1IXKA

Crystal structure analysis of methyltransferase homolog protein from pyrococcus horikoshii
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
305
Chain Sequence
LSPSMLDKLLRLGYSKLFADRYFQLWGERAIRIAEAMEKPLPRCFRVNTLKISVQDLVKRLNKKGFQFKRVPWAKEGFCLTREPFSITSTPEFLTGLIYIQEASSMYPPVALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNVEFDKILLDAPCTGSGTIHRTMDDIKFCQGLQMRLLEKGLEVLKPGGILVYSTCSLEPEENEFVIQWALDNFDVELLPLKYGEPALTNPFGIELSEEIKNARRLYPDVHETSGFFIAKIRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human p120 homologue protein PH1374 from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords Methyltransferase
total genus 103
structure length 305
sequence length 313
ec nomenclature
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F
A PF17125 Methyltr_RsmF_N N-terminal domain of 16S rRNA methyltransferase RsmF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ixkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ixkA02
1R8YA 3LPMA 5DTMA 5DRTA 2BM9A 4DCMA 2NP7A 5FA5A 1QAQA 3UZUA 1L3BA 3GNLA 3AY0A 2ZBRA 2WA2A 1KYZA 1D2GA 2KW5A 2N47A 2JHAA 5CVDA 4C06A 2QY6A 4ER3A 2P8JA 3DH0A 5GWXA 4E30A 1PJZA 4FR0A 4CTKA 2UYCA 3LECA 1XCLA 2K4MA 4FT4A 2ZTHA 3LCCA 1NW3A 3ORHA 3EVAA 2FK7A 4X60A 1N7IA 2G1PA 1M0EA 1XXLA 2YTZA 3DLCA 2PJDA 3ID6C 3LX6A 5E1OA 4QQKA 5FWAA 4BLVA 1VE3A 2I6GA 4ER6A 1ORHA 2P1DA 5LQCA 1D2CA 3EPPA 3DLIA 4EKIA 5HIIA 3DMHA 5DRYA 1YFLA 2AOWA 3A7DA 4MHTA 3KPVA 2O05A 3Q87B 3P2KA 3RODA 3VC2A 3FRHA 5EEGA 3NVKI 5DT2A 3BWCA 3G2MA 1UIRA 2WK1A 2OB2A 1VP3A 3EVEA 3SXJA 2G72A 4YMHA 4RTMA 4C08A 3NTVA 5GINE 2ZLBA 3DULA 3A26A 3GGDA 2XYRA 4X41A 2AOTB 2AVNA 5EMMA 1RI1A 3BT7A 5LQAA 4QVGA 5EZSA 5DM0A 4QDJA 3UA3A 2P3OA 3MHTA 2XBMA 2PWYA 5E9WA 2AOVA 4PCAA 4Z2YA 4ZTBA 1HNNA 1RJFA 2E5WA 3FUVA 4MQ4A 2Y1XA 5K0JA 1AV6A 1KPHA 3EVGA 3QOWA 1R8XA 3ANXA 4C4AA 5CCXA 3HA5A 4A6DA 1JG4A 3GRVA 2IBTA 9MHTA 3KPJA 3CGGA 5EHGA 3SSMA 3VC1A 2PY6A 5C1IA 4DF3A 5LQJA 5LSAA 5HIKA 1RJDA 5E9QA 2BR5A 1I9GA 3GO4A 5DXAA 4V0RA 5EKXA 4R8RA 2GPYA 4YUXA 2ZULA 1G55A 1WXWA 5GP1A 5K8VA 3I58A 3GWZA 4R6WA 4PINA 3OZRA 1JQ3A 4HGYA 3JWGA 4PYLA 1YFJA 3LHDA 2HV9A 3KQSA 1KP9A 4OX9Y 5FUBA 2P7IA 5K09A 1L3CA 4PGGA 4CKEA 2P3LA 5K03A 3TM4A 1X1BA 3H2BA 4M36A 2AOUB 1X19A 4M7RA 3SSNA 2G71A 3OPNA 5CVJA 4LG1A 4OBWA 5HIMA 4AUKA 2CL5A 2UYQA 3E7PA 2EFJA 3BWMA 3I64A 3PVCA 4AZVA 1DL5A 3SM3A 4POOA 4FZVA 2BH2A 3HM2A 4M37A 2CKDA 5CCBA 3UBTA 2ZZMA 4DA4A 3GCZA 2FCAA 2YR0A 3BWYA 2JJQA 4C04A 3P9IA 3HA7A 3RIEA 1L1EA 4GOND 5GOZA 1EG2A 3FPFA 2F8LA 3DMGA 2ZW9A 3BZBA 1INLA 2PGXA 3KQYA 3R0QA 3FTDA 2XVMA 4XUCA 4OQEA 3KQQA 4RTRA 1RI5A 3SSOA 2EG5A 4O29A 3KR0A 1SQFA 4EKGA 1JSZA 3HP7A 1ZGAA 2VZ9A 3ERCA 4U7PB 4CTJA 2PV0A 1P91A 2EJTA 3ELWA 3MGGA 4V0QA 1Y8CA 5FHRA 3PT9A 2AOUA 5FULA 4Y2HA 3FPEA 5HIJA 1SUSA 1VPTA 4QVKA 4UOEA 3FTEA 3PFGA 4YV2A 3KR1A 4GOLD 4AX8A 3OZTA 2B25A 2PX5A 2ZFUA 5DTQA 3P9NA 5E8RA 2NXNA 5CUQA 2CMGA 5EMJA 4RTOA 3M6VA 3BKXA 4QTTB 3FUUA 3HVHA 3SR4A 2B3TA 4G56A 4WVLA 3TMAA 2PBFA 3DP7A 3GRZA 3FYDA 2B78A 3M6XA 5HOQA 3FPHA 2QYOA 2ZBQA 4KWCA 3FPGA 5F2NA 3FUTA 3EVBA 2I9KA 3HTXA 5T6BA 1VIDA 3DXZA 1IXKA 1JSXA 1RI2A 4M38A 2ZIGA 3JWHA 4BY9E 2V74B 2A14A 4E2ZA 2ORED 3B3JA 4DM3A 5DLYA 3MCTA 5C9ZA 4GC9A 5IKMA 3BWBA 3KQPA 4MWZA 2IIPA 5ICFA 3GU3A 1VQ1A 4RTPA 3HCAA 2OPBA 3V97A 2NNWB 2IP2A 3KQWA 4QPPA 1SUIA 2CMHA 5EKUA 4BLUA 4YV0A 1XDZA 3OE4A 2YXLA 1BC5A 3G5LA 3AXTA 4AZWA 3REOA 4P7GA 2C7QA 5EIWA 2ZIEA 2ZZNA 3A27A 4PCLA 1WZNA 3PS9A 3PX2A 2C7PA 3B5IA 3CJTA 4PGHA 2VDVE 4H0NA 3M6WA 3KHKA 3LGAA 5FHQA 3MERA 5DM4A 2AN3A 4KIGA 3NDJA 1ZHFA 4KRGA 3R6TA 1H1DA 2PVCA 1SVUA 3AWIA 3GRYA 4HRAA 3X0DA 3AJDA 4HGZA 2LD4A 3S68A 5E2AA 1Q0TA 2Y1WA 5DSTA 1IM8A 4Y30A 3CJQA 4GQBA 4KIFA 1RJGA 2PX4A 3G2PA 3OCJA 2FPOA 4GF5A 2YUIA 2GB4A 2ADMA 3I5UA 4GEKA 5EZQA 3OU7A 3NMUF 1JG1A 3OE5A 1UFKA 2NXJA 3G2QA 3G2OA 1KYWA 4ER7A 3FUXA 3HCEA 3B7PA 4CKCA 3E23A 1P1BA 1Z3CA 3QV2A 2R3SA 3NVMB 3EGVA 3FTFA 4GUAA 4ER0A 3ME5A 3KKZA 3BUSA 3U81A 5LR6A 2P41A 1L9KA 2QE6A 1NBIA 2PXCA 5DPMA 4PWYA 2UYOA 4E2WA 3EEOA 3KQTA 3P2EA 4YUVA 3CJRA 3B3FA 3JWJA 4ATNA 3PLAE 2XYQA 5DX0A 2JH8A 3MQ2A 1O54A 4XCXA 2IBSA 2O07A 3KPYA 4P7FA 4XUEA 4XUDA 4C03A 3M33A 2XVAA 3DXYA 3EGIA 2PT6A 3EVCA 4PYNA 5FQOA 5FTWA 2JHCA 2QRVA 2GLUA 3NWEA 4IKPA 1RI3A 2PSSA 2AS0A 4IV8A 4RVGA 3EVZA 3G5TA 5K0GA 2ZIFA 1JTFA 5CVUA 3BGIA 3CVOA 3T0IA 1KPGA 4X63A 5HILA 5E2BA 3UFBA 3P9CA 3UJDA 4BP3A 1AQIA 2HR1A 3SGLA 1R00A 1EAMA 2NXEA 3C6MA 4GOMD 4QQNA 3UJBA 1JQEA 1XDSA 2O57A 3OU2A 2OY0A 5U4XA 3ELYA 4CWAA 4ER5A 1XJ5A 2Z6QA 1WXXA 3D2LA 3KR9A 2ZVJA 3GXOA 1VLMA 2XYVA 3SX0A 3C6KA 3P97A 4KDRA 5JR3A 2IH2A 3DR5A 4RTLA 1BHJA 1JG3A 3SMQA 