 1RFYA 1QU7A 2FKXA 5JH7A 5KMGA 4X1YA 3SDLA 2JEXA 2XAJA 4DUYO 2YDEA 5IWAO 1XOUA 4H0LB 4KFMA 5KHHA 2ZCEA 4GKKO 4MVSA 3L75H 4DR6O 3WB0A 1VQPV 3CRAA 1S77D 4O2BB 1BT8A 2ITCC 1Y76A 2X7RB 1I5XA 4I0XA 3AG1B 4JYYA 4TV9A 3PJSK 4OPAA 1W0KG 1KKCA 1J5EO 1FXKC 3K79A 3ZRVA 3WG7C 1EN4A 4TQFA 1KBHA 2AZ2A 3CCMV 3SYOA 2NNUA 3ZMZA 4DV0B 1NVPB 4UCVA 1KMIZ 3OGIB 1AR4A 2HJFC 1B06A 4OPHA 5DEDA 4ZHQB 3OTOO 1MSDA 2IBZH 1VQ9V 2EJ7A 1FXKA 1US6A 2QEXV 4Z1MG 4WF9V 1R3JC 2F93B 4IIJB 2LQTA 3L9DA 3ZHVA 5E79Z 3J81N 1XNQO 4MVQA 3C3TA 3FB8C 2AXTZ 4LFCO 1AR1B 3E35A 2OYQA 1GM8A 1B04A 2BOCC 1K34A 1GM9A 1JOYA 3N2GB 3B4SA 2BSKA 1Y74B 3P3PA 5H6RA 1ZSPA 4MVRA 4KP4A 1ZUQA 1VF7A 3CX5F 2UUAB 3H1HH 5JJNB 4L87A 2YUAA 5J2UA 4GCZA 4CS3A 3BABA 1YTFD 3BCCH 4LF5B 2ZT9B 5IYZB 4DV7O 3RGBA 4MVMA 2QKCA 4JI1B 4IL6Z 2Y4TA 4J80A 3B09A 1MZFA 1XHXA 5LGNA 1WPXA 1AB3A 1KD1W 1M56C 1DLBA 4LWSA 3UO2A 3EHBB 3OMNB 4B3RB 3KCYA 5CA0B 3AK3A 5IYDO 4EB6A 3SPIA 2FMLA 1S5HC 4YIPA 2RDCA 1RPRA 3WG7B 1ORQC 1EBOA 4X89A 2ATKC 3ABLB 2IH1C 2XAQA 4MW8A 3JCUZ 5B1BC 4B3SO 2EINB 1D2DA 2Q0AA 1DTOA 2WLIB 4O2AB 1X59A 2IM9A 3CCSV 1AP6A 4K8XA 5CA3A 1XUQA 3CS5A 1NVPD 4LFBB 4LNUB 5J2UB 1L0LH 4J7ZA 2HFEC 3CC4V 2ZKOA 5BMVB 1VQ7V 1S72V 2E75B 1NQTA 3CMEV 1NS1A 3K5MA 2EIMB 4LF7O 4PA7A 1IJGA 2E76B 3THOA 1JA8A 4HNAA 2CUGA 3AG3C 4LF9O 5HFLA 5EZYA 2LGWA 1N32O 4DV6B 2KKWA 3ZRSA 3CCRV 2NLJC 1E1RG 1KU9A 2KSDA 4UB8Z 1SQBH 4TWKA 1JJ2U 5EBMC 4TT3G 1VQMV 3FB5C 2ZM6B 2JJ2G 1NT2B 3AG4C 2OIGA 3BY6A 4G28B 2UUCO 4KXRA 1VQLV 3IJ4A 1CPYA 4DK1A 3ZN0A 1JJOA 1IDSA 4R8CA 1MA1A 5J2TA 4NXNO 2R70A 4JAVA 3IC7A 5JCOA 2EX3A 1Q6UA 4DV2B 1K33A 4LF6O 3ETGA 4UUJC 3OUFA 1GN2A 3SJCC 2BTOA 1GN4A 2YI9A 2JJ1G 5IY5C 1BSMA 4HAMA 2YI8A 2OIEA 4I4TA 2B1IA 4FLTA 1R6NA 1ZWIC 2BSKB 3ABUA 3TJTA 1N34O 4H13B 1XI1A 3HKDB 4LF9B 3W7UA 2JK5C 3QO7A 3G4SV 1S5JA 2XAGA 1PV0A 4EFEA 2BTQB 1YHQV 4DR5O 1IVSA 1RSOA 3B8MA 1HNWO 2Q69A 1PP9H 4LF4B 4JI0B 4MVUA 3CRMA 1W2BU 5DN6G 5LMNB 1EM1A 2P6JA 4PI0A 4D7TA 4ZKIA 3E2EA 2WLJA 4LH7A 3VQWA 5L3FA 4O4LB 4XBFA 1NTMH 2XOKG 1M57C 3LNNA 1NTKH 3JAWA 3ETQA 3CXHF 1VQ4V 1RPOA 1L8DA 5FPOA 3CE2A 3B8NA 1XMQO 2Q5ZA 4Q20A 1H2NA 4DV4B 4JAUA 4YJ3A 1N0NA 3T1HO 2GHYA 3T2MA 3BRCA 2RN9A 3A0RA 3R65A 3R66A 5K1PA 5FLXN 2UXBO 1J5EB 2PY5A 3FYEB 2ARHA 1BQZA 4GX5A 1Y74A 2F23A 4JTAB 4DW1A 5CMUA 5C93A 1XL6A 4XDKA 4WFBV 4LR3A 2VRZA 1F4NA 4RUEA 1DK1A 4J41A 3O65A 2D3OW 1QQCA 3HKDA 1HNXB 3CRQA 3CWBH 4KHPO 3STLC 3SPCA 4DUYB 1Y67A 3QF7A 1OHHG 2LO1A 5KHKA 4GX0A 2VWJA 2Q73A 4DV1B 1Q5OA 3UQ8A 2VQEO 5IT9N 5KX5B 4JI3O 5IYCO 4BIZA 4KUMA 3A0HZ 2OTLV 4LFCB 1K73W 1S3JA 5LMUO 3HKCB 4EB6B 4PDVA 3RYHA 3CD6V 1ZL8A 1H8EG 5KUMA 3E8BA 1V54B 1OCRC 4CH4A 2JS3A 1R6TA 1WA8B 4U7NA 3ZRWA 3AG7A 4KL1A 4NXMO 2EINC 1KQSU 2Q7EA 2IU0A 4R50A 2Q68A 3N2KB 4RQEA 2UXDB 5KAIZ 2CK3G 4O4IA 1RM1B 1JNBA 2BE3A 5KMGB 1IXBA 2GTAA 3K04A 1J95A 1KUQA 3A2FA 1BHAA 4DR7B 1EZJA 2DQ3A 3H9VA 2M6YA 3UO3A 3E22B 4BWAA 3TCUA 2LP7A 2LFSA 3DTUB 4JZ2A 5LBQA 5BR8O 1Q81W 2F4VO 1KECA 2R9AA 4QNHB 2UUAO 1MZEA 4B7EA 2AHYA 3JD3A 3SR2C 2JS5A 3J80N 5H2FZ 3JAKB 4UCTA 3CB2A 1FXKB 2WWWA 5E1AC 2Q8VA 3GWKC 3W7TA 4JI8B 4X62B 3IFXA 2YXHA 1GO3F 2GDSA 1SZXA 5EC2C 1M56B 1M5IA 3GWOA 5JH7B 3E89A 3IAYA 2R72A 1ZLZA 4K0KO 2XASA 1EN6A 3CCJV 4JI8O 1YTFB 4DUZB 3RBZA 1AR5A 3JAWB 3JSLA 5LOVA 4ZOLB 1BS3A 3HKEA 3RN4A 4DR1O 4FZ0A 1QNMA 3CJHA 5LP6C 3P3NA 4I7ZB 4DV5B 2WA3A 1OCOB 2JGDB 2XT9A 2PYJA 4PA4A 1SQVH 3C90A 1YXBA 2XNDG 4QPJA 2NN4A 5FL7G 4JI5B 4LF7B 3K03A 2BTQA 4WFHA 3L72H 3A0BZ 2QGNA 4BW9A 1SS3A 2MW2B 2V4DA 4MTFA 3OR6C 5GTIZ 3KG2A 1JMKC 3W7XA 3G80A 4J11A 1QBZA 2UXBB 1M57B 2N05A 1SETA 3QTCA 5B66Z 4LFBO 5L3GA 4GLXA 3ZMVA 3OM3B 4DV4O 4DR3B 2YIDA 4RAIA 1R3KC 1CP9A 4NB5A 2HVJC 2A7WA 1XMQB 2HKOA 3P30A 2JRIA 1XNQB 5CA1A 2NR5A 