1IXBA

Crystal structure of the e. coli manganese(ii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Structures at 0.90 A resolution of the oxidised and reduced forms of the Y174F mutant of the manganese superoxide dismutase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 79
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ixbA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ixbA02
4JYYA 1P7GA 3TJTA 4C7UA 3RN4A 1BT8A 1WB8A 1GN3A 1XUQA 1QNMA 3AK2A 4BR6A 1I08A 3EVKA 1IDSA 1AP6A 1IX9A 1IXBA 4FFKA 2QKCA 2GDSA 3CEIA 1SZXA 1LUVA 3IC9A 3OT7A 4YIPA 4F6EA 3DC6A 1BSMA 1XREA 4JZGA 1JA8A 4E4EA 1KKCA 1I0HA 1VEWA 4X9QA 2P4KA 1N0JA 3QVNA 1AR4A 1EN6A 1N0NA 1WB7A 1GN2A 1ZUQA 1EN5A 1PL4A 5AG2A 1XILA 4YIOA 1GN4A 3C3TA 1D5NA 3C3SA 1MSDA 4GUNA 4JZ2A 3K9SA 1GN6A 1MNGA 2ADQB 5A9GA 3AK1A 1PM9A 1MMMA 1ZSPA 2RCVA 2QKAA 3KKYA 3LSUA 2CDYA 3AK3A 1XDCA 2AW9A 1VARA 3DC5A 3MDSA 1BS3A 1Y67A 2CE4A 1JR9A 1LUWA 1B06A 1EN4A 1AP5A 1ZTEA 1EM1A 1AR5A 2ADPA 1AVMA 1ZLZA 1MA1A 3BFRA
chains in the Genus database with same CATH superfamily
1P7GA 4UFZA 2Q69A 2NN4A 3ETGA 1WB8A 4J42A 1HNZO 2YC0A 1XEQA 2BOCC 4TV9A 2XAJA 2VWKA 1MG1A 2RDCA 4QJFB 5HFLA 3CYOA 4JI7B 1AJQA 4WFBV 3E8FA 1J95A 1TGOA 3JASB 4O4IA 1Q5OA 1GAXA 1E1QG 4J7JA 3CEIA 1HDJA 1Y66A 1LUVA 3IC9A 4AHCA 1K4DC 2GBOA 3G6BA 2ZIOA 3ZCCA 2UU9O 1Q90D 4ASUG 3TXQA 3CC4V 4JV5B 5CA0A 3CMAV 2XUMA 4WBNB 3ZN0A 4I0XB 3L75H 2AZ2A 4CBCA 4JGSA 1QLEC 4LF4B 2YEVB 4PDMA 1FXHA 2P4KA 4K8ZA 2RN9A 2JEUA 2R9IA 1EN6A 5EBMC 4NXMO 5KHHA 2P67A 2ZDIC 4DW0A 1ZUQA 4P9OA 3BABA 1RM1B 3HB3B 1MOFA 3WB0A 1VQPV 1M56B 5EBWC 1I94O 2R72A 5K1XA 2F4VO 2QWOB 3T1CA 4TT3G 3VQXA 4J9ZB 2DQ3A 4YJ3B 1XNRB 5B1AB 5ITZB 5CA1B 1S76D 4UV9A 1ZSPA 4EB6B 1F4MA 4DV1O 1SQBH 1JQ0A 2UUBO 5FNVA 3KCXA 5B1BB 3IJ4A 3LNMB 4J80A 4MSWC 2YIAA 4X66B 3AG4B 1YI2V 3BA9A 1SRYA 4EEQA 2M6YA 1BHBA 1G1XB 4JI6O 4A5UB 2ADPA 3ZHQA 2HVJC 3HKBA 3CC2V 2UXCO 1OHHG 2QTOA 1PD3A 3K5LA 3B8MA 5K1PA 3K06A 5LA6B 3D3QA 1OCCC 1JOYA 2Y0PA 4HAMA 1JX9A 1SA0B 1IDSA 4RUEA 5LGNA 1IX9A 1IXBA 2IJIA 2QKCA 1XI1A 3FD9A 2F1MA 1BCCH 4MVMA 5LHIA 4BW9A 2X7RB 4WFFA 3JD2A 2EJ7A 2JVDA 1ZAUA 3M99B 1V55B 2ZNIA 4H37A 2BTQB 4R7CA 1O9HA 1P4RA 3CRAA 3L70H 1DF5A 4JI2B 2XASA 1PNLA 3I5DA 3L72H 3RYCB 1Q6IA 2PYLA 1AI7A 3I56V 2A79B 4JI5O 4JF3A 1WPBA 2ZM6O 4UUJC 4DR7B 2Q5ZA 5IWAB 3SYPA 3CRMA 3OMIB 4IIJA 1SQGA 3FB5C 2DQ0A 4JI4B 1K5QA 2UXDB 4NXNB 2E5LO 2ZCEA 2WLIA 1TUBA 4OXSA 4TSFG 3AK3A 5IE9A 1TAEA 5IT9N 3ZHVA 2HP8A 1S3JA 4X1IA 2F95B 2Z0AA 3CP1A 2RJZA 1Y67A 4LF9B 2PZSA 3E8GA 3VBBA 4ZOLA 4H44B 5LHGA 5IJ9B 4ICGA 2ZKOA 5KUKA 4LFBO 1XHZA 5B5EZ 4G27B 3TJTA 5DECA 3GVMA 1BT8A 1NTMH 4ABMA 4R50A 1OCRC 4MTXA 2OIEA 3R66A 1HNZB 2K9PA 4PHZA 3LDCA 2IJJA 4I9QA 3D36A 1THZA 3K79A 4JYBA 5LOVA 2EIKC 3FB6C 4DR2O 3OUFA 4B3SO 3OT7A 3DSQA 2JGDB 4F6EA 3CPWU 4LFAB 3DTUB 1HP8A 4LCUC 4JI0O 3JAWB 1L8DA 2HEPA 5FL7G 1AR4A 3OE7G 2IU3A 4IGGA 4UCSA 3K0GA 4MVSA 2PYJA 3F7VC 2Q6AA 3AG2C 1Q3EA 1H2SB 3LSQA 1WAZA 4KUMA 1EBOA 5LMUO 4GKKB 4DR6B 1QR9A 1FJGO 3CRCA 1I94B 4WF9V 1PM9A 1G8MA 5EYPB 1M9NA 1SETA 2F4VB 4LF8O 3SJBC 4I50A 4DYLA 1NT2B 2CH7B 4DV1B 1Y4MA 1Q43A 4FIPC 3E35A 1DLBA 3LSUA 3IAYA 3HR0A 3FB8C 5KX5B 1R3IC 1QHTA 5KUMA 2JS3A 3DC5A 1MZFA 1LUWA 4TUYA 1SKVA 3RYIB 5CBGA 3ASNC 3QO5A 4D7SA 2VS0A 5KHKA 3APOA 5KMGA 2DN9A 1F51A 4PV1B 1BHAA 2NR5A 3SYAA 1XNQB 2UXCB 1V54C 3RN4A 4R8CA 4TV8A 4ZKIA 3JSLA 5LMNO 2HHHO 2EINC 4X1YB 4J41A 3K58A 3OEHG 1S5HC 2ZE5A 4MTGA 5KLVH 2ZDIA 3BY6A 4B7EA 3ZX6A 3U11A 4K3AA 1KMIZ 5KAIZ 1N36B 1Z5WA 1Y74B 4O4JB 3F7YC 2EZPA 2QTSA 1N33O 3TETA 1I5YA 2W6IG 3CS5A 1K5SA 1N0JA 1J5EO 2W0XA 1IVSA 2CTRA 2LP7A 4LR3A 1VQOV 2VQFO 4YIOA 3T4ZA 3JAKB 5H5NA 4PI2A 4MTFA 2P5OA 3E2EA 4K0KO 1MSDA 5J2UB 3TGUH 2ZM6B 5LP6B 3K0DA 3JATA 1YHQV 1I5XA 2NLJC 3ASOB 4DR5O 1XMQB 1G6UA 3G80A 5L3EA 1P49A 4GX5A 1YIJV 1QLNA 5KA6A 4RQEA 1K92A 4CS4A 2HG5C 2XAFA 3ZJZA 2ZE7A 2QDOA 3SPCA 1VF6C 2EBOA 4JI3O 4ZHQB 2DW4A 4OX9O 1N34B 1KKDA 1ZLZA 1VQ4V 4PDRA 5LYJA 1RM1C 5JJJB 3EFFK 4JTAB 4O2BB 4X89A 3UO2A 5KHIA 2X6AA 4UVCA 2D2CB 4NB5A 5IYDO 3WB1A 3FYIB 4O4HA 1FXKC 4FFBA 3N2KB 4DR2B 4YIPA 2A3QA 