1IXBA

Crystal structure of the e. coli manganese(ii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Structures at 0.90 A resolution of the oxidised and reduced forms of the Y174F mutant of the manganese superoxide dismutase from Escherichia coli
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 79
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1ixbA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1ixbA02
3AK3A 4GUNA 1JR9A 1BSMA 1ZSPA 2AW9A 5AG2A 1AP5A 1AP6A 1WB8A 1B06A 1I08A 3EVKA 1GN3A 3DC5A 1MMMA 1VARA 1JA8A 3C3SA 1GN4A 1AR5A 1SZXA 3QVNA 3KKYA 1GN6A 1EN4A 4YIPA 4JZ2A 1I0HA 1GN2A 1AVMA 4E4EA 3AK1A 4YIOA 1XREA 1QNMA 4JYYA 1MA1A 1MNGA 1Y67A 3DC6A 3K9SA 3C3TA 1XUQA 3AK2A 1ZUQA 2P4KA 4JZGA 1EM1A 1PM9A 3MDSA 4C7UA 4X9QA 1IX9A 1WB7A 1N0JA 1BT8A 2QKCA 1IXBA 3CEIA 1D5NA 2ADPA 1AR4A 1EN5A 2ADQB 1ZLZA 1XDCA 1MSDA 1ZTEA 1EN6A 1LUWA 4F6EA 2CDYA 1VEWA 4BR6A 3TJTA 2GDSA 5A9GA 1IDSA 3OT7A 3IC9A 2RCVA 1LUVA 3LSUA 1PL4A 2QKAA 1KKCA 1XILA 1P7GA 3RN4A 2CE4A 1BS3A 3BFRA 1N0NA 4FFKA
chains in the Genus database with same CATH superfamily
2UUCO 3QO8A 4DW1A 4X20A 1EFRG 2ETNA 2WSSG 1Q82W 5B1BB 4UVCA 2Y69C 4JI5O 5D5QA 2AW9A 1Y66A 1VF5B 2WLIB 1NQTA 3SYAA 2F93B 3HKBB 1M9NA 1G8MA 1VIBA 3QF7A 2GUZB 4H44B 3KKYA 1XNQB 2BCCH 4LR3A 3K58A 3RGBA 4RQFA 3CCLV 3ZHTA 4PD4F 3VBBA 2Q5ZA 1M4UA 3WG7C 1VF6C 1KB9F 1SA0A 2XT9A 5CA3A 4NXNB 2Q9LA 3BEHA 2E5LO 1S5JA 1Q5OA 3MDSA 1R73A 4RUFA 4LC1A 3K5OA 1I5XA 2UU9O 4GKKB 3FX7A 5LMNO 1L1FA 2Y4UA 3QG5A 2DOSA 4R7CA 2E74B 4DR6B 3JSNA 5IT9N 3ABLB 1IBMO 2YSUB 1TGOA 2IJJA 4D6TH 4ZIBA 2VQFO 3O65A 2Z0AA 3C90A 1H8EG 4PA3A 3IGAC 1KBHA 1S5HC 1HDJA 5IJ0A 2QM7A 4KL1A 4QJFB 4LF8O 2AZ0A 3BA9A 1LUVA 2AZ2A 1BZKA 1FAFA 2VQEB 3RN4A 5IYDO 2CE4A 1PNKA 1KYOF 2N05A 1SQGA 1M57B 4KP4A 4XDLA 5FPRA 3AK3A 1PNMA 1NTKH 3M99B 3SYPA 3SJAC 4JI8B 1HNZO 2E76B 4GX0A 5JH7A 5BY1A 3RYFA 4LF5O 4LFCB 1AP5A 1D2DA 4UCUA 1MMMA 2QWQB 4U3JB 5JVDB 5IYZA 3N2GB 1BCCH 4MVZA 3ASOC 3CPWU 2YIBA 4LF9O 3E8BA 5H6QA 3JATA 5CBHA 1QNMA 4OXSA 4UCTA 1RSOB 1MNGA 1U97A 3G71V 2WLNA 3C3TA 3L72H 1FOUA 4X1YA 4LF7B 5D5PA 1H38A 4DV6B 2IU3A 3S3WA 1AI6A 3BRCA 4I5SA 4FIPC 3LNNA 2AXTZ 1OV9A 3JD2A 5KHIA 4LWSA 1ORQC 2JK5C 1IXBA 3SJBC 1K5QA 2XAFA 4DUZO 2XAQA 4ZKIA 1I94B 5JCOA 1K8AW 1Q6IA 3CD6V 3H1HH 3NR7A 4GLXA 5KUMA 3OGIB 5CA0B 2ZE8A 3I5DA 3ZMZA 2EJ7A 1PP9H 2OCHA 5LYJA 1WAZA 4EFBA 4PELA 5LMUO 3ABMC 4B3RB 2Q6AA 2CH7B 3LDEA 1VQLV 5KLVH 4YY3O 1AILA 4CZZA 2UUBO 1Y74B 4LF6B 3JARB 4LF4B 1AI5A 1BL8A 1WP7A 5BR8B 5BMVA 1JPXA 4UCOA 4BAYA 1H2SB 1NBMG 3Q4HB 2HKOA 1H8HG 3CJHB 1PD3A 3A2FA 2XNDG 5EIBD 1VMGA 2NNUA 1HR0B 2RJZA 4J80A 3CXCU 5EBMC 4O4IA 3UCSC 5B1AC 1H5WA 1SQXH 4B3TB 3AG2B 1EN4A 3U10A 4H37A 4U7NA 2XOKG 1H2MA 2ZXWB 3QO5A 5H9CA 4DV2B 2MW2B 2B5UA 3B4SA 1QVGU 1IVSA 1YTFB 4Z2WA 2DJVA 2ZE6A 4O2BB 2IW5A 3A0RA 2UUAB 3CWBH 2JGDB 2HEPA 2W0FC 4CS2A 3K59A 4X64O 2ZM6O 5K1PA 4J7ZA 2NR5A 2Z5UA 4OGQB 1WB7A 3UO2A 1WP8A 2W0XA 2FTKA 3OD4A 1D5NA 1XNRO 1GM9A 1EZVH 3D3QA 1L8DA 1AI7A 3BA8A 1N33O 4W4LA 4J7JA 1MSDA 3UM7A 1RPRA 2CTQA 2EBOA 3OR6C 4TUYA 1TVKB 3S3XA 4DK0A 3HKEB 4G2KA 2DYSB 4HAMA 2ZINA 4FVMA 2A06H 1PL4A 2EIKB 3OMNB 4YHHO 4DV7O 4KFMA 5B3SC 3G4SV 4O4HB 4MVOA 5LHGA 3UT5B 4NB5A 2QEXV 4PI2A 4X65O 3EXAA 3L74H 1SQVH 1V54C 1SQPH 1BSMA 1GH6A 4TV8B 2D3OW 1ZWIC 5GONA 1M93A 4I9QA 3OUFA 3EVKA 1GN3A 1FFXB 3CB2A 4GKJO 1PKXA 3OEHG 1YDXA 4AHCA 3E2EA 3FAVB 4B3SB 4CH6A 2BTQA 3HKCB 2EJRA 4GX2A 2IU0A 4NVPA 2Q73A 1R6TA 1Q6UA 2WWWA 4XDJA 5JJNB 3RYHA 3E22A 2IH3C 5EC1C 3JALA 1SRYA 4O4JB 4YIOA 1JMKC 3DXRA 2CGOA 4IIJB 1R3KC 1ZUQA 3QNEA 2QJ1A 3IAYA 2HFEC 4DV4O 4DR7B 2RDCA 3ASNC 3R65A 2H94A 4TOIA 1VQOV 1N0JA 3CRCA 2P7TC 2P5OA 4MTOA 2JRIA 1AR4A 2P4VA 1EN5A 2MK3A 4WCEV 5IWAB 3UQ8A 1QHTA 4FM1A 2XTAA 3ZN0A 2BSKB 4K0KB 1QLEB 2OCCB 3K04A 4ZHQA 1HNWB 1FD9A 3HB3B 1W2BU 1OZ0A 3HKDB 1K73W 1N36B 5LOVB 3LUTB 1V55C 5LXTB 1JJ2U 3F5WC 1KKCA 1SKVA 5DM6V 3ML0A 4BIUA 1MZEA 4QE9A 3U11A 4JI2O 1YF2A 2CK3G 1AJPA 4I7ZB 4FLUA 5KA5A 1N34O 3RYIB 1DTOA 5KX5B 3W7WA 3R66A 1CP9A 1XL6A 2XASA 4QIWF 4X89A 4GCZA 2DN9A 2WA4A 4J7KA 1VQKV 5JWPA 1ZL8B 3PN1A 2XUMA 4ASUG 4UB8Z 