1IXKA

Crystal structure analysis of methyltransferase homolog protein from pyrococcus horikoshii
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
305
Chain Sequence
b'LSPSMLDKLLRLGYSKLFADRYFQLWGERAIRIAEAMEKPLPRCFRVNTLKISVQDLVKRLNKKGFQFKRVPWAKEGFCLTREPFSITSTPEFLTGLIYIQEASSMYPPVALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNVEFDKILLDAPCTGSGTIHRTMDDIKFCQGLQMRLLEKGLEVLKPGGILVYSTCSLEPEENEFVIQWALDNFDVELLPLKYGEPALTNPFGIELSEEIKNARRLYPDVHETSGFFIAKIRKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase
molecule tags Transferase
source organism Pyrococcus horikoshii
publication title Crystal structure of human p120 homologue protein PH1374 from Pyrococcus horikoshii
pubmed doi rcsb
total genus 103
structure length 305
sequence length 313
ec nomenclature
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F
A PF17125 Methyltr_RsmF_N N-terminal domain of 16S rRNA methyltransferase RsmF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ixkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ixkA02
2PT9A 3KR9A 1BC5A 2QY6A 2VZ9A 2XYVA 3I58A 1NE2A 3ME5A 3NJRA 1X1DA 3O4FA 3PFHA 2ZIEA 4UOEA 4PIPA 5LQAA 1INLA 1ZGJA 2QE6A 3HA5A 3KQOA 2P3QA 2P1DA 3SSOA 4IV0A 3BGDA 3I5UA 3ELYA 3TKYA 2NP7A 3GGDA 2GB4A 4C05A 4G56A 1XDUA 2F8LA 2G1PA 2NXCA 3E23A 2UYCA 2ZTHA 4GF5A 4E33A 1RI1A 3M6XA 4Z2YA 5EGSA 3SVZA 3R24A 3B3GA 3ELWA 3MCZA 2NXJA 5DLYA 5DTQA 3ELDA 5LQUA 3C3YA 2AN5A 4RTPA 3VYWA 3OE5A 5DPMA 4YMHA 5F2KA 3DLCA 5CVUA 3KQVA 2PVCA 5EG5A 4GC5A 1AF7A 2WA2A 2XYRA 4YMGA 1IM8A 1Y8CA 3CGGA 3I53A 4OBWA 5DX1A 5DXAA 4ER5A 5C9ZA 3JWJA 3HM2A 2OB1A 2PY6A 3GWZA 3KQMA 3NWBA 1ORHA 3UJBA 3GRZA 4BLVA 1NV8A 2P7HA 1G6Q1 5D1NA 5K01A 3R9XB 4PYOA 5IH3A 3LBYA 4ER7A 1P1BA 2OXTA 2WA1A 3FUXA 1XXLA 2N47A 3RW9A 2QRVA 1UIRA 2Z6UA 3PVCA 2FHPA 2PLWA 4E32A 5HIIA 3F4KA 3OFJA 3ID6C 4HGZA 5GIOE 3R6TA 2IDKA 3G7UA 3HCDA 4QTUB 4HRAA 4LECA 4R05A 3SGLA 1EJ0A 2JH9A 2JHPA 2B2CA 5FHRA 3X0DA 3REOA 5FA5A 1YFJA 2IBSA 4GEKA 1YZ3A 1WS6A 3EVGA 4RTNA 3Q7EA 4BY9E 5E1DA 3E8SA 5DTMA 2PX5A 4C03A 2AOUA 5EIWA 1G38A 1QAQA 3CJQA 3KPJA 3SX0A 4DCGA 2ZBRA 4AZVA 3LKDA 5ERGB 1SG9A 2YXEA 2NYUA 5EZQA 2AOUB 1JQEA 2DPMA 2R6ZA 4F86A 4F84A 4DKJA 3HTXA 2NXEA 3NMUF 4HGYA 2IH2A 1YB2A 3AXSA 1NW3A 5D1HA 5KQRA 2JG3A 3EVBA 1PJZA 1F38A 5DX8A 1P39A 2C7QA 1T43A 3LGAA 1QAOA 2R3SA 5EMKA 4YUVA 1VBFA 3A7EA 1MJFA 4EMSA 4YUZA 2OB2A 2JHAA 5ICFA 3FTEA 2AVDA 3FZGA 3SXJA 1NT2A 3EPPA 3PLAE 1RI4A 1SQGA 1XTPA 2PXXA 3DXYA 3FUUA 5LQKA 1O9GA 4C4AA 3MCTA 1IY9A 4GOLD 5FHQA 3SSNA 4A6DA 4GUAA 2QRVB 3FPJA 4RTLA 3B89A 3FPFA 4PONA 3P9KA 5FADA 4FS8A 3UJAA 3HNRA 3LCUA 4PYKA 4QDJA 2WK1A 2O06A 5C1IA 2XVAA 1M6EX 1NBIA 2ONYA 4FT4A 2BH2A 4GC9A 5DX0A 5E9JA 3UZUA 3G8AA 2K4MA 4ER3A 2UZ4A 5EHIA 2ZWVA 3LX6A 1JSZA 5EKXA 1L1EA 5F2NA 4LWOA 2H1RA 1AV6A 3IEIA 4XUCA 3EVAA 4E2XA 1G8AA 3HVHA 3HA3A 2CWWA 2Y1XA 3CJTA 4RSRA 3T7TA 4CKEA 4E70A 1BHJA 1O9HA 5EEHA 2P35A 3THSA 8MHTA 4CTJA 1SUIA 3LHDA 2VP3A 1O54A 3JWIA 5EVJA 3D2LA 4E30A 3PB3A 4OBXA 1D2CA 2ZZKA 4QPNA 5E2AA 2P8JA 1YF3A 4PYIA 5GOZA 1L3BA 4RVFA 4V0QA 4KWCA 5DM0A 5E8JA 3OE4A 2I62A 3DXZA 3T7RA 1L3CA 3OCJA 1VLMA 3HCEA 5CUQA 2H00A 2EX4A 2GH1A 4RVGA 1NKVA 3M70A 3GO4A 2DULA 5E1OA 4U7PB 2ERCA 3TLJA 3KQWA 4V0RA 5K05A 3QOWA 2HR1A 4AZTA 2BR3A 3RODA 3GJYA 4OQDA 5E1BA 2ADMA 4IWNA 1SVUA 5GM2A 2PGXA 2PT6A 4R6WA 4Y30A 1WZNA 5CVDA 1MHTA 3ER8A 4AX8A 3FTDA 3LDUA 1F3LA 2CMGA 1RI3A 1XDSA 3DR5A 4GBED 1JG3A 2ONZA 3DULA 5GP1A 2OO3A 3G89A 5T6BA 3OZTA 2EFJA 1U2ZA 3I9FA 1ZHFA 5LQNA 3P97A 2AN4A 3C3PA 3DMFA 3ORHA 4RVHA 5HFJA 5LQCA 4POOA 5JR3A 4FR0A 4KDRA 4PGHA 3FTFA 3LECA 5HIMA 1ZGAA 2C7OA 4H0NA 5EC8A 5FWAA 1KYZA 2YUIA 3IYLW 4GOOD 3UJ7A 3DTNA 2ESRA 2FYTA 2PXAA 3GXOA 5ICEA 2P41A 3G2MA 3BGVA 3PTAA 5K0GA 3BKXA 2B3TA 5DXJA 1D2HA 4FSXA 5DSTA 1JQDA 4FGZA 2P3OA 2JH8A 2GPYA 5EIFA 2I6GA 4BP3A 1NW6A 3DXXA 2PBFA 4K6MA 3B5IA 4FZVA 1VIDA 5G02A 5HOQA 2HNKA 2NXNA 2ZW9A 3G2QA 3HCAA 3MTIA 1ZG3A 3KQQA 4LG1A 3KQYA 2BR5A 3PFGA 3V97A 3NW9A 4ER0A 2GAFA 5M5BA 3G2PA 2CL5A 2VS1A 5EKUA 4C07A 3BXOA 3OZSA 2OPBA 2P40A 4HG2A 2G71A 2XYQA 4HSGA 3OU7A 4FSDA 4P7KA 1VP9A 3M33A 3CVOA 3GRRA 4QVKA 5EMMA 3IV6A 2OKCA 1EG2A 4U7TB 4HTFA 4XCXA 1DL5A 1KIAA 2PX2A 2YR0A 3DUWA 4R8RA 5T67A 2ZIFA 5DM2A 5EEGA 5U4XA 2ZCJA 3FRHA 4X60A 3UJ8A 5ICGA 3KKZA 4WXHA 1JSXA 3G88A 4CKBA 5K0EA 5K09A 3FTCA 3P2EA 5CD1A 3K6RA 3LPMA 5HIKA 3QV2A 1OR8A 4R6XA 3GCZA 2P7IA 3MAGA 4PYLA 2JHCA 3C6MA 3NWEA 3VC1A 4EQZA 1JG4A 2OY0A 3KQSA 5GIPE 3UJCA 3M4XA 3AY0A 3NDJA 3LSTA 1RI2A 3TR6A 4BLUA 2AVNA 4GQBA 4QVGA 1RJDA 3A26A 4RTMA 2C7RA 1YZHA 4E2WA 5CVEA 3B3FA 5EOVA 3G5LA 5B1SA 1VPTA 1VQ1A 3CCFA 4C04A 1AQJA 2EG5A 2IIPA 4RVDA 5P8WA 5LQRA 1FBNA 2HMYB 4EKIA 1SQFA 1WXWA 5FTWA 1R18A 3FPEA 4PNEA 1R8YA 3PT9A 1PRYA 2ZBQA 1WXXA 3EEOA 4XUDA 3M6VA 1SKMA 3EVDA 3V8VA 3KQPA 5CCBA 4PWYA 5CVVA 2ZFUA 3MERA 2ZBPA 1NBHA 4X1OA 3TM5A 4ZTBA 4L7VA 2V7EA 5IKMA 1XJ5A 5GM1A 3HA7A 2ZLBA 3EVFA 1XVAA 3EMBA 4PINA 3UBTA 5DTRA 1Q0SA 2AS0A 5EPEA 4HH4A 5LSAA 3G2OA 2UYHA 3RIEA 5BW4A 5EHGA 1VP3A 1QAMA 3FYCA 2FK8A 3GU3A 3LL7A 4PCLA 2XBMA 3KPYA 4YV1A 1UWVA 4PIMA 3B3JA 1BKYA 1UFKA 4OX9Y 2BM9A 1KXZA 2OYRA 5DWQA 