3D36A 2EIKB 4IT5A 4MVOA 3ZMTA 4B3RO 2HJDA 2ZR2A 3VQYA 3K59A 1P7GA 4LCUC 3ZCCA 1K4DC 2Q6AA 4MVZA 4MW3A 4FLXA 5LMUB 2AW9A 3FKSG 5JQGA 1XILA 2B5UA 2CTPA 1KYOF 4DR2B 2YEVB 4QPKA 2QSAA 4FLVA 3N2KA 2DYRB 4DV7B 3SJAC 4JAAA 1RM1C 3SPGA 4DV0O 1FFTB 3D36C 3DXRB 1U96A 2OCCC 3E86A 3K06A 1N33B 5JQGB 4LF5O 4J10A 4B3TO 1K5QA 4I5SA 1PM9A 3ZBHA 3I56V 1V55C 1BHBA 1KP3A 4Z2WA 4B08A 2QKSA 1H38A 5LGUA 1VQNV 1SQFA 4X65B 5IDJA 4JYAO 2ETNA 2YIBA 2QTOA 3CPWU 4R6ZA 5GW7A 1HDJA 4AILC 1GTOA 2ZE8A 4AI8A 4DV1O 2Y0PA 4HBNA 4BW5A 4I9QA 4U3JA 4DXWA 3H1JH 1V9PA 5KX5A 3MHSC 3CXCU 4GT1A 1OCZC 2JVDA 2GSMB 5GONA 1VARA 2A06H 2ADQB 4U3JB 3OMIB 1IBKO 4YHHB 5GTHZ 3OR7C 2CGOA 4FVMA 1D5AA 5LHGA 3TETA 1Z5VA 1QVFU 1IURA 3FB7C 4OX9O 5CA0A 1R6KA 4X1IA 2OCHA 3JARB 4ICGA 5IJ0B 1G1XB 3VQXA 2Z3YA 1B6QA 4L8JA 3OT7A 2YXYA 3QO5A 4BIUA 4JI6B 4JI4B 4LC1A 4IHJB 4J7KA 2PYLA 3TXSA 1FOUA 4X20B 3ABTA 1Q8IA 2P7TC 1XBLA 3HKEB 4BIOA 1TGOA 3ZHRA 4PDLA 3X2QB 2D2CB 4O4JA 4D6TH 5EYPB 4UCSA 1EN5A 3CCLV 4WFEA 4JYBA 1BE3H 4I0XB 1M1KW 3E22A 1SF9A 1VQ8V 4H44B 1K92A 2W6IG 4DV3O 4GX1A 5JVDA 4PV1B 2FL4A 1E1QG 1XDCA 1N34B 5KUKA 1SQXH 4DR5B 5LYJA 1TUBA 4IYHA 2WLHA 2P4KA 4LBEC 1HW7A 2PI5A 4K8ZA 2O57A 4X62O 5LHHA 1IBLO 1R73A 2KB1A 1JVMA 1XNRO 4NXNB 3WU2Z 1AVMA 2HP8A 3K5OA 3OEEG 3OAAG 2XAFA 1XNRB 2ZE6A 5H9CA 2EIJC 2DE0X 1R1BA 1CEZA 3CRRA 5B3SC 1H8HG 1KP2A 2H3OA 4TQDA 1AI6A 3JASA 4LFAO 3KKYA 4PHZA 5LXTA 3ZEDA 3WFVA 1FJGO 1YCIA 3HB3B 3CCVV 2AHZA 1EZVH 5LMNO 3J7AU 4FFBB 3DSQA 2Q0OC 1HR0O 3ZHQA 2GV9A 1N36O 4LF4O 5B3SB 3OD4A 4K35A 4E4EA 1I5YA 3QVNA 4O4HB 3JD1A 1SQQH 3I55V 1U97A 5IYBO 1OCZB 3T4DA 5AG2A 3CC7V 4GYCB 3AG4B 4R7CA 2ZXWC 1UJWB 4TSFG 1Q7YW 2WLMA 1AJQA 2IJIA 3ASNC 1QVGU 1BCCH 1N4CA 1AI7A 1FD9A 2PI4A 1Z2GA 1S5LZ 2JDIG 5FNVB 2H94A 1H2SB 2L6LA 3RYIB 4DV2O 2UXXA 2W0XA 2HLDG 4JV5O 4TV8B 4JV5B 1PNLA 5LA6B 1ZL8B 3RW0A 2UUCB 1FFXB 3FB6C 2AZ0A 2A9HA 3SYCA 1VQKV 4YIOA 1YI2V 5CB4A 1THZA 1W0JG 4X1YB 3X2QC 4O2BA 2F4VB 4Z1VA 2XUMA 1Z5WA 4ZBMA 1E79G 3D3IA 3ASNB 2ZDIA 2JIZG 3P32A 2QE7G 3ZHSA 1OCRB 1X4TA 4UVBA 4DR2O 4B3MO 2XTAA 1BMFG 2IH3C 3STZC 3BA9A 3RT3C 4FFBA 3QO8A 1N33O 2QWPB 4NTWA 3UCSC 2WLLB 3T1CA 4CZZA 5LYJB 4O4HA 1RSOB 4LWSB 5D5PA 3WB1A 4TOIA 1MOFA 1JPXA 2Y4UA 2ITDC 3L71H 1NR1A 2YICA 3I5DA 4GKJB 1Y6XA 1PL4A 2V1DA 1QR8A 2UUBO 1AILA 1VQ6V 2PUSA 1O9GA 4X64O 2Z5UA 4MTXA 3JD0A 3RYCB 1NR7A 2CTQA 4LP8A 3VQVA 2P4VA 4JI7B 3F7YC 2WLNA 1FKAO 5DECA 4YY3O 3T1YO 4FFKA 1PD3A 1Y66A 3ICXA 1IBLB 2QR4A 4AQYO 3SJQC 2IJKA 2YIAA 1YDXA 2JGUA 1Q6HA 3AK1A 4PJ0Z 1HNZB 5J9PC 4DR4B 4JI2B 3SJBC 3G6EV 4I50A 1QHTA 2YXLA 3K5LA 3K08A 3BPZA 3JD4A 1K8AW 3JCZA 1WB7A 1H2MA 4A5UB 4DV5O 5CBHA 3Q4HB 5EK0A 4K0KB 3G6BA 1OZ0A 4DW0A 3D3QA 1YZBA 3AG2C 2Q7GA 2ZR3A 4XDJA 1P4RA 2DW4A 4TUYB 3N27A 4QJFB 2DN9A 3OTFA 3H1IH 4LF6B 2DWEC 3CEIA 1OCCB 5H5NA 5FNVA 2GUZB 1BGYH 1K3EA 2Q7HA 5IJ9A 2QWNB 3AG3B 1GK9A 1KKDA 1F7YA 4F6RA 4N21A 2K9PA 3AEIA 3JAKA 3QNEA 4UV9A 1BL8A 3NXSA 3RVZA 3LSUA 1H2GA 5J2TB 5EC1C 2DMXA 2IJHA 1DF4A 2YS8A 5F2VO 4O4JB 1GN6A 3L74H 5KHIA 3B40A 4UCUA 3OTOB 1DF5A 3RVYA 2DYSB 3AK2A 4DV3B 3JASB 4DR3O 3ZX6A 3D8CA 3JYCA 1HNWB 3M7MX 4DR4O 2YSUB 2YC0A 4LNUA 2WA4A 2UXCO 2PGGA 4MT8A 4K3AA 3PN1A 3K9SA 4NKGB 1FYJA 2A3QA 2K1EA 1M93A 3ABMB 3LDCA 4I50B 1YEWA 1B3QA 1NBMG 3H1LH 1CXZB 4GKKB 2GBOA 3ZRXA 3UT5A 1M90W 2GUZA 2ZIMA 2DOSA 4NYKA 1GH6A 3VOUA 3KCXA 1JFFB 1F23A 4EKWA 1XREA 3JD2A 4EFBA 3C3SA 3W7WA 3MHHC 4P9PA 5IJ0A 4JI4O 1KC8W 4JI6O 3ABKB 5GONB 4FLUA 4NTYA 3MAQA 1H2LA 4NVPA 3RYFB 2WLIA 1LUWA 5LOVB 2EULA 2Q67A 5CN0A 1NKDA 4GUNA 5B1AB 3DXRA 3CJHB 2LW7A 2KG7B 3CHXA 5D5QA 2ZNIA 5CB4B 4PDRA 4UV8A 1ZX3A 3ASOB 5L3CA 4UVAA 1WP8A 1URFA 1BZKA 3IC9A 4IYIA 2CH7A 1N0JA 4OXSA 4G27B 4X65O 3EXAA 1GAXA 3FAVB 1NH2B 1P7BA 5EBLC 3E8FA 4TV9B 2CTRA 