1IX9A

Crystal structure of the e. coli manganase(iii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide Dismutase
publication title Structures at 0.90 A resolution of the oxidised and reduced forms of the Y174F mutant of the manganese superoxide dismutase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 80
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ix9A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ix9A02
1EN6A 4C7UA 1JA8A 3EVKA 1QNMA 3MDSA 3TJTA 5AG2A 1AR5A 4X9QA 4FFKA 1ZLZA 2GDSA 1AVMA 1BSMA 1I08A 1XUQA 1MNGA 1IX9A 2CDYA 2ADQB 1BT8A 3AK3A 4JZ2A 1AR4A 1IXBA 1BS3A 1ZSPA 3QVNA 3DC6A 1LUVA 1VEWA 1PM9A 3KKYA 3BFRA 3AK1A 3RN4A 4YIOA 4BR6A 1GN6A 1SZXA 2P4KA 1GN2A 3K9SA 1N0NA 1IDSA 3OT7A 1P7GA 1LUWA 1EN5A 1AP6A 2AW9A 1GN3A 4JYYA 1WB8A 1B06A 3CEIA 2QKAA 4JZGA 2QKCA 4GUNA 1VARA 1MMMA 1MSDA 2RCVA 1XDCA 4E4EA 1Y67A 1ZUQA 1JR9A 1D5NA 1MA1A 1N0JA 3C3SA 1XILA 4YIPA 1GN4A 4F6EA 1EN4A 3LSUA 1PL4A 2ADPA 2CE4A 1I0HA 1WB7A 3AK2A 1AP5A 1ZTEA 1XREA 3C3TA 1EM1A 3IC9A 3DC5A 5A9GA 1KKCA
chains in the Genus database with same CATH superfamily
2XUMA 3H9VA 1KQSU 3IGAC 2QWRB 4UCRA 1JA8A 3EVKA 2OCCB 4G28B 1YSCA 1URFA 5IJ9A 3TJTA 1Q82W 2P06A 3IAYA 5J9PC 2PI4A 2UUCO 3FB6C 2EZPA 4TT3G 1NBMG 1RM1B 1YITV 4DV7B 5CB4A 4YJ2B 1HR0B 1R3JC 4DV4O 2EINC 1S5LZ 3ABLB 4IIJB 5LBQA 3AK1A 1AJNA 4X88A 4X66O 1QVFU 2V7QG 3A8TA 3KCYA 2LGWA 4LF8O 2BSKB 1HNXB 1TUBA 4DRXB 2AW9A 1ORQC 4X1YB 5CBFA 1XQ8A 3QO7A 2C2AA 3H01A 3D36A 4IYHA 3OTOB 3MHSC 3K3WA 1NZ6A 2B5UA 3UO2A 4QNHB 4I4TB 3ZMZA 5KHJA 2FKXA 1Z2GA 2A0LA 3E89A 4GKJO 3T1HB 1Y67A 1I5YA 4DO2A 5EZYB 2FTKA 5LGUA 1NT2B 3ABMB 3D36C 4DV4B 2EX3A 5GTHZ 3W7XA 3H1LH 1V55C 1XHXA 5D5PA 3STLC 1O9HA 4LWSA 4X66B 4WFBV 4HAMA 2GSMB 3CCQV 1Q43A 2WA4A 4L87A 1HNWO 1ZX3A 1NQTA 4UXNA 1B3QA 4XDKA 1AB3A 4FLTA 1I7FA 2BTOA 1RSOB 1S77D 2NN4A 3RFRA 4J80A 3JD2A 5JJJB 5JH7B 1H8EG 4MS2A 3T4DA 2QM4A 2XAJA 3N2GB 2JJ1G 3ZN1A 1SQXH 2OTLV 2CAZC 1NVPD 1SQPH 4FVMA 2PI5A 4GKJB 1BT8A 4NR1A 1ZSPA 5B5EZ 3AG1B 1OCOC 4QE9A 3MHHC 1CXZB 2IU3A 3NXSA 3ZRWB 3K04A 3ABTA 4R50A 1JOYA 3B4SA 2RDCA 4FZ1A 4CS3A 4X65B 4LF5O 1PL0A 4B3SB 2P67A 5KLVH 1Y66A 2GUZB 3RWRD 4K8XA 1FXKB 3CJHB 3OT7A 2XAFA 1F4MA 5JQGB 3F7YC 4AILC 4KP4A 1WP7A 3RYFB 2JIZG 1M56B 5CBGA 3ZHTA 1TVKB 4IT5A 5C93A 3R66A 1UPGA 4D7TA 1MSDA 1KMIZ 2B9ZA 3BRCA 4ICGA 2D2CB 5IY5C 2JRIA 1M1KW 4EB6A 5H6RA 2EINB 4AHCA 4J10A 5IJ9B 1PKXA 3ZMSA 1VP7A 4JYBA 3SPJA 1GN4A 4F6EA 2XNDG 2CTRA 4LF5B 1FAFA 1GH6A 3LDEA 4XBFA 2EILC 4O4JA 4CH6A 1K4DC 4J41A 4WFFA 2YDEA 1BGYH 4C7UA 3ZMVA 1XMOB 3UT5B 3SPGA 1ZLZA 1TUBB 3OMNB 4PA6A 1H2GA 1IX9A 1VQ5V 1KBHA 4I0XB 4LF7B 4GX2A 2IW5A 1YTFD 5J2UB 1HW7A 1QVGU 3BAAA 2WLLA 2NNUA 1HNZO 1VQLV 1KUQA 2YICA 3L73H 3SYQA 4JAAA 3BFRA 1SA0A 1IBLO 4DR6B 4WFHA 4NTWA 3BPZA 1SS3A 2LFSA 1F51A 1M90W 2WAMA 2DMXA 4ZIBA 3E83A 4IHJA 5C8YA 4GX1A 3HPLC 3T2MA 4ZHQA 3G80A 1FFXA 4XDJA 4DR7O 4LWSB 5E1AC 1YXBA 1S5HC 1R3IC 1MABG 2QWPB 3F5WC 1I94B 3L70H 4CH4A 3SJCC 5IDJA 1H2SB 1SZTA 4DR5B 3F7VC 1HNZB 1D5NA 4AQYO 3JD3A 4MVZA 4I55A 2AHYA 4WBNA 1IBLB 3QG5A 3RYHB 1AI7A 2ZR3A 3K79A 3QTCA 2CK3G 2X6BA 3CSXA 5CN0A 3CXCU 2PGGA 4MW3A 5A9GA 4I50A 4UVBA 2F66C 4U3JA 4HBNA 2UXBO 2XHBA 3WB2A 4LR3A 2GDSA 2DWDC 3K5NA 2ATKC 1JFFB 5LGNA 4JZ2A 5TISZ 1DGSA 3CE2A 2DW4A 2XAGA 5IY5B 2IU0A 4ZKIA 2Q0AA 4JI3B 5H6QA 4AQYB 5EC2C 4E2LA 4JV5B 4P9PA 2KQXA 2ZXWC 4A5UB 5KX5A 3OW2U 5IJ0A 4BR6A 5KUKA 3ABKC 2P4KA 5L3CA 1SQGA 4LNUA 1IBMB 3B77A 1R73A 1Q90D 2EILB 4EB6B 1T5EA 3OM3B 4FMTA 4CBCA 4MT8A 2QEXV 1AROP 2A9HA 2EULA 1ZL8A 2CH7A 4QGPA 2QKCA 4X20B 4OPAA 4BW5A 3PN1A 3BA9A 2RCVA 4J7ZA 1Q7YW 4DV6O 2DQ0A 4K0KO 3B2EE 2DYRC 2Q7EA 4YJ2A 4TV8B 3JD4A 4DK0A 1FKAO 4B08A 2EIKC 2YSUB 4W4KA 4DR3O 2W6JG 4FFBA 4IIJA 3FYEB 2QA4V 1Q5OA 3AG3B 2ZM6B 1ZAUA 1UJWB 2OTJV 1LNQA 3W7WA 2L6LA 3CC7V 1VQ4V 3CCSV 2BSKA 3LSQA 3K0DA 2WPDG 2P6JA 1SA0B 2Y69C 3JAKB 4X1YA 1RPOA 1TAEA 4R8CA 3D8CA 4DV5B 3RW0A 4LBEC 1GM9A 1N33O 5E79Z 2CGOA 2ZE6A 3F5TA 4GX5A 4DV6B 3FB7C 2Q73A 5C8YB 4K0KB 3CMAV 1AR4A 4ZHQB 1BS3A 5HFMA 4PI2A 5IYZB 5L3EA 1F7YA 1VEWA 1N4CA 1WPXA 4DR3B 1Q3EA 2QTSA 5CMUA 5FLXN 3KDRA 