1K9MW 5KHGA 4J42A 1YI2V 2KSDA 1HNXO 4LNUA 2ZQMA 3M7MX 1G1XB 3ABUA 4WFAV 2H3OA 5BZBA 4CS4A 3T4DA 3OTOO 4JYCA 1OCRB 3AG7A 1XMQO 3ZMVA 3KG2A 3FYIB 3SPCA 4GZRB 1GAXA 5EIBC 1P7BA 1GRJA 2LGQA 4NXMB 3E86A 4JI0O 1ENVA 4I0XA 2Y69B 1S3JA 3VQVA 3N2KA 2UXDO 1BT8A 4UCSA 5KAIZ 4FLTA 1L0LH 1JX9A 3L71H 4TSFG 4YJ2B 2EIJC 1JFFB 4Z1MG 1VQ4V 3BPZA 2X0LA 4X1IB 1HP8A 5KMGA 2HHHB 1ZTEA 4UFZA 4PA4A 2LJ2A 1TAEA 2KG7B 3W7UA 1RP3B 2EX3A 3K5LA 4DR5B 1M1KW 4BR6A 5LA6B 3RVZA 4X66O 1FS0G 2YICA 3L70H 5J2TA 4X62O 3QTCA 3OT7A 4DR4B 4EKWA 1GM8A 4UV9A 1P7GA 5LGTA 4JI6B 1W59A 3CC7V 3ABTA 4WFHA 2RNBA 2EZPA 1IBKB 4P2ZA 2EILC 1JQ0A 4I50A 2Q7EA 4FFBB 3CXHF 2CTPA 1KU9A 4GT1A 4TT3G 4X88A 4I55B 3JAWA 3LSQA 2PY5A 2DYRB 3W7SA 2IJKA 5DEDA 3FB8C 4JI7B 3G80A 5CMUA 3T1CA 1ZAUA 1B3QA 1HW7A 2VWKA 5J9PC 2DQ3A 2F1MA 4U7OA 3T4ZA 4X20B 5IY5C 3T1HB 1YJ9V 4E4EA 2ARHA 4FZ1A 1DF5A 1VQNV 2CAZC 1M5IA 3DC6A 1RM1C 4DR3B 1IXMA 2BTOA 3E8GA 4FM2A 4IHJA 1Q81W 3LDDA 3FKSG 2LFRA 3UKMA 2F43G 1SZTA 2IBZH 3ZHQA 4JGSA 1BQZA 3SJCC 4OPHA 1K4CC 5GW7A 2YIAA 3SYCA 3MAQA 4LP8A 3O9OA 4LFBB 4KHPO 1SA0B 2ADQB 1ZLZA 4AQYO 3OE7G 5C8YA 2P22C 1NVPB 4BIOA 3OFNG 2VWJA 5LP6A 3GWKC 4LH6A 2GBOA 2EIMB 2FL4A 4R8CA 3ICXA 2NLJC 3IC9A 4B3MO 1W0KG 1NS1A 4F4LA 5JJEB 4DV0O 1WJZA 4R6ZA 2B1GA 1KC8W 5L3EA 3CCSV 1UFIA 2AHZA 1AB3A 1N32O 1WNSA 5CBFA 3AG1C 1JR9A 4DRXA 4DV5O 4PDRA 5IJ0B 1NTZH 4PDVA 2ZR3A 2JEUA 3DSQA 3APQA 1JA8A 2UXXA 2W6JG 3CCJV 1AROP 3ZJZA 3QVNA 2OTLV 4K8ZA 5L3FA 3CCMV 3OGCC 3ABKB 5B66Z 1NH2B 3D3IA 2N74A 1GN2A 5B1BC 4JAVA 2UXCO 1H2GA 4JI3O 2YEVA 3P3PA 4LFAO 5JH7B 3J81N 3RYFB 3CCEV 3D36C 3M8AA 1BHAA 3ETEA 1XI1A 1SQFA 4JYAO 3K06A 4HNAA 5IYZB 1NTMH 1MOFA 2X6BA 1I7FA 1WA8A 2WAMA 3FD9A 2P4KA 2ZT9B 4H0LB 1VQ9V 1EM1A 1WPBA 4UB6Z 4J41A 3STLC 4C7UA 1NZ6A 5LP6C 4BW5A 5IJ9B 4TV9A 1VQ7V 2Q4PA 2Y0PA 4WBNA 1DF4A 2W6IG 1Q43A 1XMOB 3JATB 3H1LH 1OJHA 3SJQC 3U0ZA 2HVKC 4X1YB 4WFEA 3WFVA 3I55V 4R50A 3JCUZ 3K08A 3B40A 4X65B 4MVSA 4O2AA 5LGNA 4NR1A 2VS0A 2BOBC 2IJIA 2G38A 1US6A 5JQGA 4LWSB 4FLZA 1OCOB 2UXBB 2R9AA 4I4TA 2FYUH 3CCVV 4GKJB 1IBLB 2Q7GA 2NN4A 1Q8IA 3TXSA 3T1YO 4FFKA 3UO3A 2LP7A 4O4LB 1NI8A 4WFFA 1PNLA 4JI4O 1YJNV 3CCUV 2OWOA 4MTGA 5LYJB 5AG2A 3L75H 2C2AA 1XEQA 2YUAA 1B06A 2VRZA 5K1XA 2A79B 1FPOA 1M57C 5B5EZ 2ZD9A 3ZHVA 4DR2O 1XNQO 1WLEA 4CBCA 4FMTA 1OHHG 4JTCB 3G67A 2AGAA 5BMVB 1FJGB 2GHYA 1VQPV 4KUMA 3E8HA 2O57A 3K9AA 3SYQA 1M56B 4DV3O 3JASB 3RYCA 5L3DA 4NXNO 2DWDC 3B77A 1AJNA 3B8NA 4O4IB 5EBLC 3F7VC 4HZ3A 4ZOLA 5KHKA 1J5EO 4X9QA 4JF3A 1V54B 1FXKA 4GKKO 4JI1B 3PJSK 2ZR2A 4J9ZB 1Y76A 1XL4A 1THZA 4DR6O 4DR1B 2FMLA 1GK9A 1NJIW 1J95A 2HJFC 5FPOA 4LCUC 1LUWA 4J9YB 4JPRA 3ZMSA 2KB1A 4F6EA 4YJ3A 3G6EV 4CH5A 4B7KA 1K4DC 1R6KA 3TJTA 1K34A 2DQ0A 3IJ4A 4QNHB 4EB6B 1L0NH 3D8CA 1N34B 3FB6C 4O2BA 1O9HA 3B2EE 2QKSA 3JAKB 2Z3YA 3TCUA 2HR3A 2EULA 3VQYA 1YCIA 1FXVA 4JI8O 1KD1W 4JV5B 4P9OA 4TUYB 1FYJA 3QO7A 4F6RA 2LQTA 1MSWD 4LFCO 3ZBHA 5JJJB 4Q6GA 1GM7A 3K57A 3DC5A 3SDLA 3VQXA 2F4VB 1ROPA 3CMEV 4I9WA 4JTAB 3C3SA 1S0VA 4JASA 2EINB 5KHHA 5CA1A 1URFA 1Y4MA 3MHSC 4ZI7A 2A3QA 4UXNA 4Q20A 5L3GA 3RVYA 4G28B 4PDMA 4RAIA 1FXKC 1AJQA 5H5NA 1MZFA 2CUGA 1V55B 5GONB 2QWNB 4O4HA 4J10A 2IH1C 4LF7O 2P90A 2X7RB 4DV6O 2YC0A 3NXSA 1P49A 1F23A 2BTQB 3AG2C 4CS3A 4K35A 5J2UA 3RYHB 5EZYA 3E22B 4P30A 4FLXA 2ZXWC 2QKCA 3CC2V 3HR0A 3DXRB 2ZIOA 2JS3A 3B09A 4DUYB 1I94O 1Q6HA 1VP7A 2DW4A 2QGNA 1QLNA 3WB1A 4B08A 4G27B 5HFLA 5CB4B 1GKFA 3JYCA 1K92A 2JJ1G 2YDEA 3CS5A 3LNMB 3VOUA 1YSCA 2QM4A 2YXHA 2HVJC 3SGIA 1E1QG 3BFRA 4HYOA 3BAAA 5FNVA 2UUCB 3SPGA 4LF6O 4UVBA 3ZRSA 4LF4O 4ZHQB 2F23A 5BR8O 4MTFA 2QE7G 3J7AU 4JI5B 2JEXA 1UPGA 5B1NA 1I08A 2EIKC 4DO2A 2WLKA 4TWKA 1HR0O 5ITZA 4N21A 1KMIZ 5L3CA 2ZNJA 3H9VA 4B3TO 1SERA 3HKDA 5HFMA 2M6YA 1GO3F 3CRMA 5H6RA 3AK1A 1F4MA 2KQXA 4X1KA 3EFFK 4DV2O 3ZRWA 2IM9A 2UUAO 1NKDA 4AQYB 1VQ8V 3SPJA 2GTAA 1N4CA 2ITCC 1CXZB 1Q7YW 2E5LB 4PDLA 2QM8A 1YHQV 4NKGB 1B6QA 2YS8A 2UU9B 2XHBA 1G4YB 3X2QB 3I56V 4JAAA 5LMNB 3ZMTA 3CHXA 2L35A 1GTOA 3ZEDA 1NVPD 3WB2A 1LNQA 1E79G 1OCCB 4D7SA 3P3NA 1IBMB 2Y4TA 1ZL8A 1SF9A 4UCRA 2VQFB 2R9RB 4N23A 5IE9A 4L8JA 2B9ZA 4I0XB 