1IXDA

Solution structure of the cap-gly domain from human cylindromatosis tomour-suppressor cyld
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
104
structure length
104
Chain Sequence
GSSGSSGLAMPPGNSHGLEVGSLAEVKENPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFASLQPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cylindromatosis tumour-suppressor CYLD
publication title The CAP-Gly domain of CYLD associates with the proline-rich sequence in NEMO/IKKgamma
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 8
structure length 104
sequence length 104
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1ixdA00
1WHJA 1WHLA 2E4HA 2CP5A 2COZA 1WHHA 2HL5C 2CP3A 3RDVA 1WHKA 2M02A 3TQ7P 3E2UA 2HL3A 1TOVA 2E3HA 1IXDA 2Z0WA 2CP0A 2CP6A 1WHMA 2COWA 2COYA 2CP2A 2QK0A 2E3IA 1TXQA 2MPXC 2HKQB 2CP7A 4B6MA 1WHGA 2HKNA 2HQHA 1LPLA
chains in the Genus database with same CATH superfamily
3JCMX 4IIMA 3BFMA 4ME7A 3CMAA 3MP1A 5GAOl 1KQSA 1TUGB 2LQKA 4J7FA 3PMTA 1SEMA 4M7DG 4J6YA 2DJZA 4PJOC 3JCMd 3HPWA 3HFNA 3TVTA 1Y57A 1E6HA 4X1VA 4X9DA 4F7UG 1K0SA 4HT9A 3UDCA 3CCQA 2AKLA 4XTXA 1WHJA 5GANf 2CP5A 2Y4XA 1YJWA 1WJQA 5D6XA 2XG8D 3QJ6A 3VUBA 3EFSA 1PD0A 1VQ7A 3JB9D 3O8VA 1M1KR 1KQ1A 3NGPA 1OI1A 3PT9A 4C8QB 1M8MA 2HEQA 2DMOA 5HCKA 2YHTA 2CREA 1K1ZA 1BI3A 2A3LA 2K2VA 4JPBW 2HNIA 5HKCA 3VJPA 3L2WA 3OW2A 2FPFA 3EHQA 2DL8A 3R6NA 3EGXA 3VRYA 1J3TA 4C92E 1RAEB 5GAN4 2K5FA 1NJIU 4M78D 2CT3A 3G4ST 4JJDA 1VQNA 1NJIC 3QXEB 2DL4A 3TSZA 3SWNC 1LPLA 2OJ2A 4E7LA 4IUTA 2RHZA 3G1JA 4KH1B 4X34A 5GANh 1SF9A 4DOWA 2WSCE 2KR3A 3EH2A 2ED0A 4M75A 1JXOA 2L3QA 3OMGA 2X4WA 1SRLA 3I56Q 3GP8A 2CS7A 2DIGA 2RM4A 5LJ5f 4M7DD 2KXDA 5CVIA 1ABQA 3I5RA 1FYNA 1WJSA 5FRNA 3CCLQ 2AKKA 2RQUA 4XU1A 2DRKA 4PFOA 5GJVB 1GBRA 5IHNA 5GMKe 1R0BG 1Y71A 5CKDA 4BACA 1SHGA 2ZPBB 4FIBA 1R0CB 1ABOA 2D9TA 2KQWA 4M7AB 2LCCA 3UT1A 3QHSA 4XTVA 4DOVA 4J9IA 4L6V5 2HMAA 5KYXB 1GXIE 5DY9A 1YITA 4JS5A 3CBOA 3IQLA 2E3HA 3EG3A 2VVKA 4CC7A 2M16A 3MEVA 3WXMB 4KBMB 4C92C 1I07A 3L42A 3C94A 1NLOC 4M78B 1ZSZC 2DF6A 4O6JA 1OEBA 4V2SA 5KYYB 1ACMB 1VQ9Q 1NLPC 2RB6A 4J9EA 3NMZC 3A8GB 1ZHIA 1RLPC 1M1KU 1TH7A 5DLOA 2BIVA 1M1KC 3JCMb 1YN8A 2DNUA 1ZBJA 2FVUA 3QBYA 4DBRA 2EYXA 4M75E 3CCRT 4M7AF 3CC4A 1WHLA 5GAOm 4PLIA 1H92A 1WX6A 5CKEA 4QVCA 1X01A 1B34B 4RTWA 3A1PA 4XTWA 3PNWC 2F5KA 5FROA 3QJYA 4HVWA 2YRDA 1CKBA 1N6AA 2KAFA 1C0MA 4LXCA 4ZN3A 1YIJA 1H3ZA 2WSFE 1HSQA 3CBPA 3HTRA 3S6WA 2HL5C 4FYWB 3JB9I 2DILA 5FWCA 1K9MR 3OYJA 4XTYA 1H8KA 5GMKh 4RUGA 3E19A 2W10A 1VA7A 2Z0WA 1QQJA 1QP3A 3LWHA 3CCJT 2DBMA 5LJ3j 1I4K1 1X6BA 2KMTA 4Z8AA 1BIAA 1VQ8Q 4F04B 2XMFA 2DYIA 4FYXB 3ZBDA 1Q7YR 4B9WA 3CCSA 4QT7A 2O88A 2QEXA 4XU0A 2GFAA 1K8AR 2KRNA 4WTOB 3QWXX 3RNJA 2BZYA 3MEWA 3UF4A 2EJGA 2V1QA 1Q82R 4FCYA 1QVFS 4FSSA 3CMEQ 4M75C 3M58A 1QKWA 1V29B 3CCMA 3M54A 3H8ZA 2MWOA 3RDVA 1WNLA 4Y28E 2HL3A 3VU3C 1QVPA 1AZGB 3EFOB 1KD1R 3JRZA 1YJ9A 2E65A 3CMAQ 3META 2K9GA 1JB0E 1GFDA 2JTEA 4FM4B 5GAOn 3MO8A 2L5QA 2EQJA 1QP2A 3HL8A 3GOXA 2EAYA 4PJOB 2EKOA 2LMJA 4R55A 1NPRA 4FSXA 2D6FA 1BI0A 3CCUT 3I35A 5DM7R 2PNIA 2A0FB 3SD4A 3CCQQ 3P8BB 5I2SA 3RIRA 1YJWQ 1QVFA 5LJ3e 4M77G 5A2QE 1EZZB 4ZGDB 2OTJT 2OTLT 1B3QA 1M3AA 1ZX6A 1NE8A 2DVEA 2ESWA 3CD6A 9ATCB 4F7UA 2NLUA 3KUFA 1OU8A 2LQNA 1IHWA 4HVUA 2RNAA 1PSFA 3L1AA 3JB9H 1EX4A 4R0KA 1QCNA 1LVKA 2NUTA 2QYZA 1D3BA 1BBZA 2C0OA 4RG8A 5CKHA 2GNCA 2QI2A 4PJOF 5GANd 3GPLA 1D0ZA 2HCKA 1WGSA 1OZ2A 2JN0A 4OB2B 4CC3A 5CO7A 3SWNB 3EGDB 4PFPA 1VQNQ 1R8OB 1KK7A 2EIFA 1X27A 2VV5A 5KCHA 3CXCS 1SKUB 3OA6A 3NTKA 5L23A 1EIFA 2O2OA 1M3CA 3VS6A 4BY6C 2F2XA 2QQRA 2AT1B 3OYHA 2E64A 1Q7YC 1IXDA 5GAN8 5I11A 1SSFA 1IGQA 4AFQC 2VC8A 1K8AU 1XJWB 3GIBA 1C6VX 3BE3A 1DJ7B 1G83A 3V8LA 4HA8A 4XQ3A 1K8AC 1BK2A 4BDYA 2E5KA 2EFIA 2O9SA 2RQWA 1Q82U 4C5EA 4XU3A 1YI2A 1Q82C 2RD1A 1WJRA 2K3YA 3M0QA 4JLIA 1NYGA 2LT1A 5CK9A 1K76A 1YHQT 3QSUA 1WHKA 3M9QA 4RKUE 2KEAA 3CXCA 2ENMA 3RUXA 1KQ2A 5LJ3h 4UC4A 1JO8A 1PRMC 5I22A 4A4GA 1BKBA 3CCEA 2XICA 1ZSGA 2FYKA 1K4US 1SG5A 3L2RA 4F7UE 2NUZA 2H3EB 1I1JA 2LJ0A 4J9FA 1YITQ 3AHUA 1KJWA 3H0IA 1G2BA 2HQHA 1SSHA 2LVMA 