1HR0B 3DC6A 5B1AC 3ETEA 1IBMO 2HHHO 4LF8O 3UKMA 3U0ZA 1NJIW 5KLVH 2CAZC 1F51A 1YSCA 4FZ1A 2G38A 5B1OA 4PA9A 1QLEB 1XHZA 3AG2B 1Y76B 5IWAB 4TUYA 1W59A 2F66C 1VQ5V 4F6RB 1TVKB 2ADPA 4NTXA 5B5EZ 1ENVA 2GTSA 2RNBA 2WPDG 3CP1A 5BY1A 4BAYA 2FTKA 1WNSA 1FFXA 4OX9B 4PI2A 3OUSA 1UPGA 3L73H 3SYAA 1OJHA 4FM0A 1WB8A 4JI7O 5LP6A 1LNQA 2DQ0A 4I55B 4X1KB 2UU9O 1G6UA 2CE4A 4EEQA 1GM7A 5BXZA 4P2ZA 3BAAA 1SERA 3TK1A 1SC5B 2CH7B 4QGPA 4U7OA 4J9ZB 1YF2A 2L35A 4JF3A 3K3WA 2VQEB 2A0LA 3ZIAG 4RQFA 2ZD9A 4UXNA 1HP8A 1WPBA 2E5LB 2WLKA 3Q4HA 5FPRA 4B7KA 2HVKC 2Z0AA 1PKXA 4WFAV 1WP7A 4JI0O 1AJNA 2P5OA 4LFAB 5LHIA 2X0LA 1MABG 1FPOA 4MSWC 2OCCB 3JATB 5JVDB 3CC2V 5A9GA 2QWRB 1QLEC 3B2EE 3QG5A 3OGCC 5K1XA 4JTCB 3APOA 1NH2D 5JJJB 5KHJA 1N8RW 4RWUA 1VMGA 4CC5A 4PD4F 3FX7A 1YVWA 1K97A 5CBFA 5C8YB 2YEVA 4X8AA 4YJ3B 4CS2A 4ZOLA 1K5SA 5B1BB 1SQGA 4LH6A 4DYLA 3ETDA 3AG1C 4YJ2A 1S76D 4JI1O 3FAVA 4FLYA 3ABLC 3CCEV 1BQ0A 3IGAC 1JR9A 1I7FA 1QLNA 1VIBA 3K0GA 2HG5C 4DR7O 4YJ2B 1TVKA 3O9OA 1VQOV 3H1KH 3DGEA 3HKBB 4P30A 4WCEV 2B9ZA 4FJCC 2AGAA 4JTDB 5BR8B 2IU3A 1R3LC 2ZINA 3LSSA 5EZYB 1UFIA 2Y69B 2UXDO 1G8MA 2PF4E 1V54C 2B1GA 2VQFO 1TUBB 2EILB 4FLZA 4F4LA 1XL4A 4J9YB 2QTSA 1FJGB 2BOBC 4DUZO 3FYIB 4X1KA 4JI2O 2UU9B 1YJNV 4FPPA 4CS4A 2W0FC 3JALA 3OE7G 5LA6A 5A2QN 2P22C 4QE9A 1AP5A 2HR3A 3HR0A 2YIBD 3G67A 2QDOA 4OGQB 4DRXB 5EIBD 3BFRA 3T1HB 2OWOA 3RYHB 5C8YA 3T1YB 4IGGA 1SZTA 3HKCA 4ZI7B 1AJPA 1M4UA 1AROP 3RYCA 2ZDIC 3ABMC 4WBNA 2QWOB 2QWQB 4UCRA 3CYOA 3JSNA 3SYPA 4J42A 2V7QG 2IJJA 4B3TB 5EYPA 2X6BA 2DJVA 4PA3A 3SYQA 1FAFA 4JI3B 3KDRA 5KA6A 1SESA 1I0HA 1H2KA 5ITZA 1JX9A 2EIKC 2WSSG 4HZ3A 1HNZO 4MS2A 3F5TA 3BHPA 4KHPB 5TISZ 2Q9LA 2QM4A 1Y4MA 4X66B 2DWDC 1N36B 3MD0A 4B3MB 1D5NA 4PDMA 3SPHA 4CH6A 3APQA 2QM7A 3SPJA 1I94O 3S3WA 3OMAB 4QE7A 4YY3B 1NTZH 1R3IC 4UVCA 2ZIOA 3K58A 4DRXA 2A79B 1WA8A 2FB5A 2OTJV 1GMGA 3EVKA 5B1NA 3RFRA 3U10A 5L3DA 1COWG 2ZE7A 1KB9F 5CBGA 2XAHA 5JWPA 3N2GA 1PPJH 4GKJO 3L70H 3JATA 5LP6B 5BZBA 1H5WA 1ROPA 2LJ2A 2P67A 4I4TB 2R9IA 3JAMN 1VEWA 3WB2A 2ZM6O 1P84F 1NZ6A 4O2AA 3OEHG 4H37A 2UXCB 4HNAB 2IW5A 1F4MA 1O9HA 3LUTB 2CTWA 1IX9A 4O4LA 3BEHA 4MTOA 2VQFB 2ILMA 2EZPA 3LDDA 1TAEA 1GRJA 4E2LA 2F43G 4WFGA 5H6QA 1P49A 4FM1A 1PNMA 2LW1A 1IBMB 1SRYA 1PNKA 4FMTA 2X6CA 3K5NA 3B77A 2LGQA 1M9NA
chains in the Genus database with same CATH topology
3K9SA 3KDRA 2ADPA 2GDSA 1I0HA 1SZXA 2CDYA 1AR4A 1ZLZA 1EN6A 3AK1A 1B06A 1PM9A 1XDCA 4F6EA 2QKAA 1MMMA 1AR5A 1MSDA 1WB8A 1AP6A 1BS3A 2P4KA 1D5NA 1XUQA 1JR9A 1GN3A 3RN4A 1XREA 1QNMA 1EM1A 4YIOA 3C3SA 3C3TA 1WB7A 2CE4A 1AVMA 3EVKA 1VARA 1ZTEA 1LUWA 2ADQB 1JA8A 1ZSPA 3CEIA 1ZUQA 4X9QA 3KKYA 3MDSA 4GUNA 1LUVA 1IXBA 1I08A 1N0NA 1VEWA 3LSUA 1AP5A 3OT7A 3IC9A 2QKCA 1N0JA 3DC5A 4JZ2A 3BFRA 1GN6A 4E4EA 1IDSA 1MA1A 3QVNA 1PL4A 3DC6A 4JZGA 3AK2A 4C7UA 1IX9A 1BT8A 3AK3A 5AG2A 1GN2A 1P7GA 4JYYA 5A9GA 1EN5A 1GN4A 1MNGA 1BSMA 2RCVA 4YIPA 1Y67A 2AW9A 1KKCA 4BR6A 1XILA 1EN4A 4FFKA 3TJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9S A;  2ADP A;  2GDS A;  1I0H A;  1SZX A;  2CDY A;  1AR4 A;  1ZLZ A;  1EN6 A;  3AK1 A;  1B06 A;  1PM9 A;  1XDC A;  4F6E A;  2QKA A;  1MMM A;  1AR5 A;  1MSD A;  1WB8 A;  1AP6 A;  1BS3 A;  2P4K A;  1D5N A;  1XUQ A;  1JR9 A;  1GN3 A;  3RN4 A;  1XRE A;  1QNM A;  1EM1 A;  4YIO A;  3C3S A;  3C3T A;  1WB7 A;  2CE4 A;  1AVM A;  3EVK A;  1VAR A;  1ZTE A;  1LUW A;  2ADQ B;  1JA8 A;  1ZSP A;  3CEI A;  1ZUQ A;  4X9Q A;  3KKY A;  3MDS A;  4GUN A;  1LUV A;  1IXB A;  1I08 A;  1N0N A;  1VEW A;  3LSU A;  1AP5 A;  3OT7 A;  3IC9 A;  2QKC A;  1N0J A;  3DC5 A;  4JZ2 A;  3BFR A;  1GN6 A;  4E4E A;  1IDS A;  1MA1 A;  3QVN A;  1PL4 A;  3DC6 A;  4JZG A;  3AK2 A;  4C7U A;  1IX9 A;  1BT8 A;  3AK3 A;  5AG2 A;  1GN2 A;  1P7G A;  4JYY A;  5A9G A;  1EN5 A;  1GN4 A;  1MNG A;  1BSM A;  2RCV A;  4YIP A;  1Y67 A;  2AW9 A;  1KKC A;  4BR6 A;  1XIL A;  1EN4 A;  4FFK A;  3TJT A; 
