1IXDA

Solution structure of the cap-gly domain from human cylindromatosis tomour-suppressor cyld
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
104
structure length
104
Chain Sequence
b'GSSGSSGLAMPPGNSHGLEVGSLAEVKENPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFASLQPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cylindromatosis tumour-suppressor CYLD
publication title The CAP-Gly domain of CYLD associates with the proline-rich sequence in NEMO/IKKgamma
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 8
structure length 104
sequence length 104
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1ixdA00
2MPXC 2CP2A 2QK0A 3E2UA 3TQ7P 1IXDA 1WHJA 2HKQB 2Z0WA 1WHMA 2CP6A 1LPLA 1WHGA 2CP0A 2HQHA 1TXQA 2E3IA 1WHLA 2COWA 2COYA 1WHKA 2HL5C 2E4HA 4B6MA 2E3HA 2HKNA 1TOVA 1WHHA 2CP7A 3RDVA 2CP3A 2COZA 2HL3A 2CP5A 2M02A
chains in the Genus database with same CATH superfamily
2M1HA 4XU1A 3RUXA 3FEOA 4NS5A 4QVZA 1IHWA 4PFPA 1TG0A 1ZX6A 2KBTA 1R77A 3MPUB 1FWZA 4PJMA 2CZ0B 2C06A 5IAYA 1W70A 2DZ9A 3LLRA 3WVEB 4XQ3A 3CPWP 2YWWA 3MP1A 3CCEA 1QVGA 2L89A 2M02A 4RG8A 4CC2A 1VQ7A 1UDLA 3CCRQ 3M58A 3ME9A 4N4IA 4PJOG 2DKGA 2Z0WA 3VV0A 3P8DA 3EG0A 1UJ0A 2GQIA 3PMTA 3I35A 2MAMA 1AHJB 2JMAA 1RAIB 1KQSS 3I55T 4XTZA 2NUPA 2G3RA 3FLGA 2P4TA 3HL8A 5LJ5f 4DOVA 2PZ1A 5FU7B 1U1SA 3X24B 4HT9A 4GLMA 2XICA 1VQ4Q 2EKOA 1WPYA 5IT9E 1D3BB 3JCMd 3RNJA 3N5BB 2ATCB 3X25B 3ZEHA 1AWWA 1CSKA 5GAMe 4XTVA 1C1AA 3QG1A 1MHNA 4M78G 1YJ9T 2XMFA 1WDXA 2F5TX 2QGFB 2DYBA 3A8LB 4C8QG 4BACA 1HXDA 1XTDA 1PHTA 2KRSA 1WIEA 2L3QA 4XTUA 4EMGA 2NLUA 2DZCA 4L5GA 2MF2A 4EMKC 2R57A 1K8AC 3TSWA 4OB2B 2X4YA 4JPBW 2ZPBB 2ROTA 5GANh 4DBRA 2JM9A 3HRSA 4M78B 3VS4A 2DETA 2A7YA 3CC2A 4X9CA 2EYWA 3LGFA 2QEXQ 1M1KU 1WI7A 4HVWA 4C92F 3TCJA 2EBPA 4ZGJB 5LJ5e 3VYHB 4C0ZA 1YHQT 1ZBJA 4IUVA 5KYXA 3CBMA 3M0TA 3CCVQ 4RTVA 2EQUA 2DD5A 3MEUA 2K2MA 4E7HA 3EG2A 2FZKB 1M3CA 2DL8A 2P0KA 4E7ZA 1SRMA 1W1FA 2LQ8A 1YITQ 2PVOB 2FL7A 1KD1C 2DMOA 1NEBA 2JVVA 3PNWC 1HSQA 2K5IA 2HD0A 6AT1B 3LH5A 3MJXA 4OMOA 2DF6A 5IN1A 2VVKA 1AZEA 3QYHB 4RTZA 4EDUA 1RACB 2J6KA 5FU6B 2RM4A 1VQPQ 1T0HA 2DVEA 5CKEA 3QPHA 3GNGA 1VYTA 4RTUA 3T9NA 1NJIC 1M2OA 4E7IA 2LMJA 1VQ4T 2JMCA 5FROA 4BD3A 4A4FA 1IGQA 2DEUA 1YI2A 4II1A 5CKFA 1NEGA 1QP2A 5KYWA 2QQSA 1ZQ1A 3PMIA 1N8RU 2D0NA 1WXUA 3JRZA 1K0SA 1IGUA 2V8KA 4O5VA 3CCJT 4A4KA 2X51A 2X4XA 5GAN7 2HAXA 4EMHA 4M75C 3G6EQ 2MIOA 3FC3A 1PKSA 2XD0A 4OGEA 2LQWA 3C94A 4BDYA 2ZPIB 5I2SA 1Y57A 2DAQA 3VS7A 1AWXA 2LP5A 1M27C 3CXCS 1W2BS 1FMKA 3RDVA 1K9MC 3CD6Q 5KYUA 4IUPA 4Z02A 3E19A 3G1JA 1JEGA 5GAN4 3HRUA 5A0DA 1N8RR 1AWOA 1YFNA 3OA6A 2PUKB 4LUEA 1VYVA 3OYEA 5GAOl 2QEXT 3D7SB 4BE0A 4M7DE 3G71Q 1RLPC 4FYYB 1W6XA 1XQHA 1G3WA 1RUWA 3CCVT 5LJ3h 1VQMA 1RAGB 3FRNA 4R0KA 3QIIA 2YRCA 1O75A 2DXUA 4IUQA 5CKHA 1X6OA 3L1AA 1EX4A 2WSFE 4AT1B 1SPKA 1M90U 8AT1B 1SHFA 4D8KA 2E3IA 2ED1A 4C92G 3BFMA 1Q82R 2D1XA 2QG9B 4JRKA 2O9VA 3J81E 4LDWA 2RA2A 2NUPB 1BKBA 2ENMA 3OBYA 2A37A 4MZPA 1D0XA 3LWIA 1UGSB 3FDRA 2IPOB 3M0SA 4QT7A 1FXXA 4JDSA 1OPKA 3CEYA 4JRPA 1KQSA 3QZ5B 3EFRA 3H0FA 3M55A 5A2QE 5L23A 1PWTA 2KEAA 5GMKe 2VXEA 1MUZA 4F7UG 3J80E 2E4HA 3A8HB 2RHIA 1MNEA 1TSFA 3EG1A 2RPNA 1M90R 2RI5A 4DOWA 4J7IA 2LJ3A 4M7DF 4BDZA 1YIJA 1S72Q 1UFFA 1SSFA 3SHWA 2XKOC 2M51A 1LPLA 2H3JA 3GOXA 1RAHB 4J7FA 2O4XA 2KROA 1YJNT 4A4HA 4B6MA 1KQSP 5IHKA 1TUDA 1CKBA 1J3TA 1YNZA 2QQAA 1K0XA 1AEYA 1F1BB 1PSFA 4JRQA 3ULRB 4BY6B 2CH4A 2ZCFB 1I5OB 4P5NA 2LCLA 3CC4Q 3EHQA 3CD6T 2CZ7B 2DIQA 3JB9I 3OW2S 4M7AG 2AKLA 1E6HA 4FT2A 5KYXB 2YUNA 3JV3A 4Q5WA 5GANf 2BE7D 3NTIA 2Y4YA 3TQ7P 2DBMA 2RJFA 3L42A 4OMNA 4ZN3A 2CP6A 1YN8A 2LNVA 4A4GA 2E6ZA 1M4ZA 4PJOA 2I2LA 1K9AA 1ZSZC 2HZYA 2JN0A 1Q7YU 1NPRA 2V8JA 2RQRA 2VXFA 2HEQA 2EJFA 4QQDA 4RTWA 1X43A 3RESA 1QW1A 2YDLA 3FJPA 3SWNA 2DXBA 4J9IA 1PG5B 1PKTA 5J26A 3LGLA 2GGRA 2JUFA 1GL5A 3CCUQ 2W0ZA 3JSCA 3CCSA 2D9TA 1VQ6A 3M53A 2A28A 4BI4A 1N27A 5HCKA 3WXMB 2KT8A 4X1VA 1MGQA 4ZN1A 4NL2A 3M5AA 2A3LA 2KDSA 1Q7YR 4RTYA 4C8QA 1U8RA 2HNIA 2DK3A 2FEIA 2JTMA 3FJ5A 3OYKA 1M1GA 4LDVA 4OVAA 3P8HA 2J6OA 5D6XA 3JCMQ 2DJQA 