4C92B 4RTXA 4C8QG 2X35A 3P8HA 3DLLA 1M27C 2ZPEB 3QWYA 4E7JA 2KE9A 2LCSA 3MCAB 3LGFA 3GLXA 2DK3A 3E9GA 3OYMA 1RI9A 2IVWA 2JS2A 2A36A 2KXCA 2WSEE 5DLQE 4RCCA 5FLXE 3P8DA 2EYZA 2DZCA 1RAAB 1M30A 2RI2A 3SFMA 5HY6A 2VYTA 1YBYA 3E9FA 5IHIA 3CC7A 1TOVA 1M8VA 2CKKA 2D8JA 3CC4Q 2Y90A 1MGQA 5FU7B 1U8RA 1AEYA 1CSKA 5GAOq 4DBHA 2YSQA 8AT1B 2GTOA 2M51A 3CC2T 1VYUA 2LX9A 1I0CA 4J9DA 2O4XA 1W6XA 1KSWA 4C92F 1YIJQ 4MZTA 1K73U 3TQ7P 3V7RA 1BYMA 2E70A 2DL5A 1YWOA 4RTVA 1BI2A 1LJOA 3EG9B 2ECZA 2OAWA 1QMCA 2EYWA 4AMCA 1NJIR 1M90R 3OYYA 1LOJA 1IREB 1G3SA 2K79A 1AZEA 2ZPHB 3JB9G 5LL6S 4FYYB 3PIPA 1RUWA 1OYXA 2GTJA 5I21A 2LDMA 4K11A 3L2QA 3CCSQ 3OBWA 3OYNA 4M7AG 2QEXQ 4X9CA 2COWA 3CEYA 3QO3A 4JJNK 2LT4A 1WFWA 2SRCA 1PHTA 3QG1A 1RAFB 1KQSP 5CQYA 2HKQB 2J05A 2CP7A 3VS7A 5GAMj 2FPDA 1GCPA 1ZA1B 4IIOA 3TSWA 2DPPB 5D6YA 2QGGA 5LJ5j 2GGRA 2CP3A 3X28B 1NM7A 1UHCA 2DO3A 1VQ4T 2R58A 4M78G 3KBGA 3S3NA 4E7KA 1HD3A 2EJFA 4HCKA 1X6GA 1RACB 2RJEA 1FMWA 3MHXA 3JAME 4GLKA 1G3YA 3LLRA 3CPWS 1YJ9Q 2PQWA 1LNXA 4ELYC 3CPWP 4A54A 3I5SA 3E2UA 3TU4K 2JM8A 2QXFA 3OW2S 3OYLA 1ARKA 2XKOC 4P5NA 5GAN5 3QYHB 1VQ5T 3M56A 3OW2P 1RI0A 1Y96B 3X20B 1JJ2S 2CGHA 3G4SA 1NYFA 5KCOA 4PJNA 2EQIA 1Q95G 3QZ9B 1AWJA 3RR6A 3RKYA 2WACA 4OB0B 1JJ2P 1M9SA 3M53A 5KYUA 2QASA 4M75F 2E41A 3CD6Q 4C5HA 5GMKj 3CPWA 2L8DA 1VYVA 2ZAEA 4N4HA 1WA7A 4M7AD 2LP5A 4XTZA 5L8RE 5IAYA 5GAMe 1M2VB 4M77A 3CMET 4FW2A 2JVVA 4BI3A 3VKIA 2AIRB 5LJ5e 2CZ6B 4AFSC 1AVZC 2EGCA 1W4SA 4DBQA 4ESRA 3H0FA 5CAIA 1WYXA 2D0QB 4RCBA 1PCXA 2E3IA 3VS1A 4PJMA 3CMAT 1JJ2A 1VQPA 2NUPA 3A8HB 2AHJB 1M90U 1VQOT 3HP9A 1M90C 1YCSB 4BY6B 1YJNA 3TEEA 2JUFA 2EJ9A 4EPCA 2ZPIB 2BZXA 4XTUA 1W1FA 3DKMA 5GAMf 2K2MA 1YJWT 1MUZA 4LD6A 2HQEA 1U5SA 4Z88A 1Z9QA 1XOVA 2GFUA 1WHHA 3D7SB 5EG2A 5A0DA 5LJ3d 1K0XA 2M9UA 1MMDA 1YI2Q 4C0ZA 2K4YA 2L3SA 5KE2A 1NPPA 1TG0A 4PJOG 2EGEA 5KYWB 2A37A 2F69A 4MDXA 1ZUUA 3E1SA 5KH6A 3TREA 2V26A 3HKSA 1JRIA 1AOJA 4OF1A 3JCMg 4HCCA 3CCEQ 3G71Q 2FZCB 1T0HA 3LH0A 5GMKi 1OQKA 4ANJA 3UATA 2QTXA 2XI9A 4RG2A 3CCRA 2QA4Q 2EWNA 2YUNA 3LGLA 4M77E 4HXJA 2M0YA 4Z02A 5GAMh 1HYOA 4GLMA 1OX9A 3QZ5B 1TTHB 3A8OB 4AFUC 5LJ5h 1BCOA 4B9XA 2L3PA 3C12A 1X2KA 2DTIA 4J9CA 2KBTA 1WDXA 1H641 4J8OA 4C8QA 2OI3A 1VQKA 1PRLC 2J7IA 4IUPA 1TUCA 1VUBA 2OAUA 2KYBA 3QIIA 3EG1A 3CC7Q 3CCJA 1D0YA 4L5GA 2AZSA 4RTZA 2HSEB 2IPOB 3MP6A 1BIBA 2QQSA 3N5BB 2RI3A 2KROA 1WXBA 3FLGA 1YWPA 3HRTA 3OYEA 2F1LA 4KH0B 2H8HA 3C95A 2RI5A 2JS0A 3ER0A 1B07A 3X25B 3H41A 5AT1B 4PJOD 3GNFB 2D1XA 2COZA 2K7AA 3NTHA 1KIKA 4FL6A 1N27A 4CRIA 4OMLA 5GAN7 1M3BA 2MMPA 1U06A 4M77C 4E6RA 4RTYA 2RQVA 2VASA 4LDWA 4C0GA 5FWBA 8ATCB 3G6ET 5CKFA 4PJLA 2CH4A 3DB4A 2VXEA 1JBMA 2KGTA 1GCQA 4OVAA 3OY9A 4KT0E 2EVRA 4AG1C 2JT4A 2P4RA 5KE3A 1C1AA 3CCUA 2FO0A 3TCJA 4J9GA 2E10A 1PM3A 2ED1A 4DQ2A 3HFOA 4C92G 1W2BS 1AWXA 2GCXA 4JRPA 2LC4A 5J39A 2CZ1B 2DD4A 3C4SA 1UHFA 1PKTA 1VQ6A 5GMKl 2OTJA 5KYXA 1QVFP 3M55A 4F7UF 2OTLA 2ROTA 1H3HA 2RQRA 4A63B 1X2QA 1YFNA 1KFZA 2PTKA 4KUDK 3JCMf 4N4GA 4CC2A 2MOXA 3RERA 2H3JA 1SHFA 4M78A 1U1SA 3FIFA 1UG1A 3JB9J 2RQTA 4DBFA 5KYYA 5CIUA 1MV3A 1XQHA 2PVOB 4BD3A 1VQMT 1KC8R 3EAEA 4J9BA 4AG2C 4JRQA 1K9AA 3I55T 2PVDB 1W2BA 1YP5A 3G4SQ 2ZCFB 3KFVA 3A8LB 3BDUA 1VQ7Q 4M7DA 1AHJB 2LJ1A 4OMQA 2KI7A 1X6OA 1KG1A 2LZ6B 3PVLA 2JTMA 2YUOA 2ATCB 2GF7A 2C0TA 3J80E 2DL7A 1B34A 3H6ZA 4ZNXA 1WXTA 3H9NA 3X26B 2PUKB 3UWNA 1Y07A 1MNEA 3S3MA 2DRMA 1PNJA 2E1HA 3X24B 1S72T 2EBPA 2KDSA 2LJ3A 4C92D 1VQLT 5C6SA 1YNZA 1UEBA 3JSCA 2EYYA 3ZEHA 3VS5A 1YJ9T 1K73R 1VQPQ 2L3RA 3M4GA 1GBQA 4PK4A 1B7TA 3VRZA 1YHQA 1M5Q1 4EMKA 1ZBXA 3INZA 1YJNQ 2P84A 1I81A 1RLQC 1KHIA 3CXCP 4J6WA 4LDUA 3UPUA 3GBQA 2MCNA 2EQMA 4DA4A 2LRQA 2F2VA 2KY9A 3PFSA 4M78E 4F16A 2DEQA 2COYA 4HVVA 3CCVA 3OS0A 1E7OA 1NG2A 4FT4A 3LW5E 1TS9A 2RPNA 3PMIA 1HK9A 2KVQG 1QVGS 4N4IA 1JU5C 2IIMA 4YTLA 2QDLA 2JNGA 1IB8A 2GBQA 4MMKA 2YRCA 3OYDA 4M7DE 3EFOA 3VS3A 1WHMA 2DIQA 2G6FX 5GAMd 1GCQC 1X75C 3VS0A 2XIDA 1RADB 5LJ5d 1TSFA 1D1CA 2JXBA 1WHGA 5IT9E 2P0KA 3CC2A 1KC8U 2I2LA 4NL3A 1KC8C 1ZSZB 3RKWA 2V8JA 5I2MA 2P4TA 4OMOA 2FZKB 3V8JA 4BDZA 3QYGB 1V76A 1I8FA 2QK0A 