4QJFB 1VQ7V 4DV1O 1G4YB 3CCLV 1EN5A 4GZRB 2F43G 4H44B 3ZHQA 3OMIB 1L0LH 1WB8A 5GW7A 4HNAB 4WBNB 3FKSG 5JH7A 4JPRA 4B3MO 1N33B 3N2GA 4K3AA 4Q20A 3A0BZ 4JTDB 1KKDA 4I50B 1VQ6V 1M93A 1VQ9V 4F6RA 2Y48A 4U3JB 3GWOA 1O9GA 1AJPA 3GWKC 4OX9O 4YJ3B 3CCVV 2ZXWB 4UV9A 1WJZA 1BQZA 1EBOA 3OAAG 4I9QA 3ZRWA 3ABKB 2PF4E 5LMUO 3ZRVA 4GKKO 3A0HZ 1IZ3A 5F2VO 4LFCO 1MSWD 4MTXA 4DR4O 1FXKA 3CJHA 1Y6XA 5KX5B 4LC1A 1YEWA 4LFBO 2Z5UA 5IJ0B 3RYFA 4JAVA 1SRYA 1ENVA 4UVAA 4RQEA 1TVKA 2HG5C 3JARA 3ZX6A 2HVJC 2OT5A 3TK1A 1QR8A 1YVWA 3OR7C 4DR2B 3DC6A 2AZ2A 4B3RO 1FS0G 2CH7B 2ETNA 4JI2O 1EFRG 2P4VA 4OX9B 2B1GA 4P9OA 2EIKB 3SYPA 5H9CA 5B1BC 1OCZC 5LMUB 5LOVA 4RWUA 4QPKA 1COWG 4H13B 1P7GA 4DW1A 4UCSA 4LFCB 2BOCC 5CBHA 2JK5C 2IH3C 4MSWC 3D3QA 4X1KA 3OEHG 4TQDA 5LA6A 1B06A 3SR2C 4FFBB 4BAYA 2Y69B 3LSSA 4MVQA 2UUAO 1MMMA 1B6QA 2HJFC 4RAIA 3SPCA 3UT5A 2ZIMA 3K5OA 4JI7B 3CPWU 2LGQA 4I0XA 1Q6HA 3CRQA 3K03A 5KA6A 3W7TA 4ZBMA 2UXCO 5IT9N 5J2UA 2YUAA 4B3RB 3CWBH 3P3PA 4H33A 1N8RW 4TOIA 2CUGA 3WB1A 4CH3A 2WSSG 3LSUA 5A2QN 4UUJC 2CE4A 1YCIA 4GX0A 4MVMA 5DN6G 4FLVA 5KMGA 5KHKA 2UUCB 1N32O 3BY6A 2ZDIA 1M5IA 3M99B 4QE7A 3CX5F 1EM1A 2Q8VA 3DC5A 5ITZA 1NR7A 1SERA 2AZ0A 4YHHO 1DK1A 1KKCA 5LHIA 1IJGA 4LF9O 2LQTA 2EJRA 4ZI7A 2ZDIC 1KP2A 1VQOV 2GV9A 3WU2Z 2QDOA 1KU9A 2CTPA 3W7SA 4LF8B 2OIGA 3ABUA 2GTSA 3RVZA 5GONB 2UXCB 4IL6Z 3JAMN 4DUZO 1GMGA 4JI1O 3I55V 2CGNA 4Z1MG 2A79B 1AI6A 3QNEA 4J42A 1H8HG 1NU1H 4FLWA 4O2AA 5IYDO 2YXHA 3SDLA 3ZHUA 3U10A 4NXMO 1WP8A 1N32B 3RYHA 2WLIB 1N0NA 3N2KB 4F6RB 5K1XA 1SQFA 1AP6A 2RQ6A 1V54C 3IFXA 1K4CC 2Z0AA 2F1MA 1A32A 4FM0A 3RYIB 1FPOA 1FOUA 3T1YO 1KP3A 4JZGA 3CCRV 4U7OA 2JEXA 2YC0A 4O2BB 4N23A 1HNWB 4NVPA 5JVDB 4JI6O 3OGIB 5BZBA 1EZVH 3TXSA 5L3BA 1SESA 2QWNB 1SETA 4NXNO 1JFFA 2Y0IA 4DUZB 4NYKA 1GM8A 3OGCC 5B1AC 3P32A 4TWKA 2MK3A 3VQVA 4WF9V 1XILA 2Q69A 1KD1W 2D3OW 2QKSA 1P84F 1XI1A 3JARB 4PA4A 2Q5ZA 3JCUZ 1YI2V 4NXMB 4WFEA 4X8AA 5B1BB 1OCZB 3CYOA 3RVYA 4FZ0A 2ZR2A 3ZBHA 1GTOA 2Y4UA 2CTWA 5K1PA 1WN7A 3CS5A 4UB8Z 3EFFK 1XOUA 2YIAA 2RN9A 4QIWF 1Q8IA 2ZT9B 3ZMUA 5LOVB 4X1IB 5KAFZ 4X20A 1MNGA 1OZ0A 2R9AA 4JI6B 4CC5A 1BHAA 2DYSC 3EHBB 5JCOC 1GAXA 2JGDB 4DW0A 4FLYA 2VWKA 4X1KB 5EBMC 5KA5A 4PJ0Z 5LA6B 1GM7A 4NTXA 3ZCCA 4EFEA 2HFEC 4J9YB 3MAQA 1RPRA 4Z2WA 4TV8A 3ETGA 4JYAO 1RP3B 4G2KA 3APOA 3K9SA 2O57A 2E5LO 5JJEB 3TCUA 2YEVA 2GBOA 1FYJA 3E8GA 5KHHA 1G6UA 1H2KA 3DGEA 1KB9F 3JAKA 2VQFO 3KCXA 5KMGB 2ILMA 3AG3C 3X2QC 5B3SC 1BQ0A 4KFMA 3ZIAG 3B09A 4DV3O 5DECA 3VQYA 5ITZB 1GRJA 3CCJV 2HR3A 4K35A 1JX9A 1MA1A 4ZI7B 4J7KA 5IYZA 1R3LC 3CD6V 4QPJA 2E76B 4WFGA 1EN4A 3CP1A 1AR1B 2E75B 1SQQH 3JYCA 1NS1A 3KZIZ 5D5QA 4WCEV 1JJOA 4MVSA 5CA0B 2IBZH 2E5LB 5B1OA 1DTOA 1V54B 3SPIA 4MW8A 3UO3A 4LH6A 2BOBC 2Q0OC 1NVPB 3JCZA 5EC1C 2GTAA 5JWPA 2R70A 4O2AB 3CRCA 4HNAA 4I9WA 1QLNA 3JSNA 4I5SA 2OYQA 2DQ3A 1BSMA 1I08A 4H0LB 2BE3A 1FD9A 3UQ8A 1L1FA 1Q6UA 3QVNA 2Y0PA 2XASA 3ASOB 1JQ0A 2NLJC 4TSFG 2JEUA 2DE0X 5B1AB 3FB8C 4DR7B 1SC5B 2IJJA 1CPYA 4DV0O 1MOFA 3RBZA 3VQWA 3HKDB 4UB6Z 3FFQA 3QF7A 4YJ3A 2EIJC 3K9AA 1WPBA 5FL7G 4UCUA 5LGTA 4BIOA 1GN3A 3W7UA 3H1IH 2F4VO 1OCCC 1QQCA 3E8BA 4IGGA 3RT3C 1G8MA 1Q81W 2HHHO 4PELA 1W2BU 3CC2V 1U97A 1OCRC 5DEDA 5LYJA 1XDCA 1X59A 4E4EA 3FYIB 2DYSB 2H94A 4FM1A 4LF4O 1N0JA 2P22C 4JI5O 1S76D 3C3SA 3LUTB 4X64O 2E74B 2ITDC 2P7TC 2UXBB 3EXAA 5JJNB 2ADPA 1IXMA 1G1XB 3O65A 5BY1A 4LF6O 1R1BA 1XL6A 2UXDO 4G27B 3I56V 2F4VB 2RNBA 1VQMV 1YTFB 3IC7A 5LMNO 1QNMA 3Q4HA 1YZBA 2YIDA 1J5EO 1FXVA 4FLZA 3SYCA 3X2QB 5B3SB 2H3OA 4KUMA 2XT9A 2QSAA 4PDVA 1QCEA 1JNBA 3L74H 4LH7A 2YEVB 1E1RG 1DLBA 4LF4B 2E3CA 1JVMA 1LUVA 3AG7A 1TUEB 4JI5B 1XNQO 2QGNA 3ZS8C 4X64B 2Q68A 2HJDA 4Z1VA 3S3XA 2AXTZ 4BWAA 1AILA 4LF6B 1HDJA 4O4HB 3K5MA 2RJZA 2LW1A 4O4IA 2XAQA 2X0LA 3K57A 3K58A 5LMNB 4DUYO 1YJ9V 2KG7B 1U96A 1J5EB 1K5SA 1VIBA 1QR9A 5BXZA 1MG1A 2N05A 1K9MW 2NR5A 3BHPA 1ZUQA 2L35A 3ZMTA 3OR6C 2QE7G 1V9PA 3FB5C 5GONA 5IYBO 4MTFA 1XNQB 3WB0A 5IWAO 1S72V 2Q9LA 4LP8A 2YIBD 1XNRO 1AP5A 2EIJB 1ZTEA 4W4LA 4JTAB 2WLIA 2ZNJA 4CH5A 3N2KA 3BA8A 3A2FA 3K5LA 3HKEA 3E86A 3SYAA 1Y74A 5EBWC 2IM9A 1OCCB 3SJAC 4JI8O 3RYIA 