1IXDA

Solution structure of the cap-gly domain from human cylindromatosis tomour-suppressor cyld
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
104
structure length
104
Chain Sequence
GSSGSSGLAMPPGNSHGLEVGSLAEVKENPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFASLQPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The CAP-Gly domain of CYLD associates with the proline-rich sequence in NEMO/IKKgamma
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords Cylindromatosis tumour-suppressor CYLD
total genus 8
structure length 104
sequence length 104
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1ixdA00
1WHMA 2E4HA 2COZA 2COWA 2HQHA 1WHHA 1WHKA 1WHJA 2CP5A 2CP3A 2E3IA 3RDVA 1TOVA 2COYA 2CP6A 1LPLA 3E2UA 2HL3A 3TQ7P 2MPXC 2QK0A 1TXQA 2E3HA 2CP7A 1WHGA 2HL5C 4B6MA 1IXDA 1WHLA 2M02A 2Z0WA 2CP2A 2HKQB 2CP0A 2HKNA
chains in the Genus database with same CATH superfamily
2K57A 3LWHA 4BACA 3CCQA 4LNPA 3GIBA 1RABB 5GAOp 2FL7A 4M7DE 3MEAA 2JM9A 4EMGA 1VQ8Q 3SEMA 3OMGA 1TG0A 3KXTA 4QT7A 1KD1R 3UF4A 2RB6A 3VU3C 4FW1A 1C0MA 1SSFA 1PSEA 4LE9A 1M30A 1BB9A 1QVGA 2RI3A 1HD3A 5GANg 1G3TA 1G5VA 4ORZA 1Q86R 4L5GA 3DLMA 5CQYA 3VUBA 2JS2A 3OYYA 2LRQA 2J7IA 4OMLA 4F04B 3VS4A 3SHWA 2KR3A 3OYKA 4M4ZA 4M7AA 2GQVA 4DQ2A 4FYVB 2H8HA 2EYWA 2L8DA 2AHJB 5GAMe 5LJ3e 1H92A 1YJWQ 4E7HA 4OMNA 2YXYA 2PZ1A 1H641 3CBMA 1RI0A 2DBKA 2HDAA 4JS5A 3TCJA 3CC4T 2HZYA 5EC7A 3CCJT 5M9OA 1VQKT 1W2BP 2HBPA 4Y28E 3PE0A 3UPUA 1K73C 1M1FA 1IZ6A 4ATOA 1VQ4Q 4KT0E 1G3SA 1RLPC 4PFZA 3V8JA 1VQ5A 2A36A 3ZL7C 3S3OA 2LT1A 1K1ZA 1D1BA 3HKSA 4XK8E 1YJNA 2QTXA 2ZPGB 2RI5A 1I07A 1G3YA 3F70A 1JXOA 3M0SA 3L2ZA 3P8BB 3MP8A 3VYGA 5CAIA 1EX4A 4J8OA 3QZ9B 5D6YA 3I55A 3RUXA 4IIOA 3CC7T 2ZPIB 1NM7A 4M7DB 2L0AA 4RTVA 1X2KA 3V7RA 3CPWP 2ESWA 4FL6A 3CC2Q 4BI4A 5IAYA 2XD0A 1U8RA 2BIVA 4RG8A 2JXBA 1YJNQ 1RAGB 1UTIA 3M59A 3VKIA 4PFOA 2GNCA 1HK9A 3OYLA 3CCJQ 1U1SA 4JRKA 3CC4Q 2X3WD 4VUBA 2M16A 3ER0A 1ZSGA 3D7SB 3E2UA 4RUGA 1BCOA 2MCNA 4JLIA 4L59A 4Q5WA 3UT1A 4F7UF 1WHGA 1PD1A 2XI9A 3INZA 4E7IA 4CC7A 3E9FA 1YIJT 1ARKA 1QKWA 2YDLA 3QUIA 5LJ5f 3RKXA 1N9SA 5FU7B 2J6KA 1VQNQ 5KYXA 2GTOA 3HL8A 5DY9A 3FIFA 1TWBA 2DTIA 2M1HA 4MDXA 3CMET 1SEMA 1GXIE 2MIOA 1UHCA 4JS4A 4BUGA 3M4YA 4OB0B 2AZVA 2ROLA 1UEBA 1JXMA 3WVEB 3ZEHA 4XTYA 3I56Q 4LD6A 3BE3A 3EH2A 1Y0MA 1K76A 2OI3A 5GAN3 4Z02A 2WACA 1KQSS 4M75A 4NS5A 1WYXA 3CCJA 1YWPA 3JCMb 1JB0E 1QKXA 2F5TX 2DO3A 2QEXT 2P0KA 4AFSC 3RMSA 3GPLA 5DM7R 1OULA 1Z9QA 1KD1C 4LUDA 3CCQQ 2OTJQ 2RH2A 4KGZB 4M78F 4E6RA 3A5ZB 4XTVA 1A0NB 4JUVA 2CP7A 4A63B 2XHCA 5GANj 2DX1A 2R5MA 1QCFA 3CCLQ 2IPOB 1C1AA 1UGPB 4C8QF 3ULRB 5GANe 4M7AG 3OS2A 2OTLA 1VQ5T 2VYTA 2X3XD 2DPPB 1OU8A 1TUGB 3H9NA 2VXFA 4J6YA 2ZPBB 3OSSC 2EGCA 3A8OB 1MUZA 1XJWB 3M0PA 4ME7A 4PKCC 1GCPA 3VS1A 3OYIA 5GAMf 1UDLA 1WXUA 4XTZA 5L8RE 3VS2A 3OS5A 1OI1A 4C5EA 1VQOT 3G71A 3DKMA 2LJ3A 1U5SA 3MEVA 3REAB 4A53A 1LPLA 3M57A 3JCMJ 1RLQC 1MGQA 2LTOA 5ECAA 3EG0A 1VQMQ 2K5LA 2XICA 5HKCA 2EQIA 5CKDA 1D09B 4C92D 2NLUA 2W0ZA 4PJLA 1RI9A 3THKA 4A4FA 4OMQA 2ZPEB 2RHIA 5GAN8 1OV3A 4NL2A 4OF1A 1QVGS 1VQMT 1M90U 4UC4A 2RMOA 1IGQA 2ZPHB 4JDSA 2RHXA 2CH4A 1ZUYA 2HL5C 1Q7YC 3L42A 2DIQA 5GAMg 4J9FA 1PHTA 4ZN3A 3OYCA 3OYMA 1KC8C 2EJGA 1T3SA 4IUPA 1VQ4T 1V29B 3CMEA 2XG8D 4LXCA 2AIRB 5GMKh 4RCBA 2O9SA 2JW4A 1RADB 1X69A 4JPBW 3OA6A 2WSCE 1QVFP 3CBPA 3H0FA 2R57A 1UB4A 1HSQA 1C6VX 3OS1A 3JCMe 1OPKA 1WHKA 1VQPA 2F5KA 3JCMW 3QDRB 1I5OB 2D8JA 4PJOA 1KQ2A 4GBQA 1Y96A 4M77E 3BW1A 3MEWA 4GY5A 3QZ5B 2VUBA 4RG2A 2KXDA 3DB3A 3O5ZA 1IRXA 1OU9A 4JJNK 1YCSB 4C92B 5KYXB 1K9MR 2EVRA 4M77C 2QEXA 3M53A 2ECZA 2HQHA 1AWJA 2RI2A 4OMMA 3HHTB 1G83A 3G6ET 1JRIA 2FZCB 3GF5A 2KYBA 2QYZA 3PTAA 4IUQA 4JLGA 1NYFA 2P0PA 5LJ5g 1LNXA 3SD4A 1QWFA 7AT1B 1KFZA 4Z88A 1VQ5Q 2DF6A 1LOJA 4CC2A 4GLMA 1KC8U 4E7ZA 1VQ6Q 4QVDA 3JB9F 3ASKA 4PLLA 1WHHA 3KUFA 3JCMQ 2CYZB 1M8MA 1T3LA 1UGVA 4XU0A 3I9QA 1KK7A 2V1RA 2X51A 4RTYA 1MMDA 4F7UB 3OQ5A 1K0SA 4XAXB 1M4ZA 4AT1B 2O88A 4M78D 4RTWA 5FU7C 2QG9B 5C0MA 2LP5A 3MEUA 4MZPA 1VQNT 8ATCB 2R58A 4BI8B 2QQBA 1VQ7Q 4C8QD 4PJOE 4PFPA 4J6WA 4O5VA 4QQGA 