4JAAA 4EFBA 1XBLA 4X62B 1H8HG 4U3JB 1VF7A 2QEXV 3ZHSA 4UB6Z 1VIBA 2BE3A 4Z2WA 4X88A 4CS2A 2FKXA 4NVPA 1RSOB 2ITDC 1N32O 2A9HA 1AI5A 1N4CA 3KZIZ 2X6BA 1AJNA 4MS2A 3GWKC 1YTFD 2ODMA 2HJFC 1UJWB 4TV9B 1B3QA 1VP7A 4UVBA 2WLNA 1KQSU 4HNAA 2XAQA 4MVZA 4GUNA 1K9MW 5LMUB 1AILA 4GT1A 1HR0O 1FJGB 2CAZC 4O4IB 3CJHA 3CX5F 4X20A 2FB5A 2IJHA 1CEZA 2OCCB 4H13B 1OCZB 5L3BA 1WLEA 5EIBC 5CA0B 4Z1VA 4DW1A 1FFTB 4RAIA 3SYQA 1XDCA 4DV5B 3QTCA 4LFCO 4CH3A 5L3FA 1R73A 4HZ3A 1D5AA 1R6KA 2KKWA 2PGGA 4YJ2A 1B06A 5CN0A 1PPJH 1EN4A 1IBMB 1U97A 4BAYA 1ZTEA 5CBFA 4MW3A 2MW2B 4XBFA 3CCRV 1JCHA 1AVMA 1Q86W 1GTOA 4IYHA 1B6QA 3CMEV 5JH7A 3CRQA 4LNUA 2VQEO 1NQTA 4L87A 2GTAA 3ETEA 5LMNB 1I08A 3JARA 1QQCA 2YIBA 1H5WA 4NYKA 5FNVB 1QVFU 1R3JC 1SZXA 3BVOA 4F6RA 3BPZA 4DRXA 2Q7GA 5BR8O 4DV3O 5KA5A 3RGBA 2N05A 4WCEV 4AI8A 2CGOA 2WLJA 2DE0X 3E22A 4XDLA 1AI4A 5L3CA 3QVNA 4CZZA 2GV9A 4TWKA 2L35A 1Q81W 4FLVA 1J5EB 1RP3B 1NBMG 3G4SV 3SGIA 5J2TB 2N04A 1NJIW 1D2DA 4ZI7A 3FFQA 3C3TA 4DV0O 1NKDA 3IC7A 1GO3F 3LNNA 3VQWA 3MAQA 3STLC 2ZXWC 4FLUA 2ADQB 2P6JA 1P7BA 1K4CC 2Y0IA 1UPGA 3CCSV 4DV7O 3JYCA 3LUTB 3A0HZ 4JTDB 4Z1MG 2QKAA 1VF5B 4GX2A 3GB7C 3HKDA 1ENVA 2O57A 4DK0A 3CCUV 4UCUA 4LF7B 1W0KG 2QR4A 4O2AA 3JALB 1SQXH 4KHPO 1YTFB 2XT9A 4DUZO 2LQTA 1W2BU 1EM1A 3FYEB 4NR1A 1K7DA 2JDIG 2Y69C 5IYZA 4OX9B 1BQ0A 3VOUA 5J9PC 4KL1A 4JYYA 2R70A 5CB4A 4B08A 1FKAO 3G67A 2YI8A 5L3DA 4IIJB 2WLLA 4X1KB 2QGNA 4FK5C 1XHXA 3F5TA 3CD6V 2RMKB 2WLIB 1TUBB 1JNBA 2DYSB 3QO7A 4J10A 3VQYA 2UUCO 3KDRA 5HFMA 1YJNV 2HR3A 4JZGA 2ITCC 4X1IB 4GX1A 2P90A 4ZOLB 3FAVA 3FX7A 2A0LA 2P4VA 3G71V 4GZRB 4QE9A 2QWNB 4FM2A 2F66C 2E3CA 3O65A 4WFHA 1N32B 2OCHA 3QNEA 3K3WA 3GWOA 3K57A 1EN5A 1SQPH 3AG3C 3F5WC 4IYIA 3Q4HA 3ABLB 3ABKC 4YHHO 4U3FH 2V7QG 4WBNA 5LBQA 1OZ0A 4I0XA 1GN6A 2H94A 1MNGA 1EZVH 5LOVB 3AK1A 2JGUA 1HR0B 4UV8A 4NTYA 2N74A 2C2AA 2UXBB 4NTXA 3X2QB 2RCVA 1YVWA 2ZIMA 4B3TO 1VF6A 1VQ9V 4UCTA 3AG7A 3CHXA 1EFRG 3UKMA 1FAFA 1WA8B 4WFEA 2FL4A 1PP9H 4LFCB 2WPDG 4J7ZA 3OEEG 2OWOA 5F2VO 4JASA 4JTCB 2ETNA 4PA6A 4XDKA 1BQZA 3IGAC 2UUAO 4YJ3A 1QBZA 4EB6A 3W7SA 4MTOA 2YXHA 4DK1A 2ZE6A 2AGAA 5IY5C 1FXKA 4YXWG 4OPHA 4E2LA 3LDDA 4FM0A 1S77D 2LW1A 2CTQA 3B40A 2KQXA 2Y48A 4GKJO 3J80N 1ZWIC 3O9OA 4IHJB 4CH5A 1XUQA 3H9VA 4BW5A 3ABMC 2IJKA 2EIMB 2Q8VA 3T1HB 3OTFA 1YEWA 3ASOC 3N2GA 2KB1A 5LHHA 1AR1B 4ZBMA 3A0RA 3DC6A 1NR7A 3ZRSA 3L9DA 1T5EA 4X64O 1OCOC 4DV3B 5FPOA 4DV6O 4TUYB 1M57B 1K73W 4RWUA 1KB9F 4BIUA 1IURA 1VQNV 4PDLA 1VQKV 3CXHF 1H2GA 2DJVA 5E1AC 1K34A 1WP8A 2D3OW 5B3SC 4CC6A 2UU9B 4DV0B 1W59A 1Y76A 2JEXA 2IH1C 1QLEB 1TUEB 2YXYA 4EFEA 3PJSK 3ZRWA 3SYOA 2LGWA 2LGQA 5FPRA 3FKSG 3R65A 1ROPA 5TISZ 4DV7B 3RYCA 4NXMB 3ZN1A 1QVGU 5JQGA 4CC5A 3OW2U 4LH6A 3SYCA 2XTAA 1R1BA 2YICA 2HFEC 1M1KW 4IT5A 4X8AA 1N8RW 2Z5UA 1JR9A 1WJZA 2NNUA 4FJCC 1I7FA 3RYFB 4TQDA 5KHJA 1SQVH 4DUZB 1VQ5V 3BFRA 3E8HA 2FYUH 2UUBB 4N21A 1FFXA 4I55A 5BMVB 1HNXO 1IBLO 1NZ6A 1JVMA 3S3XA 3WG7C 4BWAA 3OD4A 4BR6A 3CB2A 2IBZH 3JATB 3M8AA 2YS8A 3T1YO 4H0LB 3ETDA 1FD9A 5IYBO 2QSAA 1RPOA 5IJ9A 2UXNA 5H9CA 3W7UA 4PD4F 2AHZA 2EULA 1YJ9V 1HW7A 4JI6B 2EX3A 2GHYA 2YIBD 1BGYH 4JYCA 2WAMA 5BXZA 2GTSA 3CC7V 1OCCB 1IZ3A 3ZMUA 3M7MX 3L71H 2Y4UA 3MHSC 4MVUA 5JCOC 4X65O 4J11A 4DV2O 4WFGA 4YY3O 1N0NA 1PV0A 2XNDG 1JFFB 1GN2A 2EIJB 2FTKA 2EILC 1XILA 3CCJV 3UT5B 1ORQC 3DGEA 4I4TA 3SPGA 1H8EG 1GH6A 4OPAA 4RO2A 4DR4O 2K1EA 2QA4V 2VWJA 1NH2D 2FMLA 2RQ6A 2WLKA 4J9YB 4O4HB 4FFBB 3ZRXA 1R3LC 1JPXA 3JD0A 1KD1W 2LW7A 3SR2C 4B3TB 2CDYA 3RT3C 4LC1A 3WU2Z 3OM3B 1E1RG 3CXCU 4JI5B 1NVPD 1KP2A 4G28B 3ABTA 2HKOA 2YXLA 3MHHC 5GW7A 1JJ2U 4QGPA 2UUAB 2RNBA 1VQ6V 2CH7A 1M4UA 2E5LB 4GCZA 4GLXA 5LXTA 4HNAB 2YIDA 5D5QA 4W4LA 2DWDC 3AK2A 3CJHB 5JWPA 4X20B 3WFVA 5JVDA 4FLTA 5EC1C 4PELA 3HKEA 3JSNA 3OUSA 4LFBB 2OIGA 1Q6HA 1WP7A 5H6QA 1M56C 1OCRB 4JI1O 3H1HH 4YJ2B 1SERA 4X9QA 4DV6B 1XNRO 1TVKB 3W7XA 5B1AC 1XQ8A 2EIKB 2P22C 5B1BC 3RVZA 4B3SB 4X66O 4LF5O 3ZHUA 4B7KA 1KUQA 1WN7A 4LNUB 1PL0A 1F23A 3AG4C 4P30A 3RW0A 1G4YB 2CTWA 4JI0B 3N27A 4Q6GA 3B09A 2JJ1G 4O4LA 2F93B 4G2KA 1S0VA 1US6A 5EK0A 3A2FA 2DYSC 3AG2B 3BRCA 1K8AW 1P84F 