1AR5A 3CRMA 1AVMA 4FM2A 1OCRB 4DV1B 4O2BA 3CCUV 1IXBA 1PPJH 3LNNA 5JVDA 4UCOA 1SKVA 1JPXA 3HKCA 4PA3A 3KKYA 1M9NA 3SJQC 2R9IA 5IWAB 2YS8A 5LYJB 3CHXA 2LW7A 4B3MB 2X6AA 2YI8A 4B3TO 2X7RB 3ETDA 2WLKA 3STZC 1LUWA 1VQPV 1JCHA 4DV7O 1WA8A 3A0RA 1KYOF 4P2ZA 3CXHF 3D3IA 1VMGA 2BCCH 2A7WA 1YF2A 2QKAA 4JI8B 3J7AU 1US6A 3JATB 3OUSA 2G38A 4MTOA 2HP8A 4F4LA 1TGOA 1PNKA 4X1IA 4GKKB 3OEEG 4ZOLB 3CCEV 2K9PA 1XMQO 4DR4B 2JGDA 4YXWG 2PY5A 1VF5B 4LFBB 2A3QA 3Q4HB 4RO2A 3OTOO 1QLEC 2HLDG 5LP6C 4WFAV 3CMEV 3T1CA 2PZSA 1I0HA 3LNMB 4B3TB 4OPHA 3T1HO 3VOUA 1FJGO 3SYOA 1Z5VA 4TUYB 2FYUH 1EN6A 3ML0A 2GHYA 1HP8A 4JI2B 4AI8A 4DXWA 2OWOA 4MTGA 2YXLA 3JD1A 4HZ3A 5CA1B 3E22A 2OCHA 2XTAA 3ZRSA 4CS2A 4NKGB 3LDCA 1FXHA 1XHZA 3JAWA 4FJCC 5LHGA 2ADQB 4O4IB 1QU7A 2LJ2A 3B8NA 3AK3A 1XMQB 2R9RB 1X4TA 3P30A 2UXNA 3G67A 3OD4A 5EIBD 3AEIA 3K06A 3ZRXA 2PYLA 2R72A 4FK5C 4JAUA 3GVMA 3UM7A 1H38A 2Q6AA 2Q7GA 2UUAB 5EIBC 1SZXA 3FAVB 3HKBB 2DOSA 1YJNV 1IURA 1PNMA 4N21A 2LP7A 2DWEC 3R65A 1FJGB 1UFIA 1NTKH 2YI9A 5CA0A 4FPPA 3CCMV 2HVKC 1KECA 2W6IG 3OTFA 3DXRB 3BCCH 1WNSA 3ZHSA 5DM6V 2Z3YA 4JASA 2X6CA 1RFYA 1F23A 4X65O 1FFTB 3NR7A 4B3SO 3BABA 1AJQA 3OUFA 3HKEB 2JDIG 5FNVB 4MVRA 3CRRA 1Y74B 4YHHB 3HR0A 2JVDA 5KHGA 3G6BA 4LF9B 2A06H 3O9OA 1P49A 1WAZA 1JJ2U 3JALA 1OHHG 4BIZA 3RYCB 3HKDA 3VQXA 3TETA 2QM7A 3HKCB 4UCTA 3IC9A 3AG2C 3ASOC 4JI1B 1OJHA 1NTMH 3WG7C 2ZNIA 3B8MA 2BTQA 2WLMA 1K92A 5AG2A 5HFLA 5B1NA 4PA7A 1NJIW 1K97A 1XUQA 3OE7G 4U3FH 4X62O 2CDYA 3SGIA 1AI5A 1H2NA 1WA8B 2FL4A 1TA8A 4UV8A 2F93B 2QWOB 1R3KC 2IJKA 5JCOA 1N34O 3P3NA 4EKWA 2ITCC 2QJ1A 3K0GA 2ZE5A 2EJ7A 1YJWV 3T1YB 1LR1A 3H1HH 2Q4PA 1XMOO 2ODMA 3ICXA 3ZHVA 2DN9A 4JI4O 1Y76B 1QLEB 5BMVA 1MZEA 2QR4A 3ETEA 2FMLA 1Q6IA 4LCUC 1NKDA 4PDLA 4TV9B 5LP6B 4LF7O 2RMKB 2V1DA 1F4NA 2XAHA 1SQVH 3QO5A 2LFRA 4PA9A 5FPOA 1L8DA 4NXNB 4RQFA 4JYYA 4UFZA 1EZJA 5J2TA 2QWQB 2ZKOA 3CEIA 2Y4TA 1YIJV 3PJSK 4DR6O 4P30A 1H2LA 1J95A 2WWWA 4X62B 3K59A 1DF4A 4B7KA 5CB4B 1L0NH 1K5QA 3DSQA 3ZN0A 4DYLA 3RGBA 4FLXA 4NTYA 1H2MA 3WFVA 3CB2A 4PI0A 1JR9A 1THZA 1N34B 3TGUH 3U11A 2JS5A 1YDXA 3E22B 2VQEO 1PP9H 2QM8A 3L9DA 4JI4B 3JAWB 3DTUB 1I94O 2QTOA 1B04A 1BMFG 2FB5A 4DV2O 1DF5A 4RUEA 4DR5O 3H1JH 5EYPA 4O4HA 1R6NA 4K8ZA 1Y4MA 1NH2D 3H1KH 4JTCB 4GYCB 4PD4F 1V55B 4LFAO 3MDSA 2JJ2G 1NR1A 3L75H 1BHBA 4JYAB 1M57C 1Q86W 2KG7A 3OMAB 3T4ZA 4HYOA 3G71V 1XEQA 3J81N 3UKMA 4KL1A 5H5NA 1P4RA 2EIMC 4FIPC 2IJIA 1H5WA 2VQEB 4O4LA 4UCVA 4YY3O 4ABMA 1QHTA 2VQFB 1YHQV 2V4DA 3AG4C 2IJHA 2EBOA 2LO1A 2ZE8A 1SQBH 1GN2A 4DV2B 1N36O 2HEPA 4DV3B 3LDDA 1E79G 1IBKO 2AGAA 4JI3O 1GK9A 3AG2B 1OCOB 1VQNV 3CC4V 4JV5O 3WG7B 4LFAB 2M6YA 3JALB 1JMKC 5L3GA 4X89A 3BVOA 2KB1A 4CZZA 2H8PC 2ZINA 3SJBC 1IBMO 2ZD9A 2N74A 3M7MX 2MW2B 1I5XA 1D5AA 4EEQA 2BTQB 4UVCA 3TXQA 2ZQMA 4OGQB 4L8JA 4YY3B 4YIPA 1AI4A 5B66Z 3E35A 2K1EA 2F23A 1PL4A 1P7BA 5FPRA 3JD0A 1K7DA 1WB7A 1N36B 1XREA 3QO8A 2ARHA 3C3TA 2WA3A 1XBLA 4BIUA 5LXTA 1IBKB 2VWJA 1R6TA 4MVOA 2UU9O 5GTIZ 3JASA 1K3EA 2P5OA 4JGSA 2JGUA 4DV0B 5BMVB 4PDRA 5L3FA 4D7SA 4X9QA 4FFKA 2ZM6O 1IVSA 3FX7A 1Z5WA 4IYIA 2KSDA 4B7EA 2B1IA 2JS3A 3JATA 3KG2A 4XDLA 4RUFA 4OXSA 1NI8A 1GO3F 2IH1C 3G6EV 1KC8W 2PYJA 5J2TB 1D2DA 1WLEA 4ZOLA 2W0FC 3IJ4A 4DV5O 3ASNC 3U0ZA 1GN6A 2EZOA 2HHHB 3SPHA 4O4JB 3I5DA 2DJVA 2M7WA 1NTZH 2HKOA 5LL6Y 2Q67A 4TQFA 1OV9A 3B40A 1BCCH 5L3DA 2PUSA 3MD0A 2UU9B 5IE9A 1SF9A 2OCCC 5KHIA 4PHZA 3E8FA 4TUYA 3APQA 4GUNA 1VARA 1NH2B 1M57B 5CA1A 1GKFA 2Q7HA 2WLLB 4J11A 1RM1C 5EYPB 1M4UA 3FD9A 1ZWIC 2N04A 1BE3H 2W0XA 1VF7A 2KKWA 4DRXA 3K08A 3ABLC 2UXDB 5BR8O 2ZIOA 1W0JG 2EIMB 4Q6GA 4CC6A 1VF6A 5H2FZ 4BW9A 4ASUG 3L71H 4U7NA 3AG4B 4CS4A 5CA3A 2UXXA 4IHJB 2PTMA 4I4TA 2F95B 4I7ZB 3FAVA 3E8HA 3HKBA 2AHZA 2WLHA 4DR1O 1FFXB 3UCSC 3HB3B 1S5JA 5EZYA 1VF6C 3BEHA 4O4LB 3THOA 1PD3A 2YIBA 4H37A 2UUBO 3DXRA 4PDMA 1VQ8V 3N27A 1XL4A 5KAIZ 1CEZA 4PV1B 1W59A 3ZJZA 3GB7C 3C90A 1K8AW 5EBLC 3ABMC 2CTQA 1BL8A 3G4SV 4I55B 1QBZA 1RSOA 5BR8B 1PM9A 3S3WA 4KHPO 4D6TH 5FNVA 4DUYB 1MZFA 3RN4A 4YIOA 4GT1A 4GLXA 3OFNG 4J9ZB 3J80N 1PV0A 4FLUA 4JI0O 2WLJA 4J7JA 1S0VA 1IDSA 2OIEA 4DR1B 3VBBA 1CP9A 3RYCA 5KUMA 4JYCA 4DR2O 3JSLA 1K73W 1K33A 3L72H 1R6KA 2UUBB 2ZE7A 1HWYA 5IYCO 4GCZA 1VQKV 1S3JA 4KXRA 2VS0A 3ZEDA 3ZHRA 1XNRB 5LXTB 2GUZA 5EK0A 3AG1C 3JASB 1HR0O 4NB5A 5JQGA 5LHHA 4KHPB 2VRZA 3ETQA 2YXYA 4MVUA 2XOKG 4R7CA 1K34A 4LNUB 1ROPA 4R6ZA 3ASNB 4DK1A 2WLNA 2ZCEA 3AK2A 1W0KG 1FXKC 4JI0B 1HNXO 4JI7O 1Y76A 4JF3A 3M8AA 3CRAA 5LP6A 1PNLA 4TV9A 1E1QG 1BZKA 2P90A 4EFBA 2DYRB 3E2EA 1ZL8B 1M56C