3ZHRA 5A9GA 2X6CA 3N2KB 4MW8A 4WFGA 4LF8B 3K3WA 4XBFA 4Z1VA 1RM1B 1EBOA 1AI4A 2OT5A 4IYIA 2PYLA 2PF4E 3AG4C 3CSXA 3RT3C 1T5EA 5KMGB 1QLEC 2OCCC 3OMAB 1QVFU 1Z5VA 4RUEA 4CH4A 4IYHA 1HNZB 3BABA 5J2TB 4LF5B 3L9DA 3WG7B 3E8FA 1NH2D 1YXBA 2PZSA 1CPYA 1JCHA 4B3SO 3A0HZ 4QPJA 1SZXA 1GMGA 4YIPA 1QBZA 1QR9A 4JZ2A 3JAMN 2N04A 1VQ6V 4LF9B 4I50B 3SR2C 2DMXA 2JJ2G 1XREA 4WFBV 1TUBA 4E2LA 1WN7A 5FL7G 3JAWB 4FZ0A 2QA4V 1XUQA 3ZRXA 1X4TA 1XOUA 4QE7A 2WLLA 2ILMA 1BGYH 5EYPA 2QTSA 1SQQH 2PI5A 4DR7O 4BIZA 1CEZA 1Z5WA 4CC6A 4I55A 4DW0A 3ZRVA 5L3BA 1PPJH 4GYCB 4DUZB 2V4DA 2P06A 2ZNIA 1OCRC 2V1DA 2PGGA 1MABG 4IHJB 4K0KO 2PI4A 2XAHA 1HNWO 1NU1H 3JCZA 1FFTB 4IL6Z 3K79A 2OIGA 4JI4B 1S72V 2GDSA 4DYLA 1P84F 5IDJA 4MVRA 1N36O 3D36A 3CCRV 2WLIA 5LMUB 1QU7A 3JD3A 3HKBA 1PV0A 4J11A 1BS3A 4FJCC 3ETGA 2GUZA 4PHZA 4YY3B 4OPAA 3AG3C 5C8YB 3ASOB 4DR2B 2UUBB 4GUNA 1S77D 5LP6B 3OR7C 4JYBA 4FLWA 2L6LA 2A0LA 1VF7A 3B8MA 3OTFA 4NYKA 4UUJC 1IURA 3H1IH 4DV3B 3EHBB 4K3AA 1VQMV 2DWEC 2XAGA 2KKWA 1YITV 3VQWA 1PL0A 5E1AC 3KDRA 1D5AA 1J5EB 2PUSA 2ZDIA 1AVMA 3K5NA 4MSWC 3ZHUA 5LHHA 4DRXB 4JTDB 2IJHA 1OCZC 2H8PC 3E35A 2DYRC 1TUEB 2QWRB 2QDOA 3CCQV 2JS5A 4X8AA 3ETDA 2CTRA 3KZIZ 3OEEG 5KAFZ 4BWAA 1HWYA 4X64B 4AI8A 3TETA 3TGUH 4NXMO 2ZM6B 3DTUB 3BVOA 3THOA 2E75B 1YTFD 2ATKC 1IJGA 4MW3A 2YEVB 4TQFA 2ADPA 1U96A 2LFSA 3WB0A 1XBLA 3ABMB 1YZBA 1XNRB 2A9HA 2UXNA 3FB5C 3HPLC 1N33B 1IZ3A 2YI9A 4XDKA 5LGUA 2XAJA 2HHHO 4HNAB 2HLDG 1QQCA 1JNBA 1WA8B 3CC4V 4DV1O 2QTOA 4FK5C 4DR5O 4IGGA 3KCXA 3BCCH 4TV9B 5C93A 2FKXA 4DR4O 2P6JA 4WBNB 4W4KA 2QWOB 3J80N 4FLYA 3ZMUA 4OX9O 5LBQA 4YHHB 4U3JA 5JVDA 3DGEA 4DV7B 3N2GA 4JI6O 1S5LZ 5B1AB 5IYCO 3JD0A 4PV1B 1IBKO 4B7EA 4O2AB 5IJ9A 4LH7A 2ZDIC 2HG5C 2WLHA 2OTJV 1R3LC 1ZSPA 2EIMC 1RSOA 5JQGB 3CE2A 1AP6A 2YIDA 2CTWA 3K0DA 4JI7O 4I4TB 3SPHA 5F2VO 1VQ5V 1VARA 2JGUA 2Q69A 3ABLC 2YXLA 1GN6A 4NTYA 4NTXA 3W7XA 5EC2C 3OUSA 1EZJA 3T2MA 3T1HO 1F51A 2RMKB 1BQ0A 1SC5B 1DLBA 5GTHZ 4MT8A 4U3FH 1R3JC 4RQEA 2Q68A 1DK1A 4PI0A 4DR3O 5KHJA 4UVAA 3CX5F 2LW1A 4PA9A 1XHZA 5CA0A 2V7QG 4O4LA 3ABKC 1KKDA 1NR7A 4DV4B 2GTSA 1KECA 2ZKOA 2Q0OC 5GTIZ 3JSLA 2CH7A 4LFBO 3IFXA 1RPOA 1H2KA 4GX1A 3RYCB 5B3SB 4H13B 4H33A 1WPXA 3FB7C 1I5YA 1Y74A 1YVWA 3JARA 4FM0A 2GSMB 1SQBH 2K1EA 4ZOLB 1FXKB 3Q4HA 2WLMA 2R9IA 3CJHA 3JASA 1G6UA 3FYEB 1XILA 1Y76B 1ZX3A 3GB7C 4JI2B 5EK0A 1N0NA 1MG1A 1N8RW 4QPKA 2ZIMA 4YJ3B 2PYJA 5H2FZ 1OCOC 3BHPA 2Q67A 3GVMA 2B1IA 1Q90D 2FB5A 2VQEO 2JGDA 4UCVA 3E89A 4UV8A 1JJOA 5E79Z 1GN4A 1RFYA 3E83A 1AR5A 5JCOC 4DK1A 5B1OA 2QR4A 4IT5A 3P32A 3STZC 2HP8A 4EB6A 3ASNB 4ZBMA 1HNXB 3OAAG 2EZOA 2R70A 1AR1B 2YI8A 1K3EA 4F6RB 1MA1A 3F5TA 4EFEA 5LL6Y 1B04A 2LW7A 3JAKA 3OTOB 3L73H 5CN0A 2PTMA 1XMQB 2LO1A 2E3CA 1PM9A 4JI0B 2YXYA 5CA1B 1TVKA 1IX9A 4ZI7B 3HKEA 2M7WA 2UXDB 3A8TA 1NT2B 1XMOO 2ODMA 1COWG 1M56C 1E1RG 1BE3H 2Y0IA 1S76D 3SYOA 1XDCA 3UT5A 3W7TA 1KQSU 3G6BA 1BHBA 1O9GA 1EN6A 1UJWB 3RFRA 2CDYA 3RWRD 1VEWA 3OM3B 4TV8A 3FFQA 4MVUA 4X66B 5J2UB 5EZYB 3ZHSA 1H2NA 4X62B 3JALB 2LGWA 4DXWA 2UXBO 4ABMA 2RCVA 3MD0A 3LSUA 1FFXA 1R3IC 1IBLO 1LR1A 5IYBO 3FAVA 1H2LA 2DE0X 2R72A 2D2CB 3A0BZ 3HKCA 5BXZA 1NR1A 1XQ8A 4KXRA 3K03A 3N27A 5DECA 4O4JA 3OMIB 1K5SA 1WB8A 4ICGA 4IIJA 4NTWA 4B3RO 2OIEA 2JIZG 2Y48A 4MVQA 3TK1A 5CB4A 5FNVB 1YJWV 1KP3A 3K0GA 3CMAV 3P30A 1FJGO 2ZE7A 1X59A 3CP1A 5KUKA 4CC5A 2DYSC 2Q8VA 1KP2A 3ZCCA 1Y67A 3K9SA 2EIJB 3RW0A 4RWUA 3AK2A 3AG4B 5ITZB 2BSKA 2EINC 3LDCA 1JVMA 4P9PA 1F4NA 2A7WA 2WA3A 4JI1O 3WU2Z 3ZN1A 5LOVA 4BW9A 3CRQA 1P4RA 4X1KB 3IC7A 5LXTA 3CEIA 5KA6A 4TQDA 2RQ6A 3ZRWB 4DR1O 4KHPB 3ZX6A 1SS3A 3CRAA 4QGPA 5DN6G 4GX5A 2AHYA 2OYQA 4FPPA 1FKAO 3KCYA 2EILB 3ZIAG 3SPIA 1IDSA 1K7DA 3RBZA 2Q0AA 4LNUB 4PJ0Z 2QSAA 4B3MB 3RYIA 3ZS8C 4LBEC 5KX5A 2QKAA 1TA8A 1Z2GA 2RN9A 5EBWC 4DV0B 5FLXN 4D7TA 1K33A 2BE3A 1YEWA 3JD1A 2F66C 4PA6A 1N32B 2JVDA 5IY5B 2F95B 4JV5O 4L87A 4WF9V 4DV5B 1YIJV 2K9PA 3MHHC 4JAUA 1XHXA 2ZCEA 3H1KH 3CYOA 3OW2U 2CGNA 3JD4A 2F4VO 3K5MA 4AILC 1R6NA 4MS2A 1A32A 1BMFG 4HBNA 4EEQA 2Q7HA 5CBGA 1I0HA 3APOA 2UXCB 5TISZ 3F7YC 2HJDA 4JI3B 3BY6A 4MTXA 1KUQA 4LFAB 4JYYA 4A5UB 4YJ2A 2GV9A 4FLVA 1M90W 1JFFA 2WLJA 2P67A 1Q86W 3H1JH 4X1IA 4CH3A 4JYAB 3AG3B 1R1BA 3LSSA 3AEIA 4RO2A 5A2QN 2KG7A 4DV1B 4JZGA 2X6AA 2BOCC 5LA6A 1Y6XA 3ETQA 3H01A 1FXHA 1VF6A 1Q3EA 1TUBB 4OX9B 4K8XA 4DUYO 1QCEA 1JOYA 2QWPB 5LHIA 2YIBD 1V9PA 2ITDC 2WPDG 2WLLB 3GWOA 3AG1B 5EYPB 4FFBA 3CRRA 4PA7A 4MVMA 1OCZB 2JDIG 1K97A 3X2QC 1DGSA 3TXQA 4YXWG 1QR8A 1SETA 2ZE5A 1F7YA 1W0JG 1OCCC 5IWAO 3T1YB 1SESA