1QVGA 2KRMA 4BE0A 3I56T 4JRIA 4CC4B 2MF2A 3OYIA 4O5VA 3OSSC 1VQKQ 3M0RA 4F14A 3CCLT 2VGMA 4M75D 3RMSA 3CCJQ 1OZ3A 2JZ2A 5GANg 4M78C 1YI2T 4Y92A 3LYIA 4ORZA 3JV3A 4OMMA 2FG0A 4ELZC 3ME9A 3OS2A 2QQAA 1WPYA 2P0QA 2DXCA 2J6KA 2CUBA 5A0LA 4B6MA 3F70A 1UJYA 1JQQA 2XD0A 2LNHB 2BZ8A 3G71T 3I9QA 2XHCA 3GNGA 3OYKA 3SWNA 1SRMA 1BU1A 2KYMA 4J6XA 1K73C 4R56A 2QA4T 4BE2A 3FB9A 1QCOA 2DETA 4M7DC 4E7ZA 1VQ4A 2CYZB 2B8AA 3HRUA 2KT8A 1UGSB 2KNBB 4II1A 4BB7A 2EQKA 1AWOA 3EFRA 1VQ9T 4OMPA 3EGXB 1PSEA 2DL3A 5IH2A 1N8RR 1D09B 4IUVA 4ZN1A 3M57A 4E7IA 2HAXA 3URGA 5AYFA 2NUPB 4ATOA 1FMKA 3CC7T 2QAZA 3CCUQ 1VQ5A 3HSBA 2C06A 4C5GA 1TWBA 4EMKC 2DA9A 2HZYA 2J6OA 4QQDA 3QDRB 4M75B 1M1GA 4KGZB 2X9HA 2DX1A 3NPFA 1JXMA 1VQ6Q 3AT1B 2VGNA 3CCMQ 2CP2A 2OTJQ 3WVDB 2V1RA 4OMNA 2OTLQ 2GQVA 4JS4A 1ZUYA 2CH4W 2PUOB 2YT6A 3HRSA 3NFCA 2YLCA 5CR2A 4M77F 2FL7A 4IKFA 2RHXA 4LN2A 3OYFA 3OYGA 4JDSA 1CKAA 3VS2A 2ZGWA 3QKJA 5J3BA 3SHWA 3FC3A 3LWIA 1FX7A 4LDXA 1VQ8T 3JCMP 4NL2A 4QVDA 2E4HA 2YDLA 1MHNA 2Y4YA 3RESA 4KULA 5FW9A 2HBPA 2M02A 1VQOA 2E5QA 2V8KA 2XDPA 1IRXA 1R77A 1UGQB 3RMQA 2LTOA 3EG2A 2MIOA 2MPXC 2D0NA 3NTIA 4JJBA 1EFNA 5IHKA 4JZ3A 4XU2A 4M4ZA 1UECA 3CPFA 3O5ZA 4LDVA 3V7SA 4IUUA 4BUGA 3REAB 4TVRA 3GF5A 5GAOp 3EG9A 2FHDA 4J5YA 1TXQA 1O75A 2HBWA 4QKUA 1PKSA 1XTDA 2CZ0B 3M0PA 2RJFA 4JRKA 2K6DA 1YHQQ 2BE7D 2FPEA 1Y0MA 4DEYA 4JUVA 2L2PA 2PU9B 1AWWA 1IHVA 4L59A 2EGAA 3OMCA 1N8RU 4PFZA 3M0SA 2E6NA 4C5IA 2K57A 2CSIA 1N8RC 3CCQT 3QDFA 4A4FA 4Q5WA 2LX7A 1ZA2B 4QQ6A 3NHNA 3JCMJ 4KUIA 3A5ZB 4A4HA 2RK1A 1VQ7T 3OYCA 2HKNA 3G7ZA 6AT1B 1G3TA 2JOYA 3CCVQ 1OPLA 3CBMA 2EPDA 1T3LA 4BI4A 1Q81R 1RL2A 2EW3A 1O9SA 5FU6C 2XDDA 4C8QF 4EIKA 3R6OA 4ZGJB 4D8KA 1N9RA 2MYSA 3OSVA 4QW2A 2DFUA 3V7CA 3SDZA 1UFFA 5A0GA 2JJ9A 4E47A 5EC7A 4HT8A 1D0XA 4PKCC 4IUQA 4GY5A 1PC0A 1VQPT 2JMCA 2QQ9A 1VQNT 2QDYB 3CC2Q 5GAN6 1U1TA 3L2ZA 2RJDA 1N5ZA 1YJNT 1KHCA 1MNDA 1Y96A 2EQUA 1RAIB 4RMOA 3QUIA 2KRSA 2PVGB 5IXFA 4J7IA 4WF2A 3BY7A 2RHYA 3H0HA 3EHRA 3UA7A 2LQWA 2ROLA 2KK4A 3LH5A 2IG0A 2X4YA 1S1NA 3FRNA 5J26A 2F2WA 5GJWB 2LQ8A 1D1AA 1M2VA 1QWFA 1WQWA 2X4JA 1MMAA 2AK5A 4MMLA 1VIEA 2LNVA 3G6EA 5GAN3 4OB3B 2O9VA 1W70A 2RF0A 2FRYA 2CP0A 2CP6A 3JB9F 1ZUKA 2YRVA 4PJJA 3SB2A 3REBB 4N0AA 2MWPA 4M7DB 4EDUA 2MK5A 1OULA 4D6WA 1YITT 2QTVA 2DVJA 4RTUA 4FU6A 3OS5A 2LCLA 4KGVB 5FU7C 4F7UB 4OB1B 4LD9K 1VQ4Q 4ZGEB 4AT1B 2DTOA 3U23A 1HXDA 1WZOA 2DXTA 2EKHA 1G3WA 3MEUA 1AD5A 5LJ3g 2DJQA 3Q1JA 1JEGA 4AFZC 2NUTB 2DZ9A 3PE0A 1D3BB 1PWTA 3RBBB 2A7YA 4M78F 3JCMe 2YXYA 2ZPGB 2HQXA 5ECAA 2D8HA 2GQIA 5M9OA 4E2FB 1VQKT 3PIOA 1T3SA 1Y7XA 2BE9B 2YWWA 3T9NA 1VQMA 3FJPA 1Q81U 2R5AA 1TU0B 5GAOr 4EMKB 1VQ5Q 2X3WD 3MKDA 1Q81C 3M4YA 3I55A 4J9HA 5KYWA 4C0DC 5HK0A 3CC4T 2RA2A 1HJDA 2KSSA 1IZ6A 2BTTA 3FJ5A 4M7AA 4M7DF 2QQBA 1QKXA 1W2BP 2BKDN 2DXBA 4C8QE 1M1FA 2O01E 2K5IA 2X4XA 4PLLA 2YUPA 3EH1A 3M5AA 4PNOA 2G3RA 1MMNA 4EMHA 1YIJT 2MI6A 2YLBA 2FB7A 5C0MA 1N9SA 1M4ZA 2JM9A 4E7SA 3S3OA 3DLMA 2VXFA 3KXTA 3OBYA 2I0NA 4A4KA 1S72A 2XU8A 1M2OA 1VQLA 2K3BA 4ZTFA 2DBKA 2X3XD 4LNPA 5CCAA 3CCST 4J83A 4CI0C 2FRWA 2W0ZA 2HD0A 2QEXT 2E6ZA 4QVZA 1Q86R 2HSPA 1VQOQ 1IO6A 1UGRB 1QW1A 1UE9A 2VKNA 2L0AA 4DEXA 3V8KA 1WQ7A 2F5TX 3EG0A 4RTTA 3OQ5A 1NEGA 1WI7A 1UGVA 2C0IA 3OYBA 1NBEB 2NYSA 3WVEB 4JLGA 1PG5B 1VQ6T 1OOTA 3JCMh 3CCMT 1A0NB 3JCMQ 3L2UA 1WXUA 2RHUA 4HKEA 2MAMA 1MMGA 4WCIA 1Z9ZA 2J6FA 1G5VA 4ZTJA 4C8QC 1U3OA 5CQXA 3MJXA 1X69A 2KT1A 4M7AE 3A8MB 5KYNA 3EGUA 3A98A 2L89A 4LUEA 1QCFA 1GRIA 2R57A 2R5MA 2O4XB 2XK0A 1RABB 4M75G 7AT1B 1K9MU 5LJ3f 4D8DA 3JCMW 1XNIA 2CSQA 4LDYA 1BCMA 3M0TA 4N0AC 1K9MC 1F1BB 3OB9A 2JW4A 1QWEA 1UB4A 4OMFB 3CD6T 5IN1A 1Q7YU 1P92A 2PZ1A 5FU6B 2FZGB 3VV0A 4FYVB 1OPKA 3RKXA 2BUDA 3I56A 4EMGA 2DXUA 4MDWA 4FW1A 1QVGP 2DAQA 1D1BA 1UJ0A 2NWMA 3J7AF 2DTHA 2M0OA 3DB3A 3CCLA 1V1CA 2YUQA 3PVQA 4JZ4A 2K3XA 4MZMA 4A4EA 2XDBA 3OS1A 2RJCA 3CCRQ 5D7UA 2DERA 2RHIA 3J81E 4M77D 4HCBA 3SEMA 4PJOA 1NZ9A 3JCMV 1VYTA 4XAXB 4XK8E 3L2VA 1OU9A 4BI8B 3VYGA 4OGEA 1RAGB 3MPUB 1UGPB 3G71A 1KD1U 2ZPFB 4M7AC 3MP8A 1KD1C 3FDRA 3UA6A 1WIEA 2AZVA 4BE1A 2CZ7B 2QA4A 1Q86U 1BB9A 1G8XA 1QLYA 3ASKA 