chains in the Genus database with same CATH topology
1EN6A 4C7UA 1JA8A 3EVKA 1QNMA 3MDSA 3TJTA 5AG2A 1AR5A 4X9QA 4FFKA 1ZLZA 2GDSA 1AVMA 1BSMA 1I08A 1XUQA 1MNGA 1IX9A 2CDYA 2ADQB 1BT8A 3AK3A 4JZ2A 1AR4A 1IXBA 1BS3A 1ZSPA 3QVNA 3DC6A 1LUVA 1VEWA 1PM9A 3KKYA 3BFRA 3AK1A 3RN4A 4YIOA 4BR6A 1GN6A 3KDRA 1SZXA 2P4KA 1GN2A 3K9SA 1N0NA 1IDSA 3OT7A 1P7GA 1LUWA 1EN5A 1AP6A 2AW9A 1GN3A 4JYYA 1WB8A 1B06A 3CEIA 2QKAA 4JZGA 2QKCA 4GUNA 1VARA 1MMMA 1MSDA 2RCVA 1XDCA 4E4EA 1Y67A 1ZUQA 1JR9A 1D5NA 1MA1A 1N0JA 3C3SA 1XILA 4YIPA 1GN4A 4F6EA 1EN4A 3LSUA 1PL4A 2ADPA 2CE4A 1I0HA 1WB7A 3AK2A 1AP5A 1ZTEA 1XREA 3C3TA 1EM1A 3IC9A 3DC5A 5A9GA 1KKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EN6 A;  4C7U A;  1JA8 A;  3EVK A;  1QNM A;  3MDS A;  3TJT A;  5AG2 A;  1AR5 A;  4X9Q A;  4FFK A;  1ZLZ A;  2GDS A;  1AVM A;  1BSM A;  1I08 A;  1XUQ A;  1MNG A;  1IX9 A;  2CDY A;  2ADQ B;  1BT8 A;  3AK3 A;  4JZ2 A;  1AR4 A;  1IXB A;  1BS3 A;  1ZSP A;  3QVN A;  3DC6 A;  1LUV A;  1VEW A;  1PM9 A;  3KKY A;  3BFR A;  3AK1 A;  3RN4 A;  4YIO A;  4BR6 A;  1GN6 A;  1SZX A;  2P4K A;  1GN2 A;  3K9S A;  1N0N A;  1IDS A;  3OT7 A;  1P7G A;  1LUW A;  1EN5 A;  1AP6 A;  2AW9 A;  1GN3 A;  4JYY A;  1WB8 A;  1B06 A;  3CEI A;  2QKA A;  4JZG A;  2QKC A;  4GUN A;  1VAR A;  1MMM A;  1MSD A;  2RCV A;  1XDC A;  4E4E A;  1Y67 A;  1ZUQ A;  1JR9 A;  1D5N A;  1MA1 A;  1N0J A;  3C3S A;  1XIL A;  4YIP A;  1GN4 A;  4F6E A;  1EN4 A;  3LSU A;  1PL4 A;  2ADP A;  2CE4 A;  1I0H A;  1WB7 A;  3AK2 A;  1AP5 A;  1ZTE A;  1XRE A;  3C3T A;  1EM1 A;  3IC9 A;  3DC5 A;  5A9G A;  1KKC A; 
#chains in the Genus database with same CATH topology
 2XUM A;  3H9V A;  1KQS U;  3IGA C;  2QWR B;  4UCR A;  1JA8 A;  3EVK A;  2OCC B;  4G28 B;  1YSC A;  1URF A;  5IJ9 A;  3TJT A;  1Q82 W;  2P06 A;  3IAY A;  5J9P C;  2PI4 A;  2UUC O;  3FB6 C;  2EZP A;  4TT3 G;  1NBM G;  1RM1 B;  1YIT V;  4DV7 B;  5CB4 A;  4YJ2 B;  1HR0 B;  1R3J C;  4DV4 O;  2EIN C;  1S5L Z;  3ABL B;  4IIJ B;  5LBQ A;  3AK1 A;  1AJN A;  4X88 A;  4X66 O;  1QVF U;  2V7Q G;  3A8T A;  3KCY A;  2LGW A;  4LF8 O;  2BSK B;  1HNX B;  1TUB A;  4DRX B;  2AW9 A;  1ORQ C;  4X1Y B;  5CBF A;  1XQ8 A;  3QO7 A;  2C2A A;  3H01 A;  3D36 A;  4IYH A;  3OTO B;  3MHS C;  3K3W A;  1NZ6 A;  2B5U A;  3UO2 A;  4QNH B;  4I4T B;  3ZMZ A;  5KHJ A;  2FKX A;  1Z2G A;  2A0L A;  3E89 A;  4GKJ O;  3T1H B;  1Y67 A;  1I5Y A;  4DO2 A;  5EZY B;  2FTK A;  5LGU A;  1NT2 B;  3ABM B;  3D36 C;  4DV4 B;  2EX3 A;  5GTH Z;  3W7X A;  3H1L H;  1V55 C;  1XHX A;  5D5P A;  3STL C;  1O9H A;  4LWS A;  4X66 B;  4WFB V;  4HAM A;  2GSM B;  3CCQ V;  1Q43 A;  2WA4 A;  4L87 A;  1HNW O;  1ZX3 A;  1NQT A;  4UXN A;  1B3Q A;  4XDK A;  1AB3 A;  4FLT A;  1I7F A;  2BTO A;  1RSO B;  1S77 D;  2NN4 A;  3RFR A;  4J80 A;  3JD2 A;  5JJJ B;  5JH7 B;  1H8E G;  4MS2 A;  3T4D A;  2QM4 A;  2XAJ A;  3N2G B;  2JJ1 G;  3ZN1 A;  1SQX H;  2OTL V;  2CAZ C;  1NVP D;  1SQP H;  4FVM A;  2PI5 A;  4GKJ B;  1BT8 A;  4NR1 A;  1ZSP A;  5B5E Z;  3AG1 B;  1OCO C;  4QE9 A;  3MHH C;  1CXZ B;  2IU3 A;  3NXS A;  3ZRW B;  3K04 A;  3ABT A;  4R50 A;  1JOY A;  3B4S A;  2RDC A;  4FZ1 A;  4CS3 A;  4X65 B;  4LF5 O;  1PL0 A;  4B3S B;  2P67 A;  5KLV H;  1Y66 A;  2GUZ B;  3RWR D;  4K8X A;  1FXK B;  3CJH B;  3OT7 A;  2XAF A;  1F4M A;  5JQG B;  3F7Y C;  4AIL C;  4KP4 A;  1WP7 A;  3RYF B;  2JIZ G;  1M56 B;  5CBG A;  3ZHT A;  1TVK B;  4IT5 A;  5C93 A;  3R66 A;  1UPG A;  4D7T A;  1MSD A;  1KMI Z;  2B9Z A;  3BRC A;  4ICG A;  2D2C B;  5IY5 C;  2JRI A;  1M1K W;  4EB6 A;  5H6R A;  2EIN B;  4AHC A;  4J10 A;  5IJ9 B;  1PKX A;  3ZMS A;  1VP7 A;  4JYB A;  3SPJ A;  1GN4 A;  4F6E A;  2XND G;  2CTR A;  