4F86A 1F3LA 2JHPA 2VDUE 4RSRA 3TOSA 1YF3A 2OKCA 3KPWA 2EX4A 3MTEA 4OA5A 1G8SA 5EGSA 4B17A 2GA9A 2HWKA 4DMGA 5LQUA 3DXXA 3BGDA 1UWVA 4AZTA 4YV1A 5K01A 1DCTA 2NP6A 3EMBA 4EVIA 3IV6A 3TR6A 2OXTA 1XVAA 3E05A 3G7UA 1JQDA 4X1OA 3UJ9A 4AZSA 2GH1A 3KPUA 4PYKA 2PX2A 1AQJA 3C3PA 3G8AA 2P3QA 2PWPA 4IV0A 3M70A 1VP9A 2IFTA 5K0CA 2BR4A 5G02A 1PRYA 2UZ4A 3DOUA 4EK9A 3IEIA 5BW4A 2ZWVA 3IHTA 3PX3A 3M4XA 2PX8A 1BOOA 2G70A 1WY7A 2IDJA 4IWNA 5F2OA 3E8SA 2OYRA 3CBGA 3EVFA 1WG8A 1TPYA 2OBFA 3HVJA 4KVZA 4FSDA 4GOOD 3UWPA 5HZMA 2IH4A 3LDFA 3I9FA 3UJ6A 2GAFA 4OQDA 4PNEA 1SQGA 1QANA 5E8JA 3TKYA 5DM1A 1FPQA 1FP1D 1NW7A 5EPEA 5K05A 1NV9A 4PYOA 3P2IA 4RV9A 3MCZA 4OA8A 1N7JA 3EGEA 4MTLA 3FRIA 3O31A 5GM2A 4WXHA 3HVIA 2FK8A 3FZGA 3K6RA 4RWZA 1V39A 1ZKDA 3ER9A 5EVJA 5DM2A 5MHTA 1O9GA 3LKZA 1HMYA 2NXCA 4K6MA 5GM1A 1EJ0A 5B1SA 3PB3A 2HTEA 5HEKA 1F38A 5E1BA 3L8DA 4ISCA 4U7TB 3WSTA 4BLWA 3LSTA 4X61A 5F2KA 5DWQA 2VP3A 4R8SA 4L7VA 4RYLA 1B42A 3TRKA 3O7WA 3PFHA 3MB5A 3GIWA 5ICEA 4E70A 1NKVA 3R3HA 2OO3A 2V7EA 1ZGJA 5ERGB 5DSXA 5GIPE 3EMDA 2C7RA 5P8WA 4HSGA 4PYJA 1X1CA 3PTAA 5FADA 3KU1A 3TM5A 4HH4A 4RTNA 4RTSA 5DX8A 3LBYA 3THSA 3V8VA 2HNKA 3DMFA 2I62A 2YQZA 1NW5A 4QPNA 2AOTA 4NECA 5EHIA 3A25A 3GRRA 4YUWA 5BW5A 1MHTA 2P40A 4RVFA 2BZGA 2P35A 2VS1A 1TW2A 1T43A 2AZTA 3P8ZA 4DQ0A 3JWIA 3OFKA 8MHTA 3C3YA 2AN4A 5CD1A 1G60A 3HNRA 4RTQA 1X1DA 2PT9A 1G8AA 3MTIA 5EC8A 2AR0A 4F84A 1ZQ9A 3A7EA 4JXJA 4FP9A 4A6EA 5DXJA 5EG5A 4BP1A 2NYUA 3NDIA 3TPZA 2BR3A 3LCUA 5E1DA 1QAOA 4PIMA 5EEHA 4R05A 4YMGA 2PXXA 5ICGA 3HEMA 4P7KA 3TKAA 3O4FA 1M6EX 1XTPA 5BP7A 3ELDA 2IDKA 2VDWA 2O06A 4QTUB 3NW9A 2AVDA 2O0LA 2ONYA 4LWPA 2P7HA 4RVHA 2HMYB 3A4TA 3IYLW 2PXAA 4P58A 5IH3A 4HTFB 5KQSA 1FJXA 3G8BA 4E2XA 3DUWA 1DUSA 4P7JA 2C7OA 1KR5A 1NW8A 2FHPA 2ONZA 4R6XA 5EIFA 5E9JA 5EMKA 4DKJA 3KQOA 1N2XA 2AN5A 3F4KA 3RW9A 3VYWA 2B9EA 2JG3A 1P1CA 1AF7A 3LL7A 1XCJA 1RI4A 1X1AA 1QZZA 3FTCA 4CKBA 3ER8A 1U2ZA 2B2CA 2GS9A 1NBHA 5D1NA 2OB1A 3M6UA 1RJEA 5K0LA 1VL5A 3HCCA 2FYTA 3KQVA 3P71T 3UJ7A 3FUWA 3R9XB 3T7RA 1XDUA 2H11A 2YX1A 2BM8A 1I1NA 4GBED 2H1RA 4PYQA 4LECA 1BKYA 2IPXA 2PLWA 1R74A 2R6ZA 3CCFA 5FCDA 2ERCA 3T7SA 3THRA 5K0FA 1G38A 4F85A 1R6AA 5KYGA 2Z6AA 2ESRA 1FBNA 5GIOE 3FPJA 5CVVA 3HCFA 3QOXA 1FP2A 3LDGA 2Q41A 3I53A 5M5BA 4PONA 5EMLA 4E33A 4DCGA 5BXYA 4HTFA 1P39A 1QAMA 3HCBA 2OZVA 1JG2A 2YXDA 3AXSA 3K0BA 5FWDA 5EQJB 2QRVB 2ZBPA 2AOXA 1D2HA 2G8NA 1IY9A 4YUZA 1QYRA 1OR8A 1YUBA 3KR2A 1YZHA 3LKDA 4QDKA 4EQZA 4RTKA 5E1MA 5EOVA 3SVZA 4E32A 1O9HA 3R24A 3TLJA 4LWOA 1I4WA 3NWBA 5KS2A 1YZ3A 5T67A 4C07A 5JUWA 5C0OE 5ICCA 2UYHA 1NT2A 4FS8A 4RTJA 3FYCA 3EVDA 2Z6UA 2PKWA 4MIKA 5DX1A 1JTEA 5LQRA 3EEYA 3T7TA 4CXMA 1YB2A 3OZSA 3Q7EA 4E31A 4YUYA 3G88A 3HA3A 1TW3A 3LCVB 3KQMA 4KDCA 1KIAA 2ZZKA 5CVEA 3MAGA 2QM3A 4RVDA 3C0KA 3LBFA 1MJFA 4RX1A 3LDUA 4PYIA 1KHHA 3UA4A 4HG2A 2YXEA 3GDHA 4PIPA 7MHTA 3B3GA 4EMSA 3G89A 3DTNA 2ZWAA 3NJRA 1EIZA 5CIYA 5K0NA 5K0BA 5KQRA 2EJUA 1M6YA 5H02A 4PYMA 5HFJA 2DPMA 3BXOA 5KVAA 1ZG3A 5FQNA 4GC5A 5LQKA 2IH5A 3UJAA 1ORIA 4OBXA 3TQSA 2DULA 3VSEA 2H00A 5CM2Z 1L3IA 4E2YA 4KW7A 1JR4A 1EJ6A 3OU6A 2I7CA 5DTRA 1VBFA 3TFWA 3BKWA 1G6Q1 2CWWA 3GJYA 4FT2A 4C05A 1EQAA 1SKMA 1KXZA 1R18A 3P9KA 3CC8A 2ZCJA 3B89A 2IGTA 3OFJA 2WA1A 5K0EA 4FGZA 2ZSUA 1NE2A 3HCDA 3ELUA 4HC4A 3HVKA 2JH9A 1KPIA 1Q0SA 5T64A 1NV8A 3BGVA 1NW6A 4FSXA 1WS6A 4DZRA 5LQNA 3UJ8A 3UJCA 2YVLA 10MHA 3CKKA 2FRXA 5D1HA 5FA8A 3GRUA 1SG9A
chains in the Genus database with same CATH superfamily
3IEXA 3RAGA 3NPAA 5F33A 2G2YA 4FCVA 3AY0A 2G8LA 2RHDA 1LPAB 1JWWA 6REQB 4XGQA 4DBZA 3NLCA 4RJKA 2OI2A 1HMPA 5JD6A 1P9NA 5B58C 2BRUA 4AZ3A 5LSLA 3SQMA 1T5HX 3TX2A 4RV4A 1EFDN 3CB2A 2JVKA 2ZRAA 3PICA 3VDQA 3BSSA 3PV0A 2X7IA 2X8JA 3EEBA 4TU7A 3M8SA 2Z8YM 2WDZA 3G68A 1Y7TA 1QNFA 2J7UA 1LZLA 4DLGA 4ARZB 4LNHA 4LW8A 4NCNA 3A1CA 2JHEA 4PYLA 3NXKA 5K9ZA 5DZSA 3DDSA 2AE1A 1WPQA 5E7MA 4MIOA 3HWX1 1GL7A 4K9KA 4JI7J 4KV8B 3G8SA 2AK3A 2FMKA 2A2ZA 2Q9UA 4GP9A 4GO7X 4UT4A 1EGQA 1L7RA 2JLEA 2QRRA 2EP7A 4DVJA 2A3JA 2I0XA 2IXAA 3JASA 3BRCA 5HIJA 1YKWA 3SBDA 1TKAA 4Z3OA 3HVTA 3MWJA 1SKQA 4IX1A 1VIOA 4MA0A 3LWDA 3ILOA 3SR4A 1DUVG 2E2WA 3OZWA 3PUHA 3U7HB 1VE7A 2X3YA 4JI5B 4O1HA 3R3VA 3H17A 5L9NA 5T6BA 4UNNA 3AEUB 1Z9BA 4P31A 4FKYA 5EKTA 5FBRB 2JS7A 4Z53A 2HMWA 2OJ3A 4Z54A 2VBXA 1VJ5A 1U0LA 3ZWXA 2YN0A 3VBCA 1IBCB 5ALDA 2C7PA 3CJTA 3AHCA 3PC8A 2RKIA 3EVMA 2IBOA 1CY6A 4XKJA 3BAZA 3F47A 2GRUA 2IW1A 4G8JA 4Z7QB 2NAFA 1FSSA 4DR3B 4DQDA 1PILA 3C85A 4CM9D 5EQDA 5CD9A 3ZEIA 3RSFA 1SL1A 4BQQA 2XYHA 3AVYA 1TCCA 5JZ9A 5FJJA 4Q3DA 2IYYA 4NA2A 1RHJB 2YNHB 1FD8A 4DS3A 4XCXA 1T9HA 1PGNA 3BHIA 1T9VA 1TMOA 3R7SA 4RXUA 