#chains in the Genus database with same CATH topology
 3T4Z A;  4CC6 A;  4PA6 A;  2CDY A;  3UT5 B;  4RO2 A;  3CCQ V;  1YIJ V;  4WBN B;  5KAF Z;  1GKF A;  4F6E A;  4YHH O;  3RYF A;  2LFR A;  2N04 A;  3K57 A;  4MTG A;  4IHJ A;  4J7J A;  4X64 B;  3NR7 A;  4B3S B;  2EIM C;  3A8T A;  4ZIB A;  1G4Y B;  2R9R B;  5LGT A;  4FLW A;  3K0D A;  2F1M A;  4PEL A;  5KHG A;  2MK3 A;  1N32 B;  3ZJZ A;  2P06 A;  3FFQ A;  1I94 B;  3FD9 A;  4LF8 B;  4JYA B;  1PL0 A;  1ZTE A;  5IE9 A;  4D7S A;  3F5W C;  4N23 A;  4X66 O;  4QIW F;  4UB6 Z;  4XDL A;  1Q86 W;  1OCC C;  4DV6 O;  4JAS A;  3E8G A;  1I08 A;  2E5L O;  3F7V C;  4AQY B;  1JQ0 A;  1VF6 C;  2DYS C;  5BMV A;  4ASU G;  1DGS A;  3CSX A;  1A32 A;  5DM6 V;  1L1F A;  3ZMU A;  3OFN G;  1YJW V;  2WLL A;  4H33 A;  1JFF A;  3M8A A;  1Q82 W;  3LNM B;  4JZG A;  4C7U A;  1AI4 A;  5JJE B;  1Q43 A;  4I9W A;  2P90 A;  4G2K A;  1AI5 A;  1TUE B;  1MNG A;  2W6J G;  2RCV A;  3JAR A;  2N74 A;  2DYR C;  4IIJ A;  4BR6 A;  3VBB A;  2PZS A;  3ZRW B;  2QA4 V;  2EZO A;  3E8H A;  4YXW G;  2JEU A;  3S3X A;  2UUB B;  4ZI7 A;  2KG7 A;  1YIT V;  5KA5 A;  4X1I B;  1XMO B;  2EIJ B;  2M7W A;  1RP3 B;  2QKA A;  1HNX O;  1MMM A;  2RJZ A;  2QM8 A;  2WAM A;  4X88 A;  1YJ9 V;  3K9A A;  2Y48 A;  2F95 B;  4W4K A;  3HPL C;  1GN3 A;  4CBC A;  1NU1 H;  4HYO A;  1SA0 B;  4X20 A;  1WJZ A;  5IYZ A;  3W7S A;  3ZHT A;  5IY5 B;  3U11 A;  5LXT B;  1HWY A;  1XEQ A;  5ITZ B;  4P9O A;  3HKB A;  3ZHU A;  4FK5 C;  3RWR D;  2E3C A;  5IJ9 B;  2E74 B;  3M99 B;  2VS0 A;  2JGD A;  4JPR A;  1VP7 A;  2QJ1 A;  2ZE5 A;  3ML0 A;  2VWK A;  2ZQM A;  1MSW D;  1ZAU A;  3CMA V;  5EBW C;  1WLE A;  2C2A A;  1MG1 A;  4NR1 A;  1WAZ A;  2ZNJ A;  3ZN1 A;  2ZXW B;  3EFF K;  2H8P C;  4Q6G A;  1EFR G;  4ZHQ A;  4UFZ A;  4GZR B;  3DC5 A;  1V55 B;  4CH5 A;  5CA1 B;  4RUF A;  1SKV A;  4WFF A;  5LL6 Y;  1IXM A;  2UXN A;  2KQX A;  2BCC H;  3ASO C;  2Y0I A;  5L3E A;  1SQP H;  1OV9 A;  4FM2 A;  1VF6 A;  1LR1 A;  3KZI Z;  1TA8 A;  2OT5 A;  4FIP C;  2XHB A;  2Q4P A;  2RMK B;  1Q6I A;  3SGI A;  1K9M W;  1SA0 A;  5EIB C;  2ODM A;  1Q90 D;  4I55 A;  1WN7 A;  5HFM A;  4ABM A;  2EJR A;  4O4I B;  3ZS8 C;  4JI5 O;  1FS0 G;  2HHH B;  1VF5 B;  2X6A A;  3ABK C;  4CH3 A;  2FYU H;  2EBO A;  1QCE A;  4DO2 A;  1FXV A;  2CGN A;  3CCU V;  4U3F H;  3ZMS A;  3H01 A;  1NI8 A;  3LDE A;  2RQ6 A;  5JCO C;  2PTM A;  3OW2 U;  3G71 V;  3BVO A;  4GX2 A;  4DR1 B;  3E83 A;  1K4C C;  1QR9 A;  1XQ8 A;  4DR6 B;  3UM7 A;  3RYI A;  1FXH A;  4JGS A;  3CRC A;  3BA8 A;  4AHC A;  1XMO O;  1IZ3 A;  4TV8 A;  4UCO A;  4JYC A;  4W4L A;  4DK0 A;  1Q3E A;  3LSQ A;  1K7D A;  5L3B A;  3GVM A;  1T5E A;  4X9Q A;  3MDS A;  2HEP A;  1OCO C;  1LUV A;  1JCH A;  2EIL C;  1S0V A;  3GB7 C;  3JAL B;  1L0N H;  3TGU H;  4NXM B;  2Y69 C;  1IBK B;  3TXQ A;  1RFY A;  1QU7 A;  2FKX A;  5JH7 A;  5KMG A;  4X1Y A;  3SDL A;  2JEX A;  2XAJ A;  4DUY O;  2YDE A;  5IWA O;  1XOU A;  4H0L B;  4KFM A;  5KHH A;  2ZCE A;  4GKK O;  4MVS A;  3L75 H;  4DR6 O;  3WB0 A;  1VQP V;  3CRA A;  1S77 D;  4O2B B;  1BT8 A;  2ITC C;  1Y76 A;  2X7R B;  1I5X A;  4I0X A;  3AG1 B;  4JYY A;  4TV9 A;  3PJS K;  4OPA A;  1W0K G;  1KKC A;  1J5E O;  1FXK C;  3K79 A;  3ZRV A;  3WG7 C;  1EN4 A;  4TQF A;  1KBH A;  2AZ2 A;  3CCM V;  3SYO A;  2NNU A;  3ZMZ A;  4DV0 B;  1NVP B;  4UCV A;  1KMI Z;  3OGI B;  1AR4 A;  2HJF C;  1B06 A;  4OPH A;  5DED A;  4ZHQ B;  3OTO O;  1MSD A;  2IBZ H;  1VQ9 V;  2EJ7 A;  1FXK A;  1US6 A;  2QEX V;  4Z1M G;  4WF9 V;  1R3J C;  2F93 B;  4IIJ B;  2LQT A;  3L9D