1QVPA 4C0GA 3OYLA 2J06A 4J6XA 3BY7A 4TVRA 2C0TA 3EAEA 1S72T 4J9BA 4EMKA 1XNIA 3OMCA 2MCNA 1OPLA 1TTHB 1JB0E 4Y92A 1OX9A 2HCKA 5D7UA 3VUZA 3EFSA 3M59A 4HCZA 4ORZA 1OZ3A 5AT1B 2OTLA 1WQWA 4LDYA 3VS3A 1QMCA 2EJGA 4RTTA 1OV3A 1VQOT 5KH6A 4PLLA 4M7DG 5KYUB 1VQKA 2KXCA 1WJSA 4MDWA 3A98A 7AT1B 2X3WD 3OYIA 2L0AA 2WSEE 3CXCA 3CCMT 2ZGWA 4D8DA 1RI9A 3CC4T 2RNAA 1BI1A 2P0QA 1D0YA 3JB9H 3JB9F 5CQYA 2M0OA 1QVFS 2EQKA 1YJWT 1H92A 3V7RA 1JQQA 4J9CA 5KYYA 3CBOA 4C0DC 2JM8A 4FSSA 5GAMg 1I0CA 2BIVA 2EYZA 3V8LA 3EH2A 2X3XD 3QHSA 3MCAB 3H0HA 3V8JA 5LJ5j 4AG1C 4FIBA 3OMGA 1M2VA 2EW3A 2DE0X 1ABOA 1KK7A 1X2QA 1AVZC 5HK0A 3GBQA 1M1FA 4LNPA 3ZFJA 2YUPA 1UHCA 3CXCP 1R8OB 1UEBA 4KGXB 4M78D 1VQNA 4E2FB 4ELYC 1YWOA 2JNGA 2F5KA 2VUBA 4KT0E 1VQ5A 4XTXA 4IKFA 1GRIA 5GMKm 1OI1A 3CMEQ 3QWXX 2LC4A 4VUBA 2AK5A 3M0QA 1Q81C 1VQMQ 3CCUT 2PQWA 3UA6A 3M0RA 2JOYA 4XU0A 1Q86C 1DJ7B 2BUDA 1HJDA 1VIEA 2EGAA 4ZTFA 2EGCA 4RCCA 2RI2A 4YTLA 2CYZB 3AHUA 2GTJA 4M77G 3SB2A 5LJ5d 1UGPB 4KBMB 2FPFA 4PJJA 5LJ5g 1B07A 1H3ZA 2FG0A 2WACA 1VQLQ 2IVWA 1B3QA 1ZSGA 4C5HA 4LUDA 1VOMA 5I21A 1UB4A 1KC8C 2O4XB 3HRTA 4OP0A 3CCQA 1ZBXA 1LCKA 4E7LA 1OQKA 2J7IA 2RK2A 3JCMV 3JCMW 2AT1B 4M77B 3CMAA 1QP3A 3DB3A 2KSSA 1K73C 1VYUA 1YIJQ 1WQ7A 1WYXA 2LCSA 2LVMA 2OTJA 3KBGA 2CKKA 2I0NA 1UTIA 2GQVA 1IHVA 3SFMA 1NBEB 5IH2A 1BI3A 3OYFA 4X9DA 2JS2A 1OZ2A 2QK0A 2D8JA 2VGMA 3INZA 4M75F 2DTOA 1WHMA 1MV3A 1KSWA 1UGVA 2FPDA 2RQTA 4ESRA 3L2UA 2AZVA 2NUTA 2VWFA 3OW2A 1VUBA 3OQ5A 1YCYA 4PJOB 3RR6A 3H8ZA 2BE9B 1TH7A 5J3BA 2FB7A 4C92A 5GAN6 4ATOA 4FCYA 1QCFA 2EQJA 1WXBA 1NG2A 1SKUB 2PNIA 3NPFA 5L8RE 1R0CB 2RMOA 3CC7Q 3SWNB 4XAXB 1AOJA 2K3YA 4DBHA 4M78C 1OYXA 2SEMA 2PU9B 2Y90A 5HKCA 2A08A 2QA4T 2JTEA 2P0PA 5DY9A 5A0GA 1Q82C 2O2OA 4B9XA 3CMET 4F7UA 3OW2P 5GMKl 2L8DA 1Q95G 3QBYA 3M0UA 2K9GA 1VQ9A 1T3SA 1C0MA 1RAEB 5GAOm 1YJWA 3OYCA 4DEYA 4RUGA 3EG9B 4C8QB 8ATCB 3A8OB 4C0FA 5D6YA 2R5MA 2V26A 2RB6A 1BCOA 1VQ6Q 2CP2A 3JCMf 4DBQA 1I8FA 1M30A 4OMQA 5GMKj 1VQLT 4DA4A 4EMKB 2K7AA 1KFZA 2DPPB 4PLIA 4J6YA 2BZXA 2RQWA 3H6ZA 5FU6C 1M3BA 5KE3A 4J9FA 1NLOC 2LZ6B 4IIOA 1WZOA 4QVCA 4RG2A 1JU5C 3CCRT 4E6RA 1A0NB 3JCMb 2FHDA 1M1KR 1GCQA 2PTKA 4M7AA 4N4GA 1CKAA 1VQ8A 2EVRA 1C6VX 2D8HA 3E9GA 4C92D 1X2KA 1PC0A 2OJ2A 2QQ9A 3HFNA 5A0LA 5CAIA 1TWBA 3OSVA 4X34A 2A0FB 2E70A 2KY9A 1ZLMA 4JS4A 2KXDA 1G2BA 2CGHA 1BB9A 2KYMA 2B86A 2YRVA 5KYYB 3VJPA 3CCLQ 1ZHIA 1E6GA 2GBQA 4MZTA 2M9UA 2HBPA 2O9SA 3EFOA 3BDLA 3A8MB 3OS2A 2HSEB 2EIFA 1M2VB 1QVFA 2COWA 3RKYA 2XDPA 1P92A 2ZPHB 1PRMC 3JCMc 3RMSA 3A1PA 4QKUA 3JCMe 3I56Q 3G4SQ 4M75G 2RJCA 3CC7T 4AMCA 4FU6A 2JW4A 3DB4A 3I55A 4OMFB 2HQHA 2CH4W 3UATA 2F2XA 2F2WA 2KR3A 1G3YA 2K4YA 2RHXA 2QDLA 3REAB 3HPWA 1EFNA 1QVFP 3C95A 2FRWA 2JT4A 4AFZC 2KQWA 4R56A 4MMKA 1ACMB 4IIMA 2FRYA 4LE9A 5IHIA 3ER0A 2DL4A 1NYGA 1TUCA 1RADB 2EWNA 2DX1A 4XU3A 2KVQG 4CC7A 2RQVA 1YJ9A 1JXOA 1RL2A 1IRXA 2E6NA 5EG2A 4FM4B 3UDCA 4N0AA 1ZA1B 2JS0A 3DLMA 2DVJA 1PCXA 4M7AD 2K2VA 1K8AU 3VRYA 4E7SA 2O01E 2DL5A 1GBRA 3HTRA 2L2PA 1N9SA 4GBQA 3EGDB 2QA4A 3OYYA 4M7DA 5GAN2 2A36A 1WHGA 1QKWA 2FYKA 4KH0B 1YITT 2BTTA 3TSZA 3PVLA 2GNCA 2EGEA 2KE9A 3DLLA 1WJRA 3QDFA 3UT1A 3VS5A 3RERA 2XK0A 1BIAA 1VQPT 2KK4A 3TEEA 4JS5A 3ASKA 3CCEQ 2DM1A 2V1QA 2YRDA 1YHQA 4FT4A 3RMQA 5GAMh 1K8AR 1K4US 4ZNXA 1VQ7Q 2COYA 1V76A 1WHKA 1I5LA 3H41A 1NM7A 2O31A 4RCBA 1KD1U 4KRTA 2NUTB 2K5FA 1I81A 3X26B 3CCLT 2FO0A 2EYXA 4F04B 2CT4A 4PNOA 4CI0C 2VASA 4C92B 2DD4A 2CUDA 3M54A 3SD4A 2OTJQ 1KHCA 3HFOA 4JJBA 3I5RA 4K11A 2X9HA 2FVUA 4EPCA 1Z9ZA 2ROLA 2P4RA 2X35A 3KUFA 1AWJA 1QCOA 5FWCA 4BY6C 1JO8A 3L2WA 4QW2A 4OB0B 1X27A 1ZA2B 3GLXA 3QYGB 3G6ET 1NJIU 2PVDB 1E7OA 3G4ST 3NHNA 1QVGS 4F7UB 3OYGA 1LNXA 2QQBA 3H9NA 4MMLA 4HXJA 5FRMA 3NTHA 1V29B 2XG8D 4M77A 2VB6A 3UA7A 2H8HA 3EGUA 1BU1A 2NYSA 3F70A 4C5IA 4D6WA 1VQ4A 1D0ZA 4J5YA 3QDRB 5LJ5h 5EC7A 4JLGA 1B34A 2EJ9A 4A63B 2DIGA 2KNBB 1SG5A 3GP8A 2VC8A 4DEXA 3DKMA 2R5AA 3VU3C 2OAUA 4JJCA 3G71T 4PFOA 3CCJA 3M56A 1ABQA 4J8OA 4CC4B 3C0CA 4LDUA 1NJIR 4C5GA 4XTWA 4Z8AA 2P84A 1G8XA 1OU8A 2XIDA 4BI3A 2RH2A 1U1TA 3CC2Q 2K3XA 1K9MU 3SEMA 1BBZA 1AT1B 1D1BA 4Y28E 3OYBA 