1Q86C 1VIFA 3MEAA 2FEIA 2M1HA 5GMKm 4GBQA 1UTIA 4E7HA 5D6WA 4KGXB 4LE9A 1X43A 3CCVT 1NEBA 2VWFA 2DE0X 1VOMA 2E12A 1VQ9A 2J06A 3JCMc 3G6EQ 5FRMA 2CUDA 2DYBA 2CDTA 2O31A 1FXXA 4F17A 4FT2A 5CKBA 4A53A 3PTAA 4HCZA 1SPKA 3ZFJA 4OGCA 1E6GA 1PD1A 4NS5A 1UUEA 3CCET 4LUDA 1ZLMA 5GANj 3EGDA 5KYUB 2RO0A 3M0UA 2DLPA 2CT4A 2HDAA 2OX7A 3THKA 2RMOA 2V8IA 3VS4A 1LCKA 1UDLA 3ZL7C 4VUBA 4M77B 3FEOA 4Z89A 3CQTA 3C0CA 2B86A 1T0JA 4PL6A 2DKGA 3VUZA 1I5LA 4PJOE 1FMVA 1BI1A 4OP0A 1AT1B 3M59A 5GAN2 3OYAA 2VB6A 1MV0B 3BDLA 1VQMQ 5GAMg 4C0DB 1ZQ1A 2JTFA 3I55Q 5LJ5g 1VQ8A 2K5LA 2X51A 2RN8A 2DEUA 2QG9B 4KRTA 1IGUA 3VYHB 5HK3A 1WLPB 4C8QD 3PGGA 4IURA 1GFCA 2DM1A 1KQSS 2QGFB 4NOYA 2EYQA 4JJCA 3ULRB 2RK2A 1OV3A 5IXBA 4C0FA 1OX8A 2RH2A 3BW1A 3QPHA 1GL5A 4C92A 3LX7A 2JMAA 1RAHB 2P0PA 1ZSZA 4Y91A 2A28A 2ABLA 2A08A 1FWZA 5GANe 3CMEA 2DD5A 2ZZDA 1I5OB 2SEMA 1S72Q 1YCYA 2VUBA 1VQLQ 3HHTB 1TUDA 4MZPA 4QQGA
chains in the Genus database with same CATH topology
1WHJA 1WHLA 2E4HA 2CP5A 2COZA 1WHHA 2HL5C 2CP3A 3RDVA 1WHKA 2M02A 3TQ7P 3E2UA 2HL3A 1TOVA 2E3HA 1IXDA 2Z0WA 2CP0A 2CP6A 1WHMA 2COWA 2COYA 2CP2A 2QK0A 2E3IA 1TXQA 2MPXC 2HKQB 2CP7A 4B6MA 1WHGA 2HKNA 2HQHA 1LPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHJ A;  1WHL A;  2E4H A;  2CP5 A;  2COZ A;  1WHH A;  2HL5 C;  2CP3 A;  3RDV A;  1WHK A;  2M02 A;  3TQ7 P;  3E2U A;  2HL3 A;  1TOV A;  2E3H A;  1IXD A;  2Z0W A;  2CP0 A;  2CP6 A;  1WHM A;  2COW A;  2COY A;  2CP2 A;  2QK0 A;  2E3I A;  1TXQ A;  2MPX C;  2HKQ B;  2CP7 A;  4B6M A;  1WHG A;  2HKN A;  2HQH A;  1LPL A; 
#chains in the Genus database with same CATH topology
 3JCM X;  4IIM A;  3BFM A;  4ME7 A;  3CMA A;  3MP1 A;  5GAO l;  1KQS A;  1TUG B;  2LQK A;  4J7F A;  3PMT A;  1SEM A;  4M7D G;  4J6Y A;  2DJZ A;  4PJO C;  3JCM d;  3HPW A;  3HFN A;  3TVT A;  1Y57 A;  1E6H A;  4X1V A;  4X9D A;  4F7U G;  1K0S A;  4HT9 A;  3UDC A;  3CCQ A;  2AKL A;  4XTX A;  1WHJ A;  5GAN f;  2CP5 A;  2Y4X A;  1YJW A;  1WJQ A;  5D6X A;  2XG8 D;  3QJ6 A;  3VUB A;  3EFS A;  1PD0 A;  1VQ7 A;  3JB9 D;  3O8V A;  1M1K R;  1KQ1 A;  3NGP A;  1OI1 A;  3PT9 A;  4C8Q B;  1M8M A;  2HEQ A;  2DMO A;  5HCK A;  2YHT A;  2CRE A;  1K1Z A;  1BI3 A;  2A3L A;  2K2V A;  4JPB W;  2HNI A;  5HKC A;  3VJP A;  3L2W A;  3OW2 A;  2FPF A;  3EHQ A;  2DL8 A;  3R6N A;  3EGX A;  3VRY A;  1J3T A;  4C92 E;  1RAE B;  5GAN 4;  2K5F A;  1NJI U;  4M78 D;  2CT3 A;  3G4S T;  4JJD A;  1VQN A;  1NJI C;  3QXE B;  2DL4 A;  3TSZ A;  3SWN C;  1LPL A;  2OJ2 A;  4E7L A;  4IUT A;  2RHZ A;  3G1J A;  4KH1 B;  4X34 A;  5GAN h;  1SF9 A;  4DOW A;  2WSC E;  2KR3 A;  3EH2 A;  2ED0 A;  4M75 A;  1JXO A;  2L3Q A;  3OMG A;  2X4W A;  1SRL A;  3I56 Q;  3GP8 A;  2CS7 A;  2DIG A;  2RM4 A;  5LJ5 f;  4M7D D;  2KXD A;  5CVI A;  1ABQ A;  3I5R A;  1FYN A;  1WJS A;  5FRN A;  3CCL Q;  2AKK A;  2RQU A;  4XU1 A;  2DRK A;  4PFO A;  5GJV B;  1GBR A;  5IHN A;  5GMK e;  1R0B G;  1Y71 A;  5CKD A;  4BAC A;  1SHG A;  2ZPB B;  4FIB A;  1R0C B;  1ABO A;  2D9T A;  2KQW A;  4M7A B;  2LCC A;  3UT1 A;  3QHS A;  4XTV A;  4DOV A;  4J9I A;  4L6V 5;  2HMA A;  5KYX B;  1GXI E;  5DY9 A;  1YIT A;  4JS5 A;  3CBO A;  3IQL A;  2E3H A;  3EG3 A;  2VVK A;  4CC7 A;  2M16 A;  3MEV A;  3WXM B;  4KBM B;  4C92 C;  1I07 A;  3L42 A;  3C94 A;  1NLO C;  4M78 B;  1ZSZ C;  2DF6 A;  4O6J A;  1OEB A;  4V2S A;  5KYY B;  1ACM B;  1VQ9 Q;  1NLP C;  2RB6 A;  4J9E A;  3NMZ C;  3A8G B;  1ZHI A;  1RLP C;  1M1K U;  1TH7 A;  5DLO A;  2BIV A;  1M1K C;  3JCM b;  1YN8 A;  2DNU A;  1ZBJ A;  2FVU A;  3QBY A;  4DBR A;  2EYX A;  4M75 E;  3CCR T;  4M7A F;  3CC4 A;  1WHL A;  5GAO m;  4PLI A;  1H92 A;  1WX6 A;  5CKE A;  4QVC A;  1X01 A;  1B34 B;  4RTW A;  3A1P A;  4XTW A;  3PNW C;  2F5K A;  5FRO A;  3QJY A;  4HVW A;  2YRD A;  1CKB A;  1N6A A;  2KAF A;  1C0M A;  4LXC A;  4ZN3 A;  1YIJ A;  1H3Z A;  2WSF E;  1HSQ A;  3CBP A;  3HTR A;  3S6W A;  2HL5 C;  4FYW B;  3JB9 I;  2DIL A;  5FWC A;  1K9M R;  3OYJ A;  4XTY A;  1H8K A;  5GMK h;  4RUG A;  3E19 A;  2W10 A;  1VA7 A;  2Z0W A;  1QQJ A;  1QP3 A;  3LWH A;  3CCJ T;  2DBM A;  5LJ3 