2QE7G 4PA4A 3JAKA 1VARA 1KC8W 2ZR2A 2BTOA 1BS3A 2WSSG 3CCQV 4HBNA 3HKCA 3ZMVA 2PTMA 5GTIZ 4LF8B 4HYOA 4ZI7B 1WPXA 1NH2B 3U0ZA 1MABG 4DR3O 4PA7A 3ABLC 2Q0OC 1Z2GA 3QO8A 3RVYA 1VQ7V 5IJ0A 1GM9A 5IDJA 1V55C 1R6NA 3UCSC 5CA3A 3B8NA 2Q68A 4CH6A 2Q7HA 3MD0A 1VMGA 3ASNB 4LWSA 1AP6A 4FZ0A 3S3WA 2LJ2A 4QIWF 2WA4A 2IH3C 1NVPB 1GKFA 2E76B 4ZHQA 4GYCB 3JD1A 1H38A 4D7TA 2W6JG 1DTOA 2B1IA 1V54B 3E86A 1QU7A 3I55V 3P30A 2VRZA 4OGQB 1VQLV 2CUGA 2EINB 3ETQA 3ZHRA 4JI4O 1SQFA 4RQFA 2HHHB 5IYZB 1R6TA 4DV2B 1Q6UA 3CSXA 3JCUZ 3J7AU 3NXSA 4AQYO 3OR7C 1YCIA 4LP8A 1NTKH 5EBLC 5CMUA 1Q7YW 2ZNJA 4LF9O 4JZ2A 1NTZH 1N33B 1SC5B 4L8JA 2ZINA 3RYHA 2DYRB 2QWQB 3HKBB 2JRIA 2H3OA 2QJ1A 2Q7EA 1Z5VA 4RUFA 4WFAV 2VQFB 4FPPA 2UXXA 4BIZA 5A2QN 1CPYA 3FAVB 2GUZA 3H1IH 1M57C 2E75B 4K0KB 2QM8A 2WA3A 3OR6C 2HJDA 4DV4O 5GONA 1BL8A 3OFNG 4JYAO 3ZMSA 1A32A 2DWEC 2QWPB 4QE7A 4QPKA 5EZYA 4LFAO 4UCRA 2Z3YA 3APQA 3Q4HB 1GRJA 4TOIA 5H2FZ 4DR5B 1CXZB 2B5UA 2R9RB 3E83A 2KG7A 4FLYA 4H33A 1ZL8A 3TCUA 2AHYA 3H01A 2ZE8A 1LR1A 1YXBA 4I9WA 3ML0A 5LGTA 3K5NA 3BCCH 3SPJA 2V1DA 5B1OA 3DXRA 5JCOA 3ZMZA 4JI3B 5C8YA 1IJGA 4KP4A 2YSUB 3BA8A 3CCLV 4GKKO 4DR6O 3W7WA 1BE3H 2BSKA 1EZJA 4JI1B 1SESA 2ZD9A 1XL6A 1DGSA 1FXKB 1YJWV 4UXNA 4JPRA 1PL4A 3ZBHA 4LF5B 1D5NA 2XOKG 5KAFZ 1B04A 3K9SA 3ZHTA 2ILMA 3B2EE 1GM8A 1XL4A 3P3NA 3H1KH 2JJ2G 2ZT9B 3K5MA 2F43G 4Q20A 1X59A 3N2GB 1H2MA 3L74H 1V9PA 1VQMV 3HPLC 3JASA 5J2TA 1XMOO 1XNQO 3KG2A 5L3GA 3JD4A 3OTOO 3K08A 3UM7A 3CCEV 4MT8A 4I5SA 3SPIA 1ZX3A 3AG1B 1L0LH 2YEVA 2ZR3A 1BZKA 5DM6V 2IM9A 4K8XA 2EIJC 1KECA 3D8CA 4B3RO 2R9AA 1E79G 3P3PA 1OJHA 4J7KA 1N36O 1Y76B 4DR3B 3UO3A 2W0FC 3K9AA 4DO2A 1HWYA 3SPHA 4XDJA 3ZRWB 1NI8A 3JALA 4B3MO 2GDSA 5ITZA 5CA1A 5JQGB 5JJEB 3LDEA 3WB2A 3ZS8C 5E79Z 3E8BA 2MK3A 1K97A 3W7TA 2BCCH 2IW5A 1VQ8V 2VQEB 1S5JA 2ARHA 5LP6C 3B77A 2M7WA 3CE2A 4I50B 4X1KA 1FS0G 1XMQO 3AEIA 4R6ZA 3RBZA 2EZOA 2Q67A 1PNMA 2A06H 2QKSA 1FFXB 2JS5A 4I55B 4EKWA 1WNSA 4AQYB 1MSWD 4JI8O 1TA8A 2PI4A 3JCZA 3C90A 5BR8B 1QR8A 2ATKC 2AXTZ 3TK1A 4PI0A 5LA6A 2DMXA 5EC2C 1IBKO 4QPJA 1SA0A 4DR1O 1N34O 3G6EV 5KMGB 4QNHB 1R3KC 1Y6XA 4PA3A 2YUAA 3IFXA 1RPRA 1RFYA 4NTWA 4TV8B 2AW9A 1NS1A 2H8PC 1MZEA 2Q4PA 2ZXWB 5IYCO 2BTQA 1AJPA 3J81N 4DV4B 4LF6O 1KP3A 4JYAB 1AR5A 5GTHZ 4FLXA 4X62O 1YZBA 4I4TB 4C7UA 4CH4A 5C93A 1FPOA 5DEDA 1WA8A 3THOA 2WWWA 3P32A 3OMNB 3EVKA 2CTPA 2HLDG 4KHPB 1SZTA 2QM7A 4FMTA 3ICXA 2Y69B 2Q73A 3TXSA 1BSMA 1KYOF 1M93A 5H6RA 1KBHA 1JA8A 2CGNA 3ZIAG 4FVMA 5KHGA 1I0HA 4IHJA 1U96A 1L0NH 4UB8Z 2P7TC 2EJRA 4PJ0Z 3BAAA 3QF7A 2OCCC 5LXTB 4DUYO 1OCZC 4DV5O 2XAGA 1GN4A 2OT5A 2Y4TA 2PY5A 2UUCB 3C3SA 1W0JG 1JJOA 3OGIB 3ABUA 1IBMO 1DF4A 1X4TA 5JVDB 3E89A 2JK5C 3VQVA 3EHBB 1XOUA 5LL6Y 3HKEB 1O9GA 2GSMB 4LH7A 2ZQMA 3SJQC 5LYJB 3KKYA 4D6TH 2XHBA 1HNWO 1XMOB 3AG3B 2JGDA 1FYJA 2QWRB 1YDXA 3QG5A 3ABKB 3OTOB 2DOSA 5BY1A 1KU9A 3MDSA 4YHHB 3JAWA 2F23A 3UQ8A 2G38A 3SJCC 5BZBA 4GX0A 2PUSA 2WLHA 4MVRA 3FB7C 2PF4E 3STZC 2XAHA 2X6CA 1AB3A 1Q82W 4F4LA 3LSSA 3BHPA 5CBHA 2LFRA 2OTJV 4U7NA 4B3RB 1GK9A 1F4NA 1H2LA 5B66Z 1FXVA 4BIOA 4CS3A 4JI7O 4K35A 4O4LB 2DYRC 4FFKA 3RYFA 1GM7A 5EYPA 4B3MB 3T4DA 4PA9A 5IY5B 1AI6A 3NR7A 3RFRA 4JV5O 1PNKA 3T2MA 1XREA 2CK3G 2X0LA 5KX5A 5BMVA 4LF4O 4E4EA 1S72V 2AZ0A 1UFIA 4GKJB 1VEWA 1M90W 3ABMB 3HKCB 1AROP 4KXRA 3JAMN 3RYIA 1WB7A 4KFMA 5AG2A 2P06A 4P9PA 5IJ0B 4LF7O 4JAUA 1F7YA 1H2NA 1M5IA 1OCOB 5FLXN 1K3EA 4JI8B 4AILC 1SS3A 4X64B 2L6LA 3KCYA 4FZ1A 4LWSB 3D3IA 1H2KA 1MMMA 3BEHA 4JAVA 4X1YA 1IBKB 2Q0AA 3CWBH 4DR1B 4PDVA 3PN1A 2LO1A 4UVAA 1JFFA 3A8TA 4FLZA 1SF9A 3K5OA 5JH7B 5B3SB 3UT5A 2QM4A 1FOUA 2B9ZA 5LGUA 3U10A 4MVQA 3CCVV 1NU1H 4ZIBA 3JARB 1Y74A 2YDEA 4O4JA 1NR1A 3H1JH 1AP5A 3H1LH 2HVKC 4LF6B 2OTLV 1URFA 4F6RB 1MA1A 2A7WA 2E74B 3EXAA 4DRXB 1YITV 4W4KA 2OYQA 1GN3A 2BOBC 3CCMV 1IXMA 1QNMA 3JD3A 5JJNB 3K03A 3K04A 3RWRD 5J2UA 3E22B 1YF2A 4P2ZA 3RYHB 5LP6A 3OMAB 4UCVA 2Q9LA 1S5LZ 4LBEC 4IL6Z 3SJAC 4UCOA 4TQFA 2GUZB 2LFSA 3K59A 2V4DA 1GMGA 3WG7B 5D5PA 1HNXB 1KKCA 1IBLB 3D36C 1LNQA 2B1GA 3AG1C 5GONB 2UXBO 3OAAG 5DN6G 1QCEA 3ZEDA 4JI2O 1YSCA 2JIZG 3X2QC 3T1YB 3ZMTA 5EZYB 3CRRA 3L73H 2KSDA 2IU0A 3HKDB 5B1NA 3ZRVA 4MVOA 4DUYB 2KG7B 4DR7O 1ZL8B 1BMFG 3OGCC 5IWAO 4O2AB 1JMKC 4O2BA 5A9GA 1K33A 1OV9A 3A0BZ 1TVKA 3DXRB 2UXDO 4NXNO 4DXWA 5C8YB 3B4SA 4X65B 2YI9A 4YY3B 3N2KA 4MW8A 2EILB 5CB4B 1Q8IA 4I7ZB 1CP9A 1HNWB 2BSKB 2PI5A 4NKGB 4N23A 4U3JA 2CE4A 2WLLB 4DR4B 3T1HO 1L1FA 2EIMC 1COWG 2WLMA 4FLWA 4U7OA 3SDLA 5EIBD 1RSOA 4FM1A 1PKXA 1DK1A 1SQQH