2DLPA 2ZAEA 4M7AB 4L6V5 2H3EB 2HL5C 3PGGA 2QTXA 4ZGDB 2L3PA 2LX7A 4R55A 2EYYA 3S3OA 3JAME 2QEXA 3CBPA 3HP9A 5CIUA 2XDBA 2ZPGB 3O8VA 2KT1A 2EQMA 4M78E 4QQ6A 3CCET 2OX7A 5CCAA 5DM7R 5CQXA 2M16A 1VQ7T 3EG9A 3EFOB 3PE0A 2V8IA 3OYJA 3CCVA 5GAOp 5GAOq 1K9MR 3UF4A 2CDTA 3MP6A 2QTVA 4M77D 2E5KA 2HDAA 2LT1A 2HL3A 2MPXC 2R58A 4HVVA 3R6NA 2YLBA 1X6GA 5GANe 5GAMj 2YLCA 2ZZDA 5CR2A 1MV0B 1WHJA 1TUGB 2QI2A 1YBYA 3X28B 2E64A 2XDDA 1NPPA 1YI2Q 4PJLA 4OMLA 3P8BB 1X01A 3HSBA 3G7ZA 5FRNA 4MDXA 2CP5A 2E1HA 1M8MA 2B8AA 3THKA 2C0OA 4UC4A 4PJOD 2RQUA 5J39A 1PM3A 2ZPEB 3SDZA 1PD0A 4OGCA 1W2BA 5GAOr 4KUDK 3S3MA 1RABB 3I55Q 3LYIA 4M78F 2CP7A 2L5QA 1HD3A 3VS2A 3VYGA 1UE9A 5GAMd 3MEWA 4JLIA 4J83A 1S1NA 5DLQE 1QWEA 3V8KA 3PTAA 1YJNA 1GXIE 2DTHA 4BUGA 4M7DB 5M9OA 3EG3A 3A5ZB 1PSEA 3CC2T 1QKXA 4EIKA 1VA7A 1WHHA 2DNUA 1T3LA 1W2BP 2RHZA 3H0IA 5LJ3f 4C8QD 3OYDA 4XK8E 3QZ9B 2DA9A 3KXTA 1SF9A 5GMKi 1WLPB 5HY6A 3JB9J 1M1KC 3CD6A 3QJYA 4KUIA 2O88A 5GMKh 1BI2A 4C0DB 4JRIA 4Z89A 2DJZA 3GIBA 2PUOB 4J6WA 4O6JA 1LOJA 1H3HA 4Y91A 3FB9A 2BZYA 2BZ8A 2YUOA 2YHTA 3M9QA 4LN2A 4JJNK 2QXFA 4E7JA 5KYNA 2DYIA 2GF7A 2FZCB 2WSCE 2JTFA 2RHYA 4M75A 1KJWA 5CO7A 2DO3A 1SRLA 2K57A 1IREB 2KI7A 4ME7A 3JCMX 2COZA 1YHQQ 1G83A 2DL3A 3URGA 4XU2A 3BE3A 2RK1A 1Y96A 3EGDA 3Q1JA 4LD6A 2QYZA 1X69A 5FU7C 1WXTA 1Y0MA 2J6FA 1YI2T 2ECZA 2M0YA 2KGTA 2LJ1A 3I5SA 3VS0A 3MP8A 2GTOA 2CP3A 2KMTA 5D6WA 4RMOA 4KH1B 1LVKA 1B34B 5KCOA 5LJ3e 3EHRA 4PJOC 4F16A 2RJEA 4HCKA 1I07A 4FYVB 1ZUUA 1N8RC 4WCIA 1N9RA 2IIMA 2CSIA 2AZSA 2RJDA 4GLKA 1PNJA 3PT9A 2EYQA 1QCNA 1S72A 2DERA 3SWNC 1FMWA 4C92E 3KFVA 1EZZB 1SSHA 4XTYA 4A4EA 1QVGP 1IZ6A 1PD1A 4L59A 1EIFA 2HKQB 4IURA 4JUVA 4OB3B 3WVDB 2E10A 1FX7A 4BE1A 1V1CA 3JCMg 4QVDA 4HKEA 1UJYA 4IUUA 2XI9A 1VQOA 3JB9G 2ED0A 1KG1A 1UG1A 2LDMA 1KHIA 3CCJQ 3CPFA 3LW5E 4C8QC 1OU9A 3LWHA 5GAN5 2NWMA 4F7UE 2QDYB 3CCMA 3BDUA 3M4GA 4M75D 3CC4A 4JZ4A 3VRZA 3M0PA 2G6FX 2K6DA 4RTXA 1VQMT 2HBWA 1GCPA 4WF2A 4AFQC 4FW1A 3LX7A 1WFWA 1I1JA 2F1LA 1R0BG 2DL7A 3GPLA 3V7SA 2EKHA 3NTKA 3OYHA 4BE2A 1K1ZA 3CCSQ 4HA8A 4B9WA 2LCCA 1M90C 1G5VA 5CK9A 2AHJB 4NOYA 5GAOn 3MEVA 2SRCA 1Q81U 4ZTJA 1FMVA 1Q86U 4PL6A 2HKNA 3PVQA 1Y7XA 5C6SA 3U23A 3OYNA 4PK4A 2DXTA 5CKBA 2LQKA 3CCUA 1GFCA 3PFSA 5FWBA 2FZGB 2D6FA 4ANJA 1BCMA 1RAFB 3I9QA 4M7AE 2CP0A 1YIJT 3OBWA 2MYSA 3J7AF 4F7UF 2KRNA 2HSPA 3UWNA 1H641 2W10A 2KAFA 4JZ3A 3PIPA 2EAYA 1MMDA 1KC8U 1I4K1 2OTLQ 2KYBA 1PRLC 1Q81R 1YWPA 1ZSZA 4OMMA 4WTOB 1Q86R 2RHUA 2DXCA 1VQKQ 3M4YA 1JXMA 1WA7A 1K73U 3QUIA 1ARKA 3VUBA 2AKKA 1BK2A 1N5ZA 2JZ2A 4FL6A 3MKDA 2EFIA 3RBBB 1AZGB 1JJ2S 1GFDA 1BYMA 3TREA 2VV5A 1NE8A 4CRIA 3JCMP 3L2ZA 2HQXA 1KC8R 1BI0A 2DEQA 2XU8A 1YJNQ 2FPEA 4J9GA 1HYOA 4M7AF 3M57A 3NFCA 1K76A 2E5QA 2K3BA 1BIBA 1YP5A 2ABLA 1VQNQ 2LT4A 1H8KA 3O5ZA 2RN8A 1HK9A 1FYNA 4OF1A 1K73R 1VQ5Q 1WGSA 4F17A 1Q7YC 3QSUA 1MMGA 1M9SA 2E3HA 4M75B 2YT6A 1OULA 3CCST 1VQ6T 1WJQA 4KGVB 1Q82U 5GJVB 1MMAA 2CS7A 3E9FA 1Y96B 2RI3A 5DLOA 1D1CA 2QAZA 3MHXA 1VIFA 3JCMJ 2VGNA 4KULA 3CMEA 3OYMA 4ZGEB 5GANj 4A54A 3L2QA 1JRIA 3EGXA 1MNDA 5ECAA 4IUTA 3OSSC 3V7CA 4F14A 1IO6A 4C92C 4Z88A 3CCQQ 2X4WA 4E47A 1ZUKA 3CPWS 5LL6S 2K79A 1RAAB 4QQGA 1TOVA 1KIKA 4LDXA 1UUEA 1RI0A 1VQLA 2LX9A 4AG2C 2OTLT 3CMAQ 4FSXA 1G3TA 2PVGB 1M3AA 1VQKT 2DRMA 2KRMA 1SHGA 2CREA 2YXYA 5GANd 2OAWA 3OY9A 3S3NA 5GANg 3CCRA 1WX6A 4PFZA 4NL3A 3I56T 2CSQA 2E41A 1G3SA 4DBFA 2MK5A 3AT1B 5C0MA 2HQEA 3MO8A 3E1SA 2GFAA 2EPDA 4M77E 3NGPA 4FYWB 2D0QB 5HK3A 3PIOA 2LNHB 1KD1R 4GY5A 3NMZC 1OEBA 1YCSB 3QXEB 3LH0A 4KGZB 1LJOA 2X4JA 4M7DD 2LRQA 1VQNT 2DRKA 5KE2A 1VQOQ 1XOVA 2QGGA 1VQ5T 2ESWA 1IB8A 5IXBA 3A8GB 2GCXA 2CZ6B 3CCMQ 2MWOA 5IHNA 1GBQA 2DTIA 3C4SA 4OB1B 2MI6A 4BB7A 1GCQC 2LQNA 2LJ0A 1VQ9Q 4PJOE 2K5LA 4M7AC 3QO3A 4J9EA 2DFUA 3GNFB 4HVUA 3CC7A 4AFSC 1YJWQ 1T0JA 4AFUC 1D3BA 1MMNA 3ZL7C 2MWPA 2CUBA 1IXDA 4RKUE 5GJWB 1XJWB 3QWYA 1X75C 1QWFA 4CC3A 1SEMA 2EQIA 1KQ1A 1TU0B 1Y71A 4A53A 3BW1A 4M77F 5AYFA 3C12A 2OI3A 2L3RA 5I2MA 3OS0A 4DQ2A 3HHTB 3CCQT 2CZ1B 2IG0A 5CVIA 3META 3EH1A 1ZSZB 4J9HA 5LJ3j 4C8QE 3VS1A 1X6BA 3CMAT 2DILA 4HCCA 3OS5A 4HCBA 1VQ8Q 5KCHA 1OOTA 