chains in the Genus database with same CATH topology
3AK3A 4GUNA 1JR9A 1BSMA 1ZSPA 2AW9A 5AG2A 1AP5A 1AP6A 1WB8A 1B06A 1I08A 3EVKA 1GN3A 3DC5A 1MMMA 1VARA 1JA8A 3C3SA 1GN4A 1AR5A 1SZXA 3QVNA 3KKYA 1GN6A 3KDRA 1EN4A 4YIPA 4JZ2A 1I0HA 1GN2A 1AVMA 4E4EA 3AK1A 4YIOA 1XREA 1QNMA 4JYYA 1MA1A 1MNGA 1Y67A 3DC6A 3K9SA 3C3TA 1XUQA 3AK2A 1ZUQA 2P4KA 4JZGA 1EM1A 1PM9A 3MDSA 4C7UA 4X9QA 1IX9A 1WB7A 1N0JA 1BT8A 2QKCA 1IXBA 3CEIA 1D5NA 2ADPA 1AR4A 1EN5A 2ADQB 1ZLZA 1XDCA 1MSDA 1ZTEA 1EN6A 1LUWA 4F6EA 2CDYA 1VEWA 4BR6A 3TJTA 2GDSA 5A9GA 1IDSA 3OT7A 3IC9A 2RCVA 1LUVA 3LSUA 1PL4A 2QKAA 1KKCA 1XILA 1P7GA 3RN4A 2CE4A 1BS3A 3BFRA 1N0NA 4FFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AK3 A;  4GUN A;  1JR9 A;  1BSM A;  1ZSP A;  2AW9 A;  5AG2 A;  1AP5 A;  1AP6 A;  1WB8 A;  1B06 A;  1I08 A;  3EVK A;  1GN3 A;  3DC5 A;  1MMM A;  1VAR A;  1JA8 A;  3C3S A;  1GN4 A;  1AR5 A;  1SZX A;  3QVN A;  3KKY A;  1GN6 A;  1EN4 A;  4YIP A;  4JZ2 A;  1I0H A;  1GN2 A;  1AVM A;  4E4E A;  3AK1 A;  4YIO A;  1XRE A;  1QNM A;  4JYY A;  1MA1 A;  1MNG A;  1Y67 A;  3DC6 A;  3K9S A;  3C3T A;  1XUQ A;  3AK2 A;  1ZUQ A;  2P4K A;  4JZG A;  1EM1 A;  1PM9 A;  3MDS A;  4C7U A;  4X9Q A;  1IX9 A;  1WB7 A;  1N0J A;  1BT8 A;  2QKC A;  1IXB A;  3CEI A;  1D5N A;  2ADP A;  1AR4 A;  1EN5 A;  2ADQ B;  1ZLZ A;  1XDC A;  1MSD A;  1ZTE A;  1EN6 A;  1LUW A;  4F6E A;  2CDY A;  1VEW A;  4BR6 A;  3TJT A;  2GDS A;  5A9G A;  1IDS A;  3OT7 A;  3IC9 A;  2RCV A;  1LUV A;  3LSU A;  1PL4 A;  2QKA A;  1KKC A;  1XIL A;  1P7G A;  3RN4 A;  2CE4 A;  1BS3 A;  3BFR A;  1N0N A;  4FFK A; 
#chains in the Genus database with same CATH topology
 2UUC O;  3QO8 A;  4DW1 A;  4X20 A;  1EFR G;  2ETN A;  2WSS G;  1Q82 W;  5B1B B;  4UVC A;  2Y69 C;  4JI5 O;  5D5Q A;  2AW9 A;  1Y66 A;  1VF5 B;  2WLI B;  1NQT A;  3SYA A;  2F93 B;  3HKB B;  1M9N A;  1G8M A;  1VIB A;  3QF7 A;  2GUZ B;  4H44 B;  3KKY A;  1XNQ B;  2BCC H;  4LR3 A;  3K58 A;  3RGB A;  4RQF A;  3CCL V;  3ZHT A;  4PD4 F;  3VBB A;  2Q5Z A;  1M4U A;  3WG7 C;  1VF6 C;  1KB9 F;  1SA0 A;  2XT9 A;  5CA3 A;  4NXN B;  2Q9L A;  3BEH A;  2E5L O;  1S5J A;  1Q5O A;  3MDS A;  1R73 A;  4RUF A;  4LC1 A;  3K5O A;  1I5X A;  2UU9 O;  4GKK B;  3FX7 A;  5LMN O;  1L1F A;  2Y4U A;  3QG5 A;  2DOS A;  4R7C A;  2E74 B;  4DR6 B;  3JSN A;  5IT9 N;  3ABL B;  1IBM O;  2YSU B;  1TGO A;  2IJJ A;  4D6T H;  4ZIB A;  2VQF O;  3O65 A;  2Z0A A;  3C90 A;  1H8E G;  4PA3 A;  3IGA C;  1KBH A;  1S5H C;  1HDJ A;  5IJ0 A;  2QM7 A;  4KL1 A;  4QJF B;  4LF8 O;  2AZ0 A;  3BA9 A;  1LUV A;  2AZ2 A;  1BZK A;  1FAF A;  2VQE B;  3RN4 A;  5IYD O;  2CE4 A;  1PNK A;  1KYO F;  2N05 A;  1SQG A;  1M57 B;  4KP4 A;  4XDL A;  5FPR A;  3AK3 A;  1PNM A;  1NTK H;  3M99 B;  3SYP A;  3SJA C;  4JI8 B;  1HNZ O;  2E76 B;  4GX0 A;  5JH7 A;  5BY1 A;  3RYF A;  4LF5 O;  4LFC B;  1AP5 A;  1D2D A;  4UCU A;  1MMM A;  2QWQ B;  4U3J B;  5JVD B;  5IYZ A;  3N2G B;  1BCC H;  4MVZ A;  3ASO C;  3CPW U;  2YIB A;  4LF9 O;  3E8B A;  5H6Q A;  3JAT A;  5CBH A;  1QNM A;  4OXS A;  4UCT A;  1RSO B;  1MNG A;  1U97 A;  3G71 V;  2WLN A;  3C3T A;  3L72 H;  1FOU A;  4X1Y A;  4LF7 B;  5D5P A;  1H38 A;  4DV6 B;  2IU3 A;  3S3W A;  1AI6 A;  3BRC A;  4I5S A;  4FIP C;  3LNN A;  2AXT Z;  1OV9 A;  3JD2 A;  5KHI A;  4LWS A;  1ORQ C;  2JK5 C;  1IXB A;  3SJB C;  1K5Q A;  2XAF A;  4DUZ O;  2XAQ A;  4ZKI A;  1I94 B;  5JCO A;  1K8A W;  1Q6I A;  3CD6 V;  3H1H H;  3NR7 A;  4GLX A;  5KUM A;  3OGI B;  5CA0 B;  2ZE8 A;  3I5D A;  3ZMZ A;  2EJ7 A;  1PP9 H;  2OCH A;  5LYJ A;  1WAZ A;  4EFB A;  4PEL A;  5LMU O;  3ABM C;  4B3R B;  2Q6A A;  2CH7 B;  3LDE A;  1VQL V;  5KLV H;  4YY3 O;  1AIL A;  4CZZ A;  