chains in the Genus database with same CATH topology
4JYYA 1P7GA 3TJTA 4C7UA 3RN4A 1BT8A 1WB8A 1GN3A 1XUQA 1QNMA 3AK2A 4BR6A 1I08A 3EVKA 1IDSA 1AP6A 1IX9A 1IXBA 4FFKA 2QKCA 2GDSA 3CEIA 1SZXA 1LUVA 3IC9A 3OT7A 4YIPA 4F6EA 3KDRA 3DC6A 1BSMA 1XREA 4JZGA 1JA8A 4E4EA 1KKCA 1I0HA 1VEWA 4X9QA 2P4KA 1N0JA 3QVNA 1AR4A 1EN6A 1N0NA 1WB7A 1GN2A 1ZUQA 1EN5A 1PL4A 5AG2A 1XILA 4YIOA 1GN4A 3C3TA 1D5NA 3C3SA 1MSDA 4GUNA 4JZ2A 3K9SA 1GN6A 1MNGA 2ADQB 5A9GA 3AK1A 1PM9A 1MMMA 1ZSPA 2RCVA 2QKAA 3KKYA 3LSUA 2CDYA 3AK3A 1XDCA 2AW9A 1VARA 3DC5A 3MDSA 1BS3A 1Y67A 2CE4A 1JR9A 1LUWA 1B06A 1EN4A 1AP5A 1ZTEA 1EM1A 1AR5A 2ADPA 1AVMA 1ZLZA 1MA1A 3BFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYY A;  1P7G A;  3TJT A;  4C7U A;  3RN4 A;  1BT8 A;  1WB8 A;  1GN3 A;  1XUQ A;  1QNM A;  3AK2 A;  4BR6 A;  1I08 A;  3EVK A;  1IDS A;  1AP6 A;  1IX9 A;  1IXB A;  4FFK A;  2QKC A;  2GDS A;  3CEI A;  1SZX A;  1LUV A;  3IC9 A;  3OT7 A;  4YIP A;  4F6E A;  3DC6 A;  1BSM A;  1XRE A;  4JZG A;  1JA8 A;  4E4E A;  1KKC A;  1I0H A;  1VEW A;  4X9Q A;  2P4K A;  1N0J A;  3QVN A;  1AR4 A;  1EN6 A;  1N0N A;  1WB7 A;  1GN2 A;  1ZUQ A;  1EN5 A;  1PL4 A;  5AG2 A;  1XIL A;  4YIO A;  1GN4 A;  3C3T A;  1D5N A;  3C3S A;  1MSD A;  4GUN A;  4JZ2 A;  3K9S A;  1GN6 A;  1MNG A;  2ADQ B;  5A9G A;  3AK1 A;  1PM9 A;  1MMM A;  1ZSP A;  2RCV A;  2QKA A;  3KKY A;  3LSU A;  2CDY A;  3AK3 A;  1XDC A;  2AW9 A;  1VAR A;  3DC5 A;  3MDS A;  1BS3 A;  1Y67 A;  2CE4 A;  1JR9 A;  1LUW A;  1B06 A;  1EN4 A;  1AP5 A;  1ZTE A;  1EM1 A;  1AR5 A;  2ADP A;  1AVM A;  1ZLZ A;  1MA1 A;  3BFR A; 
#chains in the Genus database with same CATH topology
 1P7G A;  4UFZ A;  2Q69 A;  2NN4 A;  3ETG A;  1WB8 A;  4J42 A;  1HNZ O;  2YC0 A;  1XEQ A;  2BOC C;  4TV9 A;  2XAJ A;  2VWK A;  1MG1 A;  2RDC A;  4QJF B;  5HFL A;  3CYO A;  4JI7 B;  1AJQ A;  4WFB V;  3E8F A;  1J95 A;  1TGO A;  3JAS B;  4O4I A;  1Q5O A;  1GAX A;  1E1Q G;  4J7J A;  3CEI A;  1HDJ A;  1Y66 A;  1LUV A;  3IC9 A;  4AHC A;  1K4D C;  2GBO A;  3G6B A;  2ZIO A;  3ZCC A;  2UU9 O;  1Q90 D;  4ASU G;  3TXQ A;  3CC4 V;  4JV5 B;  5CA0 A;  3CMA V;  2XUM A;  4WBN B;  3ZN0 A;  4I0X B;  3L75 H;  2AZ2 A;  4CBC A;  4JGS A;  1QLE C;  4LF4 B;  2YEV B;  4PDM A;  1FXH A;  2P4K A;  4K8Z A;  2RN9 A;  2JEU A;  2R9I A;  1EN6 A;  5EBM C;  4NXM O;  5KHH A;  2P67 A;  2ZDI C;  4DW0 A;  1ZUQ A;  4P9O A;  3BAB A;  1RM1 B;  3HB3 B;  1MOF A;  3WB0 A;  1VQP V;  1M56 B;  5EBW C;  1I94 O;  2R72 A;  5K1X A;  2F4V O;  2QWO B;  3T1C A;  4TT3 G;  3VQX A;  4J9Z B;  2DQ3 A;  4YJ3 B;  1XNR B;  5B1A B;  5ITZ B;  5CA1 B;  1S76 D;  4UV9 A;  1ZSP A;  4EB6 B;  1F4M A;  4DV1 O;  1SQB H;  1JQ0 A;  2UUB O;  5FNV A;  3KCX A;  5B1B B;  3IJ4 A;  3LNM B;  4J80 A;  4MSW C;  2YIA A;  4X66 B;  3AG4 B;  1YI2 V;  3BA9 A;  1SRY A;  4EEQ A;  2M6Y A;  1BHB A;  1G1X B;  4JI6 O;  4A5U B;  2ADP A;  3ZHQ A;  2HVJ C;  3HKB A;  3CC2 V;  2UXC O;  1OHH G;  2QTO A;  1PD3 A;  3K5L A;  3B8M A;  5K1P A;  3K06 A;  5LA6 B;  3D3Q A;  1OCC C;  1JOY A;  2Y0P A;  4HAM A;  1JX9 A;  1SA0 B;  1IDS A;  4RUE A;  5LGN A;  1IX9 A;  1IXB A;  2IJI A;  2QKC A;  1XI1 A;  3FD9 A;  2F1M A;  1BCC H;  4MVM A;  5LHI A;  4BW9 A;  2X7R B;  4WFF A;  3JD2 A;  2EJ7 A;  2JVD A;  1ZAU A;  3M99 B;  1V55 B;  2ZNI A;  4H37 A;  2BTQ B;  4R7C A;  1O9H A;  1P4R A;  3CRA A;  3L70 H;  1DF5 A;  4JI2 B;  2XAS A;  1PNL A;  3I5D A;  3L72 H;  3RYC B;  1Q6I A;  2PYL A;  1AI7 A;  3I56 V;  2A79 B;  4JI5 O;  4JF3 A;  1WPB A;  2ZM6 O;  4UUJ C;  4DR7 B;  2Q5Z A;  5IWA B;  3SYP A;  3CRM A;  3OMI B;  4IIJ A;  1SQG A;  3FB5 C;  2DQ0 A;  4JI4 B;  1K5Q A;  2UXD B;  4NXN B;  2E5L O;  2ZCE A;  2WLI A;  1TUB A;  4OXS A;  4TSF