2DPXA 3C2PA 4R51A 2AUMA 1MJGA 3GG1A 3W5YA 1Y6JA 3TLMA 3UB3A 1W47A 4FFSA 2LLZA 1U1GA 5AVTA 5EJGA 1JQGA 1XTQA 2HS4A 3WWZA 4EUEA 4XQ9A 3H11B 4QYIB 3CNOA 2J1LA 3OETA 3V1YA 1XDGA 2WDPA 2NTJA 2H4YA 1G8SA 2C3OA 4MKIA 3G7UA 4TVBA 1FXRA 2XEXA 5BOSA 2BZ0A 2P3QA 2Q4OA 2HQ3A 2PX8A 3QUCA 3BXPA 2Y0SD 4Q66C 3TSWA 4B9LA 2PZGA 2CL7X 1Z4PX 5EE0A 3NWGA 5ES3A 1SKRA 5I9MA 3DMNA 2QUIA 3SHVA 4FWIB 2YH1A 5GM1A 4II7A 3ZLVA 5J2TA 2CAJA 3RF6A 4ZCIA 2QGNA 4OZLA 1YL7A 2DIVA 3CNQS 4JC8A 4PLCA 2V97A 2IBMA 4RVFA 3CLKA 1KFSA 1JH8A 4RETA 1GGEA 1NJ6A 1RXUA 3CO9A 1EKXA 3UJPA 4JXJA 4BLRA 1YH3A 4LQ4A 5KFIA 1GDTA 4CIOA 4RA9B 3ED5A 1FRQA 3UOGA 3C3EA 1PGPA 1NW8A 4AKHA 5L3ZA 1BA2A 2G06A 3DHVA 3BK2A 1CC7A 1NXVA 4YP1A 1NBHA 3D7RA 4LSLA 2V9ZA 4NF2A 2H5EA 1U90A 3LBHA 4NJMA 2CJWB 2XGMA 2V45A 3HCFA 1GFZA 4EO6A 2BW2A 1WUYA 4KUEA 1JI0A 1SU8A 3NEPX 1W5SA 1AK1A 2JI7A 3E22B 1RYFA 5KG5A 3HKCA 5CHYA 1N6NA 4FX2A 5LOVA 2JFFA 4OJ1A 1ECBA 1N2HA 3EE3A 2WJGA 4JXKA 4AD8A 1RRGA 5H9EK 1X1EA 2Q99A 5BSUA 1WZIA 1U1MA 1M6YA 3KHRA 3QVLA 2ZDHA 4EHIA 3H0KA 5F8NA 5HGXA 2RILA 5FPSA 1RE1B 1CJVC 4GVBB 3CO5A 4R98A 4OBEA 3JPYA 3SJAA 3ASUA 1J70A 1AY0A 5FWYA 2XF8A 1CCWA 2XHZA 5FPKA 3CLVA 2FK7A 1NIJA 3DXBA 5KNDD 3CE6A 4KKOB 1X4AA 1CF4A 3Q87B 5B0CA 4NTZA 2XUZA 2VBFA 2FZWA 3E5MA 3FI9A 3OIYA 4ITVA 4WASA 1RYNA 4EA7A 3CMQA 1W26A 2XBMA 4HDMB 4A6PA 5HE9A 2TMDA 3E4CA 1KC8T 4LSWA 1B0ZA 1UP4A 3RE1A 4D3ZA 1XK7A 4YRMA 1D2EA 4C1BA 4KPEC 5KFAA 2COKA 4OQQA 4B3TB 1BMFD 3VR1A 3ZD7A 4K5RA 4JMPA 5KNCH 5JC1A 2ZJPQ 1JEAA 1Z5OA 2PGAA 3D31A 3P26A 3REQA 4YBZA 5J5VA 3TOCA 4QUHA 4F11A 5BURA 2QOEA 4ACBA 1ZS9A 1MG7A 2RD5C 4DANA 2AG8A 3C1AA 3TQOA 3T1YB 1KJIA 3HFVA 2O5DA 5G4LA 3HA7A 1TEVA 2NZVG 3T6KA 1EG2A 3A1EA 2G5TA 2H5JA 2GQCA 1SIBE 3SQOP 3HY6A 3LOUA 3CLTC 3FNGA 1XTRA 2Y1GA 3AZQA 1MOZA 5CIWA 3DEFA 1FERA 4CTAA 1RHQA 3T1HF 4KHMA 2V4JB 3L9WA 1QRAA 1EINA 1JEQA 1FU7A 3EM1A 2QX0A 1PG5A 1SBCA 2QP9X 2H1IA 3BKXA 2X14A 3IE1A 1X4EA 4E51A 2FA9A 3PTWA 2R7UA 2Q6OA 4N54A 1UPXA 4A4DA 3EVBA 5IVPA 3IG1A 1G2EA 4O8ZA 4O3NA 1D4OA 4EUKA 2MSKA 4FYDA 1PQUA 2C0CA 4R1QA 3RC3A 2VONA 5FOUA 1NPDA 3UWOA 1AIPA 1QE0A 1SZPA 3TNJA 5C2GA 4Y6PA 1FVFA 5CT9A 5D3MA 5LT5A 1IUNA 2XNQA 2CK3D 3U1NA 4LF9J 1RHMA 1G7CB 1GSAA 3ND5A 4HGRA 4XASA 1DQAA 3PG9A 4R0MA 1S9GB 1P5HA 3VJKA 3BS4A 1X9GA 7REQB 2XH8A 4RSGA 3DV0A 4YJHB 2KT5A 1GEEA 3KL2A 4PSKA 2QUZA 3E84A 3GZNB 1UBLS 3ICQB 4FJ1A 3SU8A 2N1BA 4FFBA 1N6OA 1KI1A 3QWFA 3FR7A 4EAQA 3RLIA 4IKPA 9LDTA 3SFTA 1MJGM 5F5LA 3BGIA 1P2BA 3D8HA 3VZSA 3MAAB 2ZSFA 4W5NA 4CG0A 3FROA 4AD6A 2YNMA 1QD1A 4HV4A 5CH8A 2XGJA 4E15A 2OA0A 2HGMA 3UFCX 1VXRA 2ZTMA 3H9JA 2G9RA 5I7FA 1M2JA 5LQUA 4ZQHA 4V0KA 1AS0A 4ENSA 4UMFA 2MOKA 1KQSR 5DSZA 4LDJA 3SC3A 3N7AA 4WNAA 3L7MA 1PSWA 4PPYA 2E4ZA 4RJJA 1MAHA 4MVXA 1O96A 5ER6A 1KI9A 2NVUA 1RQRA 1N1EA 2VV5A 4NLUA 3UG6A 3HV2A 4LYFA 3LANA 3TAHA 1SC4B 4CLUA 8AT1B 3RU7A 4FOPA 5GZ6A 3PUXA 1OV6A 3O75A 4B6EA 4NCAA 2H17A 4KACA 4X65B 1U0OC 4N48A 5H3CA 2RHWA 2J0SA 3TM5A 2ZAGA 2KVQE 1H8EA 3B2QA 2NXWA 2P40A 1KI6A 1NXQA 4M0LA 2FSIA 2E85A 3SX2A 4LBVA 3AI3A 3L7UA 4HLUC 3RW6A 5KOYA 1GAXA 3FDSA 3HJFA 1JLSA 3BH0A 4CIXA 4EY4A 3KLNA 3MFIA 2PPLA 1SCAA 3EG9B 3CKLA 4QRHA 3AT1A 2IQ5A 2X3FA 4HPWA 1ZS6A 3OQIA 2EFHB 2DR7A 1J0DA 5EWLB 4L6IA 1NURA 1MCZA 3LQRA 3RGWS 4J0HA 1TADA 3JSRA 1U0HA 1XMIA 1B76A 3OEHD 1KVUA 3LKDA 2YASA 4R2JA 4WD3A 2QLBA 1E7SA 3OJOA 3AW9A 3OOHA 4DIFA 4ZPWR 1JU9A 3OAAA 1GUAA 5E2QA 2JNWA 2XYPB 2SNIE 1ZXXA 2IYLD 4M9RA 4G09A 4RAOA 3CQ9A 4K03A 1OZFA 2VJNA 4QYXA 4PYMA 2MSTA 3M5DA 1BAPA 4W5RA 4CI9A 4V1CB 2F1FA 3CWZA 4JI6J 4KR9A 2B1RA 3TE7A 3EZLA 3TJMA 3B85A 1WF0A 5KFYA 2MKJA 5DJBA 2XWYA 1A5ZA 1JL3A 4MV6A 3O8BA 5CB4A 4OQ4A 4WKCA 3QW4B 1OI7A 3J81j 5A06A 1LQTA 1I5EA 4KR0A 4R9VA 3LUHA 4Y2GA 1WPGA 1W5EA 3RNOA 3A3KA 1ESCA 4WLEA 2XZDA 4YJ2F 2PL9A 3LRPA 2QLFA 4B3MF 1MX9A 5JEDA 3LK6A 2ZVPX 4YCLA 1TZKA 1K5HA 1KOJA 1XDBA 2E82A 3OECA 1FU8A 3EXEB 1NVKA 4DUZB 4BUCA 4PRFA 2J3HA 3AL3A 5AHOA 4ITSA 4IDNA 1DE0A 2GETA 2II6A 3IGNA 3HJCA 3ZTTA 1GADO 4MYCA 4KI0A 5JNVA 2NTNA 2XHCA 5JO0A 4O3MA 3ILIA 4V3CA 1Q0NA 1HTWA 4MVJI 3EOZA 5T4HA 1H2EA 1TYCA 5CGZA 5BN3A 5FHRA 5FULA 1JG7A 1BYUA 2D5IA 3HP1A 5AKXA 2JCXA 3OZIA 4TT3A 2VBGA 5HKKA 2J41A 4MPTA 1JKHA 5FR1A 4RVNA 1V9SA 3BF4A 1KVIA 2E6UX 3I37X 4AF6A 5C9ZA 1Y4AE 1U6JA 4JX8A 3I0SA 1XU4A 1WXDA 4XPZA 1T8TA 3M5PA 2FYXA 4BMPB 3M2UA 4B9SA 4TKZA 3OZGA 2GEJA 3WL6A 3GRYA 1Y7HA 1JXLA 4TQAA 2VDNB 1SL0A 5DF1A 2WBRA 2WYUA 2C8JA 3IURA 5K1ZA 5CXSA 2WOJA 1Q92A 3E9RA 3H19A 3GH3A 3TW0A 4P2MA 3V4ZA 3DLGA 2E1AA 4XDHA 1T3LA 2ZH4A 2YKMA 3ESAA 2PMHA 1UC4B 5KFUA 1IMJA 2HHQA 1ODKA 4B6JA 2V8GA 1Y4SA 2UXDB 1IEVA 3GUVA 2FQXA 2IZ0A 1BXGA 3VR3D 1KBZA 