3VKIA 3JCMh 3RIRA 3OS1A 2OTJT 1U06A 4M78A 1RLQC 1YITA 1D1AA 5I11A 1D09B 4PJOF 3CQTA 1JBMA 4HT8A 4FYXB 1NLPC 3RKXA 5KYWB 1TXQA 2CT3A 3S6WA 3ZBDA 1KQ2A 3MEAA 5FLXE 2RD1A 2ZPFB 4FW2A 1VQPA 1JJ2A 3IQLA 3OB9A 2YUQA 5GAN3 3VS6A 2AIRB 4N0AC 3E2UA 5LJ3d 4ELZC 1NYFA 5LJ3g 2F2VA 2E12A 2YSQA 4MZMA 4C5EA 3CCLA 3FIFA 2GFUA 3HKSA 1U3OA 2LTOA 5GAN8 5I22A 3UPUA 4PKCC 2F69A 4M7DC 1TS9A 4OMPA 2MMPA 1Y07A 4PJNA 2JJ9A 2RO0A 1QQJA 3R6OA 4M4ZA 2L3SA 4C8QF 1M8VA 1UHFA 2VYTA 1JJ2P 4LD9K 3L2RA 1UGQB 1UGRB 1NZ9A 2MOXA 2Y4XA 1VQ9T 1WHLA 3I56A 3G6EA 9ATCB 3G4SA 4LXCA 4E7KA 3RKWA 2VKNA 5IXFA 3REBB 1N6AA 1YJ9Q 2DBKA 3X20B 2RF0A 3EGXB 3GF5A 3QJ6A 4V2SA 2E65A 1QLYA 3TU4K 5FW9A 3L2VA 3JB9D 2NUZA 2XHCA 2C0IA 1AD5A 2QA4Q 1OX8A 1M5Q1 1B7TA 4J9DA 4BI8B 2HMAA 1ZUYA 3G71A 1W4SA 2QASA 2QQRA 2J05A 1WNLA 3CPWA 4N4HA 3QKJA 3OYAA 1U5SA 4JJDA 1Z9QA 2JXBA 4M75E 1VQ8T 5GAMf 5CKDA 1O9SA 2V1RA 4M77C 1UECA 3TVTA 2BKDN
chains in the Genus database with same CATH topology
2MPXC 2CP2A 2QK0A 3E2UA 3TQ7P 1IXDA 1WHJA 2HKQB 2Z0WA 1WHMA 2CP6A 1LPLA 1WHGA 2CP0A 2HQHA 1TXQA 2E3IA 1WHLA 2COWA 2COYA 1WHKA 2HL5C 2E4HA 4B6MA 2E3HA 2HKNA 1TOVA 1WHHA 2CP7A 3RDVA 2CP3A 2COZA 2HL3A 2CP5A 2M02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPX C;  2CP2 A;  2QK0 A;  3E2U A;  3TQ7 P;  1IXD A;  1WHJ A;  2HKQ B;  2Z0W A;  1WHM A;  2CP6 A;  1LPL A;  1WHG A;  2CP0 A;  2HQH A;  1TXQ A;  2E3I A;  1WHL A;  2COW A;  2COY A;  1WHK A;  2HL5 C;  2E4H A;  4B6M A;  2E3H A;  2HKN A;  1TOV A;  1WHH A;  2CP7 A;  3RDV A;  2CP3 A;  2COZ A;  2HL3 A;  2CP5 A;  2M02 A; 
#chains in the Genus database with same CATH topology
 2M1H A;  4XU1 A;  3RUX A;  3FEO A;  4NS5 A;  4QVZ A;  1IHW A;  4PFP A;  1TG0 A;  1ZX6 A;  2KBT A;  1R77 A;  3MPU B;  1FWZ A;  4PJM A;  2CZ0 B;  2C06 A;  5IAY A;  1W70 A;  2DZ9 A;  3LLR A;  3WVE B;  4XQ3 A;  3CPW P;  2YWW A;  3MP1 A;  3CCE A;  1QVG A;  2L89 A;  2M02 A;  4RG8 A;  4CC2 A;  1VQ7 A;  1UDL A;  3CCR Q;  3M58 A;  3ME9 A;  4N4I A;  4PJO G;  2DKG A;  2Z0W A;  3VV0 A;  3P8D A;  3EG0 A;  1UJ0 A;  2GQI A;  3PMT A;  3I35 A;  2MAM A;  1AHJ B;  2JMA A;  1RAI B;  1KQS S;  3I55 T;  4XTZ A;  2NUP A;  2G3R A;  3FLG A;  2P4T A;  3HL8 A;  5LJ5 f;  4DOV A;  2PZ1 A;  5FU7 B;  1U1S A;  3X24 B;  4HT9 A;  4GLM A;  2XIC A;  1VQ4 Q;  2EKO A;  1WPY A;  5IT9 E;  1D3B B;  3JCM d;  3RNJ A;  3N5B B;  2ATC B;  3X25 B;  3ZEH A;  1AWW A;  1CSK A;  5GAM e;  4XTV A;  1C1A A;  3QG1 A;  1MHN A;  4M78 G;  1YJ9 T;  2XMF A;  1WDX A;  2F5T X;  2QGF B;  2DYB A;  3A8L B;  4C8Q G;  4BAC A;  1HXD A;  1XTD A;  1PHT A;  2KRS A;  1WIE A;  2L3Q A;  4XTU A;  4EMG A;  2NLU A;  2DZC A;  4L5G A;  2MF2 A;  4EMK C;  2R57 A;  1K8A C;  3TSW A;  4OB2 B;  2X4Y A;  4JPB W;  2ZPB B;  2ROT A;  5GAN h;  4DBR A;  2JM9 A;  3HRS A;  4M78 B;  3VS4 A;  2DET A;  2A7Y A;  3CC2 A;  4X9C A;  2EYW A;  3LGF A;  2QEX Q;  1M1K U;  1WI7 A;  4HVW A;  4C92 F;  3TCJ A;  2EBP A;  4ZGJ B;  5LJ5 e;  3VYH B;  4C0Z A;  1YHQ T;  1ZBJ A;  4IUV A;  5KYX A;  3CBM A;  3M0T A;  3CCV Q;  4RTV A;  2EQU A;  2DD5 A;  3MEU A;  2K2M A;  4E7H A;  3EG2 A;  2FZK B;  1M3C A;  2DL8 A;  2P0K A;  4E7Z A;  1SRM A;  1W1F A;  2LQ8 A;  1YIT Q;  2PVO B;  2FL7 A;  1KD1 C;  2DMO A;  1NEB A;  2JVV A;  3PNW C;  1HSQ A;  2K5I A;  2HD0 A;  6AT1 B;  3LH5 A;  3MJX A;  4OMO A;  2DF6 A;  5IN1 A;  2VVK A;  1AZE A;  3QYH B;  4RTZ A;  4EDU A;  1RAC B;  2J6K A;  5FU6 B;  2RM4 A;  1VQP Q;  1T0H A;  2DVE A;  5CKE A;  3QPH A;  3GNG A;  1VYT A;  4RTU A;  3T9N A;  1NJI C;  1M2O A;  4E7I A;  2LMJ A;  1VQ4 T;  2JMC A;  5FRO A;  4BD3 A;  4A4F A;  1IGQ A;  2DEU A;  1YI2 A;  4II1 A;  5CKF A;  1NEG A;  1QP2 A;  5KYW A;  2QQS A;  1ZQ1 A;  3PMI A;  1N8R U;  2D0N A;  1WXU A;  3JRZ A;  1K0S A;  1IGU A;  2V8K A;  4O5V A;  3CCJ T;  4A4K A;  2X51 A;  2X4X A;  5GAN 7;  2HAX A;  4EMH A;  4M75 C;  3G6E Q;  2MIO A;  3FC3 A;  1PKS A;  2XD0 A;  4OGE A;  2LQW A;  3C94 A;  4BDY A;  2ZPI B;  5I2S A;  1Y57 A;  2DAQ A;  3VS7 A;  1AWX A;  2LP5 A;  1M27 C;  3CXC S;  1W2B S;  1FMK A;  3RDV A;  1K9M C;  3CD6 Q;  5KYU A;  4IUP A;  4Z02 A;  3E19 