4DM3A 2AOVA 5BXYA 1JG2A 3A25A 2PWPA 3EGVA 3AWIA 2Z6QA 1RJEA 2B78A 2BR4A 2HTEA 4HTFB 4MIKA 5KS2A 2NP6A 5HILA 3UJDA 2CMHA 4IV8A 4DA4A 5HIJA 2YTZA 3TKAA 2C7PA 2Z6AA 3BUSA 3KPUA 1VE3A 4RYLA 5FQNA 3E05A 3G8BA 5CCXA 3DLIA 3CBGA 4CWAA 1M6YA 2BM8A 4GOND 3TQSA 3LDGA 5E1MA 3NVMB 3P9NA 9MHTA 1NW8A 1KP9A 1SUSA 3TOSA 3E7PA 5EMJA 3P8ZA 4YUYA 5CM2Z 4X41A 1X19A 1NW5A 3PX2A 1KPIA 3FPGA 3G5TA 3IHTA 2PX4A 1R6AA 3AXTA 4GOMD 4M38A 3SR4A 2OBFA 2XVMA 2NNWB 1EAMA 1EQAA 4M37A 3GRYA 3MTEA 3BWCA 3EVCA 5DM4A 3EVEA 4M7RA 3BGIA 3WSTA 2EJUA 3BWBA 1JR4A 2ZIGA 4BP1A 5DT2A 3PS9A 3GNLA 3H2BA 4EK9A 5BP7A 2Q41A 2YVLA 1N7JA 1JTFA 2AOXA 3DP7A 4QTTB 1HMYA 3HVKA 3M6WA 1VL5A 3JWHA 4E2YA 5E9WA 2HWKA 3NDIA 3MHTA 7MHTA 4KVZA 3BWYA 2AOTA 3EGEA 2GA9A 3HCFA 3MQ2A 3PX3A 4RWZA 4ISCA 3FUVA 4IKPA 3EVZA 5K0FA 1M0EA 1KPHA 3B7PA 2VDUE 4WVLA 1RJGA 3A4TA 4PGGA 2VDWA 1FP1D 1FP2A 2FRXA 1R00A 4ER6A 5CVJA 2JJQA 5LQJA 1FJXA 3UWPA 2IFTA 5EQJB 3UA4A 4AZWA 5JUWA 3HCBA 3CKKA 5E8RA 4KW7A 4PYNA 1DUSA 4KRGA 4OQEA 4RTQA 1JTEA 3M6UA 3R3HA 4YV0A 1JQ3A 1BOOA 4O29A 4X61A 4RTRA 3O31A 4KIFA 3GRUA 2PX8A 3DMHA 5K0BA 1NW7A 2I7CA 1IXKA 2GS9A 2IDJA 3LKZA 4P7GA 2OZVA 4B17A 2ZWAA 2IH4A 1KR5A 4EKGA 5K03A 1DCTA 1ZQ9A 4HC4A 2I9KA 4CTKA 3HVIA 3BZBA 1N2XA 1YUBA 3AJDA 5K0CA 1NV9A 1YFLA 2IBTA 4DCMA 1TPYA 1RI5A 4CXMA 2QM3A 4NECA 3UJ9A 4P58A 3SMQA 3LCCA 2IP2A 2G70A 3BWMA 4RV9A 4MHTA 3THRA 3EEYA 5DRTA 2B9EA 1XDZA 4KIGA 1X1AA 2ZZNA 2PSSA 1N7IA 3EMDA 1G8SA 1XCLA 2ZVJA 4YV2A 5GWXA 4CKCA 1Z3CA 1ZKDA 1R74A 1WY7A 3I64A 2V74B 5FUBA 1P1CA 3JWGA 5EMLA 4LWPA 3P71T 1G60A 3P9CA 3SM3A 1EIZA 2YQZA 4P7JA 4C06A 4YUXA 1QZZA 5FQOA 3OU6A 4RX1A 4QQKA 3KR1A 4XUEA 1KYWA 4DF3A 4RTOA 2O05A 2Y1WA 2UYQA 4MQ4A 1I9GA 3FPHA 3QOXA 5DM1A 5E9QA 1KPGA 3KU1A 3R0QA 2KW5A 3KQTA 5E2BA 3LBFA 3KPVA 3BT7A 2AOWA 2PJDA 3P9IA 4QQNA 2QYOA 4ATNA 3ER9A 5HZMA 1QYRA 3NVKI 2FCAA 2G72A 3L8DA 4QPPA 5FCDA 4FP9A 3DMGA 5GINE 3KR0A 3OU2A 5DSXA 5H02A 5LR6A 1XCJA 3A7DA 3NTVA 5FWDA 3TM4A 3ERCA 2UYOA 3A27A 1B42A 1FPQA 3CJRA 3KPWA 4E2ZA 5KYGA 2ZZMA 1TW2A 3DOUA 2BZGA 4FT2A 4MTLA 4QDKA 2AOTB 2H11A 3Q87B 1EJ6A 1JG1A 2LD4A 3KR2A 2IGTA 3U81A 2O0LA 5K8VA 5MHTA 3OFKA 5KVAA 3LDFA 3P2IA 2HV9A 4M36A 3TMAA 4A6EA 2AN3A 3SSMA 1WG8A 3VC2A 1AQIA 2FPOA 3K0BA 3OPNA 3O7WA 2YXDA 3C6KA 4DZRA 1R8XA 2ORED 3T0IA 5HEKA 5DRYA 5K0JA 1TW3A 5T64A 1H1DA 3C0KA 2YX1A 4DQ0A 1L3IA 4MWZA 2PXCA 4YUWA 5FULA 4KDCA 2B25A 4OA8A 1I1NA 1RJFA 3UA3A 4C08A 2A14A 2ZSUA 4E31A 4EVIA 1I4WA 2GLUA 4PYQA 3GIWA 4P7FA 1G55A 2ZULA 2YXLA 3FYDA 2VDVE 4RTJA 2AR0A 1P91A 2PWYA 4RTSA 3TFWA 5K0NA 3HCCA 1ORIA 3HEMA 1L9KA 3DH0A 5F2OA 10MHA 1HNNA 5CIYA 4R8SA 4X63A 3CC8A 2PKWA 3UJ6A 5C0OE 4OA5A 3LCVB 4DMGA 3GRVA 3HVJA 3MGGA 3MB5A 3OZRA 2G8NA 3TPZA 3FRIA 3VSEA 4AUKA 3BKWA 1X1CA 2IPXA 2O07A 2AZTA 3FUTA 1V39A 5K0LA 2E5WA 2FK7A 2IH5A 4F85A 1D2GA 5BW5A 1QANA 5FA8A 4Y2HA 2P3LA 2PV0A 3T7SA 3TRKA 3GDHA 5EZSA 5KQSA 3ELUA 3EGIA 3S68A 3KHKA 4JXJA 4PCAA 5ICCA 1X1BA 3FUWA 2O57A 3ANXA 2EJTA 1KHHA 4PYMA 4BLWA 1Q0TA 3P2KA 3HP7A 4PYJA 4AZSA 3UFBA 2CKDA 4RTKA
chains in the Genus database with same CATH superfamily
1G2QA 2VPZA 2F5GA 3Q5EA 3ZZ1A 2O8EB 2H16A 3GDOA 1HNWB 3KVNA 4DZTA 5EWMB 4O0LA 3OE5A 3Q86A 4AO7A 3O9ZA 3H9EO 3NM5A 2KM8C 4U7GA 1GKYA 3ETEA 1G1AA 3OLAA 1M8KA 3VHXB 2WKPA 4UT4A 3ZWDA 4CGZA 2N47A 2WRMA 3H40A 2HHAA 4OHXA 3N8DA 1GV0A 2HAEA 5F1YA 4H3HB 4H7PA 3PW4A 1P6UA 2Z2LA 1RTTA 3KLIB 5A03A 2W6JD 4DRYA 1J2TA 1R5BA 1JX6A 3H4DA 3E9EA 1TA9A 2VUUA 1Y98A 1ZGHA 1HQ2A 5FV7A 2YL2A 3EC1A 1ISMA 4ZVSB 2QZ9A 5ICFA 3QHPA 4JDPA 2NWQA 3DPSA 1YMVA 3I04M 4EKEA 3I1YA 3ZDEA 2ZYVX 3FPFA 1BX0A 1HSOA 4XB6B 2RH9B 4AT1B 3G8AA 1U3DA 4BRZA 4A4JA 1YDFA 4OMUA 5B4UA 2BKVA 1X3SA 4F56A 3OPYI 4LXYA 2HCBA 4KYUA 4ZOEA 5FI1B 2J3LA 3ISND 4GYWA 2XWJI 3UXHA 1U1QA 3FOWA 2A4KA 1Q77A 2VVTA 1EP3B 3P4XA 2K5UA 5B3AA 1RKQA 4BQRA 5DHRA 5IAAA 1IHYA 1YAHA 4P7VA 4XM0A 2O54A 3FKSD 4XKJA 5F0UA 1EA7A 5AK3A 4FF4A 1PHPA 4CM0A 2P9GA 1NTRA 2IRXA 1YZYA 2B7BA 3Q15C 5LYJA 2OXFA 3DONA 1D09A 4HHJA 5JV5A 1J09A 1RLOA 1CJTA 2R79A 1NW6A 2HXYA 2RDIA 3CC7S 3VJRA 4OZLA 2QIFA 4YRNA 1CUHA 1KH1A 1B7GO 2FW6A 2G71A 3ZY2A 1THGA 4M60A 3H18A 5DM2A 4KUGA 3VH3A 2Y0SD 2FWRA 3A0UA 3NOQA 4BO0A 2XA1A 3QATA 1VYUA 3ZLBA 1ZRMA 2Q8QA 2H2HA 2NZ4A 2PKEA 3E03A 3D7KA 4FYPA 4LJRA 4HX2A 3CF6R 3VH2A 1OZHA 4RL4A 4BLSA 4R8MA 2YJGA 4WLEA 4BTEA 2FMHA 4EWLA 1S2IA 2FPSA 1DAKA 5SZJA 1UPBA 5BUQA 4GOKA 1YGYA 4MAAA 2X4GA 3CT4A 4O08A 4EY4A 5KX5A 3AF0A 1X74A 1HFEL 1WELA 5IV4A 1NM2A 3LI2A 2X5OA 5HRAA 1KSGA 2X1AA 3UATA 4ZPTR 3QPBA 1NG9A 3DKPA 1RRVA 1QYWA 4GOMD 3U3DA 4C48A 1XQIA 2JCXA 4IH1A 4CIXA 1HLFA 3OIYA 2FPIA 3IRXB 4OGWA 2EQAA 3M6WA 3CINA 1EK2A 2VQEF 5DG9A 3I2FA 3M2UB 2CD7A 1T2UA 4PS1A 1WCIA 3B1VA 1FP2A 2ZC3A 1GFSA 1CY0A 4MJKA 3IAM1 3TTTA 4RTRA 1NR1A 3MVEA 2YZMA 2XNQA 1LI4A 1AT1B 2HSWA 3BWMA 4PLVA 5KVVA 3T9EA 4LHYA 2IEBA 2Y0PA 4U9UA 1MT0A 3O9VA 5HQ3A 1QGZA 4EMDA 3NGSA 1WD5A 3P9CA 3ZHSA 2AF4C 4LJSA 4XUEA 5ALDA 5DLFA 3T1VA 2PGCA 4ZVKA 4GKJJ 1X8DA 5C25B 4NMXB 2VAWA 3ROXA 3SN6A 4DJJA 3ENQA 3MMAA 3CZMA 5HUHA 5KTMA 1QLJA 3DEHA 2LTAA 1P5ZB 1G66A 4D4GA 1MD9A 2YUTA 3WFJA 5H3CA 3HO1A 3THYA 4PPYA 4YWHA 5C3MA 1I7SB 2WB1D 