A;  3ZHV A;  5E79 Z;  3J81 N;  1XNQ O;  4MVQ A;  3C3T A;  3FB8 C;  2AXT Z;  4LFC O;  1AR1 B;  3E35 A;  2OYQ A;  1GM8 A;  1B04 A;  2BOC C;  1K34 A;  1GM9 A;  1JOY A;  3N2G B;  3B4S A;  2BSK A;  1Y74 B;  3P3P A;  5H6R A;  1ZSP A;  4MVR A;  4KP4 A;  1ZUQ A;  1VF7 A;  3CX5 F;  2UUA B;  3H1H H;  5JJN B;  4L87 A;  2YUA A;  5J2U A;  4GCZ A;  4CS3 A;  3BAB A;  1YTF D;  3BCC H;  4LF5 B;  2ZT9 B;  5IYZ B;  4DV7 O;  3RGB A;  4MVM A;  2QKC A;  4JI1 B;  4IL6 Z;  2Y4T A;  4J80 A;  3B09 A;  1MZF A;  1XHX A;  5LGN A;  1WPX A;  1AB3 A;  1KD1 W;  1M56 C;  1DLB A;  4LWS A;  3UO2 A;  3EHB B;  3OMN B;  4B3R B;  3KCY A;  5CA0 B;  3AK3 A;  5IYD O;  4EB6 A;  3SPI A;  2FML A;  1S5H C;  4YIP A;  2RDC A;  1RPR A;  3WG7 B;  1ORQ C;  1EBO A;  4X89 A;  2ATK C;  3ABL B;  2IH1 C;  2XAQ A;  4MW8 A;  3JCU Z;  5B1B C;  4B3S O;  2EIN B;  1D2D A;  2Q0A A;  1DTO A;  2WLI B;  4O2A B;  1X59 A;  2IM9 A;  3CCS V;  1AP6 A;  4K8X A;  5CA3 A;  1XUQ A;  3CS5 A;  1NVP D;  4LFB B;  4LNU B;  5J2U B;  1L0L H;  4J7Z A;  2HFE C;  3CC4 V;  2ZKO A;  5BMV B;  1VQ7 V;  1S72 V;  2E75 B;  1NQT A;  3CME V;  1NS1 A;  3K5M A;  2EIM B;  4LF7 O;  4PA7 A;  1IJG A;  2E76 B;  3THO A;  1JA8 A;  4HNA A;  2CUG A;  3AG3 C;  4LF9 O;  5HFL A;  5EZY A;  2LGW A;  1N32 O;  4DV6 B;  2KKW A;  3ZRS A;  3CCR V;  2NLJ C;  1E1R G;  1KU9 A;  2KSD A;  4UB8 Z;  1SQB H;  4TWK A;  1JJ2 U;  5EBM C;  4TT3 G;  1VQM V;  3FB5 C;  2ZM6 B;  2JJ2 G;  1NT2 B;  3AG4 C;  2OIG A;  3BY6 A;  4G28 B;  2UUC O;  4KXR A;  1VQL V;  3IJ4 A;  1CPY A;  4DK1 A;  3ZN0 A;  1JJO A;  1IDS A;  4R8C A;  1MA1 A;  5J2T A;  4NXN O;  2R70 A;  4JAV A;  3IC7 A;  5JCO A;  2EX3 A;  1Q6U A;  4DV2 B;  1K33 A;  4LF6 O;  3ETG A;  4UUJ C;  3OUF A;  1GN2 A;  3SJC C;  2BTO A;  1GN4 A;  2YI9 A;  2JJ1 G;  5IY5 C;  1BSM A;  4HAM A;  2YI8 A;  2OIE A;  4I4T A;  2B1I A;  4FLT A;  1R6N A;  1ZWI C;  2BSK B;  3ABU A;  3TJT A;  1N34 O;  4H13 B;  1XI1 A;  3HKD B;  4LF9 B;  3W7U A;  2JK5 C;  3QO7 A;  3G4S V;  1S5J A;  2XAG A;  1PV0 A;  4EFE A;  2BTQ B;  1YHQ V;  4DR5 O;  1IVS A;  1RSO A;  3B8M A;  1HNW O;  2Q69 A;  1PP9 H;  4LF4 B;  4JI0 B;  4MVU A;  3CRM A;  1W2B U;  5DN6 G;  5LMN B;  1EM1 A;  2P6J A;  4PI0 A;  4D7T A;  4ZKI A;  3E2E A;  2WLJ A;  4LH7 A;  3VQW A;  5L3F A;  4O4L B;  4XBF A;  1NTM H;  2XOK G;  1M57 C;  3LNN A;  1NTK H;  3JAW A;  3ETQ A;  3CXH F;  1VQ4 V;  1RPO A;  1L8D A;  5FPO A;  3CE2 A;  3B8N A;  1XMQ O;  2Q5Z A;  4Q20 A;  1H2N A;  4DV4 B;  4JAU A;  4YJ3 A;  1N0N A;  3T1H O;  2GHY A;  3T2M A;  3BRC A;  2RN9 A;  3A0R A;  3R65 A;  3R66 A;  5K1P A;  5FLX N;  2UXB O;  1J5E B;  2PY5 A;  3FYE B;  2ARH A;  1BQZ A;  4GX5 A;  1Y74 A;  2F23 A;  4JTA B;  4DW1 A;  5CMU A;  5C93 A;  1XL6 A;  4XDK A;  4WFB V;  4LR3 A;  2VRZ A;  1F4N A;  4RUE A;  1DK1 A;  4J41 A;  3O65 A;  2D3O W;  1QQC A;  3HKD A;  1HNX B;  3CRQ A;  3CWB H;  4KHP O;  3STL C;  3SPC A;  4DUY B;  1Y67 A;  3QF7 A;  1OHH G;  2LO1 A;  5KHK A;  4GX0 A;  2VWJ A;  2Q73 A;  4DV1 B;  1Q5O A;  3UQ8 A;  2VQE O;  5IT9 N;  5KX5 B;  4JI3 O;  5IYC O;  4BIZ A;  4KUM A;  3A0H Z;  2OTL V;  4LFC B;  1K73 W;  1S3J A;  5LMU O;  3HKC B;  4EB6 B;  4PDV A;  3RYH A;  3CD6 V;  1ZL8 A;  1H8E G;  5KUM A;  3E8B A;  1V54 B;  1OCR C;  4CH4 A;  2JS3 A;  1R6T A;  1WA8 B;  4U7N A;  3ZRW A;  3AG7 A;  4KL1 A;  4NXM O;  2EIN C;  1KQS U;  2Q7E A;  2IU0 A;  4R50 A;  2Q68 A;  3N2K B;  4RQE A;  2UXD B;  5KAI Z;  2CK3 G;  4O4I A;  1RM1 B;  1JNB A;  2BE3 A;  5KMG B;  1IXB A;  2GTA A;  3K04 A;  1J95 A;  1KUQ A;  3A2F A;  1BHA A;  4DR7 B;  1EZJ A;  2DQ3 A;  3H9V A;  2M6Y A;  3UO3 A;  3E22 B;  4BWA A;  3TCU A;  2LP7 A;  2LFS A;  3DTU B;  4JZ2 A;  5LBQ A;  5BR8 O;  1Q81 W;  2F4V O;  1KEC A;  2R9A A;  4QNH