A;  3G1J A;  1JEG A;  5GAN 4;  3HRU A;  5A0D A;  1N8R R;  1AWO A;  1YFN A;  3OA6 A;  2PUK B;  4LUE A;  1VYV A;  3OYE A;  5GAO l;  2QEX T;  3D7S B;  4BE0 A;  4M7D E;  3G71 Q;  1RLP C;  4FYY B;  1W6X A;  1XQH A;  1G3W A;  1RUW A;  3CCV T;  5LJ3 h;  1VQM A;  1RAG B;  3FRN A;  4R0K A;  3QII A;  2YRC A;  1O75 A;  2DXU A;  4IUQ A;  5CKH A;  1X6O A;  3L1A A;  1EX4 A;  2WSF E;  4AT1 B;  1SPK A;  1M90 U;  8AT1 B;  1SHF A;  4D8K A;  2E3I A;  2ED1 A;  4C92 G;  3BFM A;  1Q82 R;  2D1X A;  2QG9 B;  4JRK A;  2O9V A;  3J81 E;  4LDW A;  2RA2 A;  2NUP B;  1BKB A;  2ENM A;  3OBY A;  2A37 A;  4MZP A;  1D0X A;  3LWI A;  1UGS B;  3FDR A;  2IPO B;  3M0S A;  4QT7 A;  1FXX A;  4JDS A;  1OPK A;  3CEY A;  4JRP A;  1KQS A;  3QZ5 B;  3EFR A;  3H0F A;  3M55 A;  5A2Q E;  5L23 A;  1PWT A;  2KEA A;  5GMK e;  2VXE A;  1MUZ A;  4F7U G;  3J80 E;  2E4H A;  3A8H B;  2RHI A;  1MNE A;  1TSF A;  3EG1 A;  2RPN A;  1M90 R;  2RI5 A;  4DOW A;  4J7I A;  2LJ3 A;  4M7D F;  4BDZ A;  1YIJ A;  1S72 Q;  1UFF A;  1SSF A;  3SHW A;  2XKO C;  2M51 A;  1LPL A;  2H3J A;  3GOX A;  1RAH B;  4J7F A;  2O4X A;  2KRO A;  1YJN T;  4A4H A;  4B6M A;  1KQS P;  5IHK A;  1TUD A;  1CKB A;  1J3T A;  1YNZ A;  2QQA A;  1K0X A;  1AEY A;  1F1B B;  1PSF A;  4JRQ A;  3ULR B;  4BY6 B;  2CH4 A;  2ZCF B;  1I5O B;  4P5N A;  2LCL A;  3CC4 Q;  3EHQ A;  3CD6 T;  2CZ7 B;  2DIQ A;  3JB9 I;  3OW2 S;  4M7A G;  2AKL A;  1E6H A;  4FT2 A;  5KYX B;  2YUN A;  3JV3 A;  4Q5W A;  5GAN f;  2BE7 D;  3NTI A;  2Y4Y A;  3TQ7 P;  2DBM A;  2RJF A;  3L42 A;  4OMN A;  4ZN3 A;  2CP6 A;  1YN8 A;  2LNV A;  4A4G A;  2E6Z A;  1M4Z A;  4PJO A;  2I2L A;  1K9A A;  1ZSZ C;  2HZY A;  2JN0 A;  1Q7Y U;  1NPR A;  2V8J A;  2RQR A;  2VXF A;  2HEQ A;  2EJF A;  4QQD A;  4RTW A;  1X43 A;  3RES A;  1QW1 A;  2YDL A;  3FJP A;  3SWN A;  2DXB A;  4J9I A;  1PG5 B;  1PKT A;  5J26 A;  3LGL A;  2GGR A;  2JUF A;  1GL5 A;  3CCU Q;  2W0Z A;  3JSC A;  3CCS A;  2D9T A;  1VQ6 A;  3M53 A;  2A28 A;  4BI4 A;  1N27 A;  5HCK A;  3WXM B;  2KT8 A;  4X1V A;  1MGQ A;  4ZN1 A;  4NL2 A;  3M5A A;  2A3L A;  2KDS A;  1Q7Y R;  4RTY A;  4C8Q A;  1U8R A;  2HNI A;  2DK3 A;  2FEI A;  2JTM A;  3FJ5 A;  3OYK A;  1M1G A;  4LDV A;  4OVA A;  3P8H A;  2J6O A;  5D6X A;  3JCM Q;  2DJQ A;  1QVP A;  4C0G A;  3OYL A;  2J06 A;  4J6X A;  3BY7 A;  4TVR A;  2C0T A;  3EAE A;  1S72 T;  4J9B A;  4EMK A;  1XNI A;  3OMC A;  2MCN A;  1OPL A;  1TTH B;  1JB0 E;  4Y92 A;  1OX9 A;  2HCK A;  5D7U A;  3VUZ A;  3EFS A;  3M59 A;  4HCZ A;  4ORZ A;  1OZ3 A;  5AT1 B;  2OTL A;  1WQW A;  4LDY A;  3VS3 A;  1QMC A;  2EJG A;  4RTT A;  1OV3 A;  1VQO T;  5KH6 A;  4PLL A;  4M7D G;  5KYU B;  1VQK A;  2KXC A;  1WJS A;  4MDW A;  3A98 A;  7AT1 B;  2X3W D;  3OYI A;  2L0A A;  2WSE E;  3CXC A;  3CCM T;  2ZGW A;  4D8D A;  1RI9 A;  3CC4 T;  2RNA A;  1BI1 A;  2P0Q A;  1D0Y A;  3JB9 H;  3JB9 F;  5CQY A;  2M0O A;  1QVF S;  2EQK A;  1YJW T;  1H92 A;  3V7R A;  1JQQ A;  4J9C A;  5KYY A;  3CBO A;  4C0D C;  2JM8 A;  4FSS A;  5GAM g;  1I0C A;  2BIV A;  2EYZ A;  3V8L A;  3EH2 A;  2X3X D;  3QHS A;  3MCA B;  3H0H A;  3V8J A;  5LJ5 j;  4AG1 C;  4FIB A;  3OMG A;  1M2V A;  2EW3 A;  2DE0 X;  1ABO A;  1KK7 A;  1X2Q A;  1AVZ C;  5HK0 A;  3GBQ A;  1M1F A;  4LNP A;  3ZFJ A;  2YUP A;  1UHC A;  3CXC P;  1R8O B;  1UEB A;  4KGX B;  4M78 D;  1VQN A;  4E2F B;  4ELY C;  1YWO A;  2JNG A;  2F5K A;  2VUB A;  4KT0 E;  1VQ5 A;  4XTX A;  4IKF A;  1GRI A;  5GMK m;  1OI1 A;  3CME Q;  3QWX X;  2LC4 A;  4VUB A;  2AK5 A;  3M0Q A;  1Q81 C;  1VQM Q;  3CCU T;  2PQW A;  3UA6 A;  3M0R A;  2JOY A;  4XU0 A;  1Q86 C;  1DJ7 B;  2BUD A;  1HJD A;  1VIE A;  2EGA A;  4ZTF A;  2EGC A;  4RCC A;  2RI2 A;  4YTL A;  2CYZ B;  3AHU A;  2GTJ A;  4M77 G;  3SB2 A;  5LJ5 d;  1UGP B;  4KBM B;  2FPF A;  4PJJ A;  5LJ5 g;  1B07 A;  1H3Z A;  2FG0 A;  2WAC A;  1VQL Q;  2IVW A;  1B3Q A;  1ZSG A;  4C5H A;  4LUD A;  1VOM A;  5I21 A;  1UB4 A;  1KC8 C;  2O4X B;  3HRT A;  4OP0 A;  3CCQ A;  1ZBX A;  1LCK A;  4E7L A;  1OQK A;  2J7I A;  2RK2 A;  3JCM V;  3JCM W;  2AT1 B;  4M77 B;  3CMA A;  1QP3 A;  3DB3 A;  2KSS A;  