2UUB O;  1Y74 B;  4LF6 B;  3JAR B;  4LF4 B;  1AI5 A;  1BL8 A;  1WP7 A;  5BR8 B;  5BMV A;  1JPX A;  4UCO A;  4BAY A;  1H2S B;  1NBM G;  3Q4H B;  2HKO A;  1H8H G;  3CJH B;  1PD3 A;  3A2F A;  2XND G;  5EIB D;  1VMG A;  2NNU A;  1HR0 B;  2RJZ A;  4J80 A;  3CXC U;  5EBM C;  4O4I A;  3UCS C;  5B1A C;  1H5W A;  1SQX H;  4B3T B;  3AG2 B;  1EN4 A;  3U10 A;  4H37 A;  4U7N A;  2XOK G;  1H2M A;  2ZXW B;  3QO5 A;  5H9C A;  4DV2 B;  2MW2 B;  2B5U A;  3B4S A;  1QVG U;  1IVS A;  1YTF B;  4Z2W A;  2DJV A;  2ZE6 A;  4O2B B;  2IW5 A;  3A0R A;  2UUA B;  3CWB H;  2JGD B;  2HEP A;  2W0F C;  4CS2 A;  3K59 A;  4X64 O;  2ZM6 O;  5K1P A;  4J7Z A;  2NR5 A;  2Z5U A;  4OGQ B;  1WB7 A;  3UO2 A;  1WP8 A;  2W0X A;  2FTK A;  3OD4 A;  1D5N A;  1XNR O;  1GM9 A;  1EZV H;  3D3Q A;  1L8D A;  1AI7 A;  3BA8 A;  1N33 O;  4W4L A;  4J7J A;  1MSD A;  3UM7 A;  1RPR A;  2CTQ A;  2EBO A;  3OR6 C;  4TUY A;  1TVK B;  3S3X A;  4DK0 A;  3HKE B;  4G2K A;  2DYS B;  4HAM A;  2ZIN A;  4FVM A;  2A06 H;  1PL4 A;  2EIK B;  3OMN B;  4YHH O;  4DV7 O;  4KFM A;  5B3S C;  3G4S V;  4O4H B;  4MVO A;  5LHG A;  3UT5 B;  4NB5 A;  2QEX V;  4PI2 A;  4X65 O;  3EXA A;  3L74 H;  1SQV H;  1V54 C;  1SQP H;  1BSM A;  1GH6 A;  4TV8 B;  2D3O W;  1ZWI C;  5GON A;  1M93 A;  4I9Q A;  3OUF A;  3EVK A;  1GN3 A;  1FFX B;  3CB2 A;  4GKJ O;  1PKX A;  3OEH G;  1YDX A;  4AHC A;  3E2E A;  3FAV B;  4B3S B;  4CH6 A;  2BTQ A;  3HKC B;  2EJR A;  4GX2 A;  2IU0 A;  4NVP A;  2Q73 A;  1R6T A;  1Q6U A;  2WWW A;  4XDJ A;  5JJN B;  3RYH A;  3E22 A;  2IH3 C;  5EC1 C;  3JAL A;  1SRY A;  4O4J B;  4YIO A;  1JMK C;  3DXR A;  2CGO A;  4IIJ B;  1R3K C;  1ZUQ A;  3QNE A;  2QJ1 A;  3IAY A;  2HFE C;  4DV4 O;  4DR7 B;  2RDC A;  3ASN C;  3R65 A;  2H94 A;  4TOI A;  1VQO V;  1N0J A;  3CRC A;  2P7T C;  2P5O A;  4MTO A;  2JRI A;  1AR4 A;  2P4V A;  1EN5 A;  2MK3 A;  4WCE V;  5IWA B;  3UQ8 A;  1QHT A;  4FM1 A;  2XTA A;  3ZN0 A;  2BSK B;  4K0K B;  1QLE B;  2OCC B;  3K04 A;  4ZHQ A;  1HNW B;  1FD9 A;  3HB3 B;  1W2B U;  1OZ0 A;  3HKD B;  1K73 W;  1N36 B;  5LOV B;  3LUT B;  1V55 C;  5LXT B;  1JJ2 U;  3F5W C;  1KKC A;  1SKV A;  5DM6 V;  3ML0 A;  4BIU A;  1MZE A;  4QE9 A;  3U11 A;  4JI2 O;  1YF2 A;  2CK3 G;  1AJP A;  4I7Z B;  4FLU A;  5KA5 A;  1N34 O;  3RYI B;  1DTO A;  5KX5 B;  3W7W A;  3R66 A;  1CP9 A;  1XL6 A;  2XAS A;  4QIW F;  4X89 A;  4GCZ A;  2DN9 A;  2WA4 A;  4J7K A;  1VQK V;  5JWP A;  1ZL8 B;  3PN1 A;  2XUM A;  4ASU G;  4UB8 Z;  1K9M W;  5KHG A;  4J42 A;  1YI2 V;  2KSD A;  1HNX O;  4LNU A;  2ZQM A;  3M7M X;  1G1X B;  3ABU A;  4WFA V;  2H3O A;  5BZB A;  4CS4 A;  3T4D A;  3OTO O;  4JYC A;  1OCR B;  3AG7 A;  1XMQ O;  3ZMV A;  3KG2 A;  3FYI B;  3SPC A;  4GZR B;  1GAX A;  5EIB C;  1P7B A;  1GRJ A;  2LGQ A;  4NXM B;  3E86 A;  4JI0 O;  1ENV A;  4I0X A;  2Y69 B;  1S3J A;  3VQV A;  3N2K A;  2UXD O;  1BT8 A;  4UCS A;  5KAI Z;  4FLT A;  1L0L H;  1JX9 A;  3L71 H;  4TSF G;  4YJ2 B;  2EIJ C;  1JFF B;  4Z1M G;  1VQ4 V;  3BPZ A;  2X0L A;  4X1I B;  1HP8 A;  5KMG A;  2HHH B;  1ZTE A;  4UFZ A;  4PA4 A;  2LJ2 A;  1TAE A;  2KG7 B;  3W7U A;  1RP3 B;  2EX3 A;  3K5L A;  4DR5 B;  1M1K W;  4BR6 A;  5LA6 B;  3RVZ A;  4X66 O;  1FS0 G;  2YIC A;  3L70 H;  5J2T A;  4X62 O;  3QTC A;  3OT7 A;  4DR4 B;  4EKW A;  1GM8 A;  4UV9 A;  1P7G A;  5LGT A;  4JI6 B;  1W59 A;  3CC7 V;  3ABT A;  4WFH A;  2RNB A;  2EZP A;  1IBK B;  4P2Z A;  2EIL C;  1JQ0 A;  4I50 A;  2Q7E A;  4FFB B;  3CXH F;  2CTP A;  1KU9 A;  4GT1 A;  4TT3 G;  4X88 A;  4I55 B;  3JAW A;  3LSQ A;  2PY5 A;  2DYR B;  3W7S A;  2IJK A;  5DED A;  3FB8 C;  4JI7 B;  3G80 A;  5CMU A;  3T1C A;  1ZAU A;  1B3Q A;  1HW7 A;  2VWK A;  5J9P C;  2DQ3 A;  2F1M A;  4U7O A;  3T4Z A;  4X20 B;  5IY5 C;  3T1H B;  1YJ9 V;  4E4E A;  2ARH A;  4FZ1 A;  1DF5 A;  1VQN V;  2CAZ C;  1M5I A;  3DC6 A;  1RM1 C;  4DR3 B;  1IXM A;  2BTO A;  3E8G A;  4FM2 A;  4IHJ A;  1Q81 W;  3LDD A;  3FKS G;  2LFR A;  3UKM A;  2F43 G;  1SZT A;  2IBZ H;  3ZHQ A;  4JGS A;  1BQZ A;  3SJC C;  4OPH A;  1K4C C;  5GW7 A;  2YIA A;  3SYC A;  3MAQ A;  4LP8 A;  3O9O A;  4LFB B;  4KHP O;  1SA0 