B;  2UUA O;  1MZE A;  4B7E A;  2AHY A;  3JD3 A;  3SR2 C;  2JS5 A;  3J80 N;  5H2F Z;  3JAK B;  4UCT A;  3CB2 A;  1FXK B;  2WWW A;  5E1A C;  2Q8V A;  3GWK C;  3W7T A;  4JI8 B;  4X62 B;  3IFX A;  2YXH A;  1GO3 F;  2GDS A;  1SZX A;  5EC2 C;  1M56 B;  1M5I A;  3GWO A;  5JH7 B;  3E89 A;  3IAY A;  2R72 A;  1ZLZ A;  4K0K O;  2XAS A;  1EN6 A;  3CCJ V;  4JI8 O;  1YTF B;  4DUZ B;  3RBZ A;  1AR5 A;  3JAW B;  3JSL A;  5LOV A;  4ZOL B;  1BS3 A;  3HKE A;  3RN4 A;  4DR1 O;  4FZ0 A;  1QNM A;  3CJH A;  5LP6 C;  3P3N A;  4I7Z B;  4DV5 B;  2WA3 A;  1OCO B;  2JGD B;  2XT9 A;  2PYJ A;  4PA4 A;  1SQV H;  3C90 A;  1YXB A;  2XND G;  4QPJ A;  2NN4 A;  5FL7 G;  4JI5 B;  4LF7 B;  3K03 A;  2BTQ A;  4WFH A;  3L72 H;  3A0B Z;  2QGN A;  4BW9 A;  1SS3 A;  2MW2 B;  2V4D A;  4MTF A;  3OR6 C;  5GTI Z;  3KG2 A;  1JMK C;  3W7X A;  3G80 A;  4J11 A;  1QBZ A;  2UXB B;  1M57 B;  2N05 A;  1SET A;  3QTC A;  5B66 Z;  4LFB O;  5L3G A;  4GLX A;  3ZMV A;  3OM3 B;  4DV4 O;  4DR3 B;  2YID A;  4RAI A;  1R3K C;  1CP9 A;  4NB5 A;  2HVJ C;  2A7W A;  1XMQ B;  2HKO A;  3P30 A;  2JRI A;  1XNQ B;  5CA1 A;  2NR5 A;  3D36 A;  2EIK B;  4IT5 A;  4MVO A;  3ZMT A;  4B3R O;  2HJD A;  2ZR2 A;  3VQY A;  3K59 A;  1P7G A;  4LCU C;  3ZCC A;  1K4D C;  2Q6A A;  4MVZ A;  4MW3 A;  4FLX A;  5LMU B;  2AW9 A;  3FKS G;  5JQG A;  1XIL A;  2B5U A;  2CTP A;  1KYO F;  4DR2 B;  2YEV B;  4QPK A;  2QSA A;  4FLV A;  3N2K A;  2DYR B;  4DV7 B;  3SJA C;  4JAA A;  1RM1 C;  3SPG A;  4DV0 O;  1FFT B;  3D36 C;  3DXR B;  1U96 A;  2OCC C;  3E86 A;  3K06 A;  1N33 B;  5JQG B;  4LF5 O;  4J10 A;  4B3T O;  1K5Q A;  4I5S A;  1PM9 A;  3ZBH A;  3I56 V;  1V55 C;  1BHB A;  1KP3 A;  4Z2W A;  4B08 A;  2QKS A;  1H38 A;  5LGU A;  1VQN V;  1SQF A;  4X65 B;  5IDJ A;  4JYA O;  2ETN A;  2YIB A;  2QTO A;  3CPW U;  4R6Z A;  5GW7 A;  1HDJ A;  4AIL C;  1GTO A;  2ZE8 A;  4AI8 A;  4DV1 O;  2Y0P A;  4HBN A;  4BW5 A;  4I9Q A;  4U3J A;  4DXW A;  3H1J H;  1V9P A;  5KX5 A;  3MHS C;  3CXC U;  4GT1 A;  1OCZ C;  2JVD A;  2GSM B;  5GON A;  1VAR A;  2A06 H;  2ADQ B;  4U3J B;  3OMI B;  1IBK O;  4YHH B;  5GTH Z;  3OR7 C;  2CGO A;  4FVM A;  1D5A A;  5LHG A;  3TET A;  1Z5V A;  1QVF U;  1IUR A;  3FB7 C;  4OX9 O;  5CA0 A;  1R6K A;  4X1I A;  2OCH A;  3JAR B;  4ICG A;  5IJ0 B;  1G1X B;  3VQX A;  2Z3Y A;  1B6Q A;  4L8J A;  3OT7 A;  2YXY A;  3QO5 A;  4BIU A;  4JI6 B;  4JI4 B;  4LC1 A;  4IHJ B;  4J7K A;  2PYL A;  3TXS A;  1FOU A;  4X20 B;  3ABT A;  1Q8I A;  2P7T C;  1XBL A;  3HKE B;  4BIO A;  1TGO A;  3ZHR A;  4PDL A;  3X2Q B;  2D2C B;  4O4J A;  4D6T H;  5EYP B;  4UCS A;  1EN5 A;  3CCL V;  4WFE A;  4JYB A;  1BE3 H;  4I0X B;  1M1K W;  3E22 A;  1SF9 A;  1VQ8 V;  4H44 B;  1K92 A;  2W6I G;  4DV3 O;  4GX1 A;  5JVD A;  4PV1 B;  2FL4 A;  1E1Q G;  1XDC A;  1N34 B;  5KUK A;  1SQX H;  4DR5 B;  5LYJ A;  1TUB A;  4IYH A;  2WLH A;  2P4K A;  4LBE C;  1HW7 A;  2PI5 A;  4K8Z A;  2O57 A;  4X62 O;  5LHH A;  1IBL O;  1R73 A;  2KB1 A;  1JVM A;  1XNR O;  4NXN B;  3WU2 Z;  1AVM A;  2HP8 A;  3K5O A;  3OEE G;  3OAA G;  2XAF A;  1XNR B;  2ZE6 A;  5H9C A;  2EIJ C;  2DE0 X;  1R1B A;  1CEZ A;  3CRR A;  5B3S C;  1H8H G;  1KP2 A;  2H3O A;  4TQD A;  1AI6 A;  3JAS A;  4LFA O;  3KKY A;  4PHZ A;  5LXT A;  3ZED A;  3WFV A;  1FJG O;  1YCI A;  3HB3 B;  3CCV V;  2AHZ A;  1EZV H;  5LMN O;  3J7A U;  4FFB B;  3DSQ A;  2Q0O C;  1HR0 O;  3ZHQ A;  2GV9 A;  1N36 O;  4LF4 O;  5B3S B;  3OD4 A;  4K35 A;  4E4E A;  1I5Y A;  3QVN A;  4O4H B;  3JD1 A;  1SQQ H;  3I55 V;  1U97 A;  5IYB O;  1OCZ B;  3T4D A;  5AG2 A;  3CC7 V;  4GYC B;  3AG4 B;  4R7C A;  2ZXW C;  1UJW B;  4TSF G;  1Q7Y W;  2WLM A;  1AJQ A;  2IJI A;  3ASN C;  1QVG U;  1BCC H;  1N4C A;  1AI7 A;  1FD9 A;  2PI4 A;  1Z2G