1K73 C;  1VYU A;  1YIJ Q;  1WQ7 A;  1WYX A;  2LCS A;  2LVM A;  2OTJ A;  3KBG A;  2CKK A;  2I0N A;  1UTI A;  2GQV A;  1IHV A;  3SFM A;  1NBE B;  5IH2 A;  1BI3 A;  3OYF A;  4X9D A;  2JS2 A;  1OZ2 A;  2QK0 A;  2D8J A;  2VGM A;  3INZ A;  4M75 F;  2DTO A;  1WHM A;  1MV3 A;  1KSW A;  1UGV A;  2FPD A;  2RQT A;  4ESR A;  3L2U A;  2AZV A;  2NUT A;  2VWF A;  3OW2 A;  1VUB A;  3OQ5 A;  1YCY A;  4PJO B;  3RR6 A;  3H8Z A;  2BE9 B;  1TH7 A;  5J3B A;  2FB7 A;  4C92 A;  5GAN 6;  4ATO A;  4FCY A;  1QCF A;  2EQJ A;  1WXB A;  1NG2 A;  1SKU B;  2PNI A;  3NPF A;  5L8R E;  1R0C B;  2RMO A;  3CC7 Q;  3SWN B;  4XAX B;  1AOJ A;  2K3Y A;  4DBH A;  4M78 C;  1OYX A;  2SEM A;  2PU9 B;  2Y90 A;  5HKC A;  2A08 A;  2QA4 T;  2JTE A;  2P0P A;  5DY9 A;  5A0G A;  1Q82 C;  2O2O A;  4B9X A;  3CME T;  4F7U A;  3OW2 P;  5GMK l;  2L8D A;  1Q95 G;  3QBY A;  3M0U A;  2K9G A;  1VQ9 A;  1T3S A;  1C0M A;  1RAE B;  5GAO m;  1YJW A;  3OYC A;  4DEY A;  4RUG A;  3EG9 B;  4C8Q B;  8ATC B;  3A8O B;  4C0F A;  5D6Y A;  2R5M A;  2V26 A;  2RB6 A;  1BCO A;  1VQ6 Q;  2CP2 A;  3JCM f;  4DBQ A;  1I8F A;  1M30 A;  4OMQ A;  5GMK j;  1VQL T;  4DA4 A;  4EMK B;  2K7A A;  1KFZ A;  2DPP B;  4PLI A;  4J6Y A;  2BZX A;  2RQW A;  3H6Z A;  5FU6 C;  1M3B A;  5KE3 A;  4J9F A;  1NLO C;  2LZ6 B;  4IIO A;  1WZO A;  4QVC A;  4RG2 A;  1JU5 C;  3CCR T;  4E6R A;  1A0N B;  3JCM b;  2FHD A;  1M1K R;  1GCQ A;  2PTK A;  4M7A A;  4N4G A;  1CKA A;  1VQ8 A;  2EVR A;  1C6V X;  2D8H A;  3E9G A;  4C92 D;  1X2K A;  1PC0 A;  2OJ2 A;  2QQ9 A;  3HFN A;  5A0L A;  5CAI A;  1TWB A;  3OSV A;  4X34 A;  2A0F B;  2E70 A;  2KY9 A;  1ZLM A;  4JS4 A;  2KXD A;  1G2B A;  2CGH A;  1BB9 A;  2KYM A;  2B86 A;  2YRV A;  5KYY B;  3VJP A;  3CCL Q;  1ZHI A;  1E6G A;  2GBQ A;  4MZT A;  2M9U A;  2HBP A;  2O9S A;  3EFO A;  3BDL A;  3A8M B;  3OS2 A;  2HSE B;  2EIF A;  1M2V B;  1QVF A;  2COW A;  3RKY A;  2XDP A;  1P92 A;  2ZPH B;  1PRM C;  3JCM c;  3RMS A;  3A1P A;  4QKU A;  3JCM e;  3I56 Q;  3G4S Q;  4M75 G;  2RJC A;  3CC7 T;  4AMC A;  4FU6 A;  2JW4 A;  3DB4 A;  3I55 A;  4OMF B;  2HQH A;  2CH4 W;  3UAT A;  2F2X A;  2F2W A;  2KR3 A;  1G3Y A;  2K4Y A;  2RHX A;  2QDL A;  3REA B;  3HPW A;  1EFN A;  1QVF P;  3C95 A;  2FRW A;  2JT4 A;  4AFZ C;  2KQW A;  4R56 A;  4MMK A;  1ACM B;  4IIM A;  2FRY A;  4LE9 A;  5IHI A;  3ER0 A;  2DL4 A;  1NYG A;  1TUC A;  1RAD B;  2EWN A;  2DX1 A;  4XU3 A;  2KVQ G;  4CC7 A;  2RQV A;  1YJ9 A;  1JXO A;  1RL2 A;  1IRX A;  2E6N A;  5EG2 A;  4FM4 B;  3UDC A;  4N0A A;  1ZA1 B;  2JS0 A;  3DLM A;  2DVJ A;  1PCX A;  4M7A D;  2K2V A;  1K8A U;  3VRY A;  4E7S A;  2O01 E;  2DL5 A;  1GBR A;  3HTR A;  2L2P A;  1N9S A;  4GBQ A;  3EGD B;  2QA4 A;  3OYY A;  4M7D A;  5GAN 2;  2A36 A;  1WHG A;  1QKW A;  2FYK A;  4KH0 B;  1YIT T;  2BTT A;  3TSZ A;  3PVL A;  2GNC A;  2EGE A;  2KE9 A;  3DLL A;  1WJR A;  3QDF A;  3UT1 A;  3VS5 A;  3RER A;  2XK0 A;  1BIA A;  1VQP T;  2KK4 A;  3TEE A;  4JS5 A;  3ASK A;  3CCE Q;  2DM1 A;  2V1Q A;  2YRD A;  1YHQ A;  4FT4 A;  3RMQ A;  5GAM h;  1K8A R;  1K4U S;  4ZNX A;  1VQ7 Q;  2COY A;  1V76 A;  1WHK A;  1I5L A;  3H41 A;  1NM7 A;  2O31 A;  4RCB A;  1KD1 U;  4KRT A;  2NUT B;  2K5F A;  1I81 A;  3X26 B;  3CCL T;  2FO0 A;  2EYX A;  4F04 B;  2CT4 A;  4PNO A;  4CI0 C;  2VAS A;  4C92 B;  2DD4 A;  2CUD A;  3M54 A;  3SD4 A;  2OTJ Q;  1KHC A;  3HFO A;  4JJB A;  3I5R A;  4K11 A;  2X9H A;  2FVU A;  4EPC A;  1Z9Z A;  2ROL A;  2P4R A;  2X35 A;  3KUF A;  1AWJ A;  1QCO A;  5FWC A;  4BY6 C;  1JO8 A;  3L2W A;  4QW2 A;  4OB0 B;  1X27 A;  1ZA2 B;  3GLX A;  3QYG B;  3G6E T;  1NJI U;  2PVD B;  1E7O A;  3G4S T;  3NHN A;  1QVG S;  4F7U B;  3OYG A;  1LNX A;  2QQB A;  3H9N A;  4MML A;  4HXJ A;  5FRM A;  3NTH A;  1V29 B;  2XG8 D;  4M77 A;  2VB6 A;  3UA7 A;  2H8H A;  3EGU A;  1BU1 A;  2NYS A;  3F70 A;  4C5I A;  4D6W A;  1VQ4 A;  1D0Z A;  4J5Y A;  3QDR B;  5LJ5 h;  5EC7 A;  4JLG A;  1B34 A;  2EJ9 A;  4A63 B;  2DIG A;  2KNB B;  1SG5 A;  3GP8 A;  2VC8 A;  4DEX A;  3DKM A;  2R5A A;  3VU3 C;  2OAU A;  4JJC A;  3G71 T;  4PFO A;  3CCJ A;  3M56 A;  1ABQ A;  4J8O