5B0AA 2CG4A 2CWDA 5BV2P 3DGEC 1WAMA 4GMHA 4CF6A 1V71A 4UUOA 2VNAA 5KWEA 3HEMA 3V1MA 5ED0A 3SQGB 2AZTA 2HHVA 4FGLA 2PV0A 3FOBA 1L4NA 3L5OA 3RUBL 5DNYB 5BQPA 4WH0A 5G4LA 2BANB 4ZIWA 3K71B 4O4JB 1PR3A 1FJGF 4U67Q 3DVQX 4DDMA 1E2BA 5DJ5A 1VC6A 1NO8A 3SQDA 3UGJA 3D5TA 2EBWA 1AGYA 2HK6A 3VWSA 2J7PA 4N0DA 4MNTA 4HLUA 5DTQA 2O3UA 3T9ZA 3LD9A 1AOXA 1XMXA 4IH6A 5K4AA 3QVMA 4HR2A 4HEA1 4H4KC 3DLHA 4V1CA 3O74A 4MEJA 2W6QA 5T7BA 2VKRA 4BMVA 3DZFA 2YIDA 1B6RA 1JLCB 1OAKA 4ND8B 2XIJA 3B5EA 1U26A 1Y3KA 5E1DA 1GP2A 4QLAA 2C5HA 1LLUA 4P3KA 2GXSA 3DS8A 1H6DA 2QSZA 4C0HA 3JQCA 4IO0A 5CNIA 4QYMA 3BILA 4TRNA 5AW8A 2F3PA 3L7BA 2LDBA 3VHRA 2A1UA 1E2QA 1BCSA 1U2GA 1MUUA 1Y5NB 1EGAA 3E7XA 4BVGA 4UEOA 3QH4A 2QL5B 4Z7OB 2Q1SA 4UEWA 1NHWA 2IL1A 1N56A 2D1SA 3PFNA 4WZAE 1BCRB 4NYJQ 5CGQB 5E33A 1FX2A 3LUAA 5E4YA 1S8NA 3IT1A 3E8XA 5D86A 5FTNA 1BHJA 1TTTA 5J2MA 1ZCZA 4QIHA 3IEKA 1E94E 4RL1A 3LDAA 3ZLJA 4OYLA 1OZFA 4RCZA 3HHNB 3EY4A 4X65F 2VYND 5CVDA 3ER8A 1WXFA 1P3DA 4CM9D 2WVGA 1P29A 2XMSA 4AQYB 3Q0TA 2KI5A 1V3SA 1OROA 1R9MA 2B0CA 4G1IA 2XMQA 4ARBA 3PF9A 4OGGA 4XFKA 5A06A 4MUAA 5LOVA 3C7CB 4DMFA 3DNMA 1XJWA 4XYEA 4B46A 2BPOA 2Y1IA 5HOQA 4GBJA 4KMSA 3FSGA 3B51X 4NAVA 1O9BA 5IMSA 4BKQA 3QPUA 6CHYA 3A1WA 3F6PA 1VQ4S 5KTRA 1TZKA 3JSBA 1RT7B 3KKZA 4ZVPB 3QU2A 4IVNA 1H5QA 5J2QB 4AMVA 4RA9A 4QPXA 4QVGA 3RARA 4KFCA 3CDUA 4QXPA 3MS2A 3PI6A 4YLYA 1JHXA 4HNQA 4XWYA 5LXTF 4XB2A 1SJQA 1WOSA 5EQDA 1T9AA 4B4WA 2KBFA 1SOMA 1CZOA 4WBXC 2MSEB 4ZARA 5AXNA 3W8PA 1WJGA 2VH5R 2CYCA 3GAZA 5AH0A 4WASA 5IVDA 4QG7A 5M2RA 3OF2A 4I1PA 3U62A 1RCOB 5HILA 3ZTQA 2UXDB 4YJDA 2AX1A 3NWJA 4F5DA 2VDKB 4I7FA 5DF1A 2F6RA 3BEDA 4J6FA 3L2OB 3O95A 4YJGA 3OTHA 4MW6A 1CQMA 4E07A 3DD1A 5BORA 4JBIA 5K4GA 2QRNA 2NZVG 3L5KA 3M49A 5DT2A 2SCUA 4RQAA 3AF1A 1TKZA 2FWIA 4P2FA 5A9TA 3DWFA 3IM9A 1KNZA 1QG2A 3OCUA 4ZAXA 3IJRA 4HNSA 1CETA 2GCGA 4J7XA 2CCJA 1S5PA 5A76A 3MCNA 1X7YB 2RAVA 3I0MA 3Q7IA 4MWBA 1Q8BA 2AR7A 3EICA 1JTEA 1BOOA 4DOZA 1EFCA 1H2VZ 1QFSA 3AONB 4DUYB 1EVEA 3IP8A 4HC4A 1MO4A 2DKFA 3P0IA 4UUNA 2JI4A 4U9IS 5J58A 3RYCB 1JA1A 5KYYB 3KCQA 1AZSA 3TXYA 4KPCA 1F3FA 1XCLA 2OHOA 3QAEA 1TR0A 1PUIA 4G6VB 4WBNA 3GJTA 4RIFA 3TLKA 4WYWA 2NZYA 2O05A 3QFSA 4M7WA 2JS7A 4DBLC 5KNCA 4FHGA 4AQYF 2AEMA 5ECGC 3ZV7A 5C2CA 3REQA 3ED5A 4ID3A 1VBYA 4OIXA 1NSYA 2Z95A 3LLCA 2GJ8A 1RW4A 4NLVA 4EA8A 3BJMA 3QNWA 5CZXA 2W0SA 2V4UA 1AKYA 3VSDA 2Q99A 2Q6KA 3TFWA 3ER6A 1P2VA 2P90A 2WNIA 3RFUA 2PKQO 1KVQA 4PTLA 3CNBA 5FBZA 1R4NB 5T14A 1UZDA 4CR8A 3EGXA 4IKEA 3GL9A 2FVCA 3OTBA 1WZEA 1QM9A 3PRYA 1MN7A 4D3DA 3R3ZA 3T3OA 4WFAQ 3SZUA 2UVRA 4MGEA 2YJ4A 3G5UA 4LQ4A 2AFIE 1P9NA 3N2KB 1S4MA 3TO5A 4ND1A 4MJXA 4ZCRA 1RJWA 3PJDA 4L7QA 1XQXA 2IV2X 1GHTA 3FVYA 5CDYA 5K0TA 3CJ4A 3D1VA 4TROA 1RLDA 2YTCA 1PR5A 5B58T 5LC1A 3TLYA 1COWD 2A30A 1C7QA 2EGGA 3OLBA 3W61A 3H9JA 4LRYA 3UT0A 4M5DA 1WUKS 3Q7SA 1F5BA 1W1IA 2JI8A 5MFZA 4LXIA 1B1CA 2XMZA 3QKRB 1DAGA 2GQCA 4YPFA 3SS9X 4FFVA 4GPD1 1UF9A 3IO5A 4XLLA 1Z0AA 1Y42X 1TK5A 1FMJA 3DWIA 4MUBA 3EPIA 3S3TA 3N7AA 2PE5A 1WPQA 1U9IC 1S1UB 3H5RA 1D9FA 4ZVHA 2OGWA 3THOA 3FNBA 2VC0A 5IYZA 2GZ2A 2D0PB 3T41A 1JU3A 4LQ9A 4J4TA 1U1RA 4USUA 1KQ3A 2XQVA 4CWBA 4RC9A 2MJNA 4IOBA 1ONBA 1C1CA 1GRCA 3TQOA 3O8WA 3F9CA 3BSFA 3RRHA 4M99A 1E6VA 2JAHA 4YOEA 4NR0A 2HQ1A 3HI4A 3F6SA 4EHIA 3CF4G 2R25B 3RJMA 4QZVA 4L4RA 2HFVA 1MDFA 1JWBB 2OWEA 2VA8A 1X7DA 1JUDA 4I81A 4A8WA 1E1NA 1GZ7A 1P7YA 4HFRA 4TLCA 1PYOA 2XO7A 3FSEA 2AYBA 2HY7A 4BGUA 4N5SA 4GC7A 4PXEA 1U7TA 3LPCA 5DCLA 4B3HA 1ST3A 5JD5A 3MAAC 1VIDA 3ZZNA 1F8UA 3PCXA 4URZR 5CCMA 3LLMA 3UQYS 4DIUA 1X4AA 1NC1A 3ZI7A 2BGUA 5GJCA 4QU9A 4DSUA 4WXHA 5BT9A 1Q0ZA 3LPMA 3WP1B 1U6BA 3D6NB 4WIIA 3HRHA 4KQXA 4ZTZB 3LSTA 3AB7A 1YZHA 2PLRA 3RRFA 4OKNA 3G5LA 1BWRA 2HMIB 3FBBA 3PFEA 1TUBB 3QVVA 1GL6A 1Q44A 5AO9A 4XUDA 1QWSA 2ORVA 4TRJA 1SL0A 4GSKA 3BTVA 3WGOA 3PEVA 4WOKA 4OTZA 4DLTA 5A5FA 2GVDC 2D1TA 4TQGA 3AR8A 1VYTA 3LT0A 3ABZA 1DNPA 1R8AA 5DWQA 5DIZA 1I51A 1GSIA 2JFKA 4M2LA 4PE5B 3Q0AA 3DLIA 1W4BA 5ETVA 3RB6A 3L0PA 3M6AA 3RO7A 3E7PA 3EFEA 4Y2AA 1PFWA 4O5OA 3FPGA 1NNI1 4AWAA 4JJ7A 4ZDKA 2ASLA 3PDIA 1IFXA 1S0OA 3H97A 3MS7A 1IR0A 4BGDA 4LF9F 5JUMA 5IT9Y 2O2EA 2GCEA 4GX1A 1VGQA 1Z6GA 2BONA 3ZY5A 4AL7A 4O02B 4D46A 4X9XA 3ZGVA 4W6QA 4LXQA 1N0WA 4JMLA 4TVAB 5F5LA 4NXMJ 4DV4B 5K0CA 2DC1A 3F49S 1S3FA 1LSUA 2O3RA 5TVGA 3SI8A 1NLZA 2VG8A 3C85A 3O4IA 2DR6A 6FDRA 4RY8A 5GWXA 3WKEA 1KMMA 2W01A 5ESXA 3V6DA 4A0RA 5GADI 3MEGB 2O48X 3KEMA 4HF7A 1FXSA 3ABRB 3EZGA 4WFKA 2WV9A 4JNCA 3F67A 3JQAA 4QPPA 2JSXA 4F9TA 1G5FA 2BEKA 5BRJA 4R0MA 4UAGA 4G4GA 3U7JA 1D2EA 3O03A 3A3NA 4BFUA 4O4IB 5ENZA 5TDHA 5D3KA 4BAZA 4A91A 2R8GA 1G6BA 2IMWP 4NLYA 4DA8A 3UA3A 1UKYA 5I9BA 1KWKA 1IMOA 1FS6A 2ZQZA 2PWYA 3DAYA 4JUDX 1DMRA 1E5QA 1N32B 3VNRA 4CMGA 4ESVA 3UWMA 1NJXA 5FPPA 2AFRA 3OZUA 1VCNA 4YJGB 2JFWA 4DIDA 4JI7F 1UW4A 2FI1A 2ZPUA 1S6UA 3UN5A 5MN6A 3WHKA 1T5SA 2DHRA 1GUAA 1M6VB 2RQMA 1J20A 1TMJA 5K3FB 2WWIA 3RE1A 4D2IA 2UZIR 4DV2J 2QY6A 2R2UA 2HJHA 2HIQA 5AR1A 1T3HA 2FSHA 3VUFA 4Q82A 1A82A 2ERYA 1RI1A 4B4DA 2V6MA 3C3YA 1YDEA 4ND8A 1RTDB 4LV5B 4D26A 4ZVMA 4KLNA 3QX7A 3PJXA 3AIIA 3ZE0B 2PH1A 3L0OA 