5LJ5e 2EQJA 1NLPC 2DA9A 2L3RA 4CC3A 2LJ0A 1K8AU 1CKAA 5CO7A 3JCMh 4Y92A 1VQMA 1KQSP 4AFQC 3G6EQ 2OTLQ 2QASA 1ZSZC 2HKQB 4BDZA 3I5SA 2AZSA 1BU1A 1S72A 2DL8A 1M1KC 4AFUC 3T9NA 2QQRA 1AVZC 2HL3A 1VQ6A 1RUWA 2NUTB 4JRQA 3G4ST 1WQ7A 4C92E 2PQWA 1AEYA 1WHLA 3QJ6A 1T0JA 1I4K1 3C12A 5IXFA 1K9MC 5CR2A 2C0OA 2EPDA 5LL6S 2NUPA 2K3XA 3H0HA 2E70A 5AYFA 5LJ3f 4BD3A 1GBRA 4M7AD 2AT1B 3EHQA 5FWBA 2PU9B 3J81E 2P84A 4CRIA 4KH0B 3G7ZA 1WQWA 2EKHA 3V8LA 1YJ9T 4DOWA 2A37A 5A0LA 2ZPFB 1N8RC 2DAQA 1VQPT 1B3QA 1TUDA 1NYGA 2JMCA 1YP5A 3UA6A 1WDXA 1SF9A 1OPLA 4M75D 2EIFA 1BIAA 2C0TA 2EJ9A 2K3YA 3QG1A 1KHCA 2CUBA 2ZCFB 3CQTA 5GAN7 1ZBXA 4QQDA 3LWIA 2O4XA 3TSZA 1PKSA 1ZSZA 3CCST 4J9CA 5CKHA 4X9DA 1IO6A 2K9GA 4M75E 4C5GA 5GMKj 2J6FA 2NUTA 1VIFA 2VWFA 2D8HA 2DVEA 1OOTA 4HA8A 2L5QA 2DEQA 2LNHB 3CPWS 2BZYA 2JNGA 4IKFA 2JUFA 2DXTA 1W6XA 4FT2A 2K2VA 2QDYB 1M1GA 5GJWB 4KUIA 2LQ8A 4M7AB 1K9MU 1VQNA 2HQEA 4FU6A 2MI6A 2OJ2A 1VQKQ 2E6ZA 1GRIA 3RKYA 5I2SA 4JZ3A 2CUDA 3CCQT 2XDBA 3H41A 3JCMg 3HRUA 2B86A 2I2LA 1ABQA 3KFVA 1XQHA 4LN2A 4PJOF 2QEXQ 3QWYA 3A8LB 2L2PA 3OSVA 5HY6A 3LH5A 1D0YA 3EGDB 1PNJA 4M7DC 4E7LA 1X6OA 2HKNA 4Y91A 2RD1A 1DJ7B 2KYMA 1VQ7T 1PD0A 1E6GA 2COYA 3X20B 3CMAT 4KUDK 4J9IA 4F7UA 3AHUA 3X25B 2GF7A 1Q82U 4JRIA 5KYYB 1FMWA 2L89A 2M02A 4M78B 1Q81C 4FCYA 4J6XA 2DD4A 1M2VB 4MDWA 1MNEA 2DRKA 2O31A 3OYGA 2H3EB 3QPHA 1S72T 3NPFA 2V8IA 4BB7A 1M3CA 4C8QB 1K73U 5GAMj 2KT8A 4AFZC 1KJWA 3EG2A 4OGEA 4A4EA 1D3BA 1UUEA 2BE9B 3OYBA 3OYNA 4KGVB 1BI3A 4EIKA 2GCXA 2PNIA 2KY9A 4E2FB 3JCMd 3OS0A 3VYHB 2EQUA 1UG1A 2YRVA 1YJNT 2CT3A 1YN8A 2K5IA 1M2VA 4JJCA 1WZOA 2YUOA 9ATCB 3CD6A 3FB9A 4RKUE 1W4SA 1W2BA 4FYXB 3EH1A 1WJRA 1MMNA 1KG1A 5GAN2 5FW9A 2NYSA 2O01E 3HFOA 4KRTA 3I55T 5A2QE 3J7AF 4LDYA 2E6NA 3SB2A 4DBHA 4BY6B 2KDSA 4RTUA 2RJDA 2FG0A 4B6MA 2EQMA 2DL7A 5KYUB 4J9BA 2EJFA 2A7YA 1VIEA 2DILA 1S1NA 4F7UE 4OB2B 4HXJA 3CCSA 1FXXA 5FRMA 3QKJA 2FZKB 2JTEA 2DLPA 3HPWA 3OMCA 4BY6C 1HXDA 1VOMA 1BI0A 1UJ0A 4PJMA 1M5Q1 2RQTA 2PVGB 2KQWA 4IUUA 4PJOD 5J39A 1RAAB 2EQKA 4C0GA 4YTLA 4WTOB 2ED1A 2DJZA 3SWNB 1YIJA 2COZA 1M1KR 2X4WA 2DFUA 4AMCA 5CK9A 1AZGB 4LDUA 5GMKe 3E1SA 4B9WA 2MOXA 4HVWA 2XIDA 1TUCA 4E7KA 3QSUA 1QMCA 4RCCA 4DEXA 3KBGA 4PNOA 2JTFA 2EAYA 2VVKA 2GFAA 5GAN6 4QW2A 5IHIA 1Y57A 5FROA 3CC2A 2DNUA 4ZTJA 2LMJA 3G4SQ 1X43A 2DZ9A 1ZHIA 3I56A 3HSBA 1AZEA 2PVOB 3M9QA 2JVVA 3RESA 1IREB 3C4SA 4IURA 3EFOB 1IB8A 2DL4A 2VGMA 5HK3A 1IGUA 5KCOA 4ZN1A 1BI2A 2A28A 1EZZB 2F1LA 2BUDA 2MMPA 2OX7A 2DL5A 1H8KA 1QCOA 2Z0WA 1WHMA 1PKTA 3EFRA 3A1PA 1QVFS 2QA4A 2DXBA 3TSWA 4M75C 1LCKA 2NUPB 2W10A 4DOVA 1I8FA 5GAMh 3PIOA 4LD9K 2LCSA 3GNFB 1N9RA 2KXCA 2PUKB 2SEMA 1SPKA 2H3JA 1VQOQ 1YCYA 1O9SA 5J26A 5KYNA 1K8AC 1G3WA 4HCBA 1YNZA 3CD6T 2YRCA 1ZUKA 4N0AA 5HK0A 3URGA 3LYIA 2LNVA 2E5KA 3MO8A 8AT1B 1PM3A 2DYIA 3C94A 1YITA 4J9EA 4D8KA 5DLOA 3SFMA 3MP6A 5D6WA 2RPNA 2V8JA 2VKNA 2QGGA 3Q1JA 1VQ9A 2XK0A 1NJIR 2YT6A 3L1AA 3VS0A 3NTHA 3U23A 4DBFA 3CCLT 3NFCA 2M9UA 4M7DG 1KQ1A 2EGEA 4OMFB 1JBMA 1PRLC 3V7SA 1YHQA 4OGCA 3LH0A 4RTTA 4JZ4A 1NJIU 3C0CA 1OQKA 1PWTA 1NEBA 2A3LA 2YHTA 3EGXB 1WJSA 4XTXA 1NG2A 3PMIA 4C8QG 2FB7A 4RTZA 3M56A 3PGGA 4ZGDB 2BZ8A 2RHUA 2DTHA 5FRNA 3REBB 1HJDA 5GMKm 4EMHA 4IUTA 1M8VA 2FYKA 4XU3A 3M0TA 5I21A 1BBZA 1VA7A 4ESRA 5GMKi 4C8QC 3L2RA 2DVJA 5LJ3g 3M5AA 3CMEQ 3LGLA 3RERA 3JB9I 4ZTFA 1OYXA 2K3BA 1G8XA 2ROTA 2CP5A 1ABOA 3CD6Q 4PJNA 4KBMB 2CDTA 4FT4A 2L3SA 4A54A 3HTRA 2DXUA 4M77F 2RQWA 3CC2T 4ANJA 2Y90A 4DBQA 4HKEA 5LJ3d 1YITQ 4C5HA 1I81A 3SWNC 4BE0A 4ZGEB 2E1HA 1FMKA 2QA4T 4J7IA 2RHZA 1N8RR 3NHNA 1GBQA 2O2OA 1U3OA 1VQLQ 3OBWA 4N4HA 4XQ3A 3A8MB 3JB9H 1R0BG 1UE9A 2D0NA 2X9HA 3CPWA 3L2WA 4XTUA 4A4HA 1YI2Q 1WLPB 2DD5A 2CP3A 2PUOB 4DEYA 2K4YA 2BKDN 2DJQA 1Q82C 1B34A 2E10A 2AKKA 2KI7A 4BDYA 1KC8R 3FDRA 2R5AA 4PK4A 3QXEB 3AT1B 2DRMA 2PVDB 1UGQB 1AHJB 2FPFA 4HVVA 1OX9A 1Q86U 3QIIA 4AG2C 1GL5A 2E12A 5GAN4 3HRTA 2KBTA 2LDMA 2DBMA 3G4SA 1T0HA 2YLCA 2CZ6B 1PCXA 4FW2A 2DYBA 1Q7YU 2ATCB 4HT9A 4QQ6A 1MMAA 1K9AA 1VQPQ 4F17A 3RMQA 2KGTA 3VS6A 3HRSA 1ZBJA 3OW2P 3EG9A 1QVPA 1V1CA 1Z9ZA 1HYOA 1SKUB 1YI2A 3LW5E 2MYSA 1BIBA 