B;  2ADQ B;  1ZLZ A;  4AQY O;  3OE7 G;  5C8Y A;  2P22 C;  1NVP B;  4BIO A;  3OFN G;  2VWJ A;  5LP6 A;  3GWK C;  4LH6 A;  2GBO A;  2EIM B;  2FL4 A;  4R8C A;  3ICX A;  2NLJ C;  3IC9 A;  4B3M O;  1W0K G;  1NS1 A;  4F4L A;  5JJE B;  4DV0 O;  1WJZ A;  4R6Z A;  2B1G A;  1KC8 W;  5L3E A;  3CCS V;  1UFI A;  2AHZ A;  1AB3 A;  1N32 O;  1WNS A;  5CBF A;  3AG1 C;  1JR9 A;  4DRX A;  4DV5 O;  4PDR A;  5IJ0 B;  1NTZ H;  4PDV A;  2ZR3 A;  2JEU A;  3DSQ A;  3APQ A;  1JA8 A;  2UXX A;  2W6J G;  3CCJ V;  1ARO P;  3ZJZ A;  3QVN A;  2OTL V;  4K8Z A;  5L3F A;  3CCM V;  3OGC C;  3ABK B;  5B66 Z;  1NH2 B;  3D3I A;  2N74 A;  1GN2 A;  5B1B C;  4JAV A;  2UXC O;  1H2G A;  4JI3 O;  2YEV A;  3P3P A;  4LFA O;  5JH7 B;  3J81 N;  3RYF B;  3CCE V;  3D36 C;  3M8A A;  1BHA A;  3ETE A;  1XI1 A;  1SQF A;  4JYA O;  3K06 A;  4HNA A;  5IYZ B;  1NTM H;  1MOF A;  2X6B A;  1I7F A;  1WA8 A;  2WAM A;  3FD9 A;  2P4K A;  2ZT9 B;  4H0L B;  1VQ9 V;  1EM1 A;  1WPB A;  4UB6 Z;  4J41 A;  3STL C;  4C7U A;  1NZ6 A;  5LP6 C;  4BW5 A;  5IJ9 B;  4TV9 A;  1VQ7 V;  2Q4P A;  2Y0P A;  4WBN A;  1DF4 A;  2W6I G;  1Q43 A;  1XMO B;  3JAT B;  3H1L H;  1OJH A;  3SJQ C;  3U0Z A;  2HVK C;  4X1Y B;  4WFE A;  3WFV A;  3I55 V;  4R50 A;  3JCU Z;  3K08 A;  3B40 A;  4X65 B;  4MVS A;  4O2A A;  5LGN A;  4NR1 A;  2VS0 A;  2BOB C;  2IJI A;  2G38 A;  1US6 A;  5JQG A;  4LWS B;  4FLZ A;  1OCO B;  2UXB B;  2R9A A;  4I4T A;  2FYU H;  3CCV V;  4GKJ B;  1IBL B;  2Q7G A;  2NN4 A;  1Q8I A;  3TXS A;  3T1Y O;  4FFK A;  3UO3 A;  2LP7 A;  4O4L B;  1NI8 A;  4WFF A;  1PNL A;  4JI4 O;  1YJN V;  3CCU V;  2OWO A;  4MTG A;  5LYJ B;  5AG2 A;  3L75 H;  2C2A A;  1XEQ A;  2YUA A;  1B06 A;  2VRZ A;  5K1X A;  2A79 B;  1FPO A;  1M57 C;  5B5E Z;  2ZD9 A;  3ZHV A;  4DR2 O;  1XNQ O;  1WLE A;  4CBC A;  4FMT A;  1OHH G;  4JTC B;  3G67 A;  2AGA A;  5BMV B;  1FJG B;  2GHY A;  1VQP V;  4KUM A;  3E8H A;  2O57 A;  3K9A A;  3SYQ A;  1M56 B;  4DV3 O;  3JAS B;  3RYC A;  5L3D A;  4NXN O;  2DWD C;  3B77 A;  1AJN A;  3B8N A;  4O4I B;  5EBL C;  3F7V C;  4HZ3 A;  4ZOL A;  5KHK A;  1J5E O;  4X9Q A;  4JF3 A;  1V54 B;  1FXK A;  4GKK O;  4JI1 B;  3PJS K;  2ZR2 A;  4J9Z B;  1Y76 A;  1XL4 A;  1THZ A;  4DR6 O;  4DR1 B;  2FML A;  1GK9 A;  1NJI W;  1J95 A;  2HJF C;  5FPO A;  4LCU C;  1LUW A;  4J9Y B;  4JPR A;  3ZMS A;  2KB1 A;  4F6E A;  4YJ3 A;  3G6E V;  4CH5 A;  4B7K A;  1K4D C;  1R6K A;  3TJT A;  1K34 A;  2DQ0 A;  3IJ4 A;  4QNH B;  4EB6 B;  1L0N H;  3D8C A;  1N34 B;  3FB6 C;  4O2B A;  1O9H A;  3B2E E;  2QKS A;  3JAK B;  2Z3Y A;  3TCU A;  2HR3 A;  2EUL A;  3VQY A;  1YCI A;  1FXV A;  4JI8 O;  1KD1 W;  4JV5 B;  4P9O A;  4TUY B;  1FYJ A;  3QO7 A;  4F6R A;  2LQT A;  1MSW D;  4LFC O;  3ZBH A;  5JJJ B;  4Q6G A;  1GM7 A;  3K57 A;  3DC5 A;  3SDL A;  3VQX A;  2F4V B;  1ROP A;  3CME V;  4I9W A;  4JTA B;  3C3S A;  1S0V A;  4JAS A;  2EIN B;  5KHH A;  5CA1 A;  1URF A;  1Y4M A;  3MHS C;  4ZI7 A;  2A3Q A;  4UXN A;  4Q20 A;  5L3G A;  3RVY A;  4G28 B;  4PDM A;  4RAI A;  1FXK C;  1AJQ A;  5H5N A;  1MZF A;  2CUG A;  1V55 B;  5GON B;  2QWN B;  4O4H A;  4J10 A;  2IH1 C;  4LF7 O;  2P90 A;  2X7R B;  4DV6 O;  2YC0 A;  3NXS A;  1P49 A;  1F23 A;  2BTQ B;  3AG2 C;  4CS3 A;  4K35 A;  5J2U A;  3RYH B;  5EZY A;  3E22 B;  4P30 A;  4FLX A;  2ZXW C;  2QKC A;  3CC2 V;  3HR0 A;  3DXR B;  2ZIO A;  2JS3 A;  3B09 A;  4DUY B;  1I94 O;  1Q6H A;  1VP7 A;  2DW4 A;  2QGN A;  1QLN A;  3WB1 A;  4B08 A;  4G27 B;  5HFL A;  5CB4 B;  1GKF A;  3JYC A;  1K92 A;  2JJ1 G;  2YDE A;  3CS5 A;  3LNM B;  3VOU A;  1YSC A;  2QM4 A;  2YXH A;  2HVJ C;  3SGI A;  1E1Q G;  3BFR A;  4HYO A;  3BAA A;  5FNV A;  2UUC B;  3SPG A;  4LF6 O;  4UVB A;  3ZRS A;  4LF4 O;  4ZHQ B;  2F23 A;  5BR8 O;  4MTF A;  2QE7 G;  3J7A U;  4JI5 B;  2JEX A;  1UPG A;  5B1N A;  1I08 A;  2EIK C;  4DO2 A;  2WLK A;  4TWK A;  1HR0 O;  5ITZ A;  4N21 A;  1KMI Z;  5L3C A;  2ZNJ A;  3H9V A;  4B3T O;  1SER A;  3HKD A;  5HFM A;  2M6Y A;  1GO3 F;  3CRM A;  5H6R A;  3AK1 A;  1F4M A;  2KQX A;  4X1K A;  3EFF K;  4DV2 O;  3ZRW A;  2IM9 A;  2UUA O;  1NKD A;  4AQY B;  1VQ8 