j;  1I4K 1;  1X6B A;  2KMT A;  4Z8A A;  1BIA A;  1VQ8 Q;  4F04 B;  2XMF A;  2DYI A;  4FYX B;  3ZBD A;  1Q7Y R;  4B9W A;  3CCS A;  4QT7 A;  2O88 A;  2QEX A;  4XU0 A;  2GFA A;  1K8A R;  2KRN A;  4WTO B;  3QWX X;  3RNJ A;  2BZY A;  3MEW A;  3UF4 A;  2EJG A;  2V1Q A;  1Q82 R;  4FCY A;  1QVF S;  4FSS A;  3CME Q;  4M75 C;  3M58 A;  1QKW A;  1V29 B;  3CCM A;  3M54 A;  3H8Z A;  2MWO A;  3RDV A;  1WNL A;  4Y28 E;  2HL3 A;  3VU3 C;  1QVP A;  1AZG B;  3EFO B;  1KD1 R;  3JRZ A;  1YJ9 A;  2E65 A;  3CMA Q;  3MET A;  2K9G A;  1JB0 E;  1GFD A;  2JTE A;  4FM4 B;  5GAO n;  3MO8 A;  2L5Q A;  2EQJ A;  1QP2 A;  3HL8 A;  3GOX A;  2EAY A;  4PJO B;  2EKO A;  2LMJ A;  4R55 A;  1NPR A;  4FSX A;  2D6F A;  1BI0 A;  3CCU T;  3I35 A;  5DM7 R;  2PNI A;  2A0F B;  3SD4 A;  3CCQ Q;  3P8B B;  5I2S A;  3RIR A;  1YJW Q;  1QVF A;  5LJ3 e;  4M77 G;  5A2Q E;  1EZZ B;  4ZGD B;  2OTJ T;  2OTL T;  1B3Q A;  1M3A A;  1ZX6 A;  1NE8 A;  2DVE A;  2ESW A;  3CD6 A;  9ATC B;  4F7U A;  2NLU A;  3KUF A;  1OU8 A;  2LQN A;  1IHW A;  4HVU A;  2RNA A;  1PSF A;  3L1A A;  3JB9 H;  1EX4 A;  4R0K A;  1QCN A;  1LVK A;  2NUT A;  2QYZ A;  1D3B A;  1BBZ A;  2C0O A;  4RG8 A;  5CKH A;  2GNC A;  2QI2 A;  4PJO F;  5GAN d;  3GPL A;  1D0Z A;  2HCK A;  1WGS A;  1OZ2 A;  2JN0 A;  4OB2 B;  4CC3 A;  5CO7 A;  3SWN B;  3EGD B;  4PFP A;  1VQN Q;  1R8O B;  1KK7 A;  2EIF A;  1X27 A;  2VV5 A;  5KCH A;  3CXC S;  1SKU B;  3OA6 A;  3NTK A;  5L23 A;  1EIF A;  2O2O A;  1M3C A;  3VS6 A;  4BY6 C;  2F2X A;  2QQR A;  2AT1 B;  3OYH A;  2E64 A;  1Q7Y C;  1IXD A;  5GAN 8;  5I11 A;  1SSF A;  1IGQ A;  4AFQ C;  2VC8 A;  1K8A U;  1XJW B;  3GIB A;  1C6V X;  3BE3 A;  1DJ7 B;  1G83 A;  3V8L A;  4HA8 A;  4XQ3 A;  1K8A C;  1BK2 A;  4BDY A;  2E5K A;  2EFI A;  2O9S A;  2RQW A;  1Q82 U;  4C5E A;  4XU3 A;  1YI2 A;  1Q82 C;  2RD1 A;  1WJR A;  2K3Y A;  3M0Q A;  4JLI A;  1NYG A;  2LT1 A;  5CK9 A;  1K76 A;  1YHQ T;  3QSU A;  1WHK A;  3M9Q A;  4RKU E;  2KEA A;  3CXC A;  2ENM A;  3RUX A;  1KQ2 A;  5LJ3 h;  4UC4 A;  1JO8 A;  1PRM C;  5I22 A;  4A4G A;  1BKB A;  3CCE A;  2XIC A;  1ZSG A;  2FYK A;  1K4U S;  1SG5 A;  3L2R A;  4F7U E;  2NUZ A;  2H3E B;  1I1J A;  2LJ0 A;  4J9F A;  1YIT Q;  3AHU A;  1KJW A;  3H0I A;  1G2B A;  2HQH A;  1SSH A;  2LVM A;  4C92 B;  4RTX A;  4C8Q G;  2X35 A;  3P8H A;  3DLL A;  1M27 C;  2ZPE B;  3QWY A;  4E7J A;  2KE9 A;  2LCS A;  3MCA B;  3LGF A;  3GLX A;  2DK3 A;  3E9G A;  3OYM A;  1RI9 A;  2IVW A;  2JS2 A;  2A36 A;  2KXC A;  2WSE E;  5DLQ E;  4RCC A;  5FLX E;  3P8D A;  2EYZ A;  2DZC A;  1RAA B;  1M30 A;  2RI2 A;  3SFM A;  5HY6 A;  2VYT A;  1YBY A;  3E9F A;  5IHI A;  3CC7 A;  1TOV A;  1M8V A;  2CKK A;  2D8J A;  3CC4 Q;  2Y90 A;  1MGQ A;  5FU7 B;  1U8R A;  1AEY A;  1CSK A;  5GAO q;  4DBH A;  2YSQ A;  8AT1 B;  2GTO A;  2M51 A;  3CC2 T;  1VYU A;  2LX9 A;  1I0C A;  4J9D A;  2O4X A;  1W6X A;  1KSW A;  4C92 F;  1YIJ Q;  4MZT A;  1K73 U;  3TQ7 P;  3V7R A;  1BYM A;  2E70 A;  2DL5 A;  1YWO A;  4RTV A;  1BI2 A;  1LJO A;  3EG9 B;  2ECZ A;  2OAW A;  1QMC A;  2EYW A;  4AMC A;  1NJI R;  1M90 R;  3OYY A;  1LOJ A;  1IRE B;  1G3S A;  2K79 A;  1AZE A;  2ZPH B;  3JB9 G;  5LL6 S;  4FYY B;  3PIP A;  1RUW A;  1OYX A;  2GTJ A;  5I21 A;  2LDM A;  4K11 A;  3L2Q A;  3CCS Q;  3OBW A;  3OYN A;  4M7A G;  2QEX Q;  4X9C A;  2COW A;  3CEY A;  3QO3 A;  4JJN K;  2LT4 A;  1WFW A;  2SRC A;  1PHT A;  3QG1 A;  1RAF B;  1KQS P;  5CQY A;  2HKQ B;  2J05 A;  2CP7 A;  3VS7 A;  5GAM j;  2FPD A;  1GCP A;  1ZA1 B;  4IIO A;  3TSW A;  2DPP B;  5D6Y A;  2QGG A;  5LJ5 j;  2GGR A;  2CP3 A;  3X28 B;  1NM7 A;  1UHC A;  2DO3 A;  1VQ4 T;  2R58 A;  4M78 G;  3KBG A;  3S3N A;  4E7K A;  1HD3 A;  2EJF A;  4HCK A;  1X6G A;  1RAC B;  2RJE A;  1FMW A;  3MHX A;  3JAM E;  4GLK A;  1G3Y A;  3LLR A;  3CPW S;  1YJ9 Q;  2PQW A;  1LNX A;  4ELY C;  3CPW P;  4A54 A;  3I5S A;  3E2U A;  3TU4 K;  2JM8 A;  2QXF A;  3OW2 S;  3OYL A;  1ARK A;  2XKO C;  4P5N A;  5GAN 5;  3QYH B;  1VQ5 T;  3M56 A;  3OW2 P;  1RI0 A;  1Y96 B;  3X20 B;  1JJ2 S;  2CGH A;  3G4S A;  1NYF A;  5KCO A;  4PJN A;  2EQI A;  1Q95 G;  