1WFWA 2J6OA 3CCMT 4EMKC 5LJ5h 1Q82R 2HAXA 2WSEE 1ACMB 2FRYA 3QJYA 4LDXA 1WNLA 2YSQA 1YJ9A 1Q7YR 2OAUA 1N8RU 3EG9B 2MF2A 2LQNA 2QDLA 4C92F 3VUZA 4FYYB 1AD5A 2SRCA 5KH6A 3E19A 3EG3A 1WA7A 1YJWA 4D8DA 1PSFA 2OAWA 1OX8A 3UA7A 3VV0A 4M75G 2K7AA 2X35A 4K11A 2QK0A 4LUEA 3CCVA 2LZ6B 4XU1A 4MZMA 1M90R 2FEIA 1RACB 3TREA 3I35A 1QCNA 2OTLT 3PMTA 1WHJA 1R0CB 3EGUA 5GAN5 2YRDA 1VQ8T 2DETA 4QVCA 1LJOA 3VJPA 4A4GA 1VQ6T 2D0QB 1KSWA 5L23A 1O75A 3M0QA 3PFSA 4DA4A 3UATA 6AT1B 2MAMA 3PIPA 2KMTA 5KCHA 2P4TA 4FSXA 2FVUA 5KYYA 3FLGA 4A4KA 2B8AA 2RJEA 2CP0A 2F69A 2FRWA 5GANh 2YWWA 3CCMQ 3M0UA 4JJBA 1IHWA 2X4JA 3OY9A 4J9GA 4M77G 3JCMV 5CKEA 5LJ3j 2QQAA 5I11A 4WF2A 2CSQA 1UJYA 2JS0A 1M3AA 2QXFA 3TEEA 1B07A 3CCET 1SRLA 4C92G 2COWA 1Q81R 3M55A 4RMOA 2MWOA 1YBYA 3CCSQ 1D3BB 2A08A 3H0IA 2CZ7B 2HD0A 5LJ3h 4R0KA 3A98A 4F16A 1P92A 2AK5A 3WXMB 2EYZA 4C92C 3CCUT 1KHIA 2IVWA 2LCCA 3EG1A 1J3TA 1MV3A 3PVQA 4PJOC 1X6GA 1WJQA 4Z8AA 5IT9E 4EDUA 1YI2T 2GTJA 2KSSA 1ZSZB 3I5RA 2HBWA 2JN0A 4FM4B 3UDCA 4II1A 1VQLT 3G71Q 4C5IA 4JRPA 3RKWA 1V76A 1AWXA 3CCRQ 2NUZA 2CKKA 2KT1A 3CCVQ 3NTKA 1ZA1B 1VQ7A 3VRZA 5FWCA 1YJWT 1H3HA 4KGXB 1OZ2A 2ABLA 3CMAA 1VYTA 2KROA 1QVFA 1WXBA 2A0FB 3CCEA 1F1BB 1JU5C 3MJXA 4RTXA 2LCLA 4X1VA 3FJPA 4BE2A 5GAOm 2EBPA 1GFDA 3P8HA 4NOYA 5GAOr 2L3PA 2VXEA 4QVZA 5GAOq 4HT8A 3BFMA 2HSPA 3OYFA 2RN8A 2KAFA 2KNBB 4M78G 4C0DC 3OYJA 1NPRA 2JMAA 4LDWA 5CCAA 4IUVA 2HQXA 4E47A 2QQSA 3TVTA 1AOJA 3QWXX 1RAHB 4D6WA 3DB4A 2BZXA 5FU6B 4M7AF 3H6ZA 2YUPA 1QWEA 3WVDB 4JJDA 4C0DB 5C6SA 1JJ2A 3FRNA 1ZX6A 2CT4A 3JB9G 5AT1B 3FEOA 4M7DA 3EAEA 3JCMc 1Q81U 1I1JA 3M54A 2LT4A 2KRMA 1Y71A 2ZZDA 2E4HA 3BY7A 4KULA 2K79A 2CREA 1OZ3A 2RM4A 1MHNA 3A8GB 2QTVA 4CC4B 5GAOl 2YUQA 1PG5B 2KE9A 3GLXA 2EWNA 4M7AC 2GGRA 1PC0A 1R77A 3RBBB 3QDFA 3HFNA 3DLLA 2WSFE 3H8ZA 3QYGB 1RAEB 3JRZA 1UGRB 1NEGA 3CCRA 1OEBA 3I56T 2M51A 2MK5A 2LX9A 2RQRA 5DLQE 1MMGA 1JEGA 1S72Q 3P8DA 1KIKA 5CQXA 1BK2A 3NGPA 4IIMA 4MMLA 1X75C 2GBQA 4J9HA 4B9XA 3LX7A 1KD1U 4OB1B 4F14A 3GBQA 5GAMd 3CC4A 3SWNA 2EFIA 3NMZC 1WX6A 1FX7A 2ED0A 2MWPA 5LJ5j 3QYHB 3CMAQ 3JCMf 1Y07A 2K6DA 3OYDA 4M77B 3IQLA 2JM8A 3QO3A 4N4IA 5LJ5d 2GQIA 1WGSA 2RHYA 3EFOA 4R55A 3X28B 2XU8A 2K2MA 4EMKB 2YLBA 3CCLA 4C8QA 1BI1A 2JT4A 2PTKA 2F2WA 1D0XA 2RJCA 2EW3A 2XMFA 3CC7A 3R6OA 1JJ2S 2V8KA 4ZNXA 1YFNA 4M7AE 5KE2A 3ZFJA 2ZGWA 4OVAA 1FYNA 5CKFA 1YIJQ 4AG1C 5D7UA 1TU0B 3CC7Q 1FWZA 1I0CA 2VASA 2FPEA 3EFSA 4M75F 2CGHA 3X26B 3CBOA 4C0FA 1YHQQ 3EGDA 4PLIA 2VGNA 2DZCA 1GCQA 2G6FX 1BCMA 2FO0A 5IXBA 2RQUA 2HMAA 1YWOA 4PL6A 2DK3A 1I5LA 3META 5KYUA 1VQ9Q 4TVRA 2IG0A 2G3RA 3E9GA 1XNIA 1R8OB 3RDVA 5J3BA 1UFFA 4MMKA 1M27C 2X4XA 1W1FA 4M77A 1CSKA 2JOYA 4XU2A 5HCKA 3OW2S 5CVIA 4PJOB 2DKGA 3PVLA 2AKLA 1GCQC 4N4GA 3CCRT 4R56A 3M4GA 2LX7A 3BDUA 4ZGJB 1BKBA 1YITT 2GFUA 3G71T 4OMPA 5I2MA 1M1KU 4L6V5 1SRMA 4OB3B 1QP2A 1QQJA 3TQ7P 3EGXA 3CCEQ 4NL3A 3EHRA 3JCMP 1VQ9T 5IHKA 3LLRA 2CP2A 3OBYA 4HCZA 1VUBA 4EMKA 1XOVA 2D1XA 5KYWB 3PNWC 2HCKA 1YHQT 3GNGA 2E3IA 5GJVB 3CXCA 5I22A 3CCUQ 2EYQA 2J06A 2E41A 4M77D 1M2OA 3NTIA 2D6FA 4OMOA 3PT9A 1U06A 2M0OA 1IXDA 1N6AA 2E64A 3I55Q 2C06A 3MCAB 3N5BB 3OW2A 2DTOA 2E5QA 4O6JA 1XTDA 1B34B 1RAIB 1EFNA 2KRSA 4MZTA 3V8KA 3JAME 2JTMA 3MHXA 4GLKA 3X24B 1SHGA 3CXCS 1N5ZA 1X6BA 3G1JA 1X2QA 4X34A 2VV5A 2CH4W 2CSIA 1NJIC 1E6HA 2KEAA 4CI0C 3JB9J 1VQ4A 1G2BA 4M75B 1TH7A 5A0DA 1M90C 4HCKA 1JQQA 4QKUA 1TS9A 4X9CA 2HEQA 4FIBA 2QQ9A 2EGAA 1VQOA 3S3MA 3VS3A 1TOVA 4PJJA 1CKBA 3QHSA 2NWMA 3FC3A 1D1AA 3RNJA 3L2QA 2DMOA 4XTWA 3C95A 1K8AR 1E7OA 5GMKl 3L2VA 3VS5A 1D1CA 2JZ2A 1TSFA 2DXCA 2F2VA 1K73R 1WIEA 1UECA 2QI2A 5IN1A 1U1TA 2EYXA 2XKOC 1UHFA 2VC8A 4FYWB 5FU6C 2P4RA 2RF0A 4OP0A 1UGSB 3RIRA 2BE7D 1M3BA 1D0ZA 4C0ZA 3GOXA 4V2SA 2LVMA 4ELZC 5GANf 2O4XB 1AWOA 2CZ1B 1PRMC 4J7FA 3LGFA 5GANd 4BI3A 3MP1A 2ENMA 3VS7A 2QGFB 2KK4A 2DIGA 5KE3A 1ZLMA 2I0NA 3BDLA 2RJFA 3S3NA 1VQ8A 2Y4YA 4M7DD 2XDDA 4HVUA 4F7UG 1TTHB 2LQWA 2D9TA 1ZUUA 3M0RA 1SHFA 1Q86C 4P5NA 1QVGP 4E7SA 2DL3A 1K4US 3JSCA 1SG5A 5IH2A 1JJ2P 2V1QA 3ME9A 2V26A 4M78E 1AWWA 5FLXE 3OYHA 1W2BS 2DERA 2E65A 2RO0A 1X01A 2FPDA 4J83A 5KYWA 1X27A 