4Y0NA 1ADCA 3AKDA 1X8LA 5LLSA 2CJ9A 3A1CA 5CBPA 4A0FA 2ZM6B 5LMCA 1NQWA 3T9DA 5E4FA 2Y1EA 3JZAA 2G13A 3UD4P 4TYBA 2NSLA 4OZ5A 3KEFA 4E4YA 1ZMXA 4R2JA 2BLNA 4MVXA 3OFVA 5H4HA 2C31A 2OCLA 1T6BY 3N6LA 2ZJ8A 4UBKA 3BH7B 1F9EB 2J59A 5DNCA 1L5RA 3U16A 1RIFA 3Q8VA 1BVYF 4KV7A 3H5OA 2JANA 3HY3A 4K9MA 1IWAA 3D59A 3LYLA 2XF2A 2BH2A 1FP4A 4GC9A 5IQ6A 3W9HA 4PSKA 4MK8A 4QGBA 4EKYA 3GYGA 1GKUB 3LVFO 3TZWA 1Z07A 2YNGB 1J0EA 4G0PA 3CW2C 3GDWA 4EGSA 4HEA6 1MMNA 4XRGA 4F3CA 1NHGA 1S2OA 1CEXA 1HOTA 1HUQA 5HS4A 3GJYA 3N9UC 4Y30A 3OQIA 2ONZA 2PCJA 2CL7X 1F8GA 1JEJA 1VRVA 1OWLA 3C8YA 4IM7A 2QSWA 4QEKA 2L42A 5EJGA 2WQ7A 2H2AA 4EGAA 1G3MA 1II8B 3ESBA 4ZLNA 2PZGA 2MYNA 4K9LA 2XMWA 4G1QA 3G6YA 1P1JA 1U24A 1MNQA 4YRGA 3FCWA 3I52A 2HGNA 2PPLA 2ZREA 2HWIA 3JQ7A 4JI8J 1EM8A 2VYNA 3KYDA 1SRRA 3IV6A 5LBIA 2AJ8A 4IINA 3K70C 2HM7A 1BS1A 1KI6B 1E79D 2YV5A 2HFUA 1Q3TA 3VNAA 3OIFA 4MUJA 5CB4B 4QUAA 2ZUSA 3QFCA 2YCBA 1HIYA 4GPTA 1GGNA 1RI2A 4P33A 2J0QD 2ZSAA 1Z1ZA 4QWCA 3IMEA 5I7HA 3HGTA 3I42A 1XEXB 3ICVA 4OV6A 5JQGB 2F3QA 1Y7LA 1PU2A 3VBCA 2X9QA 3JAKA 1HMPA 3P4UA 4DRXA 2GX8A 3DHXA 3K57A 4EGLA 5L38A 3DJYA 3OHAA 5H70A 2BHRA 4IY1A 1R3DA 2A18A 1NJ1A 4KR0A 3AUUA 4XSHA 2OV3A 2E87A 5D5HA 3OIDA 4O5AA 5FF9A 3ZK8A 1DLOA 3VJLA 4P4NA 4LY9A 1YQHA 2N75A 1QOZA 5FNVA 2YX7A 3BGIA 3ZD9A 1GGMA 2YHIB 1W87A 3CPJB 1SXPA 3ESXA 1L5MA 5EJ7A 5KG5A 4HLQB 1UKAA 1C0UA 2FKAA 2WVEA 3DGFC 3CRMA 4QR0A 3ZDDA 5CVJA 3C3DA 1CR1A 3HP6A 2E4AA 5AVOA 3LZDA 4FYYB 1VMKA 2IC3B 2ZRFA 1VA4A 2GS9A 3HADA 3VR6H 3JY6A 2BMJA 3DLKB 1HFJA 5CW1A 2PMEA 2CNWA 2ZZNA 1DQ9A 2SKDA 3Q3GE 3OQPA 2H4XA 2UZ3A 4NDZA 4CLOA 3G82C 4LYHA 1X5OA 3K31A 3OU6A 3MURP 4BQFA 3ZHCA 2GBLC 3FPHA 1HDZA 4RHUA 3OR2B 2QGFB 1PEYA 1GOTA 3AT1B 2XGOA 4MQMA 4J8PA 5DSXA 5F9NA 3ICOA 1B42A 1D0VA 5IC6B 1I30A 1JJVA 3IWNC 1JWLA 3BORA 4V0NA 1HDIA 1JPUA 3WDMA 2QX7A 1Y1SA 1PYTA 3ZHBA 4G9EA 4RZSA 2R1VB 3ANMA 3I2HA 1TLTA 2YYZA 2SICE 1CIPA 1XD2B 3QRRA 1T95A 4MPPA 2U2FA 3ZUGA 5K6RA 1TUVA 2R11A 3PVZA 4R31A 4B81A 3T35A 1NJWA 1NFQA 3E8MA 1CERA 5L46A 3HRKA 3ZZZA 4M8SA 3TNJA 1ZN2A 2V34A 1SKQA 4YS2A 2J9ZB 3GJZA 3KSAC 2GKOA 2O8DB 3IQHX 1GAOA 3EDCA 2IQ5A 4U7WA 3KG0A 2XT6A 2OP5A 1WUIS 1Y8ZA 4PAGA 3DEKA 5KT2A 5EVCA 2MYFA 4DJFC 5FWYB 3TZ6A 2XWBF 3E7DA 5CYMB 1G5PA 2WMNB 2IYOA 2H65B 1KFSA 4LSNB 4EI2A 4OP3A 4JJ6A 4I66A 4JUFA 4D0GA 5IAOA 4XWOA 3X0DA 3CUUA 2PGLA 3EVGA 4I5FA 2JLWA 1YJVA 2TRSB 2RI6A 1IWGA 4H9GA 5BV7A 2QYCA 5F3DA 1JLBA 1YKSA 2R6ZA 4HGYA 5KHLB 3AXSA 4Y9RA 2GPNA 3HZOA 3IMCA 2BVZA 3TRHA 2QZZA 1HBNB 5JTTA 4YQEA 3CE9A 1HA3A 5DOZA 4R0JA 4YN3B 4YB7A 2ACWA 2L41A 4F8RA 3QLHB 5EXDA 2WOOA 4P31A 2TMYA 3LAKA 2EFPA 2YKMA 5ALHA 1MOSA 3ZWBA 1JXEA 1RWOB 2J5AA 3CQ9A 2VICA 3Q8XB 1OA1A 3IBCA 3KYBA 3GR0A 4MKIA 3BSCA 5C8YB 1XNGA 4XD7A 2BBSA 4BN0A 3ONDA 3QOWA 4P4TA 4J9QA 1G5IA 2Y1KA 1O94C 4R6WA 4NCGB 3DDOA 1IN8A 3NHKA 4ZU1X 2EKNA 4AP6A 3QVUA 3K94A 5JFGA 3BRSA 2PA3A 3G0OA 4FIDA 1GUYA 1KYZA 4PFQA 2QIPA 3K59A 3WZ2A 1NU6A 3PTAA 1GNQA 4H6VA 3RJTA 2WF5A 4R5MA 4OOFA 5I7WA 3M8YA 1GU7A 3VNSA 2ZAIA 1NUQA 1NVVQ 4PAQA 1L5ZA 3H65A 1RXIA 2H5JA 4Q16A 4HTFA 3U09A 1IVSA 2GIQA 4ZI7F 3QMVA 4ZOAA 3OFND 5K09A 5LZ9A 1YR7A 3KWJA 1BRTA 2JGMA 5FA6A 3RM3A 1H23A 1UA0A 1RJDA 1CY4A 4PAMA 4XTRA 1Q14A 4KXXA 3FLEA 1AQJA 3K70B 4MR8A 2IT1A 1WHWA 4AY3A 4MIWA 3O1HB 2XBLA 3CNOA 4MS4B 5A2QA 4K7JA 4FVTA 4F6RB 3WXBA 4YRIA 1JKMA 5CCBA 5CVVA 4NG4A 2QTHA 2W2OP 4AKIA 1ZJ4A 3PYMA 2A35A 5AI5A 2VFUA 1ZAWA 5GAHI 4Y6GB 3V33A 3AWIA 5AKIA 2RBEA 4BMCA 3UHJA 3AYZB 4UTOA 1IM5A 1WUJS 2JCGA 3CKLA 4X71A 3UQSA 3RS8A 3SJUA 3ICLA 1O5JA 3IP1A 2FQQB 2OPRA 3BD7A 2DGUA 2ANCA 5EMJA 4ZDWA 6PFKA 3FCCA 3S0JA 1CQXA 4IH9A 3WYBA 4TLDA 1BGXT 1YTUA 2WMYA 4U7DA 1O0BA 2VZ8A 1W4ZA 2RD5C 3ONQA 3ICWA 1GK8A 4WN3A 4Z53A 2YVQA 2D1CA 2HWKA 3SJCA 1ZI6A 4QOIA 2WJ4A 1J1IA 1M0EA 4FKXA 3LZ6A 3NAMA 1I4TD 4EYSA 5HP4A 3NTRA 1C7EA 2YVKA 4KO4S 1PV2A 1DRVA 1RT7A 4WADA 3PUVA 1EVZA 3O94A 3W3AD 1P1HA 3CF5Q 1NOJA 3EPRA 3R9IA 2FHOB 3KT8A 2VV5A 4YT4A 1YFLA 4X45A 3PD7A 3H0PA 5CRIA 5H9EJ 3TD6A 5AMXA 2XCQA 5HBGA 3P71T 3JYQA 4RTOA 3J7YI 1KYIA 2ZSHA 4D1YA 1REGX 4ED2A 1BQNA 2IM2A 3MPOA 2JFHA 2IDLA 5KKCA 2WJYA 4Q4JA 2BL4A 5C51B 4EGQA 4R0NA 4ARZA 3PR4A 2HF8A 2NO7A 4FD2A 5LIRA 4G3XA 1TW3A 2YYSA 2CKMA 3HYRA 2RK6A 4KKOB 2HBYA 1M6WA 2R9LA 2ZJYA 2XZTA 3DE7X 4Q39A 5AXLA 1LPNA 1RXWA 1PR4A 1NDLA 1G8MA 3DH0A 4C6RA 1T6NA 3ZKAA 1U0EA 3OZRA 2DKOA 3VZHA 1U1PA 4INOA 4KV8A 2LQJA 1EDOA 1SWVA 2WM3A 2OPRB 3G2LA 4XWTA 3PEYA 1CR2A 4QBIA 4YB6A 2EZ4A 1DWUA 4OD0A 4PIPA 4I1SA 4HZGA 2RFLA 5IWCA 1DB3A 4OLFA 3VU9B 3WL7A 1IBLJ 2VYVD 5HF8A 4OL0A 5G1OA 3MZIA 2AN5A 2HPUA 2QXUA 1XF1A 2JD2A 4OYXA 4MDEA 2O8NA 1PT7A 1TU0A 2JARA 5YASA 3MSXA 2DJWA 2Y9MB 4URHA 5JO9A 2CDQA 2HT1A 1D1UA 2AJTA 2YNMA 3F4KA 1UKUA 4DZZA 3ORRA 2QS9A 3WL8A 5FA5A 2HAFA 4CBVA 4WSOA 1OWOA 4FYWB 3BA6A 2DH5A 1X9IA 1R10A 4PNZA 4GD3Q 1V3TA 4DC1A 5A4KA 3W62A 1EETA 1YJBA 1FD2A 1DI0A 4IV5A 4DPWA 4OG2A 1IKYA 5L39A 1WD6A 1Q2UA 4Q3OA 2UP1A 5U47A 3DPIA 1D4OA 4Y2IA 3D7NA 3I9MA 1ZWLA 2ZWVA 4KP7A 2WHRA 5KFKA 2NN3C 1ANKA 5B0BA 3RVOA 3ZDCA 3VO9A 2XD9A 4OBBA 1CVRA 1DBVO 3IEVA 2ZGVA 1T4MA 5GONF 1NPKA 5AW6A 1YVEI 4DQXA 4QSMA 4I1YA 