1HBOB 4IDPA 4D8YA 4D45A 4PFKA 3ISNC 3PRDA 1SM4A 3AUXA 1KQGA 5CHCB 4DV6J 3IP3A 4MS3A 1VI5A 1EK5A 5IVIA 2I1QA 2JDJA 2R48A 3GPBA 2HQOA 4L2IA 1NZFA 1GGMA 3DA8A 1XRPA 1SBTA 3WBBA 4BNUA 3H1GA 4NI2A 4NICA 4J9RA 3TA1A 1YQUA 2GPTA 4RW7A 4NKRA 4NOMA 4UEKA 4TROA 4HQ6A 1YHYA 3QFWA 3HWWA 2EJCA 3NCQA 3GG9A 4C8ZA 2PH3A 3VAFA 5C37A 3HR7A 4X4QA 1KK1A 2QRKA 1XZKA 4UUNA 2FLNA 3O4RA 3P8BB 1QP7A 1U48A 1VSUA 3T4UA 3KK1A 5IXUA 3K4QA 1JE1A 1PG2A 2WRMA 1J8QA 1JF8A 1I2CA 3JX9A 3DDHA 4PLZA 3O7MA 4IQMA 2KHZA 3W6NA 3EW7A 1IN8A 1M5TA 4L28A 1R0ZA 4XD7D 1I8TA 4JC0A 4AP5A 5KSYA 1TT5B 3TZZA 4I55F 1S9EA 2HCTA 3T15A 4B3XA 1BQMB 1JTVA 1L6IA 2VR1A 1SJRA 4A8XA 4GS5A 5HA5A 5I9TA 4WIAA 3KEOA 4NDZA 2LMIA 3KK2B 1XNRF 4MVJD 5G0TA 3OSUA 4U5XA 1WZUA 3FRZA 1NLUA 2L41A 1QRSA 4O0MA 4RY0A 2HWXA 1UXGA 1RU2A 4QDOA 2EJUA 3CUVA 3A6DA 3BSFA 2IQIA 1ZG3A 4MMYB 4P74A 4K86A 2WMOB 1BGXT 1Z2CA 3TQSA 4MEAA 4EW2A 1E1CB 2DQYA 4KPYA 1CUCA 1JJIA 3PWZA 4JJFA 3QI7A 4B33A 5AXKA 3BBPA 1ODTC 3Q5GA 5FA8A 3IPLA 2QW0X 1ZCBA 4R71A 1CDEA 3UQYS 3GNLA 4ZQGA 2DOKA 1YR6A 2RAFA 5HBMB 1F60A 2R8IA 2WEKA 4COOA 3PE3A 4L4YA 1T3GA 2OVBA 1V96A 5A9TA 2XD9A 2MQ8A 2O05A 4EVRA 1C0KA 2NIPA 5MLCV 2RU9A 3BB5A 4L75A 3BSAA 1YI1A 1BKDR 5KOHB 4JUZA 2XUIA 2IXDA 4GKKJ 3L5OA 1OXUA 2YHSA 4FUQA 2PI4A 5C1BA 3CE9A 2WHPA 1D9ZA 3B1WA 4ZCQA 3FSXA 4LMPA 1YB6A 2GEDA 1NRWA 2V55B 2P1RA 1E98A 3RWOA 4H4OB 2X0DA 4M6WB 2QA4G 5F8HA 3AJRA 1LQUA 3B5JA 2PI5A 3AI7A 4UBIA 4CL3A 5KFMA 3OTWA 2HRBA 5K4HA 4UVIA 3RUEA 3EVWA 4ZRDA 5IT9A 3ABIA 1SIUA 1AZTA 3R0IA 1FUYB 3P2YA 1TL5A 1S5ZA 3M7IA 3G0GA 1TD1A 4IG3A 4UQOA 2PYIA 4FYXB 3KYDB 1Z25A 5B58T 1G3UA 2R8HA 1VKRA 5F52A 2CA9A 5FEUA 4MQ6A 3E2EA 4EPVA 3R8XA 5ALPA 3R9WA 3MUNA 2VSOA 4ESEA 5A3RA 3H1TA 2NXNA 4JB8B 3R7FA 1UWLA 5F5NA 3ZBTA 4J7AA 1DRVA 1GRVA 2HB6A 2WYHA 4FPXA 3N79A 1VMKA 4XYLA 1KO4A 2VI5A 4D6YA 3EUNA 3BQNB 3MMBB 1Y3IA 2I99A 1F0YA 4KODA 4E2ZA 5ALIA 3P45B 3OSZA 3GD5A 4QJBA 3ASYA 4LSNA 2OSBA 1PYTA 3S8YA 3PW4A 4PGHA 4IGEA 3C8DA 4CKXA 5NULA 1RM4A 1RYHA 3RC2A 3AHIA 4DF4A 4U7UD 1E1KA 1KYXA 4OQPA 4EYQA 2R8GA 4L4ZA 2FDRA 5B3KA 1MABA 2DTEA 2BOVA 1ORDA 2X1VA 3SQWA 5HJ7A 5J1NA 2WAYA 4QBHA 1W36D 3PR3A 4EG5A 1JDBC 1RAOA 1PF7E 4EYSA 1YHNA 3IMGA 1NVVQ 3TF5A 5CVUA 2MSNA 3K9BA 3EQ8A 2QGFA 1Y7PA 4GOMD 4IUBS 3I4LA 1CTQA 4F26A 5WRFA 4DWJA 1FP6A 4F8EA 4LF4B 1CJKC 2I6TA 3GCWP 2QVZX 3QQ5A 4N3GA 4PO9A 3I56S 3DF9A 2FWIA 3WLJA 4YJ3A 4UOGA 4MI3A 1KFKB 3OEWA 1RQLA 5E7IA 5K14B 4RHFA 2D8MA 5IH7A 5CH7B 3DF7A 1N6HA 3DZGA 4X7BA 1JAXA 3SNHA 4EATA 3JTNA 3EXHC 3IO1A 1ILEA 3O5TB 5IG2A 5J1EA 1MJNA 5J63A 4DA0A 3TGLA 5HSPA 2P2YA 1TIPA 5B7GA 3T5BA 4OLAA 1ZA1B 3KLBA 1UWBA 3PM9A 1G4UR 4AQDA 1JPUA 3AFNA 1TDJA 1DJNA 4CMEC 1NY6A 1FNCA 3PIPQ 3R9IA 2CQ1A 2VZ8A 4Y3CA 3QBCA 3CMES 4HT5A 2J5KA 3WWPA 3JWIA 2G1KA 3RUAA 1JKJB 5K4AA 3GLHA 4LUBA 2FZKB 2B4OA 1IG3A 4AUMA 5ICGA 4I9FA 4RBTA 2X1FA 3HKDB 1CYDA 2R7KA 3THYA 3W0LB 1DX4A 5E6SA 2CMDA 1V8OA 4XB6B 3TECE 4DL2A 2HLDA 5CA0A 2QL5B 4OLJA 4K9MA 2Y27A 3N0XA 5MFPA 2PUCA 3T7RA 1XP5A 3OTBA 4RQUA 1FMFA 2ZG6A 1TA4A 2CKWA 2DZDA 3M1VB 4F85A 5JE8A 1WTCA 1JEYA 1GXSB 3RAPR 4E33A 4D98A 1UANA 3GN2A 3HCBA 3UPFA 4E11A 4XJSA 1D2HA 4NJOA 4PX5A 1L0BA 3PBKA 5L1JA 4HQFA 1FFXB 4G0UA 3JQRA 1OY1A 1VLVA 3NEYA 5IJZA 1RISA 1HNXF 2A0FB 1KHWA 1KS2A 1KHHA 1Z18A 2ZP1A 2YV4A 1J5OA 3PEYA 4PHHA 4MSUA 5CYPA 3CR7A 3CC8A 3QVGB 4ILEA 1CIVA 1RWVB 4BGVA 2YVLA 3KD2A 4V39A 5H4GA 4QNRA 4YRBA 3MEQA 1D1UA 3GPAA 3IGFA 4F04A 4FR0A 3K1AA 3PJRA 1XXLA 4DMUB 2QE7D 3P20A 2Q6LA 2O01C 2UV8G 3OIUA 3W60A 1WJ9A 4O4RA 3SXUB 4D3GA 3I87A 3AFGA 2ODPA 1FMJA 1NLZA 3V81B 4TRJA 1PZEA 3IR6B 1PFYA 2JB9A 3B52X 3I0ZA 5HE8A 4EUHA 5EN4A 4J43A 4DRXA 4ADSG 3F44A 2Y1XA 1I33A 3ANXA 5IDVA 4BWVA 3GFBA 1SKBA 3KQHA 1RWWB 1V6HA 1L7NA 3DOCA 4ENWA 3RR8A 1J49A 4EBCA 4I9HA 4DWWA 1W75A 1RHRA 3USZA 2H4FA 4MW7A 2HV9A 5DG8A 1PV1A 3CT6A 3BJZA 4I1OA 5AI4A 1E6WA 2ZYWX 3D64A 1W1IA 4KKXB 1G7RA 2JFZA 4CPDA 4IVNA 3I8OA 4OP2A 1AURA 4HL6A 2YV1A 4RUCA 1CZNA 3UPDA 4DDUA 1RAIB 1RYDA 3N2KB 1HQDA 3G0CA 2GJSA 1DPFA 1DC6A 1GG2A 4TMYA 1IVYA 1HE3A 1N7GA 5JLJA 2VOOA 3BGLA 3WB2A 3W06A 1YRUA 3W5IA 3FPEA 1Q5VA 2YWEA 4B3FX 2B34A 5EJIA 3TQHA 4WFBQ 1EP3B 2JI4A 3HBFA 4CKYA 1LVUA 2FGJA 4HTAA 1E0SA 1EM8A 2HMIB 4BVEA 2HAFA 2W70A 3NYIA 1USVA 1HFJA 5BV8A 4K50A 2J09A 1R89A 3HUDA 4NMLA 4EWLA 3EX7C 5DRKA 2O66A 1HDGO 1QWOA 4EB3A 3HHKA 2IIPA 1IIRA 2YFKA 4I69A 3DNPA 3K6KA 2ZJBA 3R5GA 2V9PA 2WHQA 2KJVA 1DG3A 2YXLA 1CS0A 1TRHA 1XMJA 2OV1A 2V6AA 2HBRA 3NKVA 1KVJA 4LREA 1FFGA 1JKMA 2JZOA 2J4DA 1TL4A 1T95A 1KSGA 4TV8A 3GILA 3MWGA 1MPXA 3W5SA 3QO9B 4GEKA 2Z6VA 3BIWA 3F5DA 4H6WA 4WXMA 2JKZA 4AKSA 3EGVA 1ZH0A 2D41A 2GIQA 3QLVA 3RF7A 2AYXA 1XLTC 