A;  1S5L Z;  2JDI G;  5FNV B;  2H94 A;  1H2S B;  2L6L A;  3RYI B;  4DV2 O;  2UXX A;  2W0X A;  2HLD G;  4JV5 O;  4TV8 B;  4JV5 B;  1PNL A;  5LA6 B;  1ZL8 B;  3RW0 A;  2UUC B;  1FFX B;  3FB6 C;  2AZ0 A;  2A9H A;  3SYC A;  1VQK V;  4YIO A;  1YI2 V;  5CB4 A;  1THZ A;  1W0J G;  4X1Y B;  3X2Q C;  4O2B A;  2F4V B;  4Z1V A;  2XUM A;  1Z5W A;  4ZBM A;  1E79 G;  3D3I A;  3ASN B;  2ZDI A;  2JIZ G;  3P32 A;  2QE7 G;  3ZHS A;  1OCR B;  1X4T A;  4UVB A;  4DR2 O;  4B3M O;  2XTA A;  1BMF G;  2IH3 C;  3STZ C;  3BA9 A;  3RT3 C;  4FFB A;  3QO8 A;  1N33 O;  2QWP B;  4NTW A;  3UCS C;  2WLL B;  3T1C A;  4CZZ A;  5LYJ B;  4O4H A;  1RSO B;  4LWS B;  5D5P A;  3WB1 A;  4TOI A;  1MOF A;  1JPX A;  2Y4U A;  2ITD C;  3L71 H;  1NR1 A;  2YIC A;  3I5D A;  4GKJ B;  1Y6X A;  1PL4 A;  2V1D A;  1QR8 A;  2UUB O;  1AIL A;  1VQ6 V;  2PUS A;  1O9G A;  4X64 O;  2Z5U A;  4MTX A;  3JD0 A;  3RYC B;  1NR7 A;  2CTQ A;  4LP8 A;  3VQV A;  2P4V A;  4JI7 B;  3F7Y C;  2WLN A;  1FKA O;  5DEC A;  4YY3 O;  3T1Y O;  4FFK A;  1PD3 A;  1Y66 A;  3ICX A;  1IBL B;  2QR4 A;  4AQY O;  3SJQ C;  2IJK A;  2YIA A;  1YDX A;  2JGU A;  1Q6H A;  3AK1 A;  4PJ0 Z;  1HNZ B;  5J9P C;  4DR4 B;  4JI2 B;  3SJB C;  3G6E V;  4I50 A;  1QHT A;  2YXL A;  3K5L A;  3K08 A;  3BPZ A;  3JD4 A;  1K8A W;  3JCZ A;  1WB7 A;  1H2M A;  4A5U B;  4DV5 O;  5CBH A;  3Q4H B;  5EK0 A;  4K0K B;  3G6B A;  1OZ0 A;  4DW0 A;  3D3Q A;  1YZB A;  3AG2 C;  2Q7G A;  2ZR3 A;  4XDJ A;  1P4R A;  2DW4 A;  4TUY B;  3N27 A;  4QJF B;  2DN9 A;  3OTF A;  3H1I H;  4LF6 B;  2DWE C;  3CEI A;  1OCC B;  5H5N A;  5FNV A;  2GUZ B;  1BGY H;  1K3E A;  2Q7H A;  5IJ9 A;  2QWN B;  3AG3 B;  1GK9 A;  1KKD A;  1F7Y A;  4F6R A;  4N21 A;  2K9P A;  3AEI A;  3JAK A;  3QNE A;  4UV9 A;  1BL8 A;  3NXS A;  3RVZ A;  3LSU A;  1H2G A;  5J2T B;  5EC1 C;  2DMX A;  2IJH A;  1DF4 A;  2YS8 A;  5F2V O;  4O4J B;  1GN6 A;  3L74 H;  5KHI A;  3B40 A;  4UCU A;  3OTO B;  1DF5 A;  3RVY A;  2DYS B;  3AK2 A;  4DV3 B;  3JAS B;  4DR3 O;  3ZX6 A;  3D8C A;  3JYC A;  1HNW B;  3M7M X;  4DR4 O;  2YSU B;  2YC0 A;  4LNU A;  2WA4 A;  2UXC O;  2PGG A;  4MT8 A;  4K3A A;  3PN1 A;  3K9S A;  4NKG B;  1FYJ A;  2A3Q A;  2K1E A;  1M93 A;  3ABM B;  3LDC A;  4I50 B;  1YEW A;  1B3Q A;  1NBM G;  3H1L H;  1CXZ B;  4GKK B;  2GBO A;  3ZRX A;  3UT5 A;  1M90 W;  2GUZ A;  2ZIM A;  2DOS A;  4NYK A;  1GH6 A;  3VOU A;  3KCX A;  1JFF B;  1F23 A;  4EKW A;  1XRE A;  3JD2 A;  4EFB A;  3C3S A;  3W7W A;  3MHH C;  4P9P A;  5IJ0 A;  4JI4 O;  1KC8 W;  4JI6 O;  3ABK B;  5GON B;  4FLU A;  4NTY A;  3MAQ A;  1H2L A;  4NVP A;  3RYF B;  2WLI A;  1LUW A;  5LOV B;  2EUL A;  2Q67 A;  5CN0 A;  1NKD A;  4GUN A;  5B1A B;  3DXR A;  3CJH B;  2LW7 A;  2KG7 B;  3CHX A;  5D5Q A;  2ZNI A;  5CB4 B;  4PDR A;  4UV8 A;  1ZX3 A;  3ASO B;  5L3C A;  4UVA A;  1WP8 A;  1URF A;  1BZK A;  3IC9 A;  4IYI A;  2CH7 A;  1N0J A;  4OXS A;  4G27 B;  4X65 O;  3EXA A;  1GAX A;  3FAV B;  1NH2 B;  1P7B A;  5EBL C;  3E8F A;  4TV9 B;  2CTR A;  1HR0 B;  3DC6 A;  5B1A C;  3ETE A;  1IBM O;  2HHH O;  4LF8 O;  3UKM A;  3U0Z A;  1NJI W;  5KLV H;  2CAZ C;  1F51 A;  1YSC A;  4FZ1 A;  2G38 A;  5B1O A;  4PA9 A;  1QLE B;  1XHZ A;  3AG2 B;  1Y76 B;  5IWA B;  4TUY A;  1W59 A;  2F66 C;  1VQ5 V;  4F6R B;  1TVK B;  2ADP A;  4NTX A;  5B5E Z;  1ENV A;  2GTS A;  2RNB A;  2WPD G;  3CP1 A;  5BY1 A;  4BAY A;  2FTK A;  1WNS A;  1FFX A;  4OX9 B;  4PI2 A;  3OUS A;  1UPG A;  3L73 H;  3SYA A;  1OJH A;  4FM0 A;  1WB8 A;  4JI7 O;  5LP6 A;  1LNQ A;  2DQ0 A;  4I55 B;  4X1K B;  2UU9 O;  1G6U A;  2CE4 A;  4EEQ A;  1GM7 A;  5BXZ A;  4P2Z A;  3BAA A;  1SER A;  3TK1 A;  1SC5 B;  2CH7 B;  4QGP A;  4U7O A;  4J9Z B;  1YF2 A;  2L35 A;  4JF3 A;  3K3W A;  2VQE B;  2A0L