3HP9A 4C92A 3M58A 1KQSA 4C8QE 1N27A 1YJ9Q 5CIUA 2HSEB 2O9VA 3JCMX 3QBYA 2MPXC 1SSHA 4J5YA 3OB9A 2K5FA 4E7JA 2Y4XA 3UWNA 2OTJA 3FJ5A 3CCMA 3RR6A 3L2UA 2C0IA 3MPUB 2RK2A 1ZQ1A 1BYMA 1H3ZA 2DE0X 3GP8A 3OYAA 1Q95G 1EIFA 2LC4A 1NZ9A 4LDVA 3V7CA 2RNAA 2JJ9A 1NLOC 2QAZA 3G6EA 2IIMA 2LJ1A 3R6NA 4HCCA 3JB9D 4DBRA 1AT1B 2EYYA 3CEYA 1VYUA 1NPPA 1MNDA 5IHNA 3CCUA 3CCVT 3CPFA 4N0AC 2YUNA 3CXCP 1NBEB 1MV0B 4WCIA 1K0XA 2FZGB 2QA4Q 2XDPA 1WI7A 1GFCA 1B7TA 2X4YA 1Y7XA 3JV3A 3ZBDA 1Y96B 3OYEA 3A8HB 2M0YA 1LVKA 4M78C 1WPYA 1QP3A 2CP6A 1FMVA 3O8VA 1NE8A 1ZA2B 4EPCA 2LQKA 2HNIA 2VB6A 1VQLA 4M78A 1M9SA 4FSSA 1VYVA 3VRYA 1RAFB 1RL2A 2OTJT 1JO8A 2KVQG 2KRNA 1W70A 2DEUA 4J9DA 5D6XA 1IHVA 4Z89A 4PJOG 2CS7A 2RA2A 4KH1B 5CKBA 3SDZA 1QLYA 4ELYC 2FHDA 1WXTA 2RK1A 2L3QA 3TU4K 5A0GA 1QW1A 2DM1A 3S6WA 2BTTA 2CZ0B 2RQVA 1TXQA 2F2XA 2ZAEA 2EKOA 2E3HA 4M7DF 3MKDA 1VQKA 5GAOn 2J05A 2P0QA 4BE1A 3J80E 5EG2A
chains in the Genus database with same CATH topology
1WHMA 2E4HA 2COZA 2COWA 2HQHA 1WHHA 1WHKA 1WHJA 2CP5A 2CP3A 2E3IA 3RDVA 1TOVA 2COYA 2CP6A 1LPLA 3E2UA 2HL3A 3TQ7P 2MPXC 2QK0A 1TXQA 2E3HA 2CP7A 1WHGA 2HL5C 4B6MA 1IXDA 1WHLA 2M02A 2Z0WA 2CP2A 2HKQB 2CP0A 2HKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHM A;  2E4H A;  2COZ A;  2COW A;  2HQH A;  1WHH A;  1WHK A;  1WHJ A;  2CP5 A;  2CP3 A;  2E3I A;  3RDV A;  1TOV A;  2COY A;  2CP6 A;  1LPL A;  3E2U A;  2HL3 A;  3TQ7 P;  2MPX C;  2QK0 A;  1TXQ A;  2E3H A;  2CP7 A;  1WHG A;  2HL5 C;  4B6M A;  1IXD A;  1WHL A;  2M02 A;  2Z0W A;  2CP2 A;  2HKQ B;  2CP0 A;  2HKN A; 
#chains in the Genus database with same CATH topology
 2K57 A;  3LWH A;  4BAC A;  3CCQ A;  4LNP A;  3GIB A;  1RAB B;  5GAO p;  2FL7 A;  4M7D E;  3MEA A;  2JM9 A;  4EMG A;  1VQ8 Q;  3SEM A;  3OMG A;  1TG0 A;  3KXT A;  4QT7 A;  1KD1 R;  3UF4 A;  2RB6 A;  3VU3 C;  4FW1 A;  1C0M A;  1SSF A;  1PSE A;  4LE9 A;  1M30 A;  1BB9 A;  1QVG A;  2RI3 A;  1HD3 A;  5GAN g;  1G3T A;  1G5V A;  4ORZ A;  1Q86 R;  4L5G A;  3DLM A;  5CQY A;  3VUB A;  2JS2 A;  3OYY A;  2LRQ A;  2J7I A;  4OML A;  4F04 B;  3VS4 A;  3SHW A;  2KR3 A;  3OYK A;  4M4Z A;  4M7A A;  2GQV A;  4DQ2 A;  4FYV B;  2H8H A;  2EYW A;  2L8D A;  2AHJ B;  5GAM e;  5LJ3 e;  1H92 A;  1YJW Q;  4E7H A;  4OMN A;  2YXY A;  2PZ1 A;  1H64 1;  3CBM A;  1RI0 A;  2DBK A;  2HDA A;  4JS5 A;  3TCJ A;  3CC4 T;  2HZY A;  5EC7 A;  3CCJ T;  5M9O A;  1VQK T;  1W2B P;  2HBP A;  4Y28 E;  3PE0 A;  3UPU A;  1K73 C;  1M1F A;  1IZ6 A;  4ATO A;  1VQ4 Q;  4KT0 E;  1G3S A;  1RLP C;  4PFZ A;  3V8J A;  1VQ5 A;  2A36 A;  3ZL7 C;  3S3O A;  2LT1 A;  1K1Z A;  1D1B A;  3HKS A;  4XK8 E;  1YJN A;  2QTX A;  2ZPG B;  2RI5 A;  1I07 A;  1G3Y A;  3F70 A;  1JXO A;  3M0S A;  3L2Z A;  3P8B B;  3MP8 A;  3VYG A;  5CAI A;  1EX4 A;  4J8O A;  3QZ9 B;  5D6Y A;  3I55 A;  3RUX A;  4IIO A;  3CC7 T;  2ZPI B;  1NM7 A;  4M7D B;  2L0A A;  4RTV A;  1X2K A;  3V7R A;  3CPW P;  2ESW A;  4FL6 A;  3CC2 Q;  4BI4 A;  5IAY A;  2XD0 A;  1U8R A;  2BIV A;  4RG8 A;  2JXB A;  1YJN Q;  1RAG B;  1UTI A;  3M59 A;  3VKI A;  4PFO A;  2GNC A;  1HK9 A;  3OYL A;  3CCJ Q;  1U1S A;  4JRK A;  3CC4 Q;  2X3W D;  4VUB A;  2M16 A;  3ER0 A;  1ZSG A;  3D7S B;  3E2U A;  4RUG A;  1BCO A;  2MCN A;  4JLI A;  4L59 A;  4Q5W A;  3UT1 A;  4F7U F;  1WHG A;  1PD1 A;  2XI9 A;  3INZ A;  4E7I A;  4CC7 A;  3E9F A;  1YIJ T;  1ARK A;  1QKW A;  2YDL A;  3QUI A;  5LJ5 f;  3RKX A;  1N9S A;  5FU7 B;  2J6K A;  1VQN Q;  5KYX A;  2GTO A;  3HL8 A;  5DY9 A;  3FIF A;  1TWB A;  2DTI A;  2M1H A;  4MDX A;  3CME T;  1SEM A;  1GXI E;  2MIO A;  1UHC A;  4JS4 A;  4BUG A;  3M4Y A;  4OB0 B;  2AZV A;  2ROL A;  1UEB A;  1JXM A;  3WVE B;  3ZEH A;  4XTY A;  3I56 Q;  4LD6 A;  3BE3 A;  3EH2 A;  1Y0M A;  1K76 A;  2OI3 A;  5GAN 3;  4Z02 A;  2WAC A;  1KQS S;  4M75 A;  4NS5 A;  1WYX A;  3CCJ A;  1YWP A;  3JCM b;  1JB0 E;  1QKX A;  2F5T X;  2DO3 A;  2QEX T;  2P0K A;  4AFS C;  3RMS A;  3GPL A;  5DM7 R;  1OUL A;  1Z9Q A;  1KD1 C;  4LUD A;  3CCQ Q;  2OTJ Q;  2RH2 A;  4KGZ B;  4M78 F;  4E6R A;  3A5Z B;  4XTV A;  1A0N B;  4JUV A;  2CP7 A;  4A63 B;  2XHC A;  