3CSSA 1NJFA 3B2EA 4LV8B 2HW8A 4ZGGA 5MN5A 5G40A 1E2LA 2E4VA 2P2CA 2MLYA 2I76A 3IXMA 3NUQA 2LEBA 4LSWA 5DBGA 2MSLA 4RVHA 3RS4A 5AHXA 1ZGAA 1Z6PA 1DBPA 3UT5B 1U2CA 3JQ7B 4NPHA 4WNYA 1C30A 4L5CA 5DSTA 4B9SA 4UUMA 1OBOA 5HHTA 3EZLA 3KQYA 2HLPA 4MUIA 4WDQA 2FN9A 3EFOA 3CF0A 2HJ9A 1OWMA 1SBRA 2M6LA 4ASUD 3TANA 4X5OA 3CMAS 4I9HA 5GADl 3SYKA 1VDZA 4LSNA 1VK3A 4IIHA 4Q7EA 4UHEA 1DARA 3GBVA 4AO8A 5ALOA 4JDUA 2BMEA 2YDXA 4HYEA 1B00A 3ZLTA 2W6PA 1IWOA 3NT2A 4CKZA 3F4LA 4KDFA 3FSYA 4J6EA 1SKMA 2C61A 3NFYA 3BMQA 1HBJA 1F1BA 2XUDA 3PYGA 1TZ0A 4PRFA 1W6RA 2ODWA 4FNGA 1N2GA 3I05A 1HD0A 3WNQA 3KB1A 3QEKA 3WLOA 3I23A 4CDRA 1THZA 1Z5UA 3OVMA 4DJEC 5HBMA 5TPZA 5C53B 2G0CA 2PQ2A 2C3PA 2VQ3A 1LWOA 3KL2A 1RTIA 1WI6A 4JLUA 2HJSA 4FCTA 1M2WA 4UQGA 2WYHA 3R77A 1CUBA 2ORIA 2JF0A 2OK8A 1UDWA 3NHSA 4D9JA 2VPWB 3DEZA 2GJFA 4MXDA 2Z08A 4OI2A 4BZPA 3D3NA 1PAUA 1UL1X 4USMA 3DFKA 4CLTA 1N36B 2A94A 3UA4A 2JAPA 5IXYA 1ONSA 2DGTA 1XLVA 3EJWA 2DF8A 2IKSA 2W00A 5EKSA 3GJ8A 1ZI9A 5LN1A 2DUJA 3FCEA 3RYIB 5EJEA 2I9SA 3Q2TC 2A9FA 3HJHA 4LWQA 3OUYA 3HBAA 3Q7QA 5HPYB 3ENWA 3TW0A 2YIJA 1IQRA 4ZHRB 1VIOA 1H3EA 2Z4PA 1LFWA 1Z0SA 3ETCA 1M2EA 1DTEA 2XE7A 3YASA 4BFVA 2CDCA 3LAMA 2ZH5A 3P5BP 1PBUA 1FFXA 2HK3A 4KU4A 1A7UA 1SVLA 4LF6J 4Z1MA 1XJCA 3RS3A 4YAGA 1JB1A 1M66A 1QNLA 1RMYA 2GHWA 5HNKA 1FFSB 3OLVA 4P38A 4LVCA 1W47A 4KDCA 5F78A 2DNHA 1PJSA 4X1IB 2GYYA 3DZJA 3AI3A 3WLNA 3BQNB 4MKGA 3SC4A 3AAWB 1EB8A 4TVSA 4RENA 1NXWA 3N8NA 4W5JA 3IR5B 3H19A 3LV8A 4AURA 4F8YA 1EWYA 1SPBP 3BDEA 2VN8A 2IIBA 3T7SA 2EPIA 1S9EB 2DZDA 4RVCA 2W9CA 4QLOA 3EDYA 4N8EA 4GW3A 1UPUA 1GG5A 2FX2A 2HHPA 3AR6A 4D25A 4HWKA 4ROTA 3QW4B 4CP5A 3W5HA 3WRXA 3DF7A 3AH8A 2IYSA 3CPSA 2JFZA 3OZDA 2SHKA 3TL2A 4H27A 2ACYA 1RC0A 5AM3A 4PUOB 1GDTA 1JLGB 3GVCA 4V0KA 3GRKA 3R7NA 4YYZA 4ENSA 4GLFA 3TOXA 3I9NA 4Q2MA 2Y8EA 2ZUFA 1NLMA 5D4NA 4U0KA 4FMBB 1E3EA 1G6Q1 1AM4D 5LBUA 3LPDA 2JFXA 3UNXA 1JLBB 3QVGB 2VJOA 4NK4A 1IHXA 5DT9A 1T8WA 3QIVA 2L48A 1HQUB 1R15A 3NASA 4XH9B 3J81j 2A6OA 3G2XA 2R7AA 5E7MA 1RQRA 3DCIA 2HVDA 2ACMA 1Q15A 3QTLA 4RV5A 1GT8A 2VFTA 1YR8A 3MB8A 4JODA 1B43A 3AIOA 4NJOA 5KFZA 4ZMBA 1R4NA 3GPIA 3PEJA 2PKRA 2GZ1A 3U1VA 1RQGA 1A8UA 4O2BF 3BSAA 4NU0A 1NEEA 3D8UA 1Z88A 3OR1B 3T7TA 4W8HA 4H35A 4EB3A 4N9QA 2ZUGA 2D4HA 5LVAA 4HACB 4ZZ2A 1OQAA 1YIDA 3FDJA 5NULA 5J2QA 1T5TA 2E82A 1ZQ1A 2IC5A 4UJ5A 4WLFA 1FK9A 4J0CA 2EC0A 5I7SA 3DE3X 4YP3A 1MAAA 1KLMB 2FWPA 3T6KA 4GR5A 4HFNA 2X4LA 2QRPA 1SELA 3HJGA 4K1LA 3C5CA 2QIOA 1FXDA 4TQSA 5B3JA 4F2RA 3KJZA 4FNIA 3IP0A 2BJVA 5G1PA 3E4CA 1SBTA 2ZC4A 4RPJA 2BW7A 1AK1A 3T12A 2IYQA 5GZ1A 4WCVA 1EPUA 1IVNA 5EWJA 1QPBA 2IZ0A 5F8MA 2XB2D 2NUPB 3DBRB 1E9BA 1IQ0A 1HT3A 3A4NA 4JJ8A 2O4UX 3KKFA 1OFIA 3LUCA 3NWEA 3RFXA 4DYDA 4ZT5A 4PW0A 1N5KA 4X8LA 4NE9C 5I9MA 3K0JA 1SUFA 3MXOA 4DXAA 2GMHA 3ZNPA 3T5TA 4JBCA 1VL6A 3D6TB 1QH0A 4ZOQI 4F4ZA 3RVNA 3TI0A 5IN5A 1ZZFA 1S7CA 2VP4A 3NEKA 2ZI6A 3B6IA 3FHJA 3DHVA 4DMLA 2Z1NA 4GICA 5CCEA 5BXYA 4U5QA 2FIUA 4WA7A 3ZK9A 1NUPA 2CMHA 5FQNA 3G17A 4YRRA 4R3NA 2WY2D 2M6RA 3C15A 5CNMA 3TOSA 2ZRKA 2I4LA 1J70A 5FAXA 1YBTA 1VJRA 1ISFA 4UNQA 2ZJ2A 1PILA 1NMYA 1N5JA 3OZBA 3V46A 1OO0B 3C45A 5ADUS 2Q62A 3ZGNA 3KWFA 3UHFA 3D4JA 4H7JA 4WW0A 3CR7A 3UMYA 2VXOA 1JYSA 2BFNA 3BCUA 4FOTA 1YJWS 3GD5A 1PZGA 3S1LA 1HWJA 2BZ1A 5IM0B 3RS5A 2R8OA 4G97A 4BX3A 3WYDA 3PXCX 5JUWA 1EQ0A 3QQ5A 4DUZB 4DJBA 4CYUA 1VYAA 2DBRA 2PRJA 3PO5A 1R0SA 3X1MA 1NKSA 1KY5A 3CO0S 3Q9UA 1TPYA 1JLQB 2WR8A 4NA3A 3JS9A 5BN1A 4S1WA 4YT8A 1IE3A 4MQFB 1JHZA 4LWPA 1L6RA 3RAGA 2QLJB 3I0NA 1QZUA 3NJ4A 5T4FA 1KYXA 1WKBA 2CHEA 2QL5A 4YIKA 2JFUA 5C8VA 2HOQA 3ZE1B 3C1UA 4DWVA 2PSEA 4S04A 2RILA 3O8BA 2WWFA 5HJ5A 4A16A 2B0JA 3AERA 5CURA 5SICE 2NAFA 4EW1A 1VQ5S 1UK7A 1RM4A 2N9UA 3QXGA 4FOPA 1SKYE 4IDAA 3HJTA 4C7OA 3FYHA 1IBCB 4LCEA 1MJGM 3H16A 3IKMB 4C4RA 4JX8A 5F1PA 2C3MA 4O3OA 3DDSA 4PLYA 4B2YA 2C2NA 3H5WA 1N3IA 3LQ4A 5G4KB 1WDDA 2EW9A 3WRYC 1EE2A 1QS0A 3H83A 3IOBA 1AH2A 4DCNA 1XQYA 2GI4A 3HB7A 4XE5A 1QE1A 1PL6A 3G6XA 2O0HA 2H8GA 1ZA2A 4HAVA 1I10A 3BR8A 4ZP7A 3TPZA 4AYWA 5CG2A 5EFZA 1CUUA 1ADFA 3DEAA 2F65A 3HCXA 2C4NA 1OKKA 1GXUA 1IBLB 4X4SA 1G8KA 3ZW8A 4XOUA 1UQRA 1OTYA 2GZRA 1U63A 4LXTA 4CV0A 2NLOA 5IBRA 4ZMSA 1DKLA 2NVWA 3KQOA 2QE6A 2VPWA 2PKQP 1W0KA 3S2SA 4C20A 1YA6A 5JZSA 3WNBA 2PZFA 1B6TA 4Z2XA 2HHCA 3ELWA 3R0JA 5EIAA 4DPXA 4UDXX 1KTQA 2DJIA 1ULSA 3KE9A 2AUTA 4WFZA 5LMZA 3IXQA 2G76A 4D3SA 2EK6A 4JELA 1RWVA 1FDWA 4GO5X 1ZINA 3VM6A 1LDGA 1HWUA 5I3UA 5D2CA 3RC2A 3ROKA 5H1SV 1SR8A 1E2PA 4K87A 1MB4A 2NADA 1SG9A 4YFVA 3H84A 3SDZA 3RWOA 4G2TA 5A4MS 1YB1A 4HVZA 3VH4A 3C4QA 3JSAA 2GW8A 3WV5A 4RNOA 5B6JA 4V0OA 1WC1A 1FL9A 4PXBA 1C41A 1SNYA 2E5LB 4KQKA 4QR1A 3G8SA 5TMPA 3E2MA 4ZVUB 3GAFA 2CPJA 4NMHA 2AMFA 3LX6A 1MOQA 3K0CC 3EVAA 3GLHE 3IBFA 4C6HA 5KOXA 3E9QA 4JQZA 1UINA 4LTDA 4AS3A 4ZQBA 4JS0A 1T9GR 1H0HA 5CUQA 4ANCA 4HNGA 4J9PA 3QJGA 3D3WB 4USWA 4ZWNA 1V4BA 3TLEA 5ELLA 2VASA 4XJVA 3V7UA 3LHIA 2M98A 1RAHB 1K2WA 3K8YA 4BS2A 4IIEA 1HLPA 1QO9A 3D6MA 5DJBA 1CJKA 4FR0A 1Q7BA 5DGDA 1VHTA 2X7IA 3LRXA 3OT4A 2CJXA 1Z0KA 2PUGA 3EWSA 3O8CA 2WM9B 3HD2A 1F4LA 1F7UA 3CLHA 2FPGA 1RZRA 4HX5A 1SH7A 2D74B 