G;  3AK3 A;  5IE9 A;  1TAE A;  5IT9 N;  3ZHV A;  2HP8 A;  1S3J A;  4X1I A;  2F95 B;  2Z0A A;  3CP1 A;  2RJZ A;  1Y67 A;  4LF9 B;  2PZS A;  3E8G A;  3VBB A;  4ZOL A;  4H44 B;  5LHG A;  5IJ9 B;  4ICG A;  2ZKO A;  5KUK A;  4LFB O;  1XHZ A;  5B5E Z;  4G27 B;  3TJT A;  5DEC A;  3GVM A;  1BT8 A;  1NTM H;  4ABM A;  4R50 A;  1OCR C;  4MTX A;  2OIE A;  3R66 A;  1HNZ B;  2K9P A;  4PHZ A;  3LDC A;  2IJJ A;  4I9Q A;  3D36 A;  1THZ A;  3K79 A;  4JYB A;  5LOV A;  2EIK C;  3FB6 C;  4DR2 O;  3OUF A;  4B3S O;  3OT7 A;  3DSQ A;  2JGD B;  4F6E A;  3CPW U;  4LFA B;  3DTU B;  1HP8 A;  4LCU C;  4JI0 O;  3JAW B;  1L8D A;  2HEP A;  5FL7 G;  1AR4 A;  3OE7 G;  2IU3 A;  4IGG A;  4UCS A;  3K0G A;  4MVS A;  2PYJ A;  3F7V C;  2Q6A A;  3AG2 C;  1Q3E A;  1H2S B;  3LSQ A;  1WAZ A;  4KUM A;  1EBO A;  5LMU O;  4GKK B;  4DR6 B;  1QR9 A;  1FJG O;  3CRC A;  1I94 B;  4WF9 V;  1PM9 A;  1G8M A;  5EYP B;  1M9N A;  1SET A;  2F4V B;  4LF8 O;  3SJB C;  4I50 A;  4DYL A;  1NT2 B;  2CH7 B;  4DV1 B;  1Y4M A;  1Q43 A;  4FIP C;  3E35 A;  1DLB A;  3LSU A;  3IAY A;  3HR0 A;  3FB8 C;  5KX5 B;  1R3I C;  1QHT A;  5KUM A;  2JS3 A;  3DC5 A;  1MZF A;  1LUW A;  4TUY A;  1SKV A;  3RYI B;  5CBG A;  3ASN C;  3QO5 A;  4D7S A;  2VS0 A;  5KHK A;  3APO A;  5KMG A;  2DN9 A;  1F51 A;  4PV1 B;  1BHA A;  2NR5 A;  3SYA A;  1XNQ B;  2UXC B;  1V54 C;  3RN4 A;  4R8C A;  4TV8 A;  4ZKI A;  3JSL A;  5LMN O;  2HHH O;  2EIN C;  4X1Y B;  4J41 A;  3K58 A;  3OEH G;  1S5H C;  2ZE5 A;  4MTG A;  5KLV H;  2ZDI A;  3BY6 A;  4B7E A;  3ZX6 A;  3U11 A;  4K3A A;  1KMI Z;  5KAI Z;  1N36 B;  1Z5W A;  1Y74 B;  4O4J B;  3F7Y C;  2EZP A;  2QTS A;  1N33 O;  3TET A;  1I5Y A;  2W6I G;  3CS5 A;  1K5S A;  1N0J A;  1J5E O;  2W0X A;  1IVS A;  2CTR A;  2LP7 A;  4LR3 A;  1VQO V;  2VQF O;  4YIO A;  3T4Z A;  3JAK B;  5H5N A;  4PI2 A;  4MTF A;  2P5O A;  3E2E A;  4K0K O;  1MSD A;  5J2U B;  3TGU H;  2ZM6 B;  5LP6 B;  3K0D A;  3JAT A;  1YHQ V;  1I5X A;  2NLJ C;  3ASO B;  4DR5 O;  1XMQ B;  1G6U A;  3G80 A;  5L3E A;  1P49 A;  4GX5 A;  1YIJ V;  1QLN A;  5KA6 A;  4RQE A;  1K92 A;  4CS4 A;  2HG5 C;  2XAF A;  3ZJZ A;  2ZE7 A;  2QDO A;  3SPC A;  1VF6 C;  2EBO A;  4JI3 O;  4ZHQ B;  2DW4 A;  4OX9 O;  1N34 B;  1KKD A;  1ZLZ A;  1VQ4 V;  4PDR A;  5LYJ A;  1RM1 C;  5JJJ B;  3EFF K;  4JTA B;  4O2B B;  4X89 A;  3UO2 A;  5KHI A;  2X6A A;  4UVC A;  2D2C B;  4NB5 A;  5IYD O;  3WB1 A;  3FYI B;  4O4H A;  1FXK C;  4FFB A;  3N2K B;  4DR2 B;  4YIP A;  2A3Q A;  4JAA A;  4EFB A;  1XBL A;  4X62 B;  1H8H G;  4U3J B;  1VF7 A;  2QEX V;  3ZHS A;  4UB6 Z;  1VIB A;  2BE3 A;  4Z2W A;  4X88 A;  4CS2 A;  2FKX A;  4NVP A;  1RSO B;  2ITD C;  1N32 O;  2A9H A;  1AI5 A;  1N4C A;  3KZI Z;  2X6B A;  1AJN A;  4MS2 A;  3GWK C;  1YTF D;  2ODM A;  2HJF C;  1UJW B;  4TV9 B;  1B3Q A;  1VP7 A;  4UVB A;  2WLN A;  1KQS U;  4HNA A;  2XAQ A;  4MVZ A;  4GUN A;  1K9M W;  5LMU B;  1AIL A;  4GT1 A;  1HR0 O;  1FJG B;  2CAZ C;  4O4I B;  3CJH A;  3CX5 F;  4X20 A;  2FB5 A;  2IJH A;  1CEZ A;  2OCC B;  4H13 B;  1OCZ B;  5L3B A;  1WLE A;  5EIB C;  5CA0 B;  4Z1V A;  4DW1 A;  1FFT B;  4RAI A;  3SYQ A;  1XDC A;  4DV5 B;  3QTC A;  4LFC O;  4CH3 A;  5L3F A;  1R73 A;  4HZ3 A;  1D5A A;  1R6K A;  2KKW A;  2PGG A;  4YJ2 A;  1B06 A;  5CN0 A;  1PPJ H;  1EN4 A;  1IBM B;  1U97 A;  4BAY A;  1ZTE A;  5CBF A;  4MW3 A;  2MW2 B;  4XBF A;  3CCR V;  1JCH A;  1AVM A;  1Q86 W;  1GTO A;  4IYH A;  1B6Q A;  3CME V;  5JH7 A;  3CRQ A;  4LNU A;  2VQE O;  1NQT A;  4L87 A;  2GTA A;  3ETE A;  5LMN B;  1I08 A;  3JAR A;  1QQC A;  2YIB A;  1H5W A;  4NYK A;  5FNV B;  1QVF U;  1R3J C;  1SZX A;  3BVO A;  4F6R A;  3BPZ A;  4DRX A;  2Q7G A;  5BR8 O;  4DV3 O;  5KA5 A;  3RGB A;  2N05 A;  4WCE V;  4AI8 A;  2CGO A;  2WLJ A;  2DE0 X;  3E22 A;  4XDL A;  1AI4 A;  5L3C A;  3QVN A;  4CZZ A;  2GV9 A;  4TWK A;  2L35 A;  1Q81 W;  4FLV A;  1J5E B;  1RP3 B;  1NBM G;  3G4S V;  3SGI A;  5J2T B;  2N04 A;  1NJI W;  1D2D A;  4ZI7 A;  3FFQ A;  3C3T A;  4DV0 O;  1NKD A;  3IC7 A;  1GO3 F;  3LNN A;  3VQW A;  3MAQ A;  3STL C;  2ZXW C;  4FLU A;  2ADQ B;  2P6J A;  1P7B