V;  3SPJ A;  2GTA A;  1N4C A;  2ITC C;  1CXZ B;  1Q7Y W;  2E5L B;  4PDL A;  2QM8 A;  1YHQ V;  4NKG B;  1B6Q A;  2YS8 A;  2UU9 B;  2XHB A;  1G4Y B;  3X2Q B;  3I56 V;  4JAA A;  5LMN B;  3ZMT A;  3CHX A;  2L35 A;  1GTO A;  3ZED A;  1NVP D;  3WB2 A;  1LNQ A;  1E79 G;  1OCC B;  4D7S A;  3P3N A;  1IBM B;  2Y4T A;  1ZL8 A;  1SF9 A;  4UCR A;  2VQF B;  2R9R B;  4N23 A;  5IE9 A;  4L8J A;  2B9Z A;  4I0X B;  3ZHR A;  5A9G A;  2X6C A;  3N2K B;  4MW8 A;  4WFG A;  4LF8 B;  3K3W A;  4XBF A;  4Z1V A;  1RM1 B;  1EBO A;  1AI4 A;  2OT5 A;  4IYI A;  2PYL A;  2PF4 E;  3AG4 C;  3CSX A;  3RT3 C;  1T5E A;  5KMG B;  1QLE C;  2OCC C;  3OMA B;  1QVF U;  1Z5V A;  4RUE A;  4CH4 A;  4IYH A;  1HNZ B;  3BAB A;  5J2T B;  4LF5 B;  3L9D A;  3WG7 B;  3E8F A;  1NH2 D;  1YXB A;  2PZS A;  1CPY A;  1JCH A;  4B3S O;  3A0H Z;  4QPJ A;  1SZX A;  1GMG A;  4YIP A;  1QBZ A;  1QR9 A;  4JZ2 A;  3JAM N;  2N04 A;  1VQ6 V;  4LF9 B;  4I50 B;  3SR2 C;  2DMX A;  2JJ2 G;  1XRE A;  4WFB V;  1TUB A;  4E2L A;  1WN7 A;  5FL7 G;  3JAW B;  4FZ0 A;  2QA4 V;  1XUQ A;  3ZRX A;  1X4T A;  1XOU A;  4QE7 A;  2WLL A;  2ILM A;  1BGY H;  5EYP A;  2QTS A;  1SQQ H;  2PI5 A;  4DR7 O;  4BIZ A;  1CEZ A;  1Z5W A;  4CC6 A;  4I55 A;  4DW0 A;  3ZRV A;  5L3B A;  1PPJ H;  4GYC B;  4DUZ B;  2V4D A;  2P06 A;  2ZNI A;  1OCR C;  2V1D A;  2PGG A;  1MAB G;  4IHJ B;  4K0K O;  2PI4 A;  2XAH A;  1HNW O;  1NU1 H;  3JCZ A;  1FFT B;  4IL6 Z;  3K79 A;  2OIG A;  4JI4 B;  1S72 V;  2GDS A;  4DYL A;  1P84 F;  5IDJ A;  4MVR A;  1N36 O;  3D36 A;  3CCR V;  2WLI A;  5LMU B;  1QU7 A;  3JD3 A;  3HKB A;  1PV0 A;  4J11 A;  1BS3 A;  4FJC C;  3ETG A;  2GUZ A;  4PHZ A;  4YY3 B;  4OPA A;  3AG3 C;  5C8Y B;  3ASO B;  4DR2 B;  2UUB B;  4GUN A;  1S77 D;  5LP6 B;  3OR7 C;  4JYB A;  4FLW A;  2L6L A;  2A0L A;  1VF7 A;  3B8M A;  3OTF A;  4NYK A;  4UUJ C;  1IUR A;  3H1I H;  4DV3 B;  3EHB B;  4K3A A;  1VQM V;  2DWE C;  2XAG A;  2KKW A;  1YIT V;  3VQW A;  1PL0 A;  5E1A C;  3KDR A;  1D5A A;  1J5E B;  2PUS A;  2ZDI A;  1AVM A;  3K5N A;  4MSW C;  3ZHU A;  5LHH A;  4DRX B;  4JTD B;  2IJH A;  1OCZ C;  2H8P C;  3E35 A;  2DYR C;  1TUE B;  2QWR B;  2QDO A;  3CCQ V;  2JS5 A;  4X8A A;  3ETD A;  2CTR A;  3KZI Z;  3OEE G;  5KAF Z;  4BWA A;  1HWY A;  4X64 B;  4AI8 A;  3TET A;  3TGU H;  4NXM O;  2ZM6 B;  3DTU B;  3BVO A;  3THO A;  2E75 B;  1YTF D;  2ATK C;  1IJG A;  4MW3 A;  2YEV B;  4TQF A;  2ADP A;  1U96 A;  2LFS A;  3WB0 A;  1XBL A;  3ABM B;  1YZB A;  1XNR B;  2A9H A;  2UXN A;  3FB5 C;  3HPL C;  1N33 B;  1IZ3 A;  2YI9 A;  4XDK A;  5LGU A;  2XAJ A;  2HHH O;  4HNA B;  2HLD G;  1QQC A;  1JNB A;  1WA8 B;  3CC4 V;  4DV1 O;  2QTO A;  4FK5 C;  4DR5 O;  4IGG A;  3KCX A;  3BCC H;  4TV9 B;  5C93 A;  2FKX A;  4DR4 O;  2P6J A;  4WBN B;  4W4K A;  2QWO B;  3J80 N;  4FLY A;  3ZMU A;  4OX9 O;  5LBQ A;  4YHH B;  4U3J A;  5JVD A;  3DGE A;  4DV7 B;  3N2G A;  4JI6 O;  1S5L Z;  5B1A B;  5IYC O;  3JD0 A;  4PV1 B;  1IBK O;  4B7E A;  4O2A B;  5IJ9 A;  4LH7 A;  2ZDI C;  2HG5 C;  2WLH A;  2OTJ V;  1R3L C;  1ZSP A;  2EIM C;  1RSO A;  5JQG B;  3CE2 A;  1AP6 A;  2YID A;  2CTW A;  3K0D A;  4JI7 O;  4I4T B;  3SPH A;  5F2V O;  1VQ5 V;  1VAR A;  2JGU A;  2Q69 A;  3ABL C;  2YXL A;  1GN6 A;  4NTY A;  4NTX A;  3W7X A;  5EC2 C;  3OUS A;  1EZJ A;  3T2M A;  3T1H O;  1F51 A;  2RMK B;  1BQ0 A;  1SC5 B;  1DLB A;  5GTH Z;  4MT8 A;  4U3F H;  1R3J C;  4RQE A;  2Q68 A;  1DK1 A;  4PI0 A;  4DR3 O;  5KHJ A;  4UVA A;  3CX5 F;  2LW1 A;  4PA9 A;  1XHZ A;  5CA0 A;  2V7Q G;  4O4L A;  3ABK C;  1KKD A;  1NR7 A;  4DV4 B;  2GTS A;  1KEC A;  2ZKO A;  2Q0O C;  5GTI Z;  3JSL A;  2CH7 A;  4LFB O;  3IFX A;  1RPO A;  1H2K A;  4GX1 A;  3RYC B;  5B3S B;  4H13 B;  4H33 A;  1WPX A;  3FB7 C;  1I5Y A;  1Y74 A;  1YVW A;  3JAR A;  4FM0 A;  2GSM B;  1SQB H;  2K1E A;  4ZOL B;  1FXK B;  3Q4H A;  2WLM A;  2R9I A;  3CJH A;  3JAS A;  1G6U A;  3FYE B;  1XIL A;  1Y76 B;  1ZX3 A;  3GB7 C;  4JI2 B;  5EK0 A;  1N0N A;  1MG1 A;  1N8R W;  4QPK A;  2ZIM A;  4YJ3 B;  2PYJ A;  5H2F Z;  1OCO C;  3BHP A;  2Q67 A;  3GVM A;  2B1I A;  1Q90 D;  2FB5 A;  2VQE