3QZ9 B;  1AWJ A;  3RR6 A;  3RKY A;  2WAC A;  4OB0 B;  1JJ2 P;  1M9S A;  3M53 A;  5KYU A;  2QAS A;  4M75 F;  2E41 A;  3CD6 Q;  4C5H A;  5GMK j;  3CPW A;  2L8D A;  1VYV A;  2ZAE A;  4N4H A;  1WA7 A;  4M7A D;  2LP5 A;  4XTZ A;  5L8R E;  5IAY A;  5GAM e;  1M2V B;  4M77 A;  3CME T;  4FW2 A;  2JVV A;  4BI3 A;  3VKI A;  2AIR B;  5LJ5 e;  2CZ6 B;  4AFS C;  1AVZ C;  2EGC A;  1W4S A;  4DBQ A;  4ESR A;  3H0F A;  5CAI A;  1WYX A;  2D0Q B;  4RCB A;  1PCX A;  2E3I A;  3VS1 A;  4PJM A;  3CMA T;  1JJ2 A;  1VQP A;  2NUP A;  3A8H B;  2AHJ B;  1M90 U;  1VQO T;  3HP9 A;  1M90 C;  1YCS B;  4BY6 B;  1YJN A;  3TEE A;  2JUF A;  2EJ9 A;  4EPC A;  2ZPI B;  2BZX A;  4XTU A;  1W1F A;  3DKM A;  5GAM f;  2K2M A;  1YJW T;  1MUZ A;  4LD6 A;  2HQE A;  1U5S A;  4Z88 A;  1Z9Q A;  1XOV A;  2GFU A;  1WHH A;  3D7S B;  5EG2 A;  5A0D A;  5LJ3 d;  1K0X A;  2M9U A;  1MMD A;  1YI2 Q;  4C0Z A;  2K4Y A;  2L3S A;  5KE2 A;  1NPP A;  1TG0 A;  4PJO G;  2EGE A;  5KYW B;  2A37 A;  2F69 A;  4MDX A;  1ZUU A;  3E1S A;  5KH6 A;  3TRE A;  2V26 A;  3HKS A;  1JRI A;  1AOJ A;  4OF1 A;  3JCM g;  4HCC A;  3CCE Q;  3G71 Q;  2FZC B;  1T0H A;  3LH0 A;  5GMK i;  1OQK A;  4ANJ A;  3UAT A;  2QTX A;  2XI9 A;  4RG2 A;  3CCR A;  2QA4 Q;  2EWN A;  2YUN A;  3LGL A;  4M77 E;  4HXJ A;  2M0Y A;  4Z02 A;  5GAM h;  1HYO A;  4GLM A;  1OX9 A;  3QZ5 B;  1TTH B;  3A8O B;  4AFU C;  5LJ5 h;  1BCO A;  4B9X A;  2L3P A;  3C12 A;  1X2K A;  2DTI A;  4J9C A;  2KBT A;  1WDX A;  1H64 1;  4J8O A;  4C8Q A;  2OI3 A;  1VQK A;  1PRL C;  2J7I A;  4IUP A;  1TUC A;  1VUB A;  2OAU A;  2KYB A;  3QII A;  3EG1 A;  3CC7 Q;  3CCJ A;  1D0Y A;  4L5G A;  2AZS A;  4RTZ A;  2HSE B;  2IPO B;  3MP6 A;  1BIB A;  2QQS A;  3N5B B;  2RI3 A;  2KRO A;  1WXB A;  3FLG A;  1YWP A;  3HRT A;  3OYE A;  2F1L A;  4KH0 B;  2H8H A;  3C95 A;  2RI5 A;  2JS0 A;  3ER0 A;  1B07 A;  3X25 B;  3H41 A;  5AT1 B;  4PJO D;  3GNF B;  2D1X A;  2COZ A;  2K7A A;  3NTH A;  1KIK A;  4FL6 A;  1N27 A;  4CRI A;  4OML A;  5GAN 7;  1M3B A;  2MMP A;  1U06 A;  4M77 C;  4E6R A;  4RTY A;  2RQV A;  2VAS A;  4LDW A;  4C0G A;  5FWB A;  8ATC B;  3G6E T;  5CKF A;  4PJL A;  2CH4 A;  3DB4 A;  2VXE A;  1JBM A;  2KGT A;  1GCQ A;  4OVA A;  3OY9 A;  4KT0 E;  2EVR A;  4AG1 C;  2JT4 A;  2P4R A;  5KE3 A;  1C1A A;  3CCU A;  2FO0 A;  3TCJ A;  4J9G A;  2E10 A;  1PM3 A;  2ED1 A;  4DQ2 A;  3HFO A;  4C92 G;  1W2B S;  1AWX A;  2GCX A;  4JRP A;  2LC4 A;  5J39 A;  2CZ1 B;  2DD4 A;  3C4S A;  1UHF A;  1PKT A;  1VQ6 A;  5GMK l;  2OTJ A;  5KYX A;  1QVF P;  3M55 A;  4F7U F;  2OTL A;  2ROT A;  1H3H A;  2RQR A;  4A63 B;  1X2Q A;  1YFN A;  1KFZ A;  2PTK A;  4KUD K;  3JCM f;  4N4G A;  4CC2 A;  2MOX A;  3RER A;  2H3J A;  1SHF A;  4M78 A;  1U1S A;  3FIF A;  1UG1 A;  3JB9 J;  2RQT A;  4DBF A;  5KYY A;  5CIU A;  1MV3 A;  1XQH A;  2PVO B;  4BD3 A;  1VQM T;  1KC8 R;  3EAE A;  4J9B A;  4AG2 C;  4JRQ A;  1K9A A;  3I55 T;  2PVD B;  1W2B A;  1YP5 A;  3G4S Q;  2ZCF B;  3KFV A;  3A8L B;  3BDU A;  1VQ7 Q;  4M7D A;  1AHJ B;  2LJ1 A;  4OMQ A;  2KI7 A;  1X6O A;  1KG1 A;  2LZ6 B;  3PVL A;  2JTM A;  2YUO A;  2ATC B;  2GF7 A;  2C0T A;  3J80 E;  2DL7 A;  1B34 A;  3H6Z A;  4ZNX A;  1WXT A;  3H9N A;  3X26 B;  2PUK B;  3UWN A;  1Y07 A;  1MNE A;  3S3M A;  2DRM A;  1PNJ A;  2E1H A;  3X24 B;  1S72 T;  2EBP A;  2KDS A;  2LJ3 A;  4C92 D;  1VQL T;  5C6S A;  1YNZ A;  1UEB A;  3JSC A;  2EYY A;  3ZEH A;  3VS5 A;  1YJ9 T;  1K73 R;  1VQP Q;  2L3R A;  3M4G A;  1GBQ A;  4PK4 A;  1B7T A;  3VRZ A;  1YHQ A;  1M5Q 1;  4EMK A;  1ZBX A;  3INZ A;  1YJN Q;  2P84 A;  1I81 A;  1RLQ C;  1KHI A;  3CXC P;  4J6W A;  4LDU A;  3UPU A;  3GBQ A;  2MCN A;  2EQM A;  4DA4 A;  2LRQ A;  2F2V A;  2KY9 A;  3PFS A;  4M78 E;  4F16 A;  2DEQ A;  2COY A;  4HVV A;  3CCV A;  3OS0 A;  1E7O A;  1NG2 A;  4FT4 A;  3LW5 E;  1TS9 A;  2RPN A;  3PMI A;  1HK9 A;  2KVQ G;  1QVG S;  4N4I A;  1JU5 C;  2IIM A;  4YTL A;  2QDL A;  2JNG A;  1IB8 A;  2GBQ A;  4MMK A;  2YRC A;  3OYD A;  4M7D E;  3EFO A;  3VS3 A;  1WHM A;  2DIQ A;  2G6F X;  5GAM d;  1GCQ C;  1X75 C;  3VS0 A;  2XID A;  1RAD B;  5LJ5 d;  1TSF