A;  4CC4 B;  3C0C A;  4LDU A;  1NJI R;  4C5G A;  4XTW A;  4Z8A A;  2P84 A;  1G8X A;  1OU8 A;  2XID A;  4BI3 A;  2RH2 A;  1U1T A;  3CC2 Q;  2K3X A;  1K9M U;  3SEM A;  1BBZ A;  1AT1 B;  1D1B A;  4Y28 E;  3OYB A;  2DLP A;  2ZAE A;  4M7A B;  4L6V 5;  2H3E B;  2HL5 C;  3PGG A;  2QTX A;  4ZGD B;  2L3P A;  2LX7 A;  4R55 A;  2EYY A;  3S3O A;  3JAM E;  2QEX A;  3CBP A;  3HP9 A;  5CIU A;  2XDB A;  2ZPG B;  3O8V A;  2KT1 A;  2EQM A;  4M78 E;  4QQ6 A;  3CCE T;  2OX7 A;  5CCA A;  5DM7 R;  5CQX A;  2M16 A;  1VQ7 T;  3EG9 A;  3EFO B;  3PE0 A;  2V8I A;  3OYJ A;  3CCV A;  5GAO p;  5GAO q;  1K9M R;  3UF4 A;  2CDT A;  3MP6 A;  2QTV A;  4M77 D;  2E5K A;  2HDA A;  2LT1 A;  2HL3 A;  2MPX C;  2R58 A;  4HVV A;  3R6N A;  2YLB A;  1X6G A;  5GAN e;  5GAM j;  2YLC A;  2ZZD A;  5CR2 A;  1MV0 B;  1WHJ A;  1TUG B;  2QI2 A;  1YBY A;  3X28 B;  2E64 A;  2XDD A;  1NPP A;  1YI2 Q;  4PJL A;  4OML A;  3P8B B;  1X01 A;  3HSB A;  3G7Z A;  5FRN A;  4MDX A;  2CP5 A;  2E1H A;  1M8M A;  2B8A A;  3THK A;  2C0O A;  4UC4 A;  4PJO D;  2RQU A;  5J39 A;  1PM3 A;  2ZPE B;  3SDZ A;  1PD0 A;  4OGC A;  1W2B A;  5GAO r;  4KUD K;  3S3M A;  1RAB B;  3I55 Q;  3LYI A;  4M78 F;  2CP7 A;  2L5Q A;  1HD3 A;  3VS2 A;  3VYG A;  1UE9 A;  5GAM d;  3MEW A;  4JLI A;  4J83 A;  1S1N A;  5DLQ E;  1QWE A;  3V8K A;  3PTA A;  1YJN A;  1GXI E;  2DTH A;  4BUG A;  4M7D B;  5M9O A;  3EG3 A;  3A5Z B;  1PSE A;  3CC2 T;  1QKX A;  4EIK A;  1VA7 A;  1WHH A;  2DNU A;  1T3L A;  1W2B P;  2RHZ A;  3H0I A;  5LJ3 f;  4C8Q D;  3OYD A;  4XK8 E;  3QZ9 B;  2DA9 A;  3KXT A;  1SF9 A;  5GMK i;  1WLP B;  5HY6 A;  3JB9 J;  1M1K C;  3CD6 A;  3QJY A;  4KUI A;  2O88 A;  5GMK h;  1BI2 A;  4C0D B;  4JRI A;  4Z89 A;  2DJZ A;  3GIB A;  2PUO B;  4J6W A;  4O6J A;  1LOJ A;  1H3H A;  4Y91 A;  3FB9 A;  2BZY A;  2BZ8 A;  2YUO A;  2YHT A;  3M9Q A;  4LN2 A;  4JJN K;  2QXF A;  4E7J A;  5KYN A;  2DYI A;  2GF7 A;  2FZC B;  2WSC E;  2JTF A;  2RHY A;  4M75 A;  1KJW A;  5CO7 A;  2DO3 A;  1SRL A;  2K57 A;  1IRE B;  2KI7 A;  4ME7 A;  3JCM X;  2COZ A;  1YHQ Q;  1G83 A;  2DL3 A;  3URG A;  4XU2 A;  3BE3 A;  2RK1 A;  1Y96 A;  3EGD A;  3Q1J A;  4LD6 A;  2QYZ A;  1X69 A;  5FU7 C;  1WXT A;  1Y0M A;  2J6F A;  1YI2 T;  2ECZ A;  2M0Y A;  2KGT A;  2LJ1 A;  3I5S A;  3VS0 A;  3MP8 A;  2GTO A;  2CP3 A;  2KMT A;  5D6W A;  4RMO A;  4KH1 B;  1LVK A;  1B34 B;  5KCO A;  5LJ3 e;  3EHR A;  4PJO C;  4F16 A;  2RJE A;  4HCK A;  1I07 A;  4FYV B;  1ZUU A;  1N8R C;  4WCI A;  1N9R A;  2IIM A;  2CSI A;  2AZS A;  2RJD A;  4GLK A;  1PNJ A;  3PT9 A;  2EYQ A;  1QCN A;  1S72 A;  2DER A;  3SWN C;  1FMW A;  4C92 E;  3KFV A;  1EZZ B;  1SSH A;  4XTY A;  4A4E A;  1QVG P;  1IZ6 A;  1PD1 A;  4L59 A;  1EIF A;  2HKQ B;  4IUR A;  4JUV A;  4OB3 B;  3WVD B;  2E10 A;  1FX7 A;  4BE1 A;  1V1C A;  3JCM g;  4QVD A;  4HKE A;  1UJY A;  4IUU A;  2XI9 A;  1VQO A;  3JB9 G;  2ED0 A;  1KG1 A;  1UG1 A;  2LDM A;  1KHI A;  3CCJ Q;  3CPF A;  3LW5 E;  4C8Q C;  1OU9 A;  3LWH A;  5GAN 5;  2NWM A;  4F7U E;  2QDY B;  3CCM A;  3BDU A;  3M4G A;  4M75 D;  3CC4 A;  4JZ4 A;  3VRZ A;  3M0P A;  2G6F X;  2K6D A;  4RTX A;  1VQM T;  2HBW A;  1GCP A;  4WF2 A;  4AFQ C;  4FW1 A;  3LX7 A;  1WFW A;  1I1J A;  2F1L A;  1R0B G;  2DL7 A;  3GPL A;  3V7S A;  2EKH A;  3NTK A;  3OYH A;  4BE2 A;  1K1Z A;  3CCS Q;  4HA8 A;  4B9W A;  2LCC A;  1M90 C;  1G5V A;  5CK9 A;  2AHJ B;  4NOY A;  5GAO n;  3MEV A;  2SRC A;  1Q81 U;  4ZTJ A;  1FMV A;  1Q86 U;  4PL6 A;  2HKN A;  3PVQ A;  1Y7X A;  5C6S A;  3U23 A;  3OYN A;  4PK4 A;  2DXT A;  5CKB A;  2LQK A;  3CCU A;  1GFC A;  3PFS A;  5FWB A;  2FZG B;  2D6F A;  4ANJ A;  1BCM A;  1RAF B;  3I9Q A;  4M7A E;  2CP0 A;  1YIJ T;  3OBW A;  2MYS A;  3J7A F;  4F7U F;  2KRN A;  2HSP A;  3UWN A;  1H64 1;  2W10 A;  2KAF A;  4JZ3 A;  3PIP A;  2EAY A;  1MMD A;  1KC8 U;  1I4K 1;  2OTL Q;  2KYB A;  1PRL C;  1Q81 R;  1YWP A;  1ZSZ A;  4OMM A;  4WTO B;  1Q86 R;  2RHU A;  2DXC A;  1VQK Q;  3M4Y A;  1JXM A;  1WA7 A;  1K73 U;  3QUI A;  1ARK A;  3VUB A;  2AKK A;  1BK2 A;  1N5Z A;  2JZ2 A;  4FL6 A;  3MKD A;  2EFI A;  3RBB B;  1AZG B;  