5KG0A 3OJFA 2I4IA 2P30A 1E20A 3KPYA 4ZRMA 4J1QA 4F1WA 3D7MA 5E38A 1EUCA 3HRHA 4AY2A 3QJ5A 3EIUA 5CYQA 3ZWKA 2WSYB 4MJ7A 2QMZA 3IKMB 4UD6A 4ZYVA 2J07A 1SIOA 2OC4A 4LFAJ 4DS4A 3MXTA 1UETA 4DDFA 2BGNA 1N32F 5DIFA 3V5RA 2A1BA 4Q1DA 4U6NA 4MR8A 2UUTA 1XPUA 1XMBA 1VLQA 3HADA 1ITPA 2MQQA 2ID4A 3U7JA 3ISZA 2X23A 1LWFA 2LKZA 2VNSA 4DJTA 3AHJA 1CUXA 1IWBB 2P0YA 4RV9A 1BMFA 1NK8A 3NBXX 2WJPA 3STVA 3VMFA 2CPYA 2UUAF 4BQFA 3K15A 3LFUA 3AY7A 3L7YA 4JT9A 2ISSD 1J9EA 3M3HA 3OO1A 1XNGA 3FWPA 2Y2VA 2OQIA 1OYWA 5AW3A 1XX6A 1UJBA 2F90A 3CEHA 1ICEA 4PWUA 1HG1A 3QPBA 3FCUB 2CVIA 3C97A 5KG7A 8MHTA 2C8VA 3C3YA 2I5PO 3ODPA 2W8BB 2AMVA 4YMGA 5LNK6 2AD1A 1EK0A 2XSJA 5JCJD 3H84A 1EXWA 3ET6B 1PIEA 1KMQA 4Z0NA 3TXXA 3UDCA 2AMLA 3HXTA 4TYQA 3CLSD 1AKYA 4ZQIA 1XCJA 1GEHA 3HJNA 4DJJA 2IHKA 1NR5A 5K0LA 1M2FA 3G2KA 2VJCA 5JCOA 5K0FA 3KJVB 4RMNA 2JAQA 3OUTA 4DMRA 1BX3A 1IHYA 3MD3A 2F55A 4BJ3A 2MDAA 5U9CA 4R5HA 4HFJA 3JQAB 1N2EA 4YRGA 3CF6R 4QDTA 3RS9A 1YB2A 2JLZA 2RHJA 1ZZFA 3LC2O 5JTUA 1W0KD 5LJ3Y 4P0TA 1Z5PA 2GVNA 1Z8HA 2WF7A 1U4SA 4H7KA 4RNCA 2YJ6A 2OPQA 1ZD3A 1P74A 4MS1B 4GGOA 3SBEA 5ELMA 1SUQB 2FTRA 2GCOA 5E6RA 2H00A 2N1MA 4ALNA 2V7QA 5IVHA 3DEAA 3GQBA 1UJNA 2B5WA 2A84A 1ZOPA 2C4TA 1UAWA 2ZRBA 3UCUP 2XB6A 4JJKA 2VODA 2PQ2A 1CB7A 3KB2A 3CIZA 3GBSA 4N3AA 2IMWP 2J0VA 4C14A 3IJEB 1X5OA 3FOZA 3LCCA 1RWXB 4KQZA 3B3QA 5DBOA 1Z4KA 3WYGA 2NCKL 4PUOA 3DC2A 1PGJA 4OHCA 5IT9Y 3HABA 4IL5A 4UQPA 4JI2J 3WGIA 4XX0B 1CPZA 3IUEA 3NH9A 2KYXA 3RABA 1U09A 2NTEA 1DIAA 4N5HX 3VHLB 3ZHZA 1KEZA 1JLRA 1EKRA 2VEDA 1R8XA 3DKRA 3G0BA 2G04A 2JNJA 3A1YG 2DNNA 3VC1A 1NC3A 5E9QA 4NLVA 3WLAA 2I6XA 4ZI3A 4AMGA 4YTEA 4J1SA 3BD7A 3ABOB 1YZUA 3F9RA 3TM4A 4KQIA 3R7NB 1SCQA 1EX1A 3ICEA 4B5LA 2MZTA 1A8QA 2R1VB 1R6TA 4A47A 1W581 3B6ZA 5CB4F 2PMZD 1KQKA 4URVR 1LC0A 2E1PA 4ED6A 3IUPA 2KHCA 3JXOA 3PW5A 4PQRA 1EFLA 3GLFA 5TARA 4REMA 3V34A 4QR1A 1L4YA 3STWA 1KP6A 2B7BB 1XL1A 2FMXA 2PQMA 1VPTA 1T9DA 3Q9UA 2YC4C 4G2NA 4NEQA 1Z28A 1MBZA 4MRMA 4UJ3A 3LPEA 2A3RA 4LGCA 1ZLXA 2CUNA 2R0QC 4ID8A 3M2TA 1NM5A 2EP5A 2VG7A 5AK4A 5C8YB 3WYAA 1HWUA 3U7IA 1D9DA 3BCSA 1OH5A 4JP3A 4WLUA 4EO7A 3GYBA 1IHPA 2A6OA 3SZOA 4QHTA 1UKYA 2BMJA 1WMEA 1WOMA 5TF0A 3K0CA 5BXIA 1RA7A 5GOTA 4FN4A 4MW6A 2BKVA 2EKBA 3UG7A 4P6QA 1ADJA 5B53A 2I2FA 4UEWA 1R6VA 3GSIA 3S68A 2HNYA 2FPUA 4RIIA 1A0OB 5EJEA 3L46A 4UTRA 1VMIA 1TAQA 4I2PA 3VAYA 3TQ1A 1R0CA 1SH2A 2V3CC 3PIIA 4CL2A 4H0CA 2O2GA 3WX0A 4A8HA 3OZEA 4KQGA 3LG2A 1DARA 2P9HA 3AL2A 4NLDA 5D85A 2Z6QA 1JSRA 1PTKA 5A02A 2IH2A 3ONDA 2BABA 4QARA 3PO5A 3TOSA 3K6JA 1SXJE 2FKNA 4N7RA 3CPJB 1RT2B 4TZ0A 3ES9A 2RKOA 1AQJA 1X9WA 4YR9A 3AUYA 3ZDZB 5G02A 5L7TA 1IOLA 3UAZA 1GM5A 1I7LA 3E8SA 1Y3DE 3O2QB 1N2GA 3OTOB 3CZAA 4F2RA 1M1ZA 1WXEA 2NAPA 4HDSB 3O31A 4BCDA 4F3KA 4TVAB 2QJFA 4EGLA 3CDEA 1EJ0A 4DV1F 2WTXA 1E3QA 4BC0A 2MSLA 1QV9A 4DGSA 3ANTA 2IVZA 2V7EA 3PFEA 1TMKA 5SICE 4AM8A 4ECSA 3VOAA 1UXHA 3ZDAA 3EOAI 3FOCA 1BFDA 4CMIA 4AT1B 4YUWA 1ZXLA 3ETOA 5L3QA 4IVRA 4HTJA 4C8LA 4NQZA 3FCAA 1SQ0A 3R3ZA 3VZHA 3NXSA 2F3RA 4FYWA 3ZIDA 2ROQA 4P3KA 4YCJA 3M0EA 1KONA 1DEXA 3H8SA 1QGOA 2QW8A 3V4PB 1TPZA 1E1LA 1J0EA 5H4HA 1QSYA 2C4MA 2VYND 3IHWA 4Y7DA 3CO0P 1Q6YA 2Z4PA 3OM0A 2UZ1B 1AKWA 2WC1A 3EIEA 1RQGA 3OTQA 5KKAA 3M6UA 1UJMA 1TQHA 1XFAA 4EEKA 2H1RA 3JATB 4OI2A 3SC4A 1NA5A 4IHAA 3BM5A 4XM2A 3B9QA 3L95X 5DLQC 3W5AA 1EMDA 3S8SA 4HHUA 4EQZA 2C22A 1GAJA 1N6QB 3G02A 1V4BA 3OO0A 2WW8A 4M8NE 3OQ6A 5B4VA 3CW2C 2H51B 5IV4A 3EEYA 3T7TA 3GRCA 4WACA 4AJLA 3GVPA 3X3UA 1Y0BA 3LCVB 3LMKA 2CXQA 1QLNA 3HRKA 1M2OA 3KT8A 4DV1B 2IZ6A 4QNMA 2YZKA 2OCIA 1TQ2A 4L95C 2F8EX 3PPXA 3NQ41 3B1KA 2BX6A 3F8SA 5DLPA 1XZBA 3RUDA 1CY4A 2A5GA 3ASZA 3GZ4A 1YKFA 5AJZA 3WC4A 3Q8SB 3QXSA 2D69A 4LKOA 1FUUA 2OPRB 2YWJA 1P75A 1XCLA 2WLTA 1GR1A 1QLWA 1SBQA 4G9GA 2C2EA 3OF5A 3QQCD 3KTDA 2JZCA 3FWYA 2OB2A 3BMOA 1Y9ZA 2CHGA 1ISRA 2B9WA 4HPJB 3C24A 4I1RA 5A8RB 3M9NB 5IT5A 5FI5A 2J3MA 4A8QA 3I0RB 1J6UA 2REBA 4GKKF 5AVZA 4UU8A 2ZSJA 4L5YA 2J08A 1QVWA 2WY2D 2CXEA 5DXAA 1A7UA 4GPTA 1WXWA 5K8VA 4ELTA 4UBJA 2G67A 3DVRX 2DBVO 1SCNE 4M0CA 1ZWKA 4F7WA 4PGGA 2QMYA 3GLIE 3CLUC 1LQ2A 3R1IA 2QR5A 5DYYA 2XQGA 2GXUA 1WHTB 3A3OB 3ZY6A 4RO0A 2A1IA 2DR8A 1P4HA 4E09A 4D5GA 1N34F 2ZK7A 3ILLA 2WP8J 2W58A 4NZZA 3JQ9C 3ZE9A 4LKRA 1RCUA 4F5WA 3CONA 2EJTA 1XLWA 3TAPA 4OQMA 3FSGA 2FP4B 2HHHF 2J0UB 4CL8A 4DC1A 1J1IA 1A5BB 2W43A 4LR7A 5KFVA 3L18A 1FQWA 4E0BA 1ZRHA 1IN0A 3HVHA 3CIMA 4C3VA 4D8VA 4D4HA 1EK1A 3FXAA 1BIFA 3UXHA 3COWA 3BMQB 2DRDA 1PO6A 1QWSA 5HVFA 3WGLA 2F3PA 4K9RA 3BERA 3NOQA 2ATIA 4H0FA 2PD4A 5IEJA 2BFDA 1FPMA 4Y1RB 2B20A 4GR5A 1VBXA 3OZCA 4X8OA 2D06A 1J1ZA 3OR1A 1GU7A 5A8KB 4NHEA 3CEAA 