3KIPA 1QTNA 2P40A 1QSSA 3FHLA 2P9BA 2QNIA 2B2XA 5K0EA 3ZU6A 3AJRA 2FOXA 4MGKR 2VSOA 2ZIAA 1FVOA 1WNTA 3RZAA 1E9VA 5B58C 4JYMA 1NZ8A 2MR5A 4Q1BA 4OL8A 2XSJB 3EEFA 4NBWA 3AJ8A 3MILA 2ZBPA 5DNDA 3K2YA 3AX6A 1C4OA 3H9GA 4R2KA 2JFBA 1QIEA 3IAXA 3GU3A 3FMPB 1E4EB 3HUTA 2BM9A 3VZRA 2M4MA 5EIOA 4NA1A 4B9EA 3D9BA 5IT9U 2IXAA 3FY4A 3HKBB 1FDTA 1BHSA 1S3IA 4BV3A 2PGAA 2DFLA 4TWRA 1ZMRA 5I51A 5DM4A 3RW6A 1T4CA 1E1LA 1Q1BA 2V8GA 1I6LA 3LF0A 3WNVA 1T05A 1GNPA 3I0RB 4KSEB 4DV2F 2GEDA 1HYQA 1PZEA 2H9YA 1ZAKA 3L4JA 5LZ4A 1A27A 2PMBA 1U9JA 4XDGA 4M5MA 1LSSA 1N36J 5CXTA 2R44A 4F92B 5HP1A 3TWZA 3QVOA 4BFYA 4RLHA 1UZMA 3T5AA 3FTQA 4HT5A 3QI7A 1ZZEA 2QSUA 3EEIA 3BZBA 4FGUA 3QSGA 2NO4A 5I9TA 4DV6B 1XVUA 1A6LA 3RSGA 1ZD5A 5F9LA 4BO2A 1N7IA 1Z3CA 2OV6A 2Y05A 1XELA 3D2BA 2EG9A 4EY7A 3WIOA 2BJ7A 4L78A 4BVAA 2MSCB 3KR1A 3J81Y 4R16A 2I34A 1GAJA 4O3PA 2FKNA 2H9ZA 1WUUA 4DR3B 2CADA 2B20A 4O8ZA 1JZSA 4G25A 1YBMA 2Q2NA 1ZX1A 1DG3A 3AUKA 5DHSA 3AEKA 1O6FA 4NZ6A 1X9WA 4IHJA 4I2NA 4XIFA 2Z30B 2JIZA 1FRQA 2ZZTA 4S1VA 2H1FA 1DKPA 4FFNA 5CFPA 4UVHA 1W85A 4HLBA 1TMKA 2BHLA 2BUNA 1I94J 1Y3DE 4DSFA 4GMFA 3KXIA 4P9NA 3RVKA 4N5IX 5H82A 2E5WA 3D28A 1JDTA 5KFXA 4R4JA 1LSJA 1U0TA 1O0PA 5JI3E 3FMBA 4LNUB 1COWA 3P2JA 2CT8A 2FJDB 4KVFA 2CJQA 2QYTA 3I5UA 3PFFA 4YX9A 2LCIA 2G1PA 3FZNA 3WTCA 4NV0A 3N28A 5IQQA 2CLLB 4LXGA 3Q3JB 5CVUA 5BMVB 4Z9AA 2DEIA 5IBPA 4JQSA 1G4CA 2NV6A 3QXCA 1QIKA 1GKIA 3EAQA 3QIAA 1ZPVA 4P2XA 1VJQA 1RWKB 4ITRC 1JJFA 3R76A 2H29A 2FG5A 3K70D 2XQJA 2ATCA 1U11A 1CULA 1PKXA 2AK3A 3EFHA 5E7JA 1YI0A 1IBKF 1JZQA 1TM7E 4AZVA 1O94D 2YY6A 2Q3PA 2C04A 2AOUB 3OO0A 4CLYA 2V2QA 3MWEA 1XVTA 2OMLA 3A4IA 1IZ8A 3WLQA 5BR8F 1CUSA 3AOCA 1VBFA 3JCZA 5H80A 4PTZA 4FFBA 2IS4A 2YJ5A 3MCTA 4GUAA 4R51A 3FRJA 1BWPA 1FJEB 4A7PA 1TUGA 1NR5A 2IEAA 3TEMA 5EZ6B 4BXOB 2ASEA 3NDPA 4JI5J 3CH4B 1HDXA 1XJ0A 1SCBA 1HARA 1SKWA 2IJGX 4W7SA 3JAWB 1IG0A 1NVTA 1NSQA 2HA6A 1RTZA 4QUEA 2JW5A 4CCYB 1VCMA 2HQIA 4OX7A 1PQPA 3ZI0A 2OCKA 4L6CA 4IR9A 1ZHFA 4FTWA 1UBLS 3D5MA 4USTA 4MIEA 2NU9B 5JR3A 2JCSA 3ANNA 1PNOA 2R7XA 2FDNA 3NEJA 1Y9AA 1PJAA 5EWJB 4ZEOA 1NJ6A 3DOLB 2J5XA 4Q18A 2I6UA 1X6VA 4AKEA 4A8HA 2AYMA 1YT5A 2DD8S 1Z38A 4QVKA 2OC4A 5DLQC 4JB0A 2IVZA 4QAJA 4DL5A 2DVMA 5JSZA 4AUEA 1EZZB 1IKYB 3A1DA 4KIAA 2MCFA 4FHEA 3MA0A 3W4JA 1KQPA 4CDGA 1Z0IA 3IHLA 3A26A 3KT0A 1P0PA 2QVLA 4CIOA 2YKMB 1ZN8A 2UYGA 3F74A 1CULB 1M1NA 1C3OA 5T6MA 3RAEC 5SYNA 3QO9A 1TCUA 4I3HA 3RRZA 1FSPA 4X7MA 3CH5A 5MLCV 1FXWF 4KOEC 1XTJA 3N0WA 3OIVA 1M34B 1EQMA 3D6JA 1PDWA 5CZVA 3EGVA 4ZK6A 4KTQA 2R65A 3FNNA 1B8NA 1KO7A 1OXBB 2MKSA 3BWEA 3ZHYA 3T5CA 2O5CA 1HPZA 3FHTA 1KP9A 4S1TA 5COQA 5KWIA 3KLEA 4EYKA 5L7WA 4UOCA 3KTAB 2B0GA 4ENTA 4ZAYA 1JTFA 3AJ2A 4F36A 4H7EA 2CNNB 1AUXA 2BW2A 1MB3A 5HXAA 1X1QA 3AHGA 1FHTA 2AOTA 1IR1A 3LC2O 2J0WA 4TTTS 1KZ7B 4UMFA 3URMA 4ZT6A 1CJVA 3AVQA 3KUGA 1JNRB 1PT6A 4RTQA 1Y9DA 2I6QA 1RAEA 2C7VA 3KHTA 3QFWA 3K1AA 4F06A 2BZ0A 4X2BA 1YS1X 4OSPA 3LCCA 5K1ZA 3A6JA 4MW0A 3E81A 4IMIB 4YCLA 4K46A 1MQ8B 3LH2S 1DJOA 1N6HA 1L1FA 3IQZA 1U2RA 4CMJA 3HVUA 5KFOA 3PRKE 4RUHA 3SIRA 4HWOA 5SYAA 4C3ZA 1MO2A 4UJ3A 4OHFA 4RS4A 1DAOA 2LU2A 2VSNA 1TEZA 2AFHA 2GA7A 4TMWA 2YNGA 5K3EA 1JFVA 4C8MA 4AF6A 4Y7DA 2V69A 3BGOP 3SFTA 1J5OB 1QOQB 1ENZA 5CFLA 4JFRA 1A5ZA 5T3YA 2NPOA 1R8JA 3VR3A 1WMAA 2DXEA 2C4KA 2ZSDA 4WOBA 1CR0A 2GGSA 3V4RA 3UK7A 2AT1B 1AZSB 2EKZA 3FZBA 2EEYA 5B1YA 2ZULA 5BR1A 3TZXA 2HQ3A 4KJIA 3HFZB 3H42B 2OK7A 1ODTC 4LUBA 2AX0A 1OZ0A 3TTYA 1ORWA 1E3SA 4UHFA 1XMQB 3J7AN 1IK6A 3FMFA 3SIWA 3CG4A 4HH0A 1N5QA 4PGMA 2XZLA 3W8FA 1UBKS 1NQTA 3M9LA 5ILQA 2O0MA 4N0PA 4AMYA 2BRLA 4LYEA 2VFAA 1J23A 5HBRA 3CDAA 4WLUA 1U3GA 3OLZA 3SSOA 3WVNA 2QMZA 2W7OA 2BP7B 3O2QB 2WAYA 3D6HA 2XMMA 1LQ9A 4P80A 4V39A 5LB2A 5FO0A 1T36B 2JVRA 2OR3A 3RU7A 3O0DA 4CHTA 1UIMA 1UJ5A 3VGUA 1W75A 4KIWA 3MJVA 3C70A 3F97A 3ICCA 3IULA 1X0XA 4HGQA 3ZV5A 1M8PA 4UE3S 1ELOA 3TFQA 4QTUB 4S05A 2HNYB 2ATEA 2OPPA 3S6EA 3EGDB 1YZ3A 4Y9TA 3WGIA 3V4PB 3HXKA 3Q85A 3OA2A 3V9PA 1RAIB 1EFDN 1MW8X 1GGFA 3ZZPA 2ZOSA 5CYGA 4XGRA 2DQZA 3VZSA 4Z1OA 1CBUA 1VQPS 4MRNA 2XMRA 3JZDA 5FIUA 2R3SA 3LK6A 4RZHA 4CFYA 3CD6S 3SXJA 1OQ6A 4V19J 5J2TB 3TVYA 1IYZA 1ZZNA 2WK1A 1GPLA 1FJHA 4DQIA 4FT4A 4MV3A 2XHZA 1FYXA 3UH0A 1DFGA 1F9AA 1U7ZA 2PO7A 1EVQA 1SOVA 2WDPA 3M8SA 2ZI9A 1OYYA 4HMQA 3TAHA 3W6ZA 2OLJA 1JKFA 3I6YA 3PFWO 3BJIC 1TKRA 1PFVA 4CQNA 4RW0A 1TL4A 1KMHB 2LFVA 2GRAA 2EI5A 4GM0A 1DXOA 1SA0B 2JKZA 1OYVA 2IXEA 3IUEA 3UMJA 1IUPA 2QZJA 5JNVA 3PEFA 2R2RA 2YH2A 4DZDA 2WKSA 1IQTA 3F7NA 2PTHA 2ROPA 1MJNA 2CJBA 4G23A 1TA4A 2AJ1A 5BSVA 4LY3A 5CH3A 1JQKA 2E9TA 5B30A 3FXAA 1P62B 3JZFA 2IVYA 3N2EA 1C7ZA 4YBZA 4AFNA 2OLEA 3GH3A 2O01C 1NA5A 5C24A 4KE7A 1VIYA 1UBSB 1X2EA 3VYUB 4OB6A 1U8TA 2ZRIA 2QRMA 5AP9A 4MZXA 3QPWA 3MM6A 5G53C 1Y00A 4DCPA 2AKWB 1ZK3A 5AI4A 1E8MA 1JLKA 2W24A 1Z5OA 3K5NA 3USES 3A3OB 2X4IA 1HE2A 4C7KA 1U9CA 2YQ5A 3EPJA 5B08A 1SC6A 2CLCX 4HLCA 3JRXA 4MRRA 1X5PA 3NBQA 4JVSB 4U02A 3THWB 5EPUA 1VP3A 4PR0A 3C43A 3VU1A 1JFFA 3TW4A 3C8UA 2X0NA 3MDFA 1EBFA 3RSFA 5C37A 4M8KA 5K2MA 2GPWA 4RORA 1MEEA 2C5GA 2O8DA 4B3XA 2AU0A 4A8YA 4FXWA 1XXHB 1TAGA 2B56A 3QYFA 