O;  2JGD A;  4UCV A;  3E89 A;  4UV8 A;  1JJO A;  5E79 Z;  1GN4 A;  1RFY A;  3E83 A;  1AR5 A;  5JCO C;  4DK1 A;  5B1O A;  2QR4 A;  4IT5 A;  3P32 A;  3STZ C;  2HP8 A;  4EB6 A;  3ASN B;  4ZBM A;  1HNX B;  3OAA G;  2EZO A;  2R70 A;  1AR1 B;  2YI8 A;  1K3E A;  4F6R B;  1MA1 A;  3F5T A;  4EFE A;  5LL6 Y;  1B04 A;  2LW7 A;  3JAK A;  3OTO B;  3L73 H;  5CN0 A;  2PTM A;  1XMQ B;  2LO1 A;  2E3C A;  1PM9 A;  4JI0 B;  2YXY A;  5CA1 B;  1TVK A;  1IX9 A;  4ZI7 B;  3HKE A;  2M7W A;  2UXD B;  3A8T A;  1NT2 B;  1XMO O;  2ODM A;  1COW G;  1M56 C;  1E1R G;  1BE3 H;  2Y0I A;  1S76 D;  3SYO A;  1XDC A;  3UT5 A;  3W7T A;  1KQS U;  3G6B A;  1BHB A;  1O9G A;  1EN6 A;  1UJW B;  3RFR A;  2CDY A;  3RWR D;  1VEW A;  3OM3 B;  4TV8 A;  3FFQ A;  4MVU A;  4X66 B;  5J2U B;  5EZY B;  3ZHS A;  1H2N A;  4X62 B;  3JAL B;  2LGW A;  4DXW A;  2UXB O;  4ABM A;  2RCV A;  3MD0 A;  3LSU A;  1FFX A;  1R3I C;  1IBL O;  1LR1 A;  5IYB O;  3FAV A;  1H2L A;  2DE0 X;  2R72 A;  2D2C B;  3A0B Z;  3HKC A;  5BXZ A;  1NR1 A;  1XQ8 A;  4KXR A;  3K03 A;  3N27 A;  5DEC A;  4O4J A;  3OMI B;  1K5S A;  1WB8 A;  4ICG A;  4IIJ A;  4NTW A;  4B3R O;  2OIE A;  2JIZ G;  2Y48 A;  4MVQ A;  3TK1 A;  5CB4 A;  5FNV B;  1YJW V;  1KP3 A;  3K0G A;  3CMA V;  3P30 A;  1FJG O;  2ZE7 A;  1X59 A;  3CP1 A;  5KUK A;  4CC5 A;  2DYS C;  2Q8V A;  1KP2 A;  3ZCC A;  1Y67 A;  3K9S A;  2EIJ B;  3RW0 A;  4RWU A;  3AK2 A;  3AG4 B;  5ITZ B;  2BSK A;  2EIN C;  3LDC A;  1JVM A;  4P9P A;  1F4N A;  2A7W A;  2WA3 A;  4JI1 O;  3WU2 Z;  3ZN1 A;  5LOV A;  4BW9 A;  3CRQ A;  1P4R A;  4X1K B;  3IC7 A;  5LXT A;  3CEI A;  5KA6 A;  4TQD A;  2RQ6 A;  3ZRW B;  4DR1 O;  4KHP B;  3ZX6 A;  1SS3 A;  3CRA A;  4QGP A;  5DN6 G;  4GX5 A;  2AHY A;  2OYQ A;  4FPP A;  1FKA O;  3KCY A;  2EIL B;  3ZIA G;  3SPI A;  1IDS A;  1K7D A;  3RBZ A;  2Q0A A;  4LNU B;  4PJ0 Z;  2QSA A;  4B3M B;  3RYI A;  3ZS8 C;  4LBE C;  5KX5 A;  2QKA A;  1TA8 A;  1Z2G A;  2RN9 A;  5EBW C;  4DV0 B;  5FLX N;  4D7T A;  1K33 A;  2BE3 A;  1YEW A;  3JD1 A;  2F66 C;  4PA6 A;  1N32 B;  2JVD A;  5IY5 B;  2F95 B;  4JV5 O;  4L87 A;  4WF9 V;  4DV5 B;  1YIJ V;  2K9P A;  3MHH C;  4JAU A;  1XHX A;  2ZCE A;  3H1K H;  3CYO A;  3OW2 U;  2CGN A;  3JD4 A;  2F4V O;  3K5M A;  4AIL C;  1R6N A;  4MS2 A;  1A32 A;  1BMF G;  4HBN A;  4EEQ A;  2Q7H A;  5CBG A;  1I0H A;  3APO A;  2UXC B;  5TIS Z;  3F7Y C;  2HJD A;  4JI3 B;  3BY6 A;  4MTX A;  1KUQ A;  4LFA B;  4JYY A;  4A5U B;  4YJ2 A;  2GV9 A;  4FLV A;  1M90 W;  1JFF A;  2WLJ A;  2P67 A;  1Q86 W;  3H1J H;  4X1I A;  4CH3 A;  4JYA B;  3AG3 B;  1R1B A;  3LSS A;  3AEI A;  4RO2 A;  5A2Q N;  2KG7 A;  4DV1 B;  4JZG A;  2X6A A;  2BOC C;  5LA6 A;  1Y6X A;  3ETQ A;  3H01 A;  1FXH A;  1VF6 A;  1Q3E A;  1TUB B;  4OX9 B;  4K8X A;  4DUY O;  1QCE A;  1JOY A;  2QWP B;  5LHI A;  2YIB D;  1V9P A;  2ITD C;  2WPD G;  2WLL B;  3GWO A;  3AG1 B;  5EYP B;  4FFB A;  3CRR A;  4PA7 A;  4MVM A;  1OCZ B;  2JDI G;  1K97 A;  3X2Q C;  1DGS A;  3TXQ A;  4YXW G;  1QR8 A;  1SET A;  2ZE5 A;  1F7Y A;  1W0J G;  1OCC C;  5IWA O;  3T1Y B;  1SES A; 
#chains in the Genus database with same CATH homology
 3AK3 A;  4GUN A;  1JR9 A;  1BSM A;  1ZSP A;  2AW9 A;  5AG2 A;  1AP5 A;  1AP6 A;  1WB8 A;  1B06 A;  1I08 A;  3EVK A;  1GN3 A;  3DC5 A;  1MMM A;  1VAR A;  1JA8 A;  3C3S A;  1GN4 A;  1AR5 A;  1SZX A;  3QVN A;  3KKY A;  1GN6 A;  3KDR A;  1EN4 A;  4YIP A;  4JZ2 A;  1I0H A;  1GN2 A;  1AVM A;  4E4E A;  3AK1 A;  4YIO A;  1XRE A;  1QNM A;  4JYY A;  1MA1 A;  1MNG A;  1Y67 A;  3DC6 A;  3K9S A;  3C3T A;  1XUQ A;  3AK2 A;  1ZUQ A;  2P4K A;  4JZG A;  1EM1 A;  1PM9 A;  3MDS A;  4C7U A;  4X9Q A;  1IX9 A;  1WB7 A;  1N0J A;  1BT8 A;  2QKC A;  1IXB A;  3CEI A;  1D5N A;  2ADP A;  1AR4 A;  1EN5 A;  2ADQ B;  1ZLZ A;  1XDC A;  1MSD A;  1ZTE A;  1EN6 A;  1LUW A;  4F6E A;  2CDY A;  1VEW A;  4BR6 A;  3TJT A;  2GDS A;  5A9G A;  1IDS A;  3OT7 A;  3IC9 A;  2RCV A;  1LUV A;  3LSU A;  1PL4 A;  2QKA A;  1KKC A;  1XIL A;  1P7G A;  3RN4 A;  2CE4 A;  1BS3 A;  3BFR A;  1N0N A;  4FFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...