A;  1K4C C;  2Y0I A;  1UPG A;  3CCS V;  4DV7 O;  3JYC A;  3LUT B;  3A0H Z;  4JTD B;  4Z1M G;  2QKA A;  1VF5 B;  4GX2 A;  3GB7 C;  3HKD A;  1ENV A;  2O57 A;  4DK0 A;  3CCU V;  4UCU A;  4LF7 B;  1W0K G;  2QR4 A;  4O2A A;  3JAL B;  1SQX H;  4KHP O;  1YTF B;  2XT9 A;  4DUZ O;  2LQT A;  1W2B U;  1EM1 A;  3FYE B;  4NR1 A;  1K7D A;  2JDI G;  2Y69 C;  5IYZ A;  4OX9 B;  1BQ0 A;  3VOU A;  5J9P C;  4KL1 A;  4JYY A;  2R70 A;  5CB4 A;  4B08 A;  1FKA O;  3G67 A;  2YI8 A;  5L3D A;  4IIJ B;  2WLL A;  4X1K B;  2QGN A;  4FK5 C;  1XHX A;  3F5T A;  3CD6 V;  2RMK B;  2WLI B;  1TUB B;  1JNB A;  2DYS B;  3QO7 A;  4J10 A;  3VQY A;  2UUC O;  3KDR A;  5HFM A;  1YJN V;  2HR3 A;  4JZG A;  2ITC C;  4X1I B;  4GX1 A;  2P90 A;  4ZOL B;  3FAV A;  3FX7 A;  2A0L A;  2P4V A;  3G71 V;  4GZR B;  4QE9 A;  2QWN B;  4FM2 A;  2F66 C;  2E3C A;  3O65 A;  4WFH A;  1N32 B;  2OCH A;  3QNE A;  3K3W A;  3GWO A;  3K57 A;  1EN5 A;  1SQP H;  3AG3 C;  3F5W C;  4IYI A;  3Q4H A;  3ABL B;  3ABK C;  4YHH O;  4U3F H;  2V7Q G;  4WBN A;  5LBQ A;  1OZ0 A;  4I0X A;  1GN6 A;  2H94 A;  1MNG A;  1EZV H;  5LOV B;  3AK1 A;  2JGU A;  1HR0 B;  4UV8 A;  4NTY A;  2N74 A;  2C2A A;  2UXB B;  4NTX A;  3X2Q B;  2RCV A;  1YVW A;  2ZIM A;  4B3T O;  1VF6 A;  1VQ9 V;  4UCT A;  3AG7 A;  3CHX A;  1EFR G;  3UKM A;  1FAF A;  1WA8 B;  4WFE A;  2FL4 A;  1PP9 H;  4LFC B;  2WPD G;  4J7Z A;  3OEE G;  2OWO A;  5F2V O;  4JAS A;  4JTC B;  2ETN A;  4PA6 A;  4XDK A;  1BQZ A;  3IGA C;  2UUA O;  4YJ3 A;  1QBZ A;  4EB6 A;  3W7S A;  4MTO A;  2YXH A;  4DK1 A;  2ZE6 A;  2AGA A;  5IY5 C;  1FXK A;  4YXW G;  4OPH A;  4E2L A;  3LDD A;  4FM0 A;  1S77 D;  2LW1 A;  2CTQ A;  3B40 A;  2KQX A;  2Y48 A;  4GKJ O;  3J80 N;  1ZWI C;  3O9O A;  4IHJ B;  4CH5 A;  1XUQ A;  3H9V A;  4BW5 A;  3ABM C;  2IJK A;  2EIM B;  2Q8V A;  3T1H B;  3OTF A;  1YEW A;  3ASO C;  3N2G A;  2KB1 A;  5LHH A;  1AR1 B;  4ZBM A;  3A0R A;  3DC6 A;  1NR7 A;  3ZRS A;  3L9D A;  1T5E A;  4X64 O;  1OCO C;  4DV3 B;  5FPO A;  4DV6 O;  4TUY B;  1M57 B;  1K73 W;  4RWU A;  1KB9 F;  4BIU A;  1IUR A;  1VQN V;  4PDL A;  1VQK V;  3CXH F;  1H2G A;  2DJV A;  5E1A C;  1K34 A;  1WP8 A;  2D3O W;  5B3S C;  4CC6 A;  2UU9 B;  4DV0 B;  1W59 A;  1Y76 A;  2JEX A;  2IH1 C;  1QLE B;  1TUE B;  2YXY A;  4EFE A;  3PJS K;  3ZRW A;  3SYO A;  2LGW A;  2LGQ A;  5FPR A;  3FKS G;  3R65 A;  1ROP A;  5TIS Z;  4DV7 B;  3RYC A;  4NXM B;  3ZN1 A;  1QVG U;  5JQG A;  4CC5 A;  3OW2 U;  4LH6 A;  3SYC A;  2XTA A;  1R1B A;  2YIC A;  2HFE C;  1M1K W;  4IT5 A;  4X8A A;  1N8R W;  2Z5U A;  1JR9 A;  1WJZ A;  2NNU A;  4FJC C;  1I7F A;  3RYF B;  4TQD A;  5KHJ A;  1SQV H;  4DUZ B;  1VQ5 V;  3BFR A;  3E8H A;  2FYU H;  2UUB B;  4N21 A;  1FFX A;  4I55 A;  5BMV B;  1HNX O;  1IBL O;  1NZ6 A;  1JVM A;  3S3X A;  3WG7 C;  4BWA A;  3OD4 A;  4BR6 A;  3CB2 A;  2IBZ H;  3JAT B;  3M8A A;  2YS8 A;  3T1Y O;  4H0L B;  3ETD A;  1FD9 A;  5IYB O;  2QSA A;  1RPO A;  5IJ9 A;  2UXN A;  5H9C A;  3W7U A;  4PD4 F;  2AHZ A;  2EUL A;  1YJ9 V;  1HW7 A;  4JI6 B;  2EX3 A;  2GHY A;  2YIB D;  1BGY H;  4JYC A;  2WAM A;  5BXZ A;  2GTS A;  3CC7 V;  1OCC B;  1IZ3 A;  3ZMU A;  3M7M X;  3L71 H;  2Y4U A;  3MHS C;  4MVU A;  5JCO C;  4X65 O;  4J11 A;  4DV2 O;  4WFG A;  4YY3 O;  1N0N A;  1PV0 A;  2XND G;  1JFF B;  1GN2 A;  2EIJ B;  2FTK A;  2EIL C;  1XIL A;  3CCJ V;  3UT5 B;  1ORQ C;  3DGE A;  4I4T A;  3SPG A;  1H8E G;  1GH6 A;  4OPA A;  4RO2 A;  4DR4 O;  2K1E A;  2QA4 V;  2VWJ A;  1NH2 D;  2FML A;  2RQ6 A;  2WLK A;  4J9Y B;  4O4H B;  4FFB B;  3ZRX A;  1R3L C;  1JPX A;  3JD0 A;  1KD1 W;  2LW7 A;  3SR2 C;  4B3T B;  2CDY A;  3RT3 C;  4LC1 A;  3WU2 Z;  3OM3 B;  1E1R G;  3CXC U;  4JI5 B;  1NVP D;  1KP2 A;  4G28 B;  3ABT A;  2HKO A;  2YXL A;  3MHH C;  5GW7 A;  1JJ2 U;  4QGP A;  2UUA B;  2RNB A;  1VQ6 V;  2CH7 A;  1M4U A;  2E5L B;  4GCZ A;  4GLX A;  5LXT A;  4HNA B;  2YID A;  5D5Q A;  4W4L A;  2DWD C;  3AK2 A;  3CJH B;  5JWP A;  4X20 B;  3WFV A;  5JVD A;  4FLT A;  5EC1 C;  4PEL A;  3HKE A;  3JSN A;  3OUS A;  4LFB B;  2OIG A;  1Q6H A;  1WP7 A;  5H6Q A;  1M56 C;  1OCR B;  