5GAN j;  2DX1 A;  2R5M A;  1QCF A;  3CCL Q;  2IPO B;  1C1A A;  1UGP B;  4C8Q F;  3ULR B;  5GAN e;  4M7A G;  3OS2 A;  2OTL A;  1VQ5 T;  2VYT A;  2X3X D;  2DPP B;  1OU8 A;  1TUG B;  3H9N A;  2VXF A;  4J6Y A;  2ZPB B;  3OSS C;  2EGC A;  3A8O B;  1MUZ A;  1XJW B;  3M0P A;  4ME7 A;  4PKC C;  1GCP A;  3VS1 A;  3OYI A;  5GAM f;  1UDL A;  1WXU A;  4XTZ A;  5L8R E;  3VS2 A;  3OS5 A;  1OI1 A;  4C5E A;  1VQO T;  3G71 A;  3DKM A;  2LJ3 A;  1U5S A;  3MEV A;  3REA B;  4A53 A;  1LPL A;  3M57 A;  3JCM J;  1RLQ C;  1MGQ A;  2LTO A;  5ECA A;  3EG0 A;  1VQM Q;  2K5L A;  2XIC A;  5HKC A;  2EQI A;  5CKD A;  1D09 B;  4C92 D;  2NLU A;  2W0Z A;  4PJL A;  1RI9 A;  3THK A;  4A4F A;  4OMQ A;  2ZPE B;  2RHI A;  5GAN 8;  1OV3 A;  4NL2 A;  4OF1 A;  1QVG S;  1VQM T;  1M90 U;  4UC4 A;  2RMO A;  1IGQ A;  2ZPH B;  4JDS A;  2RHX A;  2CH4 A;  1ZUY A;  2HL5 C;  1Q7Y C;  3L42 A;  2DIQ A;  5GAM g;  4J9F A;  1PHT A;  4ZN3 A;  3OYC A;  3OYM A;  1KC8 C;  2EJG A;  1T3S A;  4IUP A;  1VQ4 T;  1V29 B;  3CME A;  2XG8 D;  4LXC A;  2AIR B;  5GMK h;  4RCB A;  2O9S A;  2JW4 A;  1RAD B;  1X69 A;  4JPB W;  3OA6 A;  2WSC E;  1QVF P;  3CBP A;  3H0F A;  2R57 A;  1UB4 A;  1HSQ A;  1C6V X;  3OS1 A;  3JCM e;  1OPK A;  1WHK A;  1VQP A;  2F5K A;  3JCM W;  3QDR B;  1I5O B;  2D8J A;  4PJO A;  1KQ2 A;  4GBQ A;  1Y96 A;  4M77 E;  3BW1 A;  3MEW A;  4GY5 A;  3QZ5 B;  2VUB A;  4RG2 A;  2KXD A;  3DB3 A;  3O5Z A;  1IRX A;  1OU9 A;  4JJN K;  1YCS B;  4C92 B;  5KYX B;  1K9M R;  2EVR A;  4M77 C;  2QEX A;  3M53 A;  2ECZ A;  2HQH A;  1AWJ A;  2RI2 A;  4OMM A;  3HHT B;  1G83 A;  3G6E T;  1JRI A;  2FZC B;  3GF5 A;  2KYB A;  2QYZ A;  3PTA A;  4IUQ A;  4JLG A;  1NYF A;  2P0P A;  5LJ5 g;  1LNX A;  3SD4 A;  1QWF A;  7AT1 B;  1KFZ A;  4Z88 A;  1VQ5 Q;  2DF6 A;  1LOJ A;  4CC2 A;  4GLM A;  1KC8 U;  4E7Z A;  1VQ6 Q;  4QVD A;  3JB9 F;  3ASK A;  4PLL A;  1WHH A;  3KUF A;  3JCM Q;  2CYZ B;  1M8M A;  1T3L A;  1UGV A;  4XU0 A;  3I9Q A;  1KK7 A;  2V1R A;  2X51 A;  4RTY A;  1MMD A;  4F7U B;  3OQ5 A;  1K0S A;  4XAX B;  1M4Z A;  4AT1 B;  2O88 A;  4M78 D;  4RTW A;  5FU7 C;  2QG9 B;  5C0M A;  2LP5 A;  3MEU A;  4MZP A;  1VQN T;  8ATC B;  2R58 A;  4BI8 B;  2QQB A;  1VQ7 Q;  4C8Q D;  4PJO E;  4PFP A;  4J6W A;  4O5V A;  4QQG A;  5LJ5 e;  2EQJ A;  1NLP C;  2DA9 A;  2L3R A;  4CC3 A;  2LJ0 A;  1K8A U;  1CKA A;  5CO7 A;  3JCM h;  4Y92 A;  1VQM A;  1KQS P;  4AFQ C;  3G6E Q;  2OTL Q;  2QAS A;  1ZSZ C;  2HKQ B;  4BDZ A;  3I5S A;  2AZS A;  1BU1 A;  1S72 A;  2DL8 A;  1M1K C;  4AFU C;  3T9N A;  2QQR A;  1AVZ C;  2HL3 A;  1VQ6 A;  1RUW A;  2NUT B;  4JRQ A;  3G4S T;  1WQ7 A;  4C92 E;  2PQW A;  1AEY A;  1WHL A;  3QJ6 A;  1T0J A;  1I4K 1;  3C12 A;  5IXF A;  1K9M C;  5CR2 A;  2C0O A;  2EPD A;  5LL6 S;  2NUP A;  2K3X A;  3H0H A;  2E70 A;  5AYF A;  5LJ3 f;  4BD3 A;  1GBR A;  4M7A D;  2AT1 B;  3EHQ A;  5FWB A;  2PU9 B;  3J81 E;  2P84 A;  4CRI A;  4KH0 B;  3G7Z A;  1WQW A;  2EKH A;  3V8L A;  1YJ9 T;  4DOW A;  2A37 A;  5A0L A;  2ZPF B;  1N8R C;  2DAQ A;  1VQP T;  1B3Q A;  1TUD A;  1NYG A;  2JMC A;  1YP5 A;  3UA6 A;  1WDX A;  1SF9 A;  1OPL A;  4M75 D;  2EIF A;  1BIA A;  2C0T A;  2EJ9 A;  2K3Y A;  3QG1 A;  1KHC A;  2CUB A;  2ZCF B;  3CQT A;  5GAN 7;  1ZBX A;  4QQD A;  3LWI A;  2O4X A;  3TSZ A;  1PKS A;  1ZSZ A;  3CCS T;  4J9C A;  5CKH A;  4X9D A;  1IO6 A;  2K9G A;  4M75 E;  4C5G A;  5GMK j;  2J6F A;  2NUT A;  1VIF A;  2VWF A;  2D8H A;  2DVE A;  1OOT A;  4HA8 A;  2L5Q A;  2DEQ A;  2LNH B;  3CPW S;  2BZY A;  2JNG A;  4IKF A;  2JUF A;  2DXT A;  1W6X A;  4FT2 A;  2K2V A;  2QDY B;  1M1G A;  5GJW B;  4KUI A;  2LQ8 A;  4M7A B;  1K9M U;  1VQN A;  2HQE A;  4FU6 A;  2MI6 A;  2OJ2 A;  1VQK Q;  2E6Z A;  1GRI A;  3RKY A;  5I2S A;  4JZ3 A;  2CUD A;  3CCQ T;  2XDB A;  3H41 A;  3JCM g;  3HRU A;  2B86 A;  2I2L A;  1ABQ A;  3KFV A;  1XQH A;  4LN2 A;  4PJO F;  2QEX Q;  3QWY A;  3A8L B;  2L2P A;  3OSV A;  5HY6 A;  3LH5 A;  1D0Y A;  3EGD B;  1PNJ A;  4M7D C;  4E7L A;  1X6O A;  2HKN A;  4Y91 A;  2RD1 A;  1DJ7 B;  2KYM A;  1VQ7 T;  1PD0 A;  1E6G A;  2COY A;  3X20 B;  3CMA T;  4KUD