4J0GA 2JVOA 4NCXA 2NXJA 1AO0A 3LW7A 1CUUA 1MQSA 4OL8A 5HFNA 2VNIA 3OX1A 3TIFA 2PUGA 2O4CA 3HSYA 1U9YA 5DU2A 4WY2A 1QHIA 4ZITA 3ENNA 3VZIA 4M8SA 2HRUA 5M2RA 3LP2A 1TU0B 2R8JA 4E08A 4LQ9A 3SFZA 2VXOA 3H8VA 1HWIA 5THQA 3HSZA 1U8YA 4DR7F 4M5GA 2N46A 3T4XA 4F67A 5COBA 5C31A 1U1DA 4I8XA 1HE4A 4QYMA 3SZMA 2C3PA 1NBAA 5KHOC 1DIOB 3CUSA 1T9GS 1QHNA 1RNLA 1JG3A 2L19A 2FC8A 2F3UA 4LTMA 4G0PA 4FIDA 2B9XA 1S7HA 1RQ2A 4AY6A 1QC5A 3BTVA 1IXSB 2J8ZA 3WL4A 4I9NA 4KFCA 4JI5F 1ZOSA 5K45A 2X5KO 2Y1EA 1AK2A 3Q83A 5JUMA 3D3JA 4F4UA 5HJ5A 5F2OA 2WWHA 5ARBA 3HVJA 3PNIA 3B20A 2OHOA 3SMVA 4KXWA 1EPUA 1U6ZA 1T5OA 1K0TA 3NIFB 4Z2AA 2DHGA 1TYEB 4PIVA 5EQFA 1EH5A 3WDKA 2G2OA 1MO6A 2QQ0A 4Q02A 1F38A 2YZMA 4PC2A 5ALUA 4D42A 2FH5B 4ZT3A 5LBIA 3KQNA 1G3RA 1R8JA 1WDWB 1YRWA 4UVGA 3J7TA 4K2XA 3JSYA 4ZDIA 1S99A 2FCRA 1BJRE 1JVNA 1T1RA 3V8VA 3TA0A 3TZHA 3ZEAA 1EEXB 3T9ZA 3O83A 2ODQA 3IT2A 2GA7A 4Y2UA 5K3CA 2PLFA 3ZE7A 2OELA 1PV2A 4DCJB 2NQTA 1TUEA 2X6QA 1P0CA 2V98A 2ZJ0A 4NU0A 4QU9A 4BP1A 5ETPA 3NXZA 2GTPA 2IHJA 1C7EA 2VDWA 2EFCB 2RG1A 2FPPB 3TZXA 2ERYA 5LLSA 5TQVA 3KK3B 4QPJC 1FVOA 1NGSA 2BUAA 3CWJA 4MHSA 1ZCFA 1PBTA 1RI4A 5BQ3A 4GQAA 4HWTA 4E5MA 3RT7A 2WF8A 2XX3A 1D0EA 4Z4HA 2HWIA 2E49A 3TYXA 2ERCA 4II2A 1YONA 2F9LA 4CCSA 3KFVA 4TWAA 1E2MA 4OMCA 4K6HA 3DW1X 3AXSA 3JCZA 1AQUA 3IR5A 3BDIA 4RNHA 5BWBA 4BNGA 1O77A 1REGX 1Y0HA 1FFWB 1YVEI 2BVNA 1FWLA 3HCRA 3DOKB 2RGNA 2XQIA 4Q82A 3T9NA 3CJKA 3P5SA 2W9CB 1KU0A 2YQ5A 3O8CA 4F3OA 1CVIA 1KIAA 1NX9A 5AHKA 1QQAA 3QP9A 4JYAB 4TLDA 1XG5A 2QRZA 4OF4A 2FF7A 2W25A 1FNDA 2QG6A 1S4EA 1M2VA 2BEFA 1P1RA 1DCFA 1VTKA 3QMPA 1QKKA 3NHAA 5G0SA 2HTFA 2QTGA 3KIPA 1Y10A 3EPGA 1Y5IB 1RKXA 4KY3A 1HYBA 4XFJA 4O2BB 2IRWA 4PZUA 1JVBA 4FVTA 4DV0J 3JY6A 2CN1A 5LC1A 3JQGA 3JRWA 4ZQFA 3HB4X 3N9UC 1BD4A 2CDBA 1R2QA 3A0UA 4HGQA 4MQEB 1YO6A 3DLIA 1UPAA 4ARSA 2XI2A 4MHTA 4GFDA 5DT2A 3ZCRA 3CXCR 3R6GA 3RUIA 5D7NA 5GINE 4YFUA 3TEHB 3T4PA 2BBOA 1JIUA 3V46A 5CEEA 1H0SA 1VRTB 2PWYA 4WK6A 4J0EA 4JI0F 1VIAA 1I10A 1N8SA 3DOLB 2AFHE 3K73O 1DINA 2ZVSA 1LW0B 5DDPC 5EHZA 4NX9A 1AGPA 4MQFB 1WZCA 1E5DA 3K70C 2ZVIA 4BRZA 2AZ1A 4CMEA 2FFRA 2RHQB 2BQRA 1ZJYA 3GGJA 1I30A 1KRWA 4C2MA 2KMLA 4OI0A 3UT5B 1ZMBA 2ZSDA 2OZLA 3MEKA 3OPYB 1M76A 4YJ2B 5CCBA 1NPKA 1JSCA 3QYFA 3NL0A 1CULA 2CGEA 3IUMA 2WE7A 4DIEA 2YKQA 3WX8A 2ZRKA 2P5SA 1L1FA 1DBDA 3JWEA 2GGSA 5M2PA 4YY3J 4LX8A 2REOA 1LPMA 2XBUA 4G0YA 3ROXA 3ABSB 2CPZA 2JIBA 4FDFA 2HIMA 3M6XA 2OHIA 1YD7A 2J7PD 3DXZA 2HSZA 1BO6A 3B1XA 2FC9A 3FH0A 4GC9A 2BEWA 3RAFC 5EUCA 2P4UA 2KXFA 4WECA 4KB7A 4KQJA 3NHBA 2QD3A 3OE4A 1BC5A 3NTQA 2V6BA 3OH8A 1RCXB 1GQRA 4G85A 3A27A 3EPIA 1PK7A 3T38A 4N5IX 4DG1B 2Z1MA 3VTKA 4JYBA 4MVWA 1DV1A 2LD4A 5EZYB 2BCJQ 1SKYB 4DR2B 4ZVPB 1BA3A 4G37A 4ER7A 2W4MA 2DWPA 3A11A 2CXNA 3D3QA 3HVUA 3KJQA 4QELA 3DBRA 3VPCA 1LBTA 1YE8A 2GN2A 2QUKA 2VSFA 2NU9B 3CSDA 4INZA 1XCGB 2EC0A 3UD4P 2DVIA 3ZXYA 3PW7A 3OP1A 3DTVD 4DPUA 3DE4X 4YHHB 2ORIA 4P3NA 3SBOA 4W98A 5AO9A 5BPFA 3EGWA 2WAXA 1IBKJ 2A9FA 2VWHA 1QG0A 4UOCA 4PGFA 3KHTA 1L7VC 1J09A 3IV6A 3GLRA 1P5ZB 1HXHA 1RRFA 2P9CA 3O3CA 5ADVA 4CLTA 1W0KA 4IQ0A 3M4XA 1FE8A 1G5TA 5DN6D 5LP6B 1H6AA 3GMTA 2HLNA 2JI6A 5CA0F 3R5JA 1M74A 4Y1EA 1K92A 1Q15A 1M8JA 2QRGA 2XO7A 1QVGR 1Z4UA 1ZKDA 5F0UA 1DU4A 1K06A 1FDBA 5JXSA 2JJ8A 4N0PA 2HQRA 3L92A 2EWMA 4LISA 3Q23A 1O94C 2VPIA 1FRKA 4L8VA 1H2HA 1POXA 3IBSA 2C2NA 2E4UA 1YASA 2C7RA 2QK4A 1XVIA 5GMEA 1CRPA 4LF5J 1RZMA 1RLOA 3SYRA 4NEZA 1AN9A 3KEMA 2J9YB 4HMPA 4MYSA 5CYMA 3PW2A 4QYRA 4PZAA 2XY6A 1FP7A 1U3FA 1Z2AA 2R7WA 1KI2A 4AUEA 4I6YA 4LOJA 4AWAA 4MTCA 1Z62A 2A1TR 4HQNA 4NBVA 4MRSA 3DQPA 5JNTA 4V0OA 1ISHA 5EXPA 3WJ7A 3F4KA 1NDHA 3W9IA 1RACA 3ZH9B 3FNFA 2YS7A 4HK4A 3VYTB 4YROA 1C2TA 3N6VA 1GUDA 3FZYA 1XJWA 3R9XB 2YX1A 2Q3CA 2FAXA 3NAGA 1W85A 1G16A 4DV2J 2RS2A 5KYWB 4QPDA 3K0BA 3QSYB 1EJBA 3E01A 1YB7A 3QEMB 4C88A 3MR5A 1FRLA 1U7UA 1L4MA 4U9RA 1EG7A 1ZN7A 1ZL0A 2W0MA 1Z29A 5HL7Q 3KLPX 4IHKA 2B8PA 1Q7BA 1U6BA 3AB2B 4DUGD 1PZNA 2A5LA 3DLTA 4EJSC 4UHFA 3RG8A 4IR1A 3THXA 4ZI7A 2DGQA 4KHRA 3BA1A 3IXMA 3QHAA 3RSGA 4UUMA 4KVAA 2G2ZA 2HXGA 4ECYA 4LQCA 5ILQA 3QGIA 3NBQA 3EZGA 3RFVA 5K0EA 3EXHA 2HM7A 4ZLJA 4EVQA 1JJHA 1WVGA 1GRCA 2Q4TA 2WILA 5JROA 2ZH9A 3X1LB 4KO2S 2EEYA 2PU5A 3UZUA 1P7VA 1U45A 3OOWA 2KW5A 4H18A 5AW4A 3J7Z5 2ZJ8A 2LXUA 4N5LA 1CDOA 2R6HA 4DUPA 2RDIA 4AS3A 3TA2A 2OCBA 5GADI 3PHGA 3H4MA 3DMJA 3IVXA 1G9SA 4W4TA 2NXUA 1X7YA 3J81k 1ST3A 4GU5A 2AVNA 4JLBA 3SS9X 1J42A 5I3UB 1RBQA 3IV9A 4UNIA 5KFHA 1BCRA 3BRWD 4OYRA 2PSJA 3LVBA 2W93A 4HVAA 2KN4A 3CLSC 2Q43A 1H3EA 3NHMA 4FSHA 3TGPA 3I5XA 1K7FB 4PLVA 4FR5A 2FW1A 3MJ4A 4K46A 4ND5A 3EUWA 4QPCA 1ZEJA 1IATA 2LQ8A 