4LF5 B;  1FAF A;  1GH6 A;  3LDE A;  4XBF A;  2EIL C;  4O4J A;  4CH6 A;  1K4D C;  4J41 A;  4WFF A;  2YDE A;  1BGY H;  4C7U A;  3ZMV A;  1XMO B;  3UT5 B;  3SPG A;  1ZLZ A;  1TUB B;  3OMN B;  4PA6 A;  1H2G A;  1IX9 A;  1VQ5 V;  1KBH A;  4I0X B;  4LF7 B;  4GX2 A;  2IW5 A;  1YTF D;  5J2U B;  1HW7 A;  1QVG U;  3BAA A;  2WLL A;  2NNU A;  1HNZ O;  1VQL V;  1KUQ A;  2YIC A;  3L73 H;  3SYQ A;  4JAA A;  3BFR A;  1SA0 A;  1IBL O;  4DR6 B;  4WFH A;  4NTW A;  3BPZ A;  1SS3 A;  2LFS A;  1F51 A;  1M90 W;  2WAM A;  2DMX A;  4ZIB A;  3E83 A;  4IHJ A;  5C8Y A;  4GX1 A;  3HPL C;  3T2M A;  4ZHQ A;  3G80 A;  1FFX A;  4XDJ A;  4DR7 O;  4LWS B;  5E1A C;  1YXB A;  1S5H C;  1R3I C;  1MAB G;  2QWP B;  3F5W C;  1I94 B;  3L70 H;  4CH4 A;  3SJC C;  5IDJ A;  1H2S B;  1SZT A;  4DR5 B;  3F7V C;  1HNZ B;  1D5N A;  4AQY O;  3JD3 A;  4MVZ A;  4I55 A;  2AHY A;  4WBN A;  1IBL B;  3QG5 A;  3RYH B;  1AI7 A;  2ZR3 A;  3K79 A;  3QTC A;  2CK3 G;  2X6B A;  3CSX A;  5CN0 A;  3CXC U;  2PGG A;  4MW3 A;  5A9G A;  4I50 A;  4UVB A;  2F66 C;  4U3J A;  4HBN A;  2UXB O;  2XHB A;  3WB2 A;  4LR3 A;  2GDS A;  2DWD C;  3K5N A;  2ATK C;  1JFF B;  5LGN A;  4JZ2 A;  5TIS Z;  1DGS A;  3CE2 A;  2DW4 A;  2XAG A;  5IY5 B;  2IU0 A;  4ZKI A;  2Q0A A;  4JI3 B;  5H6Q A;  4AQY B;  5EC2 C;  4E2L A;  4JV5 B;  4P9P A;  2KQX A;  2ZXW C;  4A5U B;  5KX5 A;  3OW2 U;  5IJ0 A;  4BR6 A;  5KUK A;  3ABK C;  2P4K A;  5L3C A;  1SQG A;  4LNU A;  1IBM B;  3B77 A;  1R73 A;  1Q90 D;  2EIL B;  4EB6 B;  1T5E A;  3OM3 B;  4FMT A;  4CBC A;  4MT8 A;  2QEX V;  1ARO P;  2A9H A;  2EUL A;  1ZL8 A;  2CH7 A;  4QGP A;  2QKC A;  4X20 B;  4OPA A;  4BW5 A;  3PN1 A;  3BA9 A;  2RCV A;  4J7Z A;  1Q7Y W;  4DV6 O;  2DQ0 A;  4K0K O;  3B2E E;  2DYR C;  2Q7E A;  4YJ2 A;  4TV8 B;  3JD4 A;  4DK0 A;  1FKA O;  4B08 A;  2EIK C;  2YSU B;  4W4K A;  4DR3 O;  2W6J G;  4FFB A;  4IIJ A;  3FYE B;  2QA4 V;  1Q5O A;  3AG3 B;  2ZM6 B;  1ZAU A;  1UJW B;  2OTJ V;  1LNQ A;  3W7W A;  2L6L A;  3CC7 V;  1VQ4 V;  3CCS V;  2BSK A;  3LSQ A;  3K0D A;  2WPD G;  2P6J A;  1SA0 B;  2Y69 C;  3JAK B;  4X1Y A;  1RPO A;  1TAE A;  4R8C A;  3D8C A;  4DV5 B;  3RW0 A;  4LBE C;  1GM9 A;  1N33 O;  5E79 Z;  2CGO A;  2ZE6 A;  3F5T A;  4GX5 A;  4DV6 B;  3FB7 C;  2Q73 A;  5C8Y B;  4K0K B;  3CMA V;  1AR4 A;  4ZHQ B;  1BS3 A;  5HFM A;  4PI2 A;  5IYZ B;  5L3E A;  1F7Y A;  1VEW A;  1N4C A;  1WPX A;  4DR3 B;  1Q3E A;  2QTS A;  5CMU A;  5FLX N;  3KDR A;  4QJF B;  1VQ7 V;  4DV1 O;  1G4Y B;  3CCL V;  1EN5 A;  4GZR B;  2F43 G;  4H44 B;  3ZHQ A;  3OMI B;  1L0L H;  1WB8 A;  5GW7 A;  4HNA B;  4WBN B;  3FKS G;  5JH7 A;  4JPR A;  4B3M O;  1N33 B;  3N2G A;  4K3A A;  4Q20 A;  3A0B Z;  4JTD B;  1KKD A;  4I50 B;  1VQ6 V;  1M93 A;  1VQ9 V;  4F6R A;  2Y48 A;  4U3J B;  3GWO A;  1O9G A;  1AJP A;  3GWK C;  4OX9 O;  4YJ3 B;  3CCV V;  2ZXW B;  4UV9 A;  1WJZ A;  1BQZ A;  1EBO A;  3OAA G;  4I9Q A;  3ZRW A;  3ABK B;  2PF4 E;  5LMU O;  3ZRV A;  4GKK O;  3A0H Z;  1IZ3 A;  5F2V O;  4LFC O;  1MSW D;  4MTX A;  4DR4 O;  1FXK A;  3CJH A;  1Y6X A;  5KX5 B;  4LC1 A;  1YEW A;  4LFB O;  2Z5U A;  5IJ0 B;  3RYF A;  4JAV A;  1SRY A;  1ENV A;  4UVA A;  4RQE A;  1TVK A;  2HG5 C;  3JAR A;  3ZX6 A;  2HVJ C;  2OT5 A;  3TK1 A;  1QR8 A;  1YVW A;  3OR7 C;  4DR2 B;  3DC6 A;  2AZ2 A;  4B3R O;  1FS0 G;  2CH7 B;  2ETN A;  4JI2 O;  1EFR G;  2P4V A;  4OX9 B;  2B1G A;  4P9O A;  2EIK B;  3SYP A;  5H9C A;  5B1B C;  1OCZ C;  5LMU B;  5LOV A;  4RWU A;  4QPK A;  1COW G;  4H13 B;  1P7G A;  4DW1 A;  4UCS A;  4LFC B;  2BOC C;  5CBH A;  2JK5 C;  2IH3 C;  4MSW C;  3D3Q A;  4X1K A;  3OEH G;  4TQD A;  5LA6 A;  1B06 A;  3SR2 C;  4FFB B;  4BAY A;  2Y69 B;  3LSS A;  4MVQ A;  2UUA O;  1MMM A;  1B6Q A;  2HJF C;  4RAI A;  3SPC A;  3UT5 A;  2ZIM A;  3K5O A;  4JI7 B;  3CPW U;  2LGQ A;  4I0X A;  1Q6H A;  3CRQ A;  3K03 A;  5KA6 A;  3W7T A;  4ZBM A;  2UXC O;  5IT9 N;  5J2U A;  2YUA A;  4B3R B;  3CWB H;  3P3P A;  4H33 A;  1N8R W;  4TOI A;  2CUG A;  3WB1 A;  4CH3 A;  2WSS G;  3LSU A;  5A2Q N;  4UUJ C;  2CE4 A;  1YCI A;  4GX0 A;  4MVM A;  5DN6 G;  4FLV A;  5KMG A;  