A;  1D1C A;  2JXB A;  1WHG A;  5IT9 E;  2P0K A;  3CC2 A;  1KC8 U;  2I2L A;  4NL3 A;  1KC8 C;  1ZSZ B;  3RKW A;  2V8J A;  5I2M A;  2P4T A;  4OMO A;  2FZK B;  3V8J A;  4BDZ A;  3QYG B;  1V76 A;  1I8F A;  2QK0 A;  1QVG A;  2KRM A;  4BE0 A;  3I56 T;  4JRI A;  4CC4 B;  2MF2 A;  3OYI A;  4O5V A;  3OSS C;  1VQK Q;  3M0R A;  4F14 A;  3CCL T;  2VGM A;  4M75 D;  3RMS A;  3CCJ Q;  1OZ3 A;  2JZ2 A;  5GAN g;  4M78 C;  1YI2 T;  4Y92 A;  3LYI A;  4ORZ A;  3JV3 A;  4OMM A;  2FG0 A;  4ELZ C;  3ME9 A;  3OS2 A;  2QQA A;  1WPY A;  2P0Q A;  2DXC A;  2J6K A;  2CUB A;  5A0L A;  4B6M A;  3F70 A;  1UJY A;  1JQQ A;  2XD0 A;  2LNH B;  2BZ8 A;  3G71 T;  3I9Q A;  2XHC A;  3GNG A;  3OYK A;  3SWN A;  1SRM A;  1BU1 A;  2KYM A;  4J6X A;  1K73 C;  4R56 A;  2QA4 T;  4BE2 A;  3FB9 A;  1QCO A;  2DET A;  4M7D C;  4E7Z A;  1VQ4 A;  2CYZ B;  2B8A A;  3HRU A;  2KT8 A;  1UGS B;  2KNB B;  4II1 A;  4BB7 A;  2EQK A;  1AWO A;  3EFR A;  1VQ9 T;  4OMP A;  3EGX B;  1PSE A;  2DL3 A;  5IH2 A;  1N8R R;  1D09 B;  4IUV A;  4ZN1 A;  3M57 A;  4E7I A;  2HAX A;  3URG A;  5AYF A;  2NUP B;  4ATO A;  1FMK A;  3CC7 T;  2QAZ A;  3CCU Q;  1VQ5 A;  3HSB A;  2C06 A;  4C5G A;  1TWB A;  4EMK C;  2DA9 A;  2HZY A;  2J6O A;  4QQD A;  3QDR B;  4M75 B;  1M1G A;  4KGZ B;  2X9H A;  2DX1 A;  3NPF A;  1JXM A;  1VQ6 Q;  3AT1 B;  2VGN A;  3CCM Q;  2CP2 A;  2OTJ Q;  3WVD B;  2V1R A;  4OMN A;  2OTL Q;  2GQV A;  4JS4 A;  1ZUY A;  2CH4 W;  2PUO B;  2YT6 A;  3HRS A;  3NFC A;  2YLC A;  5CR2 A;  4M77 F;  2FL7 A;  4IKF A;  2RHX A;  4LN2 A;  3OYF A;  3OYG A;  4JDS A;  1CKA A;  3VS2 A;  2ZGW A;  3QKJ A;  5J3B A;  3SHW A;  3FC3 A;  3LWI A;  1FX7 A;  4LDX A;  1VQ8 T;  3JCM P;  4NL2 A;  4QVD A;  2E4H A;  2YDL A;  1MHN A;  2Y4Y A;  3RES A;  4KUL A;  5FW9 A;  2HBP A;  2M02 A;  1VQO A;  2E5Q A;  2V8K A;  2XDP A;  1IRX A;  1R77 A;  1UGQ B;  3RMQ A;  2LTO A;  3EG2 A;  2MIO A;  2MPX C;  2D0N A;  3NTI A;  4JJB A;  1EFN A;  5IHK A;  4JZ3 A;  4XU2 A;  4M4Z A;  1UEC A;  3CPF A;  3O5Z A;  4LDV A;  3V7S A;  4IUU A;  4BUG A;  3REA B;  4TVR A;  3GF5 A;  5GAO p;  3EG9 A;  2FHD A;  4J5Y A;  1TXQ A;  1O75 A;  2HBW A;  4QKU A;  1PKS A;  1XTD A;  2CZ0 B;  3M0P A;  2RJF A;  4JRK A;  2K6D A;  1YHQ Q;  2BE7 D;  2FPE A;  1Y0M A;  4DEY A;  4JUV A;  2L2P A;  2PU9 B;  1AWW A;  1IHV A;  4L59 A;  2EGA A;  3OMC A;  1N8R U;  4PFZ A;  3M0S A;  2E6N A;  4C5I A;  2K57 A;  2CSI A;  1N8R C;  3CCQ T;  3QDF A;  4A4F A;  4Q5W A;  2LX7 A;  1ZA2 B;  4QQ6 A;  3NHN A;  3JCM J;  4KUI A;  3A5Z B;  4A4H A;  2RK1 A;  1VQ7 T;  3OYC A;  2HKN A;  3G7Z A;  6AT1 B;  1G3T A;  2JOY A;  3CCV Q;  1OPL A;  3CBM A;  2EPD A;  1T3L A;  4BI4 A;  1Q81 R;  1RL2 A;  2EW3 A;  1O9S A;  5FU6 C;  2XDD A;  4C8Q F;  4EIK A;  3R6O A;  4ZGJ B;  4D8K A;  1N9R A;  2MYS A;  3OSV A;  4QW2 A;  2DFU A;  3V7C A;  3SDZ A;  1UFF A;  5A0G A;  2JJ9 A;  4E47 A;  5EC7 A;  4HT8 A;  1D0X A;  4PKC C;  4IUQ A;  4GY5 A;  1PC0 A;  1VQP T;  2JMC A;  2QQ9 A;  1VQN T;  2QDY B;  3CC2 Q;  5GAN 6;  1U1T A;  3L2Z A;  2RJD A;  1N5Z A;  1YJN T;  1KHC A;  1MND A;  1Y96 A;  2EQU A;  1RAI B;  4RMO A;  3QUI A;  2KRS A;  2PVG B;  5IXF A;  4J7I A;  4WF2 A;  3BY7 A;  2RHY A;  3H0H A;  3EHR A;  3UA7 A;  2LQW A;  2ROL A;  2KK4 A;  3LH5 A;  2IG0 A;  2X4Y A;  1S1N A;  3FRN A;  5J26 A;  2F2W A;  5GJW B;  2LQ8 A;  1D1A A;  1M2V A;  1QWF A;  1WQW A;  2X4J A;  1MMA A;  2AK5 A;  4MML A;  1VIE A;  2LNV A;  3G6E A;  5GAN 3;  4OB3 B;  2O9V A;  1W70 A;  2RF0 A;  2FRY A;  2CP0 A;  2CP6 A;  3JB9 F;  1ZUK A;  2YRV A;  4PJJ A;  3SB2 A;  3REB B;  4N0A A;  2MWP A;  4M7D B;  4EDU A;  2MK5 A;  1OUL A;  4D6W A;  1YIT T;  2QTV A;  2DVJ A;  4RTU A;  4FU6 A;  3OS5 A;  2LCL A;  4KGV B;  5FU7 C;  4F7U B;  4OB1 B;  4LD9 K;  1VQ4 Q;  4ZGE B;  4AT1 B;  2DTO A;  3U23 A;  1HXD A;  1WZO A;  2DXT A;  2EKH A;  1G3W A;  3MEU A;  1AD5 A;  5LJ3 g;  2DJQ A;  3Q1J A;  1JEG A;  4AFZ C;  2NUT B;  2DZ9 A;  3PE0 A;  1D3B B;  1PWT A;  3RBB B;  2A7Y A;  4M78 F;  3JCM e;  2YXY A;  2ZPG B;  2HQX A;  5ECA A;  2D8H A;  2GQI A;  5M9O A;  4E2F B;  1VQK T;  3PIO A;  1T3S A;  1Y7X A;  