K;  4J9I A;  4F7U A;  3AHU A;  3X25 B;  2GF7 A;  1Q82 U;  4JRI A;  5KYY B;  1FMW A;  2L89 A;  2M02 A;  4M78 B;  1Q81 C;  4FCY A;  4J6X A;  2DD4 A;  1M2V B;  4MDW A;  1MNE A;  2DRK A;  2O31 A;  3OYG A;  2H3E B;  3QPH A;  1S72 T;  3NPF A;  2V8I A;  4BB7 A;  1M3C A;  4C8Q B;  1K73 U;  5GAM j;  2KT8 A;  4AFZ C;  1KJW A;  3EG2 A;  4OGE A;  4A4E A;  1D3B A;  1UUE A;  2BE9 B;  3OYB A;  3OYN A;  4KGV B;  1BI3 A;  4EIK A;  2GCX A;  2PNI A;  2KY9 A;  4E2F B;  3JCM d;  3OS0 A;  3VYH B;  2EQU A;  1UG1 A;  2YRV A;  1YJN T;  2CT3 A;  1YN8 A;  2K5I A;  1M2V A;  4JJC A;  1WZO A;  2YUO A;  9ATC B;  3CD6 A;  3FB9 A;  4RKU E;  1W4S A;  1W2B A;  4FYX B;  3EH1 A;  1WJR A;  1MMN A;  1KG1 A;  5GAN 2;  5FW9 A;  2NYS A;  2O01 E;  3HFO A;  4KRT A;  3I55 T;  5A2Q E;  3J7A F;  4LDY A;  2E6N A;  3SB2 A;  4DBH A;  4BY6 B;  2KDS A;  4RTU A;  2RJD A;  2FG0 A;  4B6M A;  2EQM A;  2DL7 A;  5KYU B;  4J9B A;  2EJF A;  2A7Y A;  1VIE A;  2DIL A;  1S1N A;  4F7U E;  4OB2 B;  4HXJ A;  3CCS A;  1FXX A;  5FRM A;  3QKJ A;  2FZK B;  2JTE A;  2DLP A;  3HPW A;  3OMC A;  4BY6 C;  1HXD A;  1VOM A;  1BI0 A;  1UJ0 A;  4PJM A;  1M5Q 1;  2RQT A;  2PVG B;  2KQW A;  4IUU A;  4PJO D;  5J39 A;  1RAA B;  2EQK A;  4C0G A;  4YTL A;  4WTO B;  2ED1 A;  2DJZ A;  3SWN B;  1YIJ A;  2COZ A;  1M1K R;  2X4W A;  2DFU A;  4AMC A;  5CK9 A;  1AZG B;  4LDU A;  5GMK e;  3E1S A;  4B9W A;  2MOX A;  4HVW A;  2XID A;  1TUC A;  4E7K A;  3QSU A;  1QMC A;  4RCC A;  4DEX A;  3KBG A;  4PNO A;  2JTF A;  2EAY A;  2VVK A;  2GFA A;  5GAN 6;  4QW2 A;  5IHI A;  1Y57 A;  5FRO A;  3CC2 A;  2DNU A;  4ZTJ A;  2LMJ A;  3G4S Q;  1X43 A;  2DZ9 A;  1ZHI A;  3I56 A;  3HSB A;  1AZE A;  2PVO B;  3M9Q A;  2JVV A;  3RES A;  1IRE B;  3C4S A;  4IUR A;  3EFO B;  1IB8 A;  2DL4 A;  2VGM A;  5HK3 A;  1IGU A;  5KCO A;  4ZN1 A;  1BI2 A;  2A28 A;  1EZZ B;  2F1L A;  2BUD A;  2MMP A;  2OX7 A;  2DL5 A;  1H8K A;  1QCO A;  2Z0W A;  1WHM A;  1PKT A;  3EFR A;  3A1P A;  1QVF S;  2QA4 A;  2DXB A;  3TSW A;  4M75 C;  1LCK A;  2NUP B;  2W10 A;  4DOV A;  1I8F A;  5GAM h;  3PIO A;  4LD9 K;  2LCS A;  3GNF B;  1N9R A;  2KXC A;  2PUK B;  2SEM A;  1SPK A;  2H3J A;  1VQO Q;  1YCY A;  1O9S A;  5J26 A;  5KYN A;  1K8A C;  1G3W A;  4HCB A;  1YNZ A;  3CD6 T;  2YRC A;  1ZUK A;  4N0A A;  5HK0 A;  3URG A;  3LYI A;  2LNV A;  2E5K A;  3MO8 A;  8AT1 B;  1PM3 A;  2DYI A;  3C94 A;  1YIT A;  4J9E A;  4D8K A;  5DLO A;  3SFM A;  3MP6 A;  5D6W A;  2RPN A;  2V8J A;  2VKN A;  2QGG A;  3Q1J A;  1VQ9 A;  2XK0 A;  1NJI R;  2YT6 A;  3L1A A;  3VS0 A;  3NTH A;  3U23 A;  4DBF A;  3CCL T;  3NFC A;  2M9U A;  4M7D G;  1KQ1 A;  2EGE A;  4OMF B;  1JBM A;  1PRL C;  3V7S A;  1YHQ A;  4OGC A;  3LH0 A;  4RTT A;  4JZ4 A;  1NJI U;  3C0C A;  1OQK A;  1PWT A;  1NEB A;  2A3L A;  2YHT A;  3EGX B;  1WJS A;  4XTX A;  1NG2 A;  3PMI A;  4C8Q G;  2FB7 A;  4RTZ A;  3M56 A;  3PGG A;  4ZGD B;  2BZ8 A;  2RHU A;  2DTH A;  5FRN A;  3REB B;  1HJD A;  5GMK m;  4EMH A;  4IUT A;  1M8V A;  2FYK A;  4XU3 A;  3M0T A;  5I21 A;  1BBZ A;  1VA7 A;  4ESR A;  5GMK i;  4C8Q C;  3L2R A;  2DVJ A;  5LJ3 g;  3M5A A;  3CME Q;  3LGL A;  3RER A;  3JB9 I;  4ZTF A;  1OYX A;  2K3B A;  1G8X A;  2ROT A;  2CP5 A;  1ABO A;  3CD6 Q;  4PJN A;  4KBM B;  2CDT A;  4FT4 A;  2L3S A;  4A54 A;  3HTR A;  2DXU A;  4M77 F;  2RQW A;  3CC2 T;  4ANJ A;  2Y90 A;  4DBQ A;  4HKE A;  5LJ3 d;  1YIT Q;  4C5H A;  1I81 A;  3SWN C;  4BE0 A;  4ZGE B;  2E1H A;  1FMK A;  2QA4 T;  4J7I A;  2RHZ A;  1N8R R;  3NHN A;  1GBQ A;  2O2O A;  1U3O A;  1VQL Q;  3OBW A;  4N4H A;  4XQ3 A;  3A8M B;  3JB9 H;  1R0B G;  1UE9 A;  2D0N A;  2X9H A;  3CPW A;  3L2W A;  4XTU A;  4A4H A;  1YI2 Q;  1WLP B;  2DD5 A;  2CP3 A;  2PUO B;  4DEY A;  2K4Y A;  2BKD N;  2DJQ A;  1Q82 C;  1B34 A;  2E10 A;  2AKK A;  2KI7 A;  4BDY A;  1KC8 R;  3FDR A;  2R5A A;  4PK4 A;  3QXE B;  3AT1 B;  2DRM A;  2PVD B;  1UGQ B;  1AHJ B;  2FPF A;  4HVV A;  1OX9 A;  1Q86 U;  3QII A;  4AG2 C;  1GL5 A;  2E12 A;  5GAN 4;  3HRT A;  2KBT A;  2LDM A;  2DBM A;  3G4S A;  1T0H A;  2YLC A;  2CZ6 B;  1PCX A;  4FW2 A;  2DYB A;  1Q7Y