5KHK A;  2UUC B;  1N32 O;  3BY6 A;  2ZDI A;  1M5I A;  3M99 B;  4QE7 A;  3CX5 F;  1EM1 A;  2Q8V A;  3DC5 A;  5ITZ A;  1NR7 A;  1SER A;  2AZ0 A;  4YHH O;  1DK1 A;  1KKC A;  5LHI A;  1IJG A;  4LF9 O;  2LQT A;  2EJR A;  4ZI7 A;  2ZDI C;  1KP2 A;  1VQO V;  2GV9 A;  3WU2 Z;  2QDO A;  1KU9 A;  2CTP A;  3W7S A;  4LF8 B;  2OIG A;  3ABU A;  2GTS A;  3RVZ A;  5GON B;  2UXC B;  4IL6 Z;  3JAM N;  4DUZ O;  1GMG A;  4JI1 O;  3I55 V;  2CGN A;  4Z1M G;  2A79 B;  1AI6 A;  3QNE A;  4J42 A;  1H8H G;  1NU1 H;  4FLW A;  4O2A A;  5IYD O;  2YXH A;  3SDL A;  3ZHU A;  3U10 A;  4NXM O;  1WP8 A;  1N32 B;  3RYH A;  2WLI B;  1N0N A;  3N2K B;  4F6R B;  5K1X A;  1SQF A;  1AP6 A;  2RQ6 A;  1V54 C;  3IFX A;  1K4C C;  2Z0A A;  2F1M A;  1A32 A;  4FM0 A;  3RYI B;  1FPO A;  1FOU A;  3T1Y O;  1KP3 A;  4JZG A;  3CCR V;  4U7O A;  2JEX A;  2YC0 A;  4O2B B;  4N23 A;  1HNW B;  4NVP A;  5JVD B;  4JI6 O;  3OGI B;  5BZB A;  1EZV H;  3TXS A;  5L3B A;  1SES A;  2QWN B;  1SET A;  4NXN O;  1JFF A;  2Y0I A;  4DUZ B;  4NYK A;  1GM8 A;  3OGC C;  5B1A C;  3P32 A;  4TWK A;  2MK3 A;  3VQV A;  4WF9 V;  1XIL A;  2Q69 A;  1KD1 W;  2D3O W;  2QKS A;  1P84 F;  1XI1 A;  3JAR B;  4PA4 A;  2Q5Z A;  3JCU Z;  1YI2 V;  4NXM B;  4WFE A;  4X8A A;  5B1B B;  1OCZ B;  3CYO A;  3RVY A;  4FZ0 A;  2ZR2 A;  3ZBH A;  1GTO A;  2Y4U A;  2CTW A;  5K1P A;  1WN7 A;  3CS5 A;  4UB8 Z;  3EFF K;  1XOU A;  2YIA A;  2RN9 A;  4QIW F;  1Q8I A;  2ZT9 B;  3ZMU A;  5LOV B;  4X1I B;  5KAF Z;  4X20 A;  1MNG A;  1OZ0 A;  2R9A A;  4JI6 B;  4CC5 A;  1BHA A;  2DYS C;  3EHB B;  5JCO C;  1GAX A;  2JGD B;  4DW0 A;  4FLY A;  2VWK A;  4X1K B;  5EBM C;  5KA5 A;  4PJ0 Z;  5LA6 B;  1GM7 A;  4NTX A;  3ZCC A;  4EFE A;  2HFE C;  4J9Y B;  3MAQ A;  1RPR A;  4Z2W A;  4TV8 A;  3ETG A;  4JYA O;  1RP3 B;  4G2K A;  3APO A;  3K9S A;  2O57 A;  2E5L O;  5JJE B;  3TCU A;  2YEV A;  2GBO A;  1FYJ A;  3E8G A;  5KHH A;  1G6U A;  1H2K A;  3DGE A;  1KB9 F;  3JAK A;  2VQF O;  3KCX A;  5KMG B;  2ILM A;  3AG3 C;  3X2Q C;  5B3S C;  1BQ0 A;  4KFM A;  3ZIA G;  3B09 A;  4DV3 O;  5DEC A;  3VQY A;  5ITZ B;  1GRJ A;  3CCJ V;  2HR3 A;  4K35 A;  1JX9 A;  1MA1 A;  4ZI7 B;  4J7K A;  5IYZ A;  1R3L C;  3CD6 V;  4QPJ A;  2E76 B;  4WFG A;  1EN4 A;  3CP1 A;  1AR1 B;  2E75 B;  1SQQ H;  3JYC A;  1NS1 A;  3KZI Z;  5D5Q A;  4WCE V;  1JJO A;  4MVS A;  5CA0 B;  2IBZ H;  2E5L B;  5B1O A;  1DTO A;  1V54 B;  3SPI A;  4MW8 A;  3UO3 A;  4LH6 A;  2BOB C;  2Q0O C;  1NVP B;  3JCZ A;  5EC1 C;  2GTA A;  5JWP A;  2R70 A;  4O2A B;  3CRC A;  4HNA A;  4I9W A;  1QLN A;  3JSN A;  4I5S A;  2OYQ A;  2DQ3 A;  1BSM A;  1I08 A;  4H0L B;  2BE3 A;  1FD9 A;  3UQ8 A;  1L1F A;  1Q6U A;  3QVN A;  2Y0P A;  2XAS A;  3ASO B;  1JQ0 A;  2NLJ C;  4TSF G;  2JEU A;  2DE0 X;  5B1A B;  3FB8 C;  4DR7 B;  1SC5 B;  2IJJ A;  1CPY A;  4DV0 O;  1MOF A;  3RBZ A;  3VQW A;  3HKD B;  4UB6 Z;  3FFQ A;  3QF7 A;  4YJ3 A;  2EIJ C;  3K9A A;  1WPB A;  5FL7 G;  4UCU A;  5LGT A;  4BIO A;  1GN3 A;  3W7U A;  3H1I H;  2F4V O;  1OCC C;  1QQC A;  3E8B A;  4IGG A;  3RT3 C;  1G8M A;  1Q81 W;  2HHH O;  4PEL A;  1W2B U;  3CC2 V;  1U97 A;  1OCR C;  5DED A;  5LYJ A;  1XDC A;  1X59 A;  4E4E A;  3FYI B;  2DYS B;  2H94 A;  4FM1 A;  4LF4 O;  1N0J A;  2P22 C;  4JI5 O;  1S76 D;  3C3S A;  3LUT B;  4X64 O;  2E74 B;  2ITD C;  2P7T C;  2UXB B;  3EXA A;  5JJN B;  2ADP A;  1IXM A;  1G1X B;  3O65 A;  5BY1 A;  4LF6 O;  1R1B A;  1XL6 A;  2UXD O;  4G27 B;  3I56 V;  2F4V B;  2RNB A;  1VQM V;  1YTF B;  3IC7 A;  5LMN O;  1QNM A;  3Q4H A;  1YZB A;  2YID A;  1J5E O;  1FXV A;  4FLZ A;  3SYC A;  3X2Q B;  5B3S B;  2H3O A;  4KUM A;  2XT9 A;  2QSA A;  4PDV A;  1QCE A;  1JNB A;  3L74 H;  4LH7 A;  2YEV B;  1E1R G;  1DLB A;  4LF4 B;  2E3C A;  1JVM A;  1LUV A;  3AG7 A;  1TUE B;  4JI5 B;  1XNQ O;  2QGN A;  3ZS8 C;  4X64 B;  2Q68 A;  2HJD A;  4Z1V A;  3S3X A;  2AXT Z;  4BWA A;  1AIL A;  4LF6 B;  1HDJ A;  4O4H B;  3K5M A;  2RJZ A;  2LW1 A;  4O4I A;  2XAQ A;  2X0L A;  3K57 A;  3K58 A;  5LMN B;  4DUY O;  1YJ9 V;  2KG7 B;  1U96 A;  1J5E B;  1K5S A;  1VIB A;  1QR9 A;  5BXZ A;  1MG1 A;  