4JI1 O;  3H1H H;  4YJ2 B;  1SER A;  4X9Q A;  4DV6 B;  1XNR O;  1TVK B;  3W7X A;  5B1A C;  1XQ8 A;  2EIK B;  2P22 C;  5B1B C;  3RVZ A;  4B3S B;  4X66 O;  4LF5 O;  3ZHU A;  4B7K A;  1KUQ A;  1WN7 A;  4LNU B;  1PL0 A;  1F23 A;  3AG4 C;  4P30 A;  3RW0 A;  1G4Y B;  2CTW A;  4JI0 B;  3N27 A;  4Q6G A;  3B09 A;  2JJ1 G;  4O4L A;  2F93 B;  4G2K A;  1S0V A;  1US6 A;  5EK0 A;  3A2F A;  2DYS C;  3AG2 B;  3BRC A;  1K8A W;  1P84 F;  2QE7 G;  4PA4 A;  3JAK A;  1VAR A;  1KC8 W;  2ZR2 A;  2BTO A;  1BS3 A;  2WSS G;  3CCQ V;  4HBN A;  3HKC A;  3ZMV A;  2PTM A;  5GTI Z;  4LF8 B;  4HYO A;  4ZI7 B;  1WPX A;  1NH2 B;  3U0Z A;  1MAB G;  4DR3 O;  4PA7 A;  3ABL C;  2Q0O C;  1Z2G A;  3QO8 A;  3RVY A;  1VQ7 V;  5IJ0 A;  1GM9 A;  5IDJ A;  1V55 C;  1R6N A;  3UCS C;  5CA3 A;  3B8N A;  2Q68 A;  4CH6 A;  2Q7H A;  3MD0 A;  1VMG A;  3ASN B;  4LWS A;  1AP6 A;  4FZ0 A;  3S3W A;  2LJ2 A;  4QIW F;  2WA4 A;  2IH3 C;  1NVP B;  1GKF A;  2E76 B;  4ZHQ A;  4GYC B;  3JD1 A;  1H38 A;  4D7T A;  2W6J G;  1DTO A;  2B1I A;  1V54 B;  3E86 A;  1QU7 A;  3I55 V;  3P30 A;  2VRZ A;  4OGQ B;  1VQL V;  2CUG A;  2EIN B;  3ETQ A;  3ZHR A;  4JI4 O;  1SQF A;  4RQF A;  2HHH B;  5IYZ B;  1R6T A;  4DV2 B;  1Q6U A;  3CSX A;  3JCU Z;  3J7A U;  3NXS A;  4AQY O;  3OR7 C;  1YCI A;  4LP8 A;  1NTK H;  5EBL C;  5CMU A;  1Q7Y W;  2ZNJ A;  4LF9 O;  4JZ2 A;  1NTZ H;  1N33 B;  1SC5 B;  4L8J A;  2ZIN A;  3RYH A;  2DYR B;  2QWQ B;  3HKB B;  2JRI A;  2H3O A;  2QJ1 A;  2Q7E A;  1Z5V A;  4RUF A;  4WFA V;  2VQF B;  4FPP A;  2UXX A;  4BIZ A;  5A2Q N;  1CPY A;  3FAV B;  2GUZ A;  3H1I H;  1M57 C;  2E75 B;  4K0K B;  2QM8 A;  2WA3 A;  3OR6 C;  2HJD A;  4DV4 O;  5GON A;  1BL8 A;  3OFN G;  4JYA O;  3ZMS A;  1A32 A;  2DWE C;  2QWP B;  4QE7 A;  4QPK A;  5EZY A;  4LFA O;  4UCR A;  2Z3Y A;  3APQ A;  3Q4H B;  1GRJ A;  4TOI A;  5H2F Z;  4DR5 B;  1CXZ B;  2B5U A;  2R9R B;  3E83 A;  2KG7 A;  4FLY A;  4H33 A;  1ZL8 A;  3TCU A;  2AHY A;  3H01 A;  2ZE8 A;  1LR1 A;  1YXB A;  4I9W A;  3ML0 A;  5LGT A;  3K5N A;  3BCC H;  3SPJ A;  2V1D A;  5B1O A;  3DXR A;  5JCO A;  3ZMZ A;  4JI3 B;  5C8Y A;  1IJG A;  4KP4 A;  2YSU B;  3BA8 A;  3CCL V;  4GKK O;  4DR6 O;  3W7W A;  1BE3 H;  2BSK A;  1EZJ A;  4JI1 B;  1SES A;  2ZD9 A;  1XL6 A;  1DGS A;  1FXK B;  1YJW V;  4UXN A;  4JPR A;  1PL4 A;  3ZBH A;  4LF5 B;  1D5N A;  2XOK G;  5KAF Z;  1B04 A;  3K9S A;  3ZHT A;  2ILM A;  3B2E E;  1GM8 A;  1XL4 A;  3P3N A;  3H1K H;  2JJ2 G;  2ZT9 B;  3K5M A;  2F43 G;  4Q20 A;  1X59 A;  3N2G B;  1H2M A;  3L74 H;  1V9P A;  1VQM V;  3HPL C;  3JAS A;  5J2T A;  1XMO O;  1XNQ O;  3KG2 A;  5L3G A;  3JD4 A;  3OTO O;  3K08 A;  3UM7 A;  3CCE V;  4MT8 A;  4I5S A;  3SPI A;  1ZX3 A;  3AG1 B;  1L0L H;  2YEV A;  2ZR3 A;  1BZK A;  5DM6 V;  2IM9 A;  4K8X A;  2EIJ C;  1KEC A;  3D8C A;  4B3R O;  2R9A A;  1E79 G;  3P3P A;  1OJH A;  4J7K A;  1N36 O;  1Y76 B;  4DR3 B;  3UO3 A;  2W0F C;  3K9A A;  4DO2 A;  1HWY A;  3SPH A;  4XDJ A;  3ZRW B;  1NI8 A;  3JAL A;  4B3M O;  2GDS A;  5ITZ A;  5CA1 A;  5JQG B;  5JJE B;  3LDE A;  3WB2 A;  3ZS8 C;  5E79 Z;  3E8B A;  2MK3 A;  1K97 A;  3W7T A;  2BCC H;  2IW5 A;  1VQ8 V;  2VQE B;  1S5J A;  2ARH A;  5LP6 C;  3B77 A;  2M7W A;  3CE2 A;  4I50 B;  4X1K A;  1FS0 G;  1XMQ O;  3AEI A;  4R6Z A;  3RBZ A;  2EZO A;  2Q67 A;  1PNM A;  2A06 H;  2QKS A;  1FFX B;  2JS5 A;  4I55 B;  4EKW A;  1WNS A;  4AQY B;  1MSW D;  4JI8 O;  1TA8 A;  2PI4 A;  3JCZ A;  3C90 A;  5BR8 B;  1QR8 A;  2ATK C;  2AXT Z;  3TK1 A;  4PI0 A;  5LA6 A;  2DMX A;  5EC2 C;  1IBK O;  4QPJ A;  1SA0 A;  4DR1 O;  1N34 O;  3G6E V;  5KMG B;  4QNH B;  1R3K C;  1Y6X A;  4PA3 A;  2YUA A;  3IFX A;  1RPR A;  1RFY A;  4NTW A;  4TV8 B;  2AW9 A;  1NS1 A;  2H8P C;  1MZE A;  2Q4P A;  2ZXW B;  5IYC O;  2BTQ A;  1AJP A;  3J81 N;  4DV4 B;  4LF6 O;  1KP3 A;  4JYA B;  1AR5 A;  5GTH Z;  4FLX A;  4X62 O;  1YZB A;  4I4T B;  4C7U A;  4CH4 A;  5C93 A;  1FPO A;  5DED A;  1WA8 A;  3THO A;  2WWW A;  3P32 A;  3OMN B;  3EVK A;  2CTP A;  2HLD G;  4KHP B;  1SZT A;  2QM7 A;  4FMT A;  3ICX A;  2Y69 B;  2Q73 A;  3TXS A;  1BSM A;  1KYO F;  