2BE9 B;  2YWW A;  3T9N A;  1VQM A;  3FJP A;  1Q81 U;  2R5A A;  1TU0 B;  5GAO r;  4EMK B;  1VQ5 Q;  2X3W D;  3MKD A;  1Q81 C;  3M4Y A;  3I55 A;  4J9H A;  5KYW A;  4C0D C;  5HK0 A;  3CC4 T;  2RA2 A;  1HJD A;  2KSS A;  1IZ6 A;  2BTT A;  3FJ5 A;  4M7A A;  4M7D F;  2QQB A;  1QKX A;  1W2B P;  2BKD N;  2DXB A;  4C8Q E;  1M1F A;  2O01 E;  2K5I A;  2X4X A;  4PLL A;  2YUP A;  3EH1 A;  3M5A A;  4PNO A;  2G3R A;  1MMN A;  4EMH A;  1YIJ T;  2MI6 A;  2YLB A;  2FB7 A;  5C0M A;  1N9S A;  1M4Z A;  2JM9 A;  4E7S A;  3S3O A;  3DLM A;  2VXF A;  3KXT A;  3OBY A;  2I0N A;  4A4K A;  1S72 A;  2XU8 A;  1M2O A;  1VQL A;  2K3B A;  4ZTF A;  2DBK A;  2X3X D;  4LNP A;  5CCA A;  3CCS T;  4J83 A;  4CI0 C;  2FRW A;  2W0Z A;  2HD0 A;  2QEX T;  2E6Z A;  4QVZ A;  1Q86 R;  2HSP A;  1VQO Q;  1IO6 A;  1UGR B;  1QW1 A;  1UE9 A;  2VKN A;  2L0A A;  4DEX A;  3V8K A;  1WQ7 A;  2F5T X;  3EG0 A;  4RTT A;  3OQ5 A;  1NEG A;  1WI7 A;  1UGV A;  2C0I A;  3OYB A;  1NBE B;  2NYS A;  3WVE B;  4JLG A;  1PG5 B;  1VQ6 T;  1OOT A;  3JCM h;  3CCM T;  1A0N B;  3JCM Q;  3L2U A;  1WXU A;  2RHU A;  4HKE A;  2MAM A;  1MMG A;  4WCI A;  1Z9Z A;  2J6F A;  1G5V A;  4ZTJ A;  4C8Q C;  1U3O A;  5CQX A;  3MJX A;  1X69 A;  2KT1 A;  4M7A E;  3A8M B;  5KYN A;  3EGU A;  3A98 A;  2L89 A;  4LUE A;  1QCF A;  1GRI A;  2R57 A;  2R5M A;  2O4X B;  2XK0 A;  1RAB B;  4M75 G;  7AT1 B;  1K9M U;  5LJ3 f;  4D8D A;  3JCM W;  1XNI A;  2CSQ A;  4LDY A;  1BCM A;  3M0T A;  4N0A C;  1K9M C;  1F1B B;  3OB9 A;  2JW4 A;  1QWE A;  1UB4 A;  4OMF B;  3CD6 T;  5IN1 A;  1Q7Y U;  1P92 A;  2PZ1 A;  5FU6 B;  2FZG B;  3VV0 A;  4FYV B;  1OPK A;  3RKX A;  2BUD A;  3I56 A;  4EMG A;  2DXU A;  4MDW A;  4FW1 A;  1QVG P;  2DAQ A;  1D1B A;  1UJ0 A;  2NWM A;  3J7A F;  2DTH A;  2M0O A;  3DB3 A;  3CCL A;  1V1C A;  2YUQ A;  3PVQ A;  4JZ4 A;  2K3X A;  4MZM A;  4A4E A;  2XDB A;  3OS1 A;  2RJC A;  3CCR Q;  5D7U A;  2DER A;  2RHI A;  3J81 E;  4M77 D;  4HCB A;  3SEM A;  4PJO A;  1NZ9 A;  3JCM V;  1VYT A;  4XAX B;  4XK8 E;  3L2V A;  1OU9 A;  4BI8 B;  3VYG A;  4OGE A;  1RAG B;  3MPU B;  1UGP B;  3G71 A;  1KD1 U;  2ZPF B;  4M7A C;  3MP8 A;  1KD1 C;  3FDR A;  3UA6 A;  1WIE A;  2AZV A;  4BE1 A;  2CZ7 B;  2QA4 A;  1Q86 U;  1BB9 A;  1G8X A;  1QLY A;  3ASK A;  1Q86 C;  1VIF A;  3MEA A;  2FEI A;  2M1H A;  5GMK m;  4GBQ A;  1UTI A;  4E7H A;  5D6W A;  4KGX B;  4LE9 A;  1X43 A;  3CCV T;  1NEB A;  2VWF A;  2DE0 X;  1VOM A;  2E12 A;  1VQ9 A;  2J06 A;  3JCM c;  3G6E Q;  5FRM A;  2CUD A;  2DYB A;  2CDT A;  2O31 A;  1FXX A;  4F17 A;  4FT2 A;  5CKB A;  4A53 A;  3PTA A;  4HCZ A;  1SPK A;  3ZFJ A;  4OGC A;  1E6G A;  1PD1 A;  4NS5 A;  1UUE A;  3CCE T;  4LUD A;  1ZLM A;  5GAN j;  3EGD A;  5KYU B;  2RO0 A;  3M0U A;  2DLP A;  2CT4 A;  2HDA A;  2OX7 A;  3THK A;  2RMO A;  2V8I A;  3VS4 A;  1LCK A;  1UDL A;  3ZL7 C;  4VUB A;  4M77 B;  3FEO A;  4Z89 A;  3CQT A;  3C0C A;  2B86 A;  1T0J A;  4PL6 A;  2DKG A;  3VUZ A;  1I5L A;  4PJO E;  1FMV A;  1BI1 A;  4OP0 A;  1AT1 B;  3M59 A;  5GAN 2;  3OYA A;  2VB6 A;  1MV0 B;  3BDL A;  1VQM Q;  5GAM g;  4C0D B;  1ZQ1 A;  2JTF A;  3I55 Q;  5LJ5 g;  1VQ8 A;  2K5L A;  2X51 A;  2RN8 A;  2DEU A;  2QG9 B;  4KRT A;  1IGU A;  3VYH B;  5HK3 A;  1WLP B;  4C8Q D;  3PGG A;  4IUR A;  1GFC A;  2DM1 A;  1KQS S;  2QGF B;  4NOY A;  2EYQ A;  4JJC A;  3ULR B;  2RK2 A;  1OV3 A;  5IXB A;  4C0F A;  1OX8 A;  2RH2 A;  3BW1 A;  3QPH A;  1GL5 A;  4C92 A;  3LX7 A;  2JMA A;  1RAH B;  2P0P A;  1ZSZ A;  4Y91 A;  2A28 A;  2ABL A;  2A08 A;  1FWZ A;  5GAN e;  3CME A;  2DD5 A;  2ZZD A;  1I5O B;  2SEM A;  1S72 Q;  1YCY A;  2VUB A;  1VQL Q;  3HHT B;  1TUD A;  4MZP A;  4QQG A; 
#chains in the Genus database with same CATH homology
 1WHJ A;  1WHL A;  2E4H A;  2CP5 A;  2COZ A;  1WHH A;  2HL5 C;  2CP3 A;  3RDV A;  1WHK A;  2M02 A;  3TQ7 P;  3E2U A;  2HL3 A;  1TOV A;  2E3H A;  1IXD A;  2Z0W A;  2CP0 A;  2CP6 A;  1WHM A;  2COW A;  2COY A;  2CP2 A;  2QK0 A;  2E3I A;  1TXQ A;  2MPX C;  2HKQ B;  2CP7 A;  4B6M A;  1WHG A;  2HKN A;  2HQH A;  1LPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...