1MDBA 3OZDA 4MINA 3BWYA 4HZGA 5GJWC 1E99A 5JISA 4RW6A 2BT4A 1YU6A 4OQEA 4C6HA 3GSDA 1NHVA 1QIFA 4NNJA 5THKA 2HFKA 5KYUB 1U6FA 1ZQ1A 3RRHA 3E1GA 4L3KA 2XXJA 4C4ZA 5HF9A 3FIUA 1RZ3A 2J45A 3I9LA 1Z74A 4JB3A 4OYAA 1FTYA 4EFKA 4RMHA 1DZ5A 1WTBA 4WBNB 4P53A 2PBFA 1I80A 3QE0A 5AKEA 4JZYA 1Y6GA 4ZDJA 4IS3A 1IXKA 4BWGA 1TCAA 1LWEA 2HRTA 3H2UB 1IVNA 2NUTA 4WADA 4B1FA 4TQRA 4BRWA 2MGZA 3W63A 2VG5B 1K2VN 1VJRA 3N53A 3OOYA 4RADA 1C3JA 2AG1A 2ZREA 2CQ2A 5T4FA 3N39C 4IZIA 2V9KA 3OC0A 1NXIA 2GQ2A 2DE0X 3MERA 1UEVA 3HSKA 3R1LA 4CUZA 5GVQA 1LXJA 1SVDA 4B3RF 4RIHA 4EFMA 2DXDA 4FOOA 4YRZA 1CJTA 1JYEA 3DZJA 1Z8DA 1XNRB 1EFHA 4DU8A 3V3KA 2E1RA 4OJGA 1T8WA 2VQSA 5FKJA 4OKSA 4KK3A 2WJYA 2C04A 1M8GA 4DV4B 1ZP6A 3KQTA 1WCYA 1Z4NA 3I2IA 1D2MA 1F0KA 4MYDA 3M33A 1HQEA 1D4ZA 2KM8C 3L0PA 3HZGA 1EAMA 2D1TA 4HNAB 1UBRS 1KMCA 3FB1A 4Q3NA 1ONSA 3A1WA 3IESA 5G0UA 4O02B 4RZ3A 4KR3A 4K6GA 1FFSB 1IJEA 1UBKS 3ASVA 3W65A 5E7QA 4RGVA 1XQXA 2R8KA 1FS5A 1GH8A 2AUTA 2AG0A 2CBGA 1IZ7A 5J2UB 5BRNA 1LLDA 2HVDA 1U7XA 3H8WA 4ZVRA 3CINA 4QA9A 4FFPA 3EF1A 5LMUJ 4IG4A 5GADl 2GOYA 2CZ4A 3TR5A 3RS7A 2ZSBA 3ONFA 5SY6A 1RTDB 1B7GO 3KG0A 1IZZA 3M89A 5C32A 4QYZJ 5CDFE 2PMCA 2MZJA 1RQ7A 4NENB 4OG2A 2WTEA 4RTNA 1M67A 2A30A 5IYZB 3EWGA 1NQUA 2QLMA 1L5FA 3DYAB 3G86A 5I3ZA 1X1DA 3LGNA 2BJ9A 4RK4A 1OSCA 3NASA 2VP0A 3NTUA 1KZHA 1FRHA 2DLCX 1T3NA 5BP7A 1XMQJ 1PC4A 3SD7A 1IYZA 4FBMA 3WL3A 2C7OA 3LFTA 1MWZA 2RHOA 4KJZA 1T6XA 4C7JA 3DM2A 3NDPA 1P3Y1 3OX2A 2H08A 4ZU3A 4EKDA 4UCXA 5C35A 2Q41A 4Y6SA 3OZUA 1SD1A 4EELA 1T9CA 2ATXA 1A8HA 4QZVB 4WE3A 4URSA 2H0AA 3U17A 2DY9A 1YRQA 1R5JA 2DBRA 2Y1OA 2CPDA 3D6HA 1RAGA 3QM1A 2FE4A 4B44A 4HRVA 4REQB 2PJZA 3FGNA 2Q1YA 2ZITA 3PQ8A 4EBEA 4WZ6A 4DV4F 2JIDA 3OZXA 1V3UA 1IJFB 2JVIA 3BILA 2UZ0A 4K6FA 5B2EA 1QQTA 4PPNA 1NKBA 4BMXA 3ZZUA 2H5IB 1VLZA 4IRXA 4CGZA 2OO5A 3ABQB 1IBKF 1N34J 3ZZYA 3K71B 4BB6A 2PVSA 3QITA 1MLAA 3CE8A 3E9MA 3PYEA 5CNIA 3UK7A 6PFKA 1SR8A 3V32A 3NAHA 2W6PA 3IDQA 3K32A 4E3ZA 2UYCA 2WBMA 1DJPA 4L0CA 3ZWBA 5EFZA 2VNHA 1WDDA 3E7FA 4MIBA 1HNVA 3IQIX 4ZA2A 3NVKI 2R47A 3PNKA 4PXAA 5EERA 4D8UA 5BUCA 3SIPA 4HADA 2YINC 4E12A 2O8FA 4I50F 3O0TA 5LOVF 3QBEA 4PLTA 3AHGA 2D1YA 1GK8A 3H2LA 1AVTA 1SXJA 4AU1A 1T2EA 3LU1A 5HCIA 3MFQA 4ZREA 2OBXA 1M2WA 4JI2F 3B6JA 3OEHA 1OLSB 4D9GA 2K7FA 2XZWA 3PENA 3TW8B 4DMKA 3NWRA 1WUUA 2VPTA 3RPEA 3CVJA 2P3LA 1PN3A 3U6BA 4WFZA 3I64A 4X95A 5FO0A 2DT9A 3T3FA 4X4TA 1S76D 4RKRA 2Z2MA 4GC7A 3ILYA 3RC7A 1Y8RB 4RPJA 3MQ4A 4U7PB 1JSLA 3W62A 3HI9A 1E3JA 3NGSA 1CEZA 3A3PA 2EK1A 1FP4A 5F98A 3H1PA 3IIJA 2ZRQA 4B3OB 4ZS6A 2H1FA 1S1CA 5ALVA 1Q16B 1LWOA 4BBPA 2CLIB 2VBYA 2MQNA 4X8LA 2Q2OA 2YNMC 4FWTA 8LDHA 5ICFA 4WU3A 2IUSA 2ZR7A 5A2QA 5DN9A 5A8WA 2XRYA 1JLQB 1QR2A 4UTXA 2YMMA 1F20A 2Z57B 1YHZA 2AN3A 2QEXS 3FFIA 4F5EA 1C4KA 2PVCA 1AFIA 3H18A 3A31A 1GLVA 2F43A 1ZM4A 1RTIB 1QBKC 2ODWA 2RJOA 3OCJA 2Y3YA 3CCLS 1GIAA 3OTEA 1ZVJA 3MWKA 3K53A 3DRXA 5CQGA 1E4OA 5HCNA 1RQXA 3MI7X 4BX2A 1Z0KA 2BGLA 1ZM7A 2ENWA 1JLAA 3EAQA 4AMUA 4TLAA 5KMGA 4FYVA 5FLXU 1R4ZA 5AVJA 1ZOIA 2HA4A 3AKCA 2W6NA 1CE8B 3NBYC 3ESYA 1K0FA 4TL9A 1JQLB 4BU1A 2JRSA 4BKRA 4X9XA 3E7DA 4OZ3A 1KJZA 4DMGA 2UVDA 3BV8A 4EYGA 5C8ZA 1F8GA 1YDFA 4I99A 3N8HA 1MO2A 2BR4A 2E5IA 3RB4A 4OV6B 4MO2A 4UXIA 3M2VB 1SXPA 3LT0A 3LYAA 1K97A 2GESA 1XNQF 3V4LA 3POTA 1XVVA 4Q4LA 1NULA 4H7JA 1W19A 4LFAB 3DEKA 2C5GA 4QIVA 3RBZA 4IRDA 5AVOA 5EWGA 4O4IF 3GCGA 4HOYA 2HCRA 4JUAA 4X7MA 3O9VA 4JKIA 3FAKA 6YASA 4B4DA 4RK1A 1P9QC 4K28A 1EWRA 3A6JA 3GG0A 2AWNA 5TJ9A 1XZQA 4AG6A 1Q1NA 3T3PB 3INNA 4RH1A 3QRWA 4GXQA 1XYGA 1RU1A 1HEIA 3JZFA 4FR2A 1CUWA 4X20B 1P4GA 2DFNA 2JFNA 5KTRA 4PNHA 2ZBDA 2XUFA 3GGOA 1ZUNA 3L1KA 1QV7A 4OXNA 4UVEA 3RTEA 5C7YA 4B6PA 5EMKA 1KVQA 1P1CA 3A37A 1N5YA 1PZGA 4BFWA 4LF4F 2Q46A 4KMSA 2H9ZA 4C7OB 5FYDA 1Y5LA 2BE9A 4LF6J 1USUA 4JYMA 3P0RA 2Q4DA 2AKEA 3PYMA 3QTBA 4CZ2A 2FX2A 3H5TA 1JX4A 3BFXA 3JQQA 4BDSA 3KNGA 2G82A 3UCGA 4TY8B 4DV5J 4AK9A 1MNEA 1ZTWA 3C8UA 2Y1JA 3W8NA 4USJC 2XT6A 3FX2A 3ONVA 4XTRA 4X4VA 2QTTA 4NYJQ 1HNWJ 4RWEA 2MWMA 4ECXA 1TKZB 3RBAA 4E2FB 2XUJA 3PFKA 2QT7A 4MQLA 4EB0A 3QK7A 3I9KA 4XPEA 3U3ZA 1E5LA 4BZZA 4QWMA 3PFOA 4K0RA 3N0WA 3QE4A 4RUAA 1MAAA 4XOIA 3DAOA 4S04A 3OLXA 2TS1A 4RYDA 5DISB 1DTEA 4O4IA 2D0IA 1COWD 4UDYX 1ZJ6A 2ZR0A 5TT1A 2D59A 4FSXA 4DZRA 3EULA 2GFIA 4YV7A 4BVJA 2FGKA 2GFFA 4G0ZA 4FMCF 2BEJA 1Y4ZB 1G1MA 5ALZA 1HMVA 2IHZA 4MP3A 4CN8A 1F9FA 3WYCA 4HN9A 4B3GA 2VNKA 1J33A 5FAXA 3G0IA 2WK1A 4ESVA 2Z2XA 2VF7A 1XEWX 4NMHA 3QNWB 2NZCA 5EZSA 3KUGA 2XMJA 2BF7A 3UUWA 4JQZA 4TSFD 1VQ8S 4Y8VA 2DJIA 4BRSA 4BVAA 4LFCF 3GEGA 4JNKA 1LXCA 1V3QE 4YRAA 5JZSA 3V00A 3HLTA 3HT3A 4ZCTA 2J0XA 2C3MA 