2N05 A;  1K9M W;  2NR5 A;  3BHP A;  1ZUQ A;  2L35 A;  3ZMT A;  3OR6 C;  2QE7 G;  1V9P A;  3FB5 C;  5GON A;  5IYB O;  4MTF A;  1XNQ B;  3WB0 A;  5IWA O;  1S72 V;  2Q9L A;  4LP8 A;  2YIB D;  1XNR O;  1AP5 A;  2EIJ B;  1ZTE A;  4W4L A;  4JTA B;  2WLI A;  2ZNJ A;  4CH5 A;  3N2K A;  3BA8 A;  3A2F A;  3K5L A;  3HKE A;  3E86 A;  3SYA A;  1Y74 A;  5EBW C;  2IM9 A;  1OCC B;  3SJA C;  4JI8 O;  3RYI A;  1AR5 A;  3CRM A;  1AVM A;  4FM2 A;  1OCR B;  4DV1 B;  4O2B A;  3CCU V;  1IXB A;  1PPJ H;  3LNN A;  5JVD A;  4UCO A;  1SKV A;  1JPX A;  3HKC A;  4PA3 A;  3KKY A;  1M9N A;  3SJQ C;  2R9I A;  5IWA B;  2YS8 A;  5LYJ B;  3CHX A;  2LW7 A;  4B3M B;  2X6A A;  2YI8 A;  4B3T O;  2X7R B;  3ETD A;  2WLK A;  3STZ C;  1LUW A;  1VQP V;  1JCH A;  4DV7 O;  1WA8 A;  3A0R A;  1KYO F;  4P2Z A;  3CXH F;  3D3I A;  1VMG A;  2BCC H;  2A7W A;  1YF2 A;  2QKA A;  4JI8 B;  3J7A U;  1US6 A;  3JAT B;  3OUS A;  2G38 A;  4MTO A;  2HP8 A;  4F4L A;  1TGO A;  1PNK A;  4X1I A;  4GKK B;  3OEE G;  4ZOL B;  3CCE V;  2K9P A;  1XMQ O;  4DR4 B;  2JGD A;  4YXW G;  2PY5 A;  1VF5 B;  4LFB B;  2A3Q A;  3Q4H B;  4RO2 A;  3OTO O;  1QLE C;  2HLD G;  5LP6 C;  4WFA V;  3CME V;  3T1C A;  2PZS A;  1I0H A;  3LNM B;  4B3T B;  4OPH A;  3T1H O;  3VOU A;  1FJG O;  3SYO A;  1Z5V A;  4TUY B;  2FYU H;  1EN6 A;  3ML0 A;  2GHY A;  1HP8 A;  4JI2 B;  4AI8 A;  4DXW A;  2OWO A;  4MTG A;  2YXL A;  3JD1 A;  4HZ3 A;  5CA1 B;  3E22 A;  2OCH A;  2XTA A;  3ZRS A;  4CS2 A;  4NKG B;  3LDC A;  1FXH A;  1XHZ A;  3JAW A;  4FJC C;  5LHG A;  2ADQ B;  4O4I B;  1QU7 A;  2LJ2 A;  3B8N A;  3AK3 A;  1XMQ B;  2R9R B;  1X4T A;  3P30 A;  2UXN A;  3G67 A;  3OD4 A;  5EIB D;  3AEI A;  3K06 A;  3ZRX A;  2PYL A;  2R72 A;  4FK5 C;  4JAU A;  3GVM A;  3UM7 A;  1H38 A;  2Q6A A;  2Q7G A;  2UUA B;  5EIB C;  1SZX A;  3FAV B;  3HKB B;  2DOS A;  1YJN V;  1IUR A;  1PNM A;  4N21 A;  2LP7 A;  2DWE C;  3R65 A;  1FJG B;  1UFI A;  1NTK H;  2YI9 A;  5CA0 A;  4FPP A;  3CCM V;  2HVK C;  1KEC A;  2W6I G;  3OTF A;  3DXR B;  3BCC H;  1WNS A;  3ZHS A;  5DM6 V;  2Z3Y A;  4JAS A;  2X6C A;  1RFY A;  1F23 A;  4X65 O;  1FFT B;  3NR7 A;  4B3S O;  3BAB A;  1AJQ A;  3OUF A;  3HKE B;  2JDI G;  5FNV B;  4MVR A;  3CRR A;  1Y74 B;  4YHH B;  3HR0 A;  2JVD A;  5KHG A;  3G6B A;  4LF9 B;  2A06 H;  3O9O A;  1P49 A;  1WAZ A;  1JJ2 U;  3JAL A;  1OHH G;  4BIZ A;  3RYC B;  3HKD A;  3VQX A;  3TET A;  2QM7 A;  3HKC B;  4UCT A;  3IC9 A;  3AG2 C;  3ASO C;  4JI1 B;  1OJH A;  1NTM H;  3WG7 C;  2ZNI A;  3B8M A;  2BTQ A;  2WLM A;  1K92 A;  5AG2 A;  5HFL A;  5B1N A;  4PA7 A;  1NJI W;  1K97 A;  1XUQ A;  3OE7 G;  4U3F H;  4X62 O;  2CDY A;  3SGI A;  1AI5 A;  1H2N A;  1WA8 B;  2FL4 A;  1TA8 A;  4UV8 A;  2F93 B;  2QWO B;  1R3K C;  2IJK A;  5JCO A;  1N34 O;  3P3N A;  4EKW A;  2ITC C;  2QJ1 A;  3K0G A;  2ZE5 A;  2EJ7 A;  1YJW V;  3T1Y B;  1LR1 A;  3H1H H;  2Q4P A;  1XMO O;  2ODM A;  3ICX A;  3ZHV A;  2DN9 A;  4JI4 O;  1Y76 B;  1QLE B;  5BMV A;  1MZE A;  2QR4 A;  3ETE A;  2FML A;  1Q6I A;  4LCU C;  1NKD A;  4PDL A;  4TV9 B;  5LP6 B;  4LF7 O;  2RMK B;  2V1D A;  1F4N A;  2XAH A;  1SQV H;  3QO5 A;  2LFR A;  4PA9 A;  5FPO A;  1L8D A;  4NXN B;  4RQF A;  4JYY A;  4UFZ A;  1EZJ A;  5J2T A;  2QWQ B;  2ZKO A;  3CEI A;  2Y4T A;  1YIJ V;  3PJS K;  4DR6 O;  4P30 A;  1H2L A;  1J95 A;  2WWW A;  4X62 B;  3K59 A;  1DF4 A;  4B7K A;  5CB4 B;  1L0N H;  1K5Q A;  3DSQ A;  3ZN0 A;  4DYL A;  3RGB A;  4FLX A;  4NTY A;  1H2M A;  3WFV A;  3CB2 A;  4PI0 A;  1JR9 A;  1THZ A;  1N34 B;  3TGU H;  3U11 A;  2JS5 A;  1YDX A;  3E22 B;  2VQE O;  1PP9 H;  2QM8 A;  3L9D A;  4JI4 B;  3JAW B;  3DTU B;  1I94 O;  2QTO A;  1B04 A;  1BMF G;  2FB5 A;  4DV2 O;  1DF5 A;  4RUE A;  4DR5 O;  3H1J H;  5EYP A;  4O4H A;  1R6N A;  4K8Z A;  1Y4M A;  1NH2 D;  3H1K H;  4JTC B;  4GYC B;  4PD4 F;  1V55 B;  4LFA O;  3MDS A;  2JJ2 G;  1NR1 A;  3L75 H;  1BHB A;  4JYA B;  1M57 C;  1Q86 W;  2KG7 A;  3OMA B;  3T4Z A;  4HYO A;  3G71 V;  1XEQ A;  3J81 N;  3UKM A;  4KL1 A;  5H5N A;  1P4R A;  2EIM C;  4FIP C;  2IJI A;  1H5W A;  2VQE B;  4O4L A;  4UCV A;  4YY3 O;  4ABM