U;  2ATC B;  4HT9 A;  4QQ6 A;  1MMA A;  1K9A A;  1VQP Q;  4F17 A;  3RMQ A;  2KGT A;  3VS6 A;  3HRS A;  1ZBJ A;  3OW2 P;  3EG9 A;  1QVP A;  1V1C A;  1Z9Z A;  1HYO A;  1SKU B;  1YI2 A;  3LW5 E;  2MYS A;  1BIB A;  1WFW A;  2J6O A;  3CCM T;  4EMK C;  5LJ5 h;  1Q82 R;  2HAX A;  2WSE E;  1ACM B;  2FRY A;  3QJY A;  4LDX A;  1WNL A;  2YSQ A;  1YJ9 A;  1Q7Y R;  2OAU A;  1N8R U;  3EG9 B;  2MF2 A;  2LQN A;  2QDL A;  4C92 F;  3VUZ A;  4FYY B;  1AD5 A;  2SRC A;  5KH6 A;  3E19 A;  3EG3 A;  1WA7 A;  1YJW A;  4D8D A;  1PSF A;  2OAW A;  1OX8 A;  3UA7 A;  3VV0 A;  4M75 G;  2K7A A;  2X35 A;  4K11 A;  2QK0 A;  4LUE A;  3CCV A;  2LZ6 B;  4XU1 A;  4MZM A;  1M90 R;  2FEI A;  1RAC B;  3TRE A;  3I35 A;  1QCN A;  2OTL T;  3PMT A;  1WHJ A;  1R0C B;  3EGU A;  5GAN 5;  2YRD A;  1VQ8 T;  2DET A;  4QVC A;  1LJO A;  3VJP A;  4A4G A;  1VQ6 T;  2D0Q B;  1KSW A;  5L23 A;  1O75 A;  3M0Q A;  3PFS A;  4DA4 A;  3UAT A;  6AT1 B;  2MAM A;  3PIP A;  2KMT A;  5KCH A;  2P4T A;  4FSX A;  2FVU A;  5KYY A;  3FLG A;  4A4K A;  2B8A A;  2RJE A;  2CP0 A;  2F69 A;  2FRW A;  5GAN h;  2YWW A;  3CCM Q;  3M0U A;  4JJB A;  1IHW A;  2X4J A;  3OY9 A;  4J9G A;  4M77 G;  3JCM V;  5CKE A;  5LJ3 j;  2QQA A;  5I11 A;  4WF2 A;  2CSQ A;  1UJY A;  2JS0 A;  1M3A A;  2QXF A;  3TEE A;  1B07 A;  3CCE T;  1SRL A;  4C92 G;  2COW A;  1Q81 R;  3M55 A;  4RMO A;  2MWO A;  1YBY A;  3CCS Q;  1D3B B;  2A08 A;  3H0I A;  2CZ7 B;  2HD0 A;  5LJ3 h;  4R0K A;  3A98 A;  4F16 A;  1P92 A;  2AK5 A;  3WXM B;  2EYZ A;  4C92 C;  3CCU T;  1KHI A;  2IVW A;  2LCC A;  3EG1 A;  1J3T A;  1MV3 A;  3PVQ A;  4PJO C;  1X6G A;  1WJQ A;  4Z8A A;  5IT9 E;  4EDU A;  1YI2 T;  2GTJ A;  2KSS A;  1ZSZ B;  3I5R A;  2HBW A;  2JN0 A;  4FM4 B;  3UDC A;  4II1 A;  1VQL T;  3G71 Q;  4C5I A;  4JRP A;  3RKW A;  1V76 A;  1AWX A;  3CCR Q;  2NUZ A;  2CKK A;  2KT1 A;  3CCV Q;  3NTK A;  1ZA1 B;  1VQ7 A;  3VRZ A;  5FWC A;  1YJW T;  1H3H A;  4KGX B;  1OZ2 A;  2ABL A;  3CMA A;  1VYT A;  2KRO A;  1QVF A;  1WXB A;  2A0F B;  3CCE A;  1F1B B;  1JU5 C;  3MJX A;  4RTX A;  2LCL A;  4X1V A;  3FJP A;  4BE2 A;  5GAO m;  2EBP A;  1GFD A;  3P8H A;  4NOY A;  5GAO r;  2L3P A;  2VXE A;  4QVZ A;  5GAO q;  4HT8 A;  3BFM A;  2HSP A;  3OYF A;  2RN8 A;  2KAF A;  2KNB B;  4M78 G;  4C0D C;  3OYJ A;  1NPR A;  2JMA A;  4LDW A;  5CCA A;  4IUV A;  2HQX A;  4E47 A;  2QQS A;  3TVT A;  1AOJ A;  3QWX X;  1RAH B;  4D6W A;  3DB4 A;  2BZX A;  5FU6 B;  4M7A F;  3H6Z A;  2YUP A;  1QWE A;  3WVD B;  4JJD A;  4C0D B;  5C6S A;  1JJ2 A;  3FRN A;  1ZX6 A;  2CT4 A;  3JB9 G;  5AT1 B;  3FEO A;  4M7D A;  3EAE A;  3JCM c;  1Q81 U;  1I1J A;  3M54 A;  2LT4 A;  2KRM A;  1Y71 A;  2ZZD A;  2E4H A;  3BY7 A;  4KUL A;  2K79 A;  2CRE A;  1OZ3 A;  2RM4 A;  1MHN A;  3A8G B;  2QTV A;  4CC4 B;  5GAO l;  2YUQ A;  1PG5 B;  2KE9 A;  3GLX A;  2EWN A;  4M7A C;  2GGR A;  1PC0 A;  1R77 A;  3RBB B;  3QDF A;  3HFN A;  3DLL A;  2WSF E;  3H8Z A;  3QYG B;  1RAE B;  3JRZ A;  1UGR B;  1NEG A;  3CCR A;  1OEB A;  3I56 T;  2M51 A;  2MK5 A;  2LX9 A;  2RQR A;  5DLQ E;  1MMG A;  1JEG A;  1S72 Q;  3P8D A;  1KIK A;  5CQX A;  1BK2 A;  3NGP A;  4IIM A;  4MML A;  1X75 C;  2GBQ A;  4J9H A;  4B9X A;  3LX7 A;  1KD1 U;  4OB1 B;  4F14 A;  3GBQ A;  5GAM d;  3CC4 A;  3SWN A;  2EFI A;  3NMZ C;  1WX6 A;  1FX7 A;  2ED0 A;  2MWP A;  5LJ5 j;  3QYH B;  3CMA Q;  3JCM f;  1Y07 A;  2K6D A;  3OYD A;  4M77 B;  3IQL A;  2JM8 A;  3QO3 A;  4N4I A;  5LJ5 d;  2GQI A;  1WGS A;  2RHY A;  3EFO A;  4R55 A;  3X28 B;  2XU8 A;  2K2M A;  4EMK B;  2YLB A;  3CCL A;  4C8Q A;  1BI1 A;  2JT4 A;  2PTK A;  2F2W A;  1D0X A;  2RJC A;  2EW3 A;  2XMF A;  3CC7 A;  3R6O A;  1JJ2 S;  2V8K A;  4ZNX A;  1YFN A;  4M7A E;  5KE2 A;  3ZFJ A;  2ZGW A;  4OVA A;  1FYN A;  5CKF A;  1YIJ Q;  4AG1 C;  5D7U A;  1TU0 B;  3CC7 Q;  1FWZ A;  1I0C A;  2VAS A;  2FPE A;  3EFS A;  4M75 F;  2CGH A;  3X26 B;  3CBO A;  4C0F A;  1YHQ Q;  3EGD A;  4PLI A;  2VGN A;  2DZC A;  1GCQ A;  2G6F X;  1BCM A;  2FO0 A;  5IXB A;  2RQU A;  2HMA A;  1YWO A;  4PL6 A;  2DK3 A;  1I5L A;  3MET A;  5KYU A;  1VQ9 Q;  4TVR A;  2IG0 A;  