A;  3ZIA G;  4RQF A;  2ZD9 A;  4UXN A;  1HP8 A;  1WPB A;  2E5L B;  2WLK A;  3Q4H A;  5FPR A;  4B7K A;  2HVK C;  2Z0A A;  1PKX A;  4WFA V;  1WP7 A;  4JI0 O;  1AJN A;  2P5O A;  4LFA B;  5LHI A;  2X0L A;  1MAB G;  1FPO A;  4MSW C;  2OCC B;  3JAT B;  5JVD B;  3CC2 V;  5A9G A;  2QWR B;  1QLE C;  3B2E E;  3QG5 A;  3OGC C;  5K1X A;  4JTC B;  3APO A;  1NH2 D;  5JJJ B;  5KHJ A;  1N8R W;  4RWU A;  1VMG A;  4CC5 A;  4PD4 F;  3FX7 A;  1YVW A;  1K97 A;  5CBF A;  5C8Y B;  2YEV A;  4X8A A;  4YJ3 B;  4CS2 A;  4ZOL A;  1K5S A;  5B1B B;  1SQG A;  4LH6 A;  4DYL A;  3ETD A;  3AG1 C;  4YJ2 A;  1S76 D;  4JI1 O;  3FAV A;  4FLY A;  3ABL C;  3CCE V;  1BQ0 A;  3IGA C;  1JR9 A;  1I7F A;  1QLN A;  1VIB A;  3K0G A;  2HG5 C;  4DR7 O;  4YJ2 B;  1TVK A;  3O9O A;  1VQO V;  3H1K H;  3DGE A;  3HKB B;  4P30 A;  4WCE V;  2B9Z A;  4FJC C;  2AGA A;  4JTD B;  5BR8 B;  2IU3 A;  1R3L C;  2ZIN A;  3LSS A;  5EZY B;  1UFI A;  2Y69 B;  2UXD O;  1G8M A;  2PF4 E;  1V54 C;  2B1G A;  2VQF O;  1TUB B;  2EIL B;  4FLZ A;  4F4L A;  1XL4 A;  4J9Y B;  2QTS A;  1FJG B;  2BOB C;  4DUZ O;  3FYI B;  4X1K A;  4JI2 O;  2UU9 B;  1YJN V;  4FPP A;  4CS4 A;  2W0F C;  3JAL A;  3OE7 G;  5LA6 A;  5A2Q N;  2P22 C;  4QE9 A;  1AP5 A;  2HR3 A;  3HR0 A;  2YIB D;  3G67 A;  2QDO A;  4OGQ B;  4DRX B;  5EIB D;  3BFR A;  3T1H B;  2OWO A;  3RYH B;  5C8Y A;  3T1Y B;  4IGG A;  1SZT A;  3HKC A;  4ZI7 B;  1AJP A;  1M4U A;  1ARO P;  3RYC A;  2ZDI C;  3ABM C;  4WBN A;  2QWO B;  2QWQ B;  4UCR A;  3CYO A;  3JSN A;  3SYP A;  4J42 A;  2V7Q G;  2IJJ A;  4B3T B;  5EYP A;  2X6B A;  2DJV A;  4PA3 A;  3SYQ A;  1FAF A;  4JI3 B;  3KDR A;  5KA6 A;  1SES A;  1I0H A;  1H2K A;  5ITZ A;  1JX9 A;  2EIK C;  2WSS G;  4HZ3 A;  1HNZ O;  4MS2 A;  3F5T A;  3BHP A;  4KHP B;  5TIS Z;  2Q9L A;  2QM4 A;  1Y4M A;  4X66 B;  2DWD C;  1N36 B;  3MD0 A;  4B3M B;  1D5N A;  4PDM A;  3SPH A;  4CH6 A;  3APQ A;  2QM7 A;  3SPJ A;  1I94 O;  3S3W A;  3OMA B;  4QE7 A;  4YY3 B;  1NTZ H;  1R3I C;  4UVC A;  2ZIO A;  3K58 A;  4DRX A;  2A79 B;  1WA8 A;  2FB5 A;  2OTJ V;  1GMG A;  3EVK A;  5B1N A;  3RFR A;  3U10 A;  5L3D A;  1COW G;  2ZE7 A;  1KB9 F;  5CBG A;  2XAH A;  5JWP A;  3N2G A;  1PPJ H;  4GKJ O;  3L70 H;  3JAT A;  5LP6 B;  5BZB A;  1H5W A;  1ROP A;  2LJ2 A;  2P67 A;  4I4T B;  2R9I A;  3JAM N;  1VEW A;  3WB2 A;  2ZM6 O;  1P84 F;  1NZ6 A;  4O2A A;  3OEH G;  4H37 A;  2UXC B;  4HNA B;  2IW5 A;  1F4M A;  1O9H A;  3LUT B;  2CTW A;  1IX9 A;  4O4L A;  3BEH A;  4MTO A;  2VQF B;  2ILM A;  2EZP A;  3LDD A;  1TAE A;  1GRJ A;  4E2L A;  2F43 G;  4WFG A;  5H6Q A;  1P49 A;  4FM1 A;  1PNM A;  2LW1 A;  1IBM B;  1SRY A;  1PNK A;  4FMT A;  2X6C A;  3K5N A;  3B77 A;  2LGQ A;  1M9N A; 
#chains in the Genus database with same CATH homology
 3K9S A;  3KDR A;  2ADP A;  2GDS A;  1I0H A;  1SZX A;  2CDY A;  1AR4 A;  1ZLZ A;  1EN6 A;  3AK1 A;  1B06 A;  1PM9 A;  1XDC A;  4F6E A;  2QKA A;  1MMM A;  1AR5 A;  1MSD A;  1WB8 A;  1AP6 A;  1BS3 A;  2P4K A;  1D5N A;  1XUQ A;  1JR9 A;  1GN3 A;  3RN4 A;  1XRE A;  1QNM A;  1EM1 A;  4YIO A;  3C3S A;  3C3T A;  1WB7 A;  2CE4 A;  1AVM A;  3EVK A;  1VAR A;  1ZTE A;  1LUW A;  2ADQ B;  1JA8 A;  1ZSP A;  3CEI A;  1ZUQ A;  4X9Q A;  3KKY A;  3MDS A;  4GUN A;  1LUV A;  1IXB A;  1I08 A;  1N0N A;  1VEW A;  3LSU A;  1AP5 A;  3OT7 A;  3IC9 A;  2QKC A;  1N0J A;  3DC5 A;  4JZ2 A;  3BFR A;  1GN6 A;  4E4E A;  1IDS A;  1MA1 A;  3QVN A;  1PL4 A;  3DC6 A;  4JZG A;  3AK2 A;  4C7U A;  1IX9 A;  1BT8 A;  3AK3 A;  5AG2 A;  1GN2 A;  1P7G A;  4JYY A;  5A9G A;  1EN5 A;  1GN4 A;  1MNG A;  1BSM A;  2RCV A;  4YIP A;  1Y67 A;  2AW9 A;  1KKC A;  4BR6 A;  1XIL A;  1EN4 A;  4FFK A;  3TJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...