1JJ2 S;  1GFD A;  1BYM A;  3TRE A;  2VV5 A;  1NE8 A;  4CRI A;  3JCM P;  3L2Z A;  2HQX A;  1KC8 R;  1BI0 A;  2DEQ A;  2XU8 A;  1YJN Q;  2FPE A;  4J9G A;  1HYO A;  4M7A F;  3M57 A;  3NFC A;  1K76 A;  2E5Q A;  2K3B A;  1BIB A;  1YP5 A;  2ABL A;  1VQN Q;  2LT4 A;  1H8K A;  3O5Z A;  2RN8 A;  1HK9 A;  1FYN A;  4OF1 A;  1K73 R;  1VQ5 Q;  1WGS A;  4F17 A;  1Q7Y C;  3QSU A;  1MMG A;  1M9S A;  2E3H A;  4M75 B;  2YT6 A;  1OUL A;  3CCS T;  1VQ6 T;  1WJQ A;  4KGV B;  1Q82 U;  5GJV B;  1MMA A;  2CS7 A;  3E9F A;  1Y96 B;  2RI3 A;  5DLO A;  1D1C A;  2QAZ A;  3MHX A;  1VIF A;  3JCM J;  2VGN A;  4KUL A;  3CME A;  3OYM A;  4ZGE B;  5GAN j;  4A54 A;  3L2Q A;  1JRI A;  3EGX A;  1MND A;  5ECA A;  4IUT A;  3OSS C;  3V7C A;  4F14 A;  1IO6 A;  4C92 C;  4Z88 A;  3CCQ Q;  2X4W A;  4E47 A;  1ZUK A;  3CPW S;  5LL6 S;  2K79 A;  1RAA B;  4QQG A;  1TOV A;  1KIK A;  4LDX A;  1UUE A;  1RI0 A;  1VQL A;  2LX9 A;  4AG2 C;  2OTL T;  3CMA Q;  4FSX A;  1G3T A;  2PVG B;  1M3A A;  1VQK T;  2DRM A;  2KRM A;  1SHG A;  2CRE A;  2YXY A;  5GAN d;  2OAW A;  3OY9 A;  3S3N A;  5GAN g;  3CCR A;  1WX6 A;  4PFZ A;  4NL3 A;  3I56 T;  2CSQ A;  2E41 A;  1G3S A;  4DBF A;  2MK5 A;  3AT1 B;  5C0M A;  2HQE A;  3MO8 A;  3E1S A;  2GFA A;  2EPD A;  4M77 E;  3NGP A;  4FYW B;  2D0Q B;  5HK3 A;  3PIO A;  2LNH B;  1KD1 R;  4GY5 A;  3NMZ C;  1OEB A;  1YCS B;  3QXE B;  3LH0 A;  4KGZ B;  1LJO A;  2X4J A;  4M7D D;  2LRQ A;  1VQN T;  2DRK A;  5KE2 A;  1VQO Q;  1XOV A;  2QGG A;  1VQ5 T;  2ESW A;  1IB8 A;  5IXB A;  3A8G B;  2GCX A;  2CZ6 B;  3CCM Q;  2MWO A;  5IHN A;  1GBQ A;  2DTI A;  3C4S A;  4OB1 B;  2MI6 A;  4BB7 A;  1GCQ C;  2LQN A;  2LJ0 A;  1VQ9 Q;  4PJO E;  2K5L A;  4M7A C;  3QO3 A;  4J9E A;  2DFU A;  3GNF B;  4HVU A;  3CC7 A;  4AFS C;  1YJW Q;  1T0J A;  4AFU C;  1D3B A;  1MMN A;  3ZL7 C;  2MWP A;  2CUB A;  1IXD A;  4RKU E;  5GJW B;  1XJW B;  3QWY A;  1X75 C;  1QWF A;  4CC3 A;  1SEM A;  2EQI A;  1KQ1 A;  1TU0 B;  1Y71 A;  4A53 A;  3BW1 A;  4M77 F;  5AYF A;  3C12 A;  2OI3 A;  2L3R A;  5I2M A;  3OS0 A;  4DQ2 A;  3HHT B;  3CCQ T;  2CZ1 B;  2IG0 A;  5CVI A;  3MET A;  3EH1 A;  1ZSZ B;  4J9H A;  5LJ3 j;  4C8Q E;  3VS1 A;  1X6B A;  3CMA T;  2DIL A;  4HCC A;  3OS5 A;  4HCB A;  1VQ8 Q;  5KCH A;  1OOT A;  3VKI A;  3JCM h;  3RIR A;  3OS1 A;  2OTJ T;  1U06 A;  4M78 A;  1RLQ C;  1YIT A;  1D1A A;  5I11 A;  1D09 B;  4PJO F;  3CQT A;  1JBM A;  4HT8 A;  4FYX B;  1NLP C;  3RKX A;  5KYW B;  1TXQ A;  2CT3 A;  3S6W A;  3ZBD A;  1KQ2 A;  3MEA A;  5FLX E;  2RD1 A;  2ZPF B;  4FW2 A;  1VQP A;  1JJ2 A;  3IQL A;  3OB9 A;  2YUQ A;  5GAN 3;  3VS6 A;  2AIR B;  4N0A C;  3E2U A;  5LJ3 d;  4ELZ C;  1NYF A;  5LJ3 g;  2F2V A;  2E12 A;  2YSQ A;  4MZM A;  4C5E A;  3CCL A;  3FIF A;  2GFU A;  3HKS A;  1U3O A;  2LTO A;  5GAN 8;  5I22 A;  3UPU A;  4PKC C;  2F69 A;  4M7D C;  1TS9 A;  4OMP A;  2MMP A;  1Y07 A;  4PJN A;  2JJ9 A;  2RO0 A;  1QQJ A;  3R6O A;  4M4Z A;  2L3S A;  4C8Q F;  1M8V A;  1UHF A;  2VYT A;  1JJ2 P;  4LD9 K;  3L2R A;  1UGQ B;  1UGR B;  1NZ9 A;  2MOX A;  2Y4X A;  1VQ9 T;  1WHL A;  3I56 A;  3G6E A;  9ATC B;  3G4S A;  4LXC A;  4E7K A;  3RKW A;  2VKN A;  5IXF A;  3REB B;  1N6A A;  1YJ9 Q;  2DBK A;  3X20 B;  2RF0 A;  3EGX B;  3GF5 A;  3QJ6 A;  4V2S A;  2E65 A;  1QLY A;  3TU4 K;  5FW9 A;  3L2V A;  3JB9 D;  2NUZ A;  2XHC A;  2C0I A;  1AD5 A;  2QA4 Q;  1OX8 A;  1M5Q 1;  1B7T A;  4J9D A;  4BI8 B;  2HMA A;  1ZUY A;  3G71 A;  1W4S A;  2QAS A;  2QQR A;  2J05 A;  1WNL A;  3CPW A;  4N4H A;  3QKJ A;  3OYA A;  1U5S A;  4JJD A;  1Z9Q A;  2JXB A;  4M75 E;  1VQ8 T;  5GAM f;  5CKD A;  1O9S A;  2V1R A;  4M77 C;  1UEC A;  3TVT A;  2BKD N; 
#chains in the Genus database with same CATH homology
 2MPX C;  2CP2 A;  2QK0 A;  3E2U A;  3TQ7 P;  1IXD A;  1WHJ A;  2HKQ B;  2Z0W A;  1WHM A;  2CP6 A;  1LPL A;  1WHG A;  2CP0 A;  2HQH A;  1TXQ A;  2E3I A;  1WHL A;  2COW A;  2COY A;  1WHK A;  2HL5 C;  2E4H A;  4B6M A;  2E3H A;  2HKN A;  1TOV A;  1WHH A;  2CP7 A;  3RDV A;  2CP3 A;  2COZ A;  2HL3 A;  2CP5 A;  2M02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...