2G3R A;  3E9G A;  1XNI A;  1R8O B;  3RDV A;  5J3B A;  1UFF A;  4MMK A;  1M27 C;  2X4X A;  1W1F A;  4M77 A;  1CSK A;  2JOY A;  4XU2 A;  5HCK A;  3OW2 S;  5CVI A;  4PJO B;  2DKG A;  3PVL A;  2AKL A;  1GCQ C;  4N4G A;  3CCR T;  4R56 A;  3M4G A;  2LX7 A;  3BDU A;  4ZGJ B;  1BKB A;  1YIT T;  2GFU A;  3G71 T;  4OMP A;  5I2M A;  1M1K U;  4L6V 5;  1SRM A;  4OB3 B;  1QP2 A;  1QQJ A;  3TQ7 P;  3EGX A;  3CCE Q;  4NL3 A;  3EHR A;  3JCM P;  1VQ9 T;  5IHK A;  3LLR A;  2CP2 A;  3OBY A;  4HCZ A;  1VUB A;  4EMK A;  1XOV A;  2D1X A;  5KYW B;  3PNW C;  2HCK A;  1YHQ T;  3GNG A;  2E3I A;  5GJV B;  3CXC A;  5I22 A;  3CCU Q;  2EYQ A;  2J06 A;  2E41 A;  4M77 D;  1M2O A;  3NTI A;  2D6F A;  4OMO A;  3PT9 A;  1U06 A;  2M0O A;  1IXD A;  1N6A A;  2E64 A;  3I55 Q;  2C06 A;  3MCA B;  3N5B B;  3OW2 A;  2DTO A;  2E5Q A;  4O6J A;  1XTD A;  1B34 B;  1RAI B;  1EFN A;  2KRS A;  4MZT A;  3V8K A;  3JAM E;  2JTM A;  3MHX A;  4GLK A;  3X24 B;  1SHG A;  3CXC S;  1N5Z A;  1X6B A;  3G1J A;  1X2Q A;  4X34 A;  2VV5 A;  2CH4 W;  2CSI A;  1NJI C;  1E6H A;  2KEA A;  4CI0 C;  3JB9 J;  1VQ4 A;  1G2B A;  4M75 B;  1TH7 A;  5A0D A;  1M90 C;  4HCK A;  1JQQ A;  4QKU A;  1TS9 A;  4X9C A;  2HEQ A;  4FIB A;  2QQ9 A;  2EGA A;  1VQO A;  3S3M A;  3VS3 A;  1TOV A;  4PJJ A;  1CKB A;  3QHS A;  2NWM A;  3FC3 A;  1D1A A;  3RNJ A;  3L2Q A;  2DMO A;  4XTW A;  3C95 A;  1K8A R;  1E7O A;  5GMK l;  3L2V A;  3VS5 A;  1D1C A;  2JZ2 A;  1TSF A;  2DXC A;  2F2V A;  1K73 R;  1WIE A;  1UEC A;  2QI2 A;  5IN1 A;  1U1T A;  2EYX A;  2XKO C;  1UHF A;  2VC8 A;  4FYW B;  5FU6 C;  2P4R A;  2RF0 A;  4OP0 A;  1UGS B;  3RIR A;  2BE7 D;  1M3B A;  1D0Z A;  4C0Z A;  3GOX A;  4V2S A;  2LVM A;  4ELZ C;  5GAN f;  2O4X B;  1AWO A;  2CZ1 B;  1PRM C;  4J7F A;  3LGF A;  5GAN d;  4BI3 A;  3MP1 A;  2ENM A;  3VS7 A;  2QGF B;  2KK4 A;  2DIG A;  5KE3 A;  1ZLM A;  2I0N A;  3BDL A;  2RJF A;  3S3N A;  1VQ8 A;  2Y4Y A;  4M7D D;  2XDD A;  4HVU A;  4F7U G;  1TTH B;  2LQW A;  2D9T A;  1ZUU A;  3M0R A;  1SHF A;  1Q86 C;  4P5N A;  1QVG P;  4E7S A;  2DL3 A;  1K4U S;  3JSC A;  1SG5 A;  5IH2 A;  1JJ2 P;  2V1Q A;  3ME9 A;  2V26 A;  4M78 E;  1AWW A;  5FLX E;  3OYH A;  1W2B S;  2DER A;  2E65 A;  2RO0 A;  1X01 A;  2FPD A;  4J83 A;  5KYW A;  1X27 A;  3HP9 A;  4C92 A;  3M58 A;  1KQS A;  4C8Q E;  1N27 A;  1YJ9 Q;  5CIU A;  2HSE B;  2O9V A;  3JCM X;  3QBY A;  2MPX C;  1SSH A;  4J5Y A;  3OB9 A;  2K5F A;  4E7J A;  2Y4X A;  3UWN A;  2OTJ A;  3FJ5 A;  3CCM A;  3RR6 A;  3L2U A;  2C0I A;  3MPU B;  2RK2 A;  1ZQ1 A;  1BYM A;  1H3Z A;  2DE0 X;  3GP8 A;  3OYA A;  1Q95 G;  1EIF A;  2LC4 A;  1NZ9 A;  4LDV A;  3V7C A;  2RNA A;  2JJ9 A;  1NLO C;  2QAZ A;  3G6E A;  2IIM A;  2LJ1 A;  3R6N A;  4HCC A;  3JB9 D;  4DBR A;  1AT1 B;  2EYY A;  3CEY A;  1VYU A;  1NPP A;  1MND A;  5IHN A;  3CCU A;  3CCV T;  3CPF A;  4N0A C;  2YUN A;  3CXC P;  1NBE B;  1MV0 B;  4WCI A;  1K0X A;  2FZG B;  2QA4 Q;  2XDP A;  1WI7 A;  1GFC A;  1B7T A;  2X4Y A;  1Y7X A;  3JV3 A;  3ZBD A;  1Y96 B;  3OYE A;  3A8H B;  2M0Y A;  1LVK A;  4M78 C;  1WPY A;  1QP3 A;  2CP6 A;  1FMV A;  3O8V A;  1NE8 A;  1ZA2 B;  4EPC A;  2LQK A;  2HNI A;  2VB6 A;  1VQL A;  4M78 A;  1M9S A;  4FSS A;  1VYV A;  3VRY A;  1RAF B;  1RL2 A;  2OTJ T;  1JO8 A;  2KVQ G;  2KRN A;  1W70 A;  2DEU A;  4J9D A;  5D6X A;  1IHV A;  4Z89 A;  4PJO G;  2CS7 A;  2RA2 A;  4KH1 B;  5CKB A;  3SDZ A;  1QLY A;  4ELY C;  2FHD A;  1WXT A;  2RK1 A;  2L3Q A;  3TU4 K;  5A0G A;  1QW1 A;  2DM1 A;  3S6W A;  2BTT A;  2CZ0 B;  2RQV A;  1TXQ A;  2F2X A;  2ZAE A;  2EKO A;  2E3H A;  4M7D F;  3MKD A;  1VQK A;  5GAO n;  2J05 A;  2P0Q A;  4BE1 A;  3J80 E;  5EG2 A; 
#chains in the Genus database with same CATH homology
 1WHM A;  2E4H A;  2COZ A;  2COW A;  2HQH A;  1WHH A;  1WHK A;  1WHJ A;  2CP5 A;  2CP3 A;  2E3I A;  3RDV A;  1TOV A;  2COY A;  2CP6 A;  1LPL A;  3E2U A;  2HL3 A;  3TQ7 P;  2MPX C;  2QK0 A;  1TXQ A;  2E3H A;  2CP7 A;  1WHG A;  2HL5 C;  4B6M A;  1IXD A;  1WHL A;  2M02 A;  2Z0W A;  2CP2 A;  2HKQ B;  2CP0 A;  2HKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...