5AK0A 3BFXA 5K8OA 4NY1A 1R6DA 2Z4SA 3QWUA 3E18A 1KAEA 4AJIA 3PV0A 3I5CA 4ZYVA 3BOSA 1WBJB 3V7FA 3CLSD 4C8OA 1TYEB 3I8SA 1ONOA 4EVQA 3MTBA 2PZAA 4N1AA 1SKUA 2FEMA 2GNAA 2QLFA 2O8BA 2XV1A 4EY5A 3A3PB 4QXRA 3KCNA 1MW9X 1V0JA 1KJ8A 4BN5A 2OZVA 3I96A 4JI0B 1VQNS 9GPBA 1GQRA 3BN4A 1BW9A 4WNAB 4HAXA 2C59A 3OX2A 3RRXA 5AHKA 3N2IA 3I64A 3WYEA 1DOZA 3UPFA 2AFHB 3AJ9A 1S0VA 4AK9A 1PCXA 4Z49A 2N3ZA 2AX4A 1NM5A 3USZA 2ZE2A 2L9DA 1KI8A 2PJDA 4MS3B 4C8YA 2GO1A 2HO5A 3VV3A 4LTNA 2ETXA 4KPYA 2UXCB 2UU9B 3BF8A 5CDFA 2Z3VA 5K8VA 4BNDA 1CUAA 2AYGA 3O21A 1AKMA 2YXDA 3C2QA 4EHFA 2QN1A 1H1DA 1UZAA 2PH7A 3PHHA 3IA0A 3F90A 2OL4A 2ZT7A 3DLEB 2DQYA 5ARDA 3T38A 4C0AC 4FLFA 2PKCA 3H9BA 5H9WA 3NHAA 3WJ1A 2BRKA 3ICPA 4GC6A 1N0UA 1GRVA 3VDMA 2O4CA 3UJ6A 4DR1F 3PXDA 3FMIA 5JMTA 2NUTB 4DLZA 1YOVB 4IS2A 4WXRA 4FVCA 1KI9A 3NGXA 2HFKA 3TRKA 4R71A 5EUHA 1KI4A 5BJRA 3RPEA 4R9NA 4BC0A 4EPTA 4PYMA 2REOA 3SHVA 4Q6BA 5FRDA 3PJRA 2X19A 2KFNA 3AXKA 3O75A 2BJ1A 3ZS8A 3KYIB 3D64A 2R87A 2RUSA 4F4CA 4OV1A 4QIVA 3KVVA 2QB5A 4UNNA 3EVMA 2JAQA 1XRNA 1Z8NA 1SUEA 2CF6A 5KSZA 2CNBA 2DP4E 4MFBA 3IDSA 4ER5A 2KJQA 3INTA 1PTJA 1G2IA 3OLWA 2GS8A 2ZH7A 4NI5A 1U1NA 3LFHA 2A84A 3MFQA 3AVPA 2HSEA 1IQPA 5FHRA 3H90A 4G07A 4ALMA 4D92A 3U61B 4D8TA 4M9CA 2JEFA 3LHSA 2IYIA 1E60A 3WV4A 2ENWA 2YC2C 9ATCA 2FN8A 4AJ4A 1WDKA 3SIXA 4N65A 3LDHA 3MEKA 3BQ0A 4K86A 1J0CA 2AXNA 1O57A 4O0IA 3FZGA 3EPPA 5JS8A 4H1TA 1JDPA 1DDIA 1XMSA 3MLBA 1E2UA 4FF1A 2ZSFA 1ABBA 3CUTA 4AUMA 3KVYA 1YVUA 4PG4A 1QVWA 4CKEA 1RPJA 2XVYA 3THSA 4CTJA 2GJKA 4CL0A 5BSEA 4EKNB 4K50A 1OX5A 4EAQA 3ZZ0A 3CDEA 3DLGB 3GO4A 1R2QA 2OBYA 4C01A 4F7DA 1P6XA 4WP8A 4LOJA 1K08A 3W5SA 2UXCF 4K8RB 3MWDA 1G2EA 1S0UA 5T6BA 1KEZA 3W1EA 1EBBA 3ZZOA 4JI8F 4WE3A 1PZFA 3DAGA 5CR9A 2XTAA 3OL8A 2O2HA 3MT0A 1RYYA 3DOJA 3WJ7A 2FYTA 4P4SA 1YKWA 1ZUD1 3OVAA 3F6CA 1KEWA 4CMIA 1DS6A 4RK5A 4JJ4A 3EGWA 2QQ0A 3K8QA 1FY2A 1HT2E 2XXAA 1UMBA 4YGXB 4TYNA 4IJWA 3SS7X 2G80A 3CZCA 4UDNA 2YZKA 3EW9A 3I2GA 4CIBA 3NIGB 5LD2B 4RIHA 4C0KA 4I1VA 4BQPA 3GC6A 2Z9BA 2OESA 4LF6F 4M5JA 4GBMA 3GUCA 3Q98A 5KTPA 2MQOA 3SFGA 3G68A 3F56A 4DIEA 1IZ9A 2WCXA 3H6KA 2EWVA 1FQKA 1QX3A 1N4AA 2K06A 3PITA 1HNXF 4ELUA 4DFJA 4TY8A 4KN5A 1JLAA 1LVHA 1JG2A 4FKZA 1T0BA 3SICE 4CQMB 2CNOA 2WSLA 1QD1A 2GSWA 4GLBA 2GASA 4CWAA 4PWDB 2VJLA 3JQ6A 1QHEA 3GZ4A 3JARA 3QE2A 5BXQC 4URFA 2WWHA 3M1YA 1RQ2A 1DJQA 4UXHA 4NE7A 1GV1A 1Z6XA 2BYCA 4J9RA 3VKUA 2UKDA 5FWYA 4IWXA 3DMYA 1LPBB 2AI2A 2W4PA 1MOZA 2KB0A 3WX8A 1MABA 3LO8A 1I7LA 2IV7A 1UFOA 2AR9A 1W9MA 1Q7TA 4JIMA 5CX1A 2W6ID 1RWPB 2FRXA 3ISVA 1PS0A 3CFYA 4B3MF 1F60A 3RBXA 4RPFA 4BVFA 1C9DB 3ZTOA 2C83A 2A0FB 3M7VA 1NYRA 1DQ8A 3Q3VA 5EWEA 2ZUTA 3H4IA 3E22B 1V3RA 3BYZA 3CIZA 1MH9A 4GL4A 4R9VA 3SMQA 4MHTA 3KYJB 1F1JA 3FOFC 4HLUC 1VRQC 1GMWA 4KTTE 1X39A 4FKBA 3N5FA 3CZAA 3J7ZT 1P27B 1ENPA 3AF6A 1QE0A 2V65A 4C4YA 5DV9A 1O8CA 2G28A 3MCUA 2B35A 4ND4A 1NTOA 3EUAA 4CL8A 2V9CA 1UMJA 3S2IA 4JD5A 1R0AB 2H1OA 4X85A 821PA 3B38A 4R8UB 4BUCA 3AVVA 3MPUB 3B2QA 5KQPA 5DI3A 1W4AA 4EEXA 5AW1A 2G77B 5HZHA 5TNXA 1VLZA 4RFLA 3J81A 1Q92A 3HZGA 3IKLA 1K3UB 3AUAA 1QTMA 1G55A 4WKPA 3ZBQA 4BHTA 4NLGA 5AVSA 1GZ3A 2YWGA 3GK3A 1DCMA 4M0LA 1WXDA 5EZYB 4P4GA 3IURA 5FEUA 3BF7A 2PD4A 3JASA 4ECAA 2IYXA 3RS7A 3OIUA 3H8WA 4ZEMA 4JXJA 2HZCA 2M88A 5C5EA 3Q9SA 3BO4A 2W2OA 3VNUA 2AMJA 3UFBA 4EW3A 2GFQA 4OM8A 1G1MA 2PJRA 2H2GA 1I4LD 3TQCA 4L0CA 4JLOA 5AVXA 5FLXA 4PCUA 3OQNA 2FSFA 2ECKA 4U7UD 1UK9A 1H1TA 1I3KA 1L7XA 4KPGA 4EK2A 4ED8A 2GVNA 2XYRA 1IM8A 3I3OA 1HNZB 5JAPA 1EIYB 2JAXA 4TU8A 2JBHA 1LKZA 1YG0A 5EWGA 1Z74A 4IUCS 1SBYA 3J7Z5 2PLWA 3F9RA 3NQ41 3DWEX 1BDBA 2V9PA 3CDBA 2J3QA 4RTNA 1JKHA 3H86A 2YINC 1IB0A 4HQRA 1RTHA 1J5PA 3R5DA 1YDLA 2A9OA 1ST2A 4Q7KA 4N8NA 3AEYA 4DLLA 2H48B 3K9BA 4PLFA 3EVBA 1DADA 3CJ5A 2FZEA 3RJMB 1TRKA 3E9NA 2PCLA 3ZNUA 4OJNA 1LDMA 2VZEA 3U37A 2OELA 5FHQA 3NG1A 3P9YA 5B6PA 4BUJA 3AHEA 1OH5A 3OBIA 2QTTA 3NBAA 2CQ2A 1Q57A 2CYAA 4RUBA 4JB8B 2R47A 1HBUB 2HXGA 5LMNB 4J07A 3VZPA 1FXWA 4EBEA 1KL7A 4ID9A 2I62A 2BABA 3RGIA 1GNTA 1SJ3P 3RFVA 4DFPA 3FEXB 3QLVA 2BR3A 5J3JA 4CMKA 2HK2A 4II7A 1QO0D 1T0TV 2C8VA 4LOKA 1FNCA 1G4UR 2G04A 3L77A 4UMVA 2G4CA 4PTYA 2X0FA 1KFKB 4K5RA 3HE3A 4Y9UA 2O6HA 1QF9A 2CCGA 2XTZA 1T0HB 2IMOA 4HPJB 5I42A 1AB5A 2QR2A 3L07A 2YIVX 3GXOA 1PK8A 4B6RA 3BGVA 1NSTA 2P9QA 3JQKA 2HVHA 2OO5A 4J16C 2QJOA 2E9SA 1XD8A 2NM0A 1WF3A 1FDDA 4FZVA 3B5IA 1QGDA 1WQ3A 3TQIA 1H4QA 4FJ2A 4IXMA 1SAYA 2C3UA 2W37A 4N7TA 1IBMF 2CL5A 4YR2A 4IJQA 4ME6A 1US8A 3TF5A 1SL2A 4QJBA 4HXFB 1ECFA 4AMBA 4QG3A 2F3TA 2V7WA 3D2CA 1JMYA 1R8SA 4OIMA 3FR8A 2JJ2A 3HL0A 4DUTA 4TKUB 3F8TA 1F6BA 4USHA 3LQ1A 4J0GA 4JIGA 1GLNA 5G0SA 3PIRA 4BMNA 1G5RA 3B3FA 3HEBA 4MPDA 1HYSA 3P20A 3PZPA 4B3TF 1RE0A 1RHJA 3FBCA 4YACA 2QTFA 1RTHB 1E1YA 4DGQA 1C7IA 2HNDB 3ND5A 3E1KA 3HEAA 2N4CA 5KNBA 3HZHA 4YLEA 2E1RA 3Q8QB 2V8VA 1I2BA 3VU8A 1Q6ZA 5B7WA 1NOKA 3ETOA 4YY3B 3ACDA 3IC5A 4ZK2A 1TAUA 2VF7A 4FZ5A 3AR5A 1LWCB 4Z51A 3ZY3A 4BQOA 2AWNA 1YH3A 5JXJA 4KRYA 3HSKA 4EI8A 5B5SA 1H72C 5BWBA 2JL1A 3AOAA 4WXOA 4HVTA 5L45A 4JV0A 1FXUA 1E6UA 3JYTA 1F0YA 4N39A 3BPSP 2O8VA 2BMBA 5E9AA 5JSUA 4C0SA 3AFIA 