1M93 A;  5H6R A;  1KBH A;  1JA8 A;  2CGN A;  3ZIA G;  4FVM A;  5KHG A;  1I0H A;  4IHJ A;  1U96 A;  1L0N H;  4UB8 Z;  2P7T C;  2EJR A;  4PJ0 Z;  3BAA A;  3QF7 A;  2OCC C;  5LXT B;  4DUY O;  1OCZ C;  4DV5 O;  2XAG A;  1GN4 A;  2OT5 A;  2Y4T A;  2PY5 A;  2UUC B;  3C3S A;  1W0J G;  1JJO A;  3OGI B;  3ABU A;  1IBM O;  1DF4 A;  1X4T A;  5JVD B;  3E89 A;  2JK5 C;  3VQV A;  3EHB B;  1XOU A;  5LL6 Y;  3HKE B;  1O9G A;  2GSM B;  4LH7 A;  2ZQM A;  3SJQ C;  5LYJ B;  3KKY A;  4D6T H;  2XHB A;  1HNW O;  1XMO B;  3AG3 B;  2JGD A;  1FYJ A;  2QWR B;  1YDX A;  3QG5 A;  3ABK B;  3OTO B;  2DOS A;  5BY1 A;  1KU9 A;  3MDS A;  4YHH B;  3JAW A;  2F23 A;  3UQ8 A;  2G38 A;  3SJC C;  5BZB A;  4GX0 A;  2PUS A;  2WLH A;  4MVR A;  3FB7 C;  2PF4 E;  3STZ C;  2XAH A;  2X6C A;  1AB3 A;  1Q82 W;  4F4L A;  3LSS A;  3BHP A;  5CBH A;  2LFR A;  2OTJ V;  4U7N A;  4B3R B;  1GK9 A;  1F4N A;  1H2L A;  5B66 Z;  1FXV A;  4BIO A;  4CS3 A;  4JI7 O;  4K35 A;  4O4L B;  2DYR C;  4FFK A;  3RYF A;  1GM7 A;  5EYP A;  4B3M B;  3T4D A;  4PA9 A;  5IY5 B;  1AI6 A;  3NR7 A;  3RFR A;  4JV5 O;  1PNK A;  3T2M A;  1XRE A;  2CK3 G;  2X0L A;  5KX5 A;  5BMV A;  4LF4 O;  4E4E A;  1S72 V;  2AZ0 A;  1UFI A;  4GKJ B;  1VEW A;  1M90 W;  3ABM B;  3HKC B;  1ARO P;  4KXR A;  3JAM N;  3RYI A;  1WB7 A;  4KFM A;  5AG2 A;  2P06 A;  4P9P A;  5IJ0 B;  4LF7 O;  4JAU A;  1F7Y A;  1H2N A;  1M5I A;  1OCO B;  5FLX N;  1K3E A;  4JI8 B;  4AIL C;  1SS3 A;  4X64 B;  2L6L A;  3KCY A;  4FZ1 A;  4LWS B;  3D3I A;  1H2K A;  1MMM A;  3BEH A;  4JAV A;  4X1Y A;  1IBK B;  2Q0A A;  3CWB H;  4DR1 B;  4PDV A;  3PN1 A;  2LO1 A;  4UVA A;  1JFF A;  3A8T A;  4FLZ A;  1SF9 A;  3K5O A;  5JH7 B;  5B3S B;  3UT5 A;  2QM4 A;  1FOU A;  2B9Z A;  5LGU A;  3U10 A;  4MVQ A;  3CCV V;  1NU1 H;  4ZIB A;  3JAR B;  1Y74 A;  2YDE A;  4O4J A;  1NR1 A;  3H1J H;  1AP5 A;  3H1L H;  2HVK C;  4LF6 B;  2OTL V;  1URF A;  4F6R B;  1MA1 A;  2A7W A;  2E74 B;  3EXA A;  4DRX B;  1YIT V;  4W4K A;  2OYQ A;  1GN3 A;  2BOB C;  3CCM V;  1IXM A;  1QNM A;  3JD3 A;  5JJN B;  3K03 A;  3K04 A;  3RWR D;  5J2U A;  3E22 B;  1YF2 A;  4P2Z A;  3RYH B;  5LP6 A;  3OMA B;  4UCV A;  2Q9L A;  1S5L Z;  4LBE C;  4IL6 Z;  3SJA C;  4UCO A;  4TQF A;  2GUZ B;  2LFS A;  3K59 A;  2V4D A;  1GMG A;  3WG7 B;  5D5P A;  1HNX B;  1KKC A;  1IBL B;  3D36 C;  1LNQ A;  2B1G A;  3AG1 C;  5GON B;  2UXB O;  3OAA G;  5DN6 G;  1QCE A;  3ZED A;  4JI2 O;  1YSC A;  2JIZ G;  3X2Q C;  3T1Y B;  3ZMT A;  5EZY B;  3CRR A;  3L73 H;  2KSD A;  2IU0 A;  3HKD B;  5B1N A;  3ZRV A;  4MVO A;  4DUY B;  2KG7 B;  4DR7 O;  1ZL8 B;  1BMF G;  3OGC C;  5IWA O;  4O2A B;  1JMK C;  4O2B A;  5A9G A;  1K33 A;  1OV9 A;  3A0B Z;  1TVK A;  3DXR B;  2UXD O;  4NXN O;  4DXW A;  5C8Y B;  3B4S A;  4X65 B;  2YI9 A;  4YY3 B;  3N2K A;  4MW8 A;  2EIL B;  5CB4 B;  1Q8I A;  4I7Z B;  1CP9 A;  1HNW B;  2BSK B;  2PI5 A;  4NKG B;  4N23 A;  4U3J A;  2CE4 A;  2WLL B;  4DR4 B;  3T1H O;  1L1F A;  2EIM C;  1COW G;  2WLM A;  4FLW A;  4U7O A;  3SDL A;  5EIB D;  1RSO A;  4FM1 A;  1PKX A;  1DK1 A;  1SQQ H; 
#chains in the Genus database with same CATH homology
 4JYY A;  1P7G A;  3TJT A;  4C7U A;  3RN4 A;  1BT8 A;  1WB8 A;  1GN3 A;  1XUQ A;  1QNM A;  3AK2 A;  4BR6 A;  1I08 A;  3EVK A;  1IDS A;  1AP6 A;  1IX9 A;  1IXB A;  4FFK A;  2QKC A;  2GDS A;  3CEI A;  1SZX A;  1LUV A;  3IC9 A;  3OT7 A;  4YIP A;  4F6E A;  3KDR A;  3DC6 A;  1BSM A;  1XRE A;  4JZG A;  1JA8 A;  4E4E A;  1KKC A;  1I0H A;  1VEW A;  4X9Q A;  2P4K A;  1N0J A;  3QVN A;  1AR4 A;  1EN6 A;  1N0N A;  1WB7 A;  1GN2 A;  1ZUQ A;  1EN5 A;  1PL4 A;  5AG2 A;  1XIL A;  4YIO A;  1GN4 A;  3C3T A;  1D5N A;  3C3S A;  1MSD A;  4GUN A;  4JZ2 A;  3K9S A;  1GN6 A;  1MNG A;  2ADQ B;  5A9G A;  3AK1 A;  1PM9 A;  1MMM A;  1ZSP A;  2RCV A;  2QKA A;  3KKY A;  3LSU A;  2CDY A;  3AK3 A;  1XDC A;  2AW9 A;  1VAR A;  3DC5 A;  3MDS A;  1BS3 A;  1Y67 A;  2CE4 A;  1JR9 A;  1LUW A;  1B06 A;  1EN4 A;  1AP5 A;  1ZTE A;  1EM1 A;  1AR5 A;  2ADP A;  1AVM A;  1ZLZ A;  1MA1 A;  3BFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...