A;  1QHT A;  2VQF B;  1YHQ V;  2V4D A;  3AG4 C;  2IJH A;  2EBO A;  2LO1 A;  2ZE8 A;  1SQB H;  1GN2 A;  4DV2 B;  1N36 O;  2HEP A;  4DV3 B;  3LDD A;  1E79 G;  1IBK O;  2AGA A;  4JI3 O;  1GK9 A;  3AG2 B;  1OCO B;  1VQN V;  3CC4 V;  4JV5 O;  3WG7 B;  4LFA B;  2M6Y A;  3JAL B;  1JMK C;  5L3G A;  4X89 A;  3BVO A;  2KB1 A;  4CZZ A;  2H8P C;  2ZIN A;  3SJB C;  1IBM O;  2ZD9 A;  2N74 A;  3M7M X;  2MW2 B;  1I5X A;  1D5A A;  4EEQ A;  2BTQ B;  4UVC A;  3TXQ A;  2ZQM A;  4OGQ B;  4L8J A;  4YY3 B;  4YIP A;  1AI4 A;  5B66 Z;  3E35 A;  2K1E A;  2F23 A;  1PL4 A;  1P7B A;  5FPR A;  3JD0 A;  1K7D A;  1WB7 A;  1N36 B;  1XRE A;  3QO8 A;  2ARH A;  3C3T A;  2WA3 A;  1XBL A;  4BIU A;  5LXT A;  1IBK B;  2VWJ A;  1R6T A;  4MVO A;  2UU9 O;  5GTI Z;  3JAS A;  1K3E A;  2P5O A;  4JGS A;  2JGU A;  4DV0 B;  5BMV B;  4PDR A;  5L3F A;  4D7S A;  4X9Q A;  4FFK A;  2ZM6 O;  1IVS A;  3FX7 A;  1Z5W A;  4IYI A;  2KSD A;  4B7E A;  2B1I A;  2JS3 A;  3JAT A;  3KG2 A;  4XDL A;  4RUF A;  4OXS A;  1NI8 A;  1GO3 F;  2IH1 C;  3G6E V;  1KC8 W;  2PYJ A;  5J2T B;  1D2D A;  1WLE A;  4ZOL A;  2W0F C;  3IJ4 A;  4DV5 O;  3ASN C;  3U0Z A;  1GN6 A;  2EZO A;  2HHH B;  3SPH A;  4O4J B;  3I5D A;  2DJV A;  2M7W A;  1NTZ H;  2HKO A;  5LL6 Y;  2Q67 A;  4TQF A;  1OV9 A;  3B40 A;  1BCC H;  5L3D A;  2PUS A;  3MD0 A;  2UU9 B;  5IE9 A;  1SF9 A;  2OCC C;  5KHI A;  4PHZ A;  3E8F A;  4TUY A;  3APQ A;  4GUN A;  1VAR A;  1NH2 B;  1M57 B;  5CA1 A;  1GKF A;  2Q7H A;  2WLL B;  4J11 A;  1RM1 C;  5EYP B;  1M4U A;  3FD9 A;  1ZWI C;  2N04 A;  1BE3 H;  2W0X A;  1VF7 A;  2KKW A;  4DRX A;  3K08 A;  3ABL C;  2UXD B;  5BR8 O;  2ZIO A;  1W0J G;  2EIM B;  4Q6G A;  4CC6 A;  1VF6 A;  5H2F Z;  4BW9 A;  4ASU G;  3L71 H;  4U7N A;  3AG4 B;  4CS4 A;  5CA3 A;  2UXX A;  4IHJ B;  2PTM A;  4I4T A;  2F95 B;  4I7Z B;  3FAV A;  3E8H A;  3HKB A;  2AHZ A;  2WLH A;  4DR1 O;  1FFX B;  3UCS C;  3HB3 B;  1S5J A;  5EZY A;  1VF6 C;  3BEH A;  4O4L B;  3THO A;  1PD3 A;  2YIB A;  4H37 A;  2UUB O;  3DXR A;  4PDM A;  1VQ8 V;  3N27 A;  1XL4 A;  5KAI Z;  1CEZ A;  4PV1 B;  1W59 A;  3ZJZ A;  3GB7 C;  3C90 A;  1K8A W;  5EBL C;  3ABM C;  2CTQ A;  1BL8 A;  3G4S V;  4I55 B;  1QBZ A;  1RSO A;  5BR8 B;  1PM9 A;  3S3W A;  4KHP O;  4D6T H;  5FNV A;  4DUY B;  1MZF A;  3RN4 A;  4YIO A;  4GT1 A;  4GLX A;  3OFN G;  4J9Z B;  3J80 N;  1PV0 A;  4FLU A;  4JI0 O;  2WLJ A;  4J7J A;  1S0V A;  1IDS A;  2OIE A;  4DR1 B;  3VBB A;  1CP9 A;  3RYC A;  5KUM A;  4JYC A;  4DR2 O;  3JSL A;  1K73 W;  1K33 A;  3L72 H;  1R6K A;  2UUB B;  2ZE7 A;  1HWY A;  5IYC O;  4GCZ A;  1VQK V;  1S3J A;  4KXR A;  2VS0 A;  3ZED A;  3ZHR A;  1XNR B;  5LXT B;  2GUZ A;  5EK0 A;  3AG1 C;  3JAS B;  1HR0 O;  4NB5 A;  5JQG A;  5LHH A;  4KHP B;  2VRZ A;  3ETQ A;  2YXY A;  4MVU A;  2XOK G;  4R7C A;  1K34 A;  4LNU B;  1ROP A;  4R6Z A;  3ASN B;  4DK1 A;  2WLN A;  2ZCE A;  3AK2 A;  1W0K G;  1FXK C;  4JI0 B;  1HNX O;  4JI7 O;  1Y76 A;  4JF3 A;  3M8A A;  3CRA A;  5LP6 A;  1PNL A;  4TV9 A;  1E1Q G;  1BZK A;  2P90 A;  4EFB A;  2DYR B;  3E2E A;  1ZL8 B;  1M56 C; 
#chains in the Genus database with same CATH homology
 1EN6 A;  4C7U A;  1JA8 A;  3EVK A;  1QNM A;  3MDS A;  3TJT A;  5AG2 A;  1AR5 A;  4X9Q A;  4FFK A;  1ZLZ A;  2GDS A;  1AVM A;  1BSM A;  1I08 A;  1XUQ A;  1MNG A;  1IX9 A;  2CDY A;  2ADQ B;  1BT8 A;  3AK3 A;  4JZ2 A;  1AR4 A;  1IXB A;  1BS3 A;  1ZSP A;  3QVN A;  3DC6 A;  1LUV A;  1VEW A;  1PM9 A;  3KKY A;  3BFR A;  3AK1 A;  3RN4 A;  4YIO A;  4BR6 A;  1GN6 A;  3KDR A;  1SZX A;  2P4K A;  1GN2 A;  3K9S A;  1N0N A;  1IDS A;  3OT7 A;  1P7G A;  1LUW A;  1EN5 A;  1AP6 A;  2AW9 A;  1GN3 A;  4JYY A;  1WB8 A;  1B06 A;  3CEI A;  2QKA A;  4JZG A;  2QKC A;  4GUN A;  1VAR A;  1MMM A;  1MSD A;  2RCV A;  1XDC A;  4E4E A;  1Y67 A;  1ZUQ A;  1JR9 A;  1D5N A;  1MA1 A;  1N0J A;  3C3S A;  1XIL A;  4YIP A;  1GN4 A;  4F6E A;  1EN4 A;  3LSU A;  1PL4 A;  2ADP A;  2CE4 A;  1I0H A;  1WB7 A;  3AK2 A;  1AP5 A;  1ZTE A;  1XRE A;  3C3T A;  1EM1 A;  3IC9 A;  3DC5 A;  5A9G A;  1KKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...