4I8IA 4FPXA 1IBSA 3ZJTA 2H1VA 1C50A 4DU7A 1K8YB 1CUIA 2KFZA 3BE6A 1N2CE 1VBZA 1WHTB 1UC8A 4J9VA 3BHNA 3QU9A 2EWHA 1U7DA 1C3LA 4FEGA 4DV5J 1SXHA 2JD1A 3G82B 3GDGA 2G70A 3PRHA 1ZVJA 2QW0X 4AS2A 3IR6A 1Q1GA 5EXPA 4CM8B 3WIEA 4W92B 3MM5A 3PP8A 3CSKA 4OU5A 3OOWA 1GZ6A 4BNDB 5L95A 2W8LA 3CULA 1XU7A 1ZTTA 2W83A 4NCXA 2XB9A 4KBGA 4GKJB 3FCOA 3AY7A 3KG4A 4LF2A 3S2UA 1G4HA 1XR3A 3BMXA 3I5MA 1QFXA 4H18A 1A9TA 1CLUA 3R20A 5IAJA 5ALLA 4XWGA 2ZK7A 2D1RA 2YX1A 4PYRA 2ATXA 4DQ0A 2QC3A 3UVJA 4GLJA 1TVCA 2OSVA 4M8LA 5DGCA 4EVIA 3K0FA 1T05B 4QHSA 2ZWIA 4F2PA 3V8BA 4LZOA 4X63A 4C98A 1LTHR 3FSJX 2CV2A 4AMZA 4AF7A 4BJ6A 2OOKA 2JA2A 1Z47A 2FGJA 2IU6A 3ZJ4A 2QX9A 4F85A 3KHLA 3O1JC 1UXIA 1GTRA 4BIIA 4MP6A 2H65A 2FWJA 2PMFA 1A72A 1XROA 4MUGA 2NOAA 2B36A 2GETA 1Y1PA 1ZICA 4IG4A 3EDQA 2VOEA 4EQ6B 2W22A 4BNYA 3C66A 5A4FS 1NJZA 2VUTA 5HFAA 3QYAA 1NUEA 2W9BB 3VPBA 3KOXA 3B8HA 4CJXA 1IM2A 1O7JA 2WYOA 1Y9OA 4NFYA 1GGKA 2BGTA 1UDXA 1R31A 2WBLC 3C14B 2IBMA 3QY9A 3E3AA 3S81A 4UREA 3FNEA 3HFJA 1YCDA 3DTTA 4PX9A 2O9JA 4XPEA 1OE0A 1BE0A 3Q7EA 2JIPA 4N18A 2RI1A 3CVXA 1SEVA 2ZDHA 3FHOA 1IY0A 4IFVB 5B3KA 4NLWA 4F26A 1ZVKA 3L7JA 3CE6A 3FHCB 5J23A 4YMLA 1Y5IA 2Y0DA 2OQVA 1RT1A 3GLUA 1M1ZA 1GRNA 3IIKA 3P9KA 3HFKA 1N8SA 3E9RA 2CF5A 3PKZA 2GN4A 1XF9A 2XVAA 3EXHB 3IALA 2E4UA 3TQEA 3RROA 1TU3A 1XMPA 3NXKA 4EYEA 2GHIA 3FWHA 4NMMA 1H6BA 4DUPA 4CO3A 1O54A 1N3YA 4A0HA 2VF2A 5KDOA 3DUFB 2OHIA 2AKAB 2PUEA 3LOUA 1VLHA 2AUMA 1J0AA 1Z7EA 3WFIA 1OY9A 1YS6A 2EW8A 1OPIA 5KOJA 2DH6A 1DOHA 1A50B 4JUZA 1LA2A 1K0UA 3ZE7A 4GT1A 4CIVA 4TMFA 2JJ1D 4XW2A 1UKZA 2BEFA 4JYAF 1RP7A 4TMVA 2YUIA 3RRNA 1VJDA 3AD9C 4I55B 4P82A 3AODA 4DNFA 1U1LA 4QKQA 1FP6A 4ZD6A 3TX8A 4XDYA 3PWSA 4NV1A 1CJVC 4C7OB 2CB9A 4DCOB 2PSDA 2V3WA 4DR2B 5JE8A 3VI4B 1XHLA 4TGLA 1NVKA 5ETJA 2YR0A 2B8JA 4KRWA 1SC3B 2FJXA 2XG8A 2L19A 3O73A 4YDXA 2YWJA 1U3FA 3ITHB 4C7MA 1N2SA 1UMDB 2CQCA 3KXKA 4KL8S 4KXUA 1CG2A 1U3UA 3BDAA 2EQ5A 1SQSA 2DBZA 1VZ2A 3WWOA 1CNEA 1XRPA 4OM7A 4WU3A 2JAUA 3T0GA 5EHGA 2ONJA 5CBPB 4YRJA 2FR8C 4WLNA 3IVMA 1ORDA 4F96A 3RQSA 2VPQA 5LJ3Y 1FSFA 5CM2Z 2XXBA 4I4IA 1SBCA 2XMPA 1EUZA 2MYUA 4NP6A 4NZNA 1K2VN 1GG2A 4Y2MA 3H1FA 1BEZA 1B8UA 2V0GA 1Q50A 3L4BA 3KKLA 1RBOB 2GQ0A 3O3MB 1NIPA 2VUGA 2R86A 1K75A 3PA6A 3VGTA 4JAVC 4YROA 3PPWA 3GA0A 2WBMA 1B0VA 2V6JA 1OLUB 3DOKA 1JU9A 4HEA9 2XOXA 3SVTA 2LYVA 2I67A 3SHOA 4RD6A 3GT0A 4QRIA 3THRA 3K5OA 3SF8A 2IXBA 3LQQA 5BNFA 3WGKA 4IH5A 4EEZA 2A9KA 5KPDA 4JQYA 2QUHA 2UUAF 3FCVA 3CW9A 1M6NA 1UKVY 1V4VA 1L4LA 2YMMA 1D1PA 2ZJPQ 1TXGA 3L1UA 4AQDA 3HDYA 2XDWA 1K73T 9ATCB 3VTIA 5HLFB 4C3VA 2AXQA 2GERA 1CJTB 1DUVG 3C0KA 2DCUA 4TM8A 3U3OA 2FPHX 1IJFA 2PFGA 2K8GA 1USGA 2GLUA 4D96A 2CNNA 4AJ1A 5KYYA 1LJUA 2Q46A 3M8QB 3ZZYA 1HL3A 3CLVA 4C8KA 4NCIA 2GK6A 2I2BA 1TCVA 4PQGA 3WGGA 1WSWA 3ST7A 3WQBA 2QV0A 2OD6A 1H0RA 3T7IA 1VSVA 4QGAA 4AZSA 1JDSA 1B0AA 3N8KA 5CLHA 2D59A 4ZI5A 1P31A 6REQA 2X1GA 2BIFA 3WZLA 2W9AA 4ED7A 2HIGA 4LF6B 4OMDA 1FU8A 5AE2A 4B3CA 3PPIA 2I8AA 1RLUA 2A7XA 3L05A 2DIUA 3WMEA 4IR7A 3VGSA 2WM2A 2XUPA 3VYTB 4DMCA 2YQ4A 5JISA 1ZA1A 1FJ7A 3OOHA 3TIIA 3OHBA 4WDRA 5KIAA 1U31A 2CVFA 3HNOA 1TT5A 1U94A 1I6KA 3RU2A 1UPXA 2VNIA 1BUXA 5L8RC 2VD3A 1MORA 3N59A 1TFUA 3C14C 1YUMA 4YJ3F 5JW6A 2AOUA 1X9SA 4LRBA 1MVNA 2JFFA 5C2GA 4K6FA 4MPJA 4DFKA 4LF8J 1WABA 1MWQA 2CDRB 5KQRA 4CUKA 1I3OA 1ZOOA 2OFPA 1P7WA 2GBGA 3KAKA 1CJUA 4ESEA 4C4PA 1E63A 2QQ5A 1OYDA 3BCRA 4UZBA 3TPFA 1TRHA 2ZVIA 1XLTC 3LBIA 2K7JA 1PT9A 1D6NA 3FRZA 4DQLA 3QQPA 2ZKIA 5HQ3B 3JQGA 4A9AA 1Q8KA 3E8OA 4OI4A 5GAHU 5FFMA 4DN0A 4BAUA 3PNLA 4BCDA 1NQOA 1I80A 2OILA 1L3CA 3H59A 2CXNA 1TGVA 3ZXYA 5K9FA 2I2FA 1SJRA 1BEUB 3ZCSA 4HNTA 2RB4A 4X3PA 4KO2S 4AN4A 3O8QB 3Q6NA 3GJSA 1M0TA 4TYWA 2FZKB 2J33A 5ICEA 3LW5C 2PH5A 2OD2A 2YN2A 3KJNA 1SQ0A 4BC1A 2ZIUB 1HEYA 5ALSA 2OBNA 3ECCA 1IY8A 1T26A 3DEJA 1UWCA 4GDFA 2HX1A 5CH8A 4MV5A 2XE4A 3KLOA 5LCXA 4HACA 3L7LA 4S1NA 4GRSA 1V9OA 3RUDA 4AP9A 1XDBA 3HLUA 1DJMA 5IXSA 1VL2A 4WL0A 4XQEA 2AG5A 3PKMA 1JILA 1DX4A 2CGEA 5B1SA 2QN9A 2KI2A 2HBRA 3DXSX 2V8HA 3OC0A 5TF4A 2OPSB 4HQLA 2LQ8A 4GGMX 1NM5C 3BGRA 2VDNB 4GKAA 4NICA 2ZLBA 4BLPA 3H3XA 3CVWA 3ML1A 3EJMA 3UTDA 1Q4RA 3KE8A 4FYVA 3CZQA 1SXJC 2G6BA 4DM3A 3AW8A 1W8IA 1T11A 2V03A 1ZBTA 4ZRDA 4IV8A 3RAXA 1NF2A 1CEEA 4RYLA 3R1IA 1IEQA 4DR1B 2WG1A 3K5LA 1R6VA 4WFBQ 3IGFA 3ZHQA 5T8KA 2C5SA 3E3LA 3K1TA 1YLXA 1FU4A 1OGYA 2O66A 3U3RA 2JEIA 4P5EA 4WMLA 2JBAA 4DW8A 4JL6A 5LP6B 3FLAA 4I6GA 4ZCLA 3RJ5A 2QTMA 3R75A 3QNWB 5EE3A 3FGVA 3X1XA 1COZA 4EENA 1A8SA 2ILVA 2R7VA 1DBIA 1M73E 1XCOA 5DM70 2QSYA 1EUCA 3EGWB 5TV2A 3V1KA 2JEJA 2H2IA 1HKUA 1G9XA 3VAFA 4PZEA 4GYKA 2OIHA 3V3TA 3M6UA 2YDYA 2R8KA 1SURA 4H7DA 4Q9AA 2OHVA 4BMZA 4J9SA 4KYVA 2PN6A 4KYZA 1Z4NA 3PEWA 4X90A 3CJ2A 4TTJA 1U98A 4G63A 3T4UA 4M21A 4PBSA 2QZ8A 5TT0A 4BVLA 1YUNA 4KIGA 1O95D 3DXFA 2UAGA 1Z25A 3V1LA 1LS1A 2FC8A 4TYQA 4INAA 4V19X 2REQA 3IH5A 4H4CA 1L4YA 3LRTA 3D4IA 4N03A 4JI0F 1BFKA 1E3JA 2IS6A 4KHPB 5HLFA 3NJ8A 1NXQA 5GINE 5TMBA 1EDDA 4W6ZA 3AI1A 2VJQA 1OXTA 1GA4A 5I7FA 5KFTA 2PRIA 3FFXA 3GJ0A 3HJUA 1MR3F 1MAVA 3V4VB 1WEKA 4BBZA 1B74A 4RY9A 2Z58A 4PBTA 2NZ2A 1CJTC 2PJUA 5ENDA