1X1BA 2OZEA 1AA1B 3MPUA 1RTHA 3RRYA 4WK1A 2IU0A 3FPLA 2R4TA 4HMQA 3AOEC 2AYEA 3MJCA 4R1SA 1U8AA 5FNVA 4H16A 5G3YA 5A9SB 3N01A 3RYLA 3IWNC 4DSKA 2Q2QA 2OXRA 4M4SA 2H1OA 1HYSB 1A9NB 3BR8A 1U0TA 1N6IA 3VX3A 2Z43A 4IG9A 3O8DA 3K4HA 1XK6A 4GOLD 4A2WA 4QUAA 1CQIA 3D5TA 4O3SA 2BVZA 3NTLA 4EUVA 3GUCA 4EG1A 2JEOA 1RCFA 1HW9A 1SC1A 3PNVA 3KKPA 1RWOB 3TG8A 1O95A 4I4LA 4PXBA 2OPPB 1CYEA 3KNAA 2IAJA 3MK31 5C5EA 4KGVA 4BLUA 2N7CA 3NEAA 4CMAA 1F6WA 2VH5R 3JTEA 4UY8T 2HDHA 3B5IA 1PWYE 2PMWA 1LZKA 1BXZA 4PYDA 1PD0A 3I2JA 2Q1WA 3EY4A 4RDIA 3SQGB 5M3BA 3UOAB 4QUJA 1RIIA 3RGGA 4ER0A 3A4MA 1NBIA 3AM1A 5F8GA 4UM8B 4EFAC 4FPIA 3LAMA 4D4MA 2MLZA 3SZUA 1C7RA 1IHDA 5K8JB 3PCXA 2JEGA 2W7PA 1SKUB 1IKXB 3P32A 5CA1B 2CDAA 2YHIA 2IPAB 1FVHA 2JJ4D 2DHHA 3G59A 4HEA9 4D9CA 3UH1A 4QNNA 4FF3A 4KP7A 3OJUA 4FE3A 1WW2A 3SJZA 3X1WA 5JAHA 3NNSA 4Q1CA 4FNHA 3LTOA 2WV9A 1P2UA 2P2CB 3KO8A 1NYTA 5KOXA 4DR7B 4ZHQB 3GGCA 3AJ9A 4PBTA 3UATA 1BH6A 2CVQA 2QA1A 4H1TA 2PRKA 2J7KA 1QDLB 4OA8A 4U8VA 1ZD1A 3WK7A 4X1IA 3LY7A 2J0EA 3HJGA 2RG7A 1DUIA 3OFFA 1SIWA 3IA7A 2BGTA 1G21A 1JK9B 4C0AC 1X80B 2X0IA 1W2IA 3BPSP 5DEIA 4OYBA 3UGKA 5KTPA 3QEBZ 3W2IA 1QFJA 1T15A 4MB6A 3NONA 1N4AA 2IV2X 4M9SA 4RLHA 1OPIA 5J1PA 3CVVA 2AZTA 3EICA 3KKEA 3HBAA 4Q15A 4ZVKA 5DNWA 1FD2A 1H6DA 4JJGA 3JQEA 2W2PA 4B3MJ 1QCDA 4DYVA 4E03A 1V11A 2C77A 1Q12A 4DMLA 4E6EA 2BTQB 3EPKA 3A36A 3LY8A 3NBPA 2WWWA 1RJ9A 4OLHA 3KTAA 3L1VA 1F7VA 5BV2P 1EBBA 3SKYA 4ZZ3A 4XH9B 3DMDA 3VAGA 4QG7A 1EWTA 2EX0A 4WXWA 4ZCPA 4DN9A 3T06B 4BLGA 3TAMA 3I53A 4B47A 5JJ5A 3QX7A 3UWKA 4B75A 1HL6A 3G23A 2VP6A 4ILKA 4UOFA 4HSEA 2AZMA 4B84A 4RW0A 3B70A 5E1MA 1ISGA 1UOOA 4RAQA 3P1JA 4LWOA 3NWBA 2JPDA 4KGKA 4HI0E 4DFKA 1L5KA 1FYXA 1CQWA 2FXIA 3S2YA 3LLMA 1TKRA 3GRKA 2JARA 3OUZA 5BNIA 1MA3A 1L5HA 1VYUA 3E1SA 4IICA 5K0BA 3G82B 1OPRA 5FT9A 3P9ZA 1T0HB 1J0CA 3LW5C 5ECDA 5J40A 1QAXA 1ZMRA 3CYFA 4WE1A 1OY8A 3QWBA 3RYIA 3EXG2 3HJUA 1DOZA 4F91B 3QXXA 5CBPA 5C5JA 2QGZA 3HCDA 1Z45A 4ZZIA 3U7FB 2QTVB 3DE5X 4RKQA 3EWSA 5F3WB 4R2KA 3EGDB 4ER3A 2WWFA 2G9OA 4AKIA 1UOPA 1TLTA 3D4IA 4DR4J 5DRYA 3MWDA 1TZMA 1P9OA 3M05A 2J31A 2AYBA 4QU0A 3GGDA 1X4BA 1ENZA 4C2AA 3EFBA 3ZCVA 4D41A 1YR2A 1VMAA 1RAEA 1H7XA 1MB0A 5FPYA 2OO7A 2VP5A 1EWKA 4DYDA 1VS3A 4C97A 3KELA 4U2DA 3KUKA 4HDGA 2NR0A 2YOHA 2WKRA 3P5BA 4P2BA 2ZBUA 4YQZA 4ZVOB 1LTHR 4E8UA 2KVIA 4A0HA 3B48A 4M36A 4TZ6A 2K2WA 3OPNA 3VI4B 4JVOA 5FJ4A 2DJ5A 1G19A 3E70C 3WMWA 3PVXA 3MJTA 3GLHE 4EEXA 2MHNA 3D8UA 2C2ZB 4M8IA 1H72C 1UEJA 3NRJA 1RR6A 3UOWA 5PNTA 1Q1ZA 1WMBA 1CRQA 3PCRB 2VZ9A 1OHHA 3ZBUA 4E7OA 3WB0A 2QAJA 4N41A 1V8DA 3DAGA 4UNRA 3WRXC 3QOFA 4PS0A 5DTQA 3ZW8A 1ZKMA 4AQYB 3RUBL 2X13A 3IAM6 1X9IA 3MPWA 3AEQA 4O2RA 5CLFA 2PM8A 3O8OB 4C0LA 1V16B 2GSWA 2D3UA 3PDWA 4MUIA 4EMDA 2V2KA 1MRNA 1NBOA 3N28A 4WXOA 5JWOA 1N34B 1CBKA 1U4OA 3TTSA 4TRMA 5D4PA 4C0HA 3H5SA 2YPYA 1B2RA 5JSYA 3LVQE 4AN1A 2AJLI 1LS6A 2DRAA 4BS9A 4KH1A 1RAHB 4GI5A 5AT1B 1Y8ZA 2ZUUA 1DQ9A 1RAJA 3DTTA 1AT1A 3HKBB 4GBJA 3K0EA 3WQQA 1WB5A 4CCAA 3WGTA 4WUVA 3U3OA 4CEIA 1GGNA 2R1ZA 4LYHA 4YMWA 5KFBA 1N2JA 4CF4A 4P2FA 3IVMA 4TQGA 4CKWA 4IHJA 3QLUA 2G9ZA 4R2IA 2XVAA 3DXYA 2WZCA 2B83A 1KARA 4QUKA 4CDGA 1BW9B 4IINA 2PTGA 1RDFA 2A9RA 3OPMA 4JFRA 1SJFA 3W6ZA 2EI5A 4V1CI 2HHXA 2QRHA 4LVCA 5JR3A 1KGDA 3AP1A 2W2QA 2GNKA 1N5VA 5LLTA 1NIPA 4NIMA 1VQKS 3U60B 1NJ5A 2VF8A 2GHPA 2HV8A 4YRIA 2LE0A 1P17A 1LX6A 2V7PA 1FXWF 4EF5A 1E1QA 2BFBA 1H5NA 4DR6F 5IDWA 1PL6A 4EG0A 4X3CA 5KFPA 2RMKA 4ZYWA 5MN5A 2SCUA 3X43A 4JEHA 1MX1A 2G36A 4CLFA 3OEED 4UFOA 4EHKA 4L15A 1R37A 1ZJ5A 1EZZB 5BNTA 1T9WA 3OP4A 4AYXA 3PR2B 1DS6A 4KXVA 5CVCA 4DL9A 3QGPA 5A4MS 2JLAA 1S6QA 5ITVA 1R0YA 1R6BX 3CH7A 5JANA 2ZI5A 5EIBC 1H3NA 3SC2A 5D0HA 3HGMA 3OJCA 5HIMA 1JAZA 2B56A 1HDRA 1KSFX 4P4SA 3NNHA 1I51A 6ABPA 4HLUA 3TFQA 2GRJA 5H83A 1I94F 2QQ5A 4P83A 3IJRA 3I4HX 4K2AA 4OMFG 1I7PA 4IH9A 4BKMA 4DL4A 5F8MA 2Z6AA 2IEDA 1FP2A 4OK6A 4N7MA 1KK2A 2B2NA 3DOMA 2RHHA 1GLNA 1F5AA 2B82A 3PPYA 4S24A 1IZ9A 4GECA 3D3WB 3G2IA 1X7XA 3UVJB 5TT0A 2C58A 1VRUB 3G88A 4CV3A 1KO7A 4DIUA 1ECPA 3G2JA 1UZMA 1CNFA 2L0XA 2ZYUX 3DC7A 4QJIA 4YAIA 3UJAA 4H2DA 5ESWA 3PR5B 1IG0A 3HBLA 1IUOA 4CT9A 3D81A 1SKWA 1FTSA 3M1LA 3TTTA 2WVDA 4C20A 3TR0A 5LZ9A 4Z6KA 2AJBA 5CLQA 4YB7A 2VYNA 3U3KA 5T7LA 2Q8QA 1K6MA 2R8RA 3GEIA 4UDNA 3UB4A 2VPQA 2HSDA 3L6RA 5LBTA 1C0LA 4EPTA 4DR1B 4OGFA 4W4MA 2HK7A 3D4LA 2LDYA 4NMXB 1S2NA 3LX6A 1NQAO 5IUNC 3RVQA 2LCQA 1BVHA 3ETLA 5EJ5A 4RTMA 3PNPA 5AK6A 3H1AA 3Q4GA 3AEKA 5BR4A 3UANA 4A73A 2ZANA 3PEUA 2PDAA 4ERDA 5L53A 4EW6A 3MG9A 4TKUA 3R4VA 3WKEA 1P5JA 4C2BA 2QJTA 5IARA 5EHGA 2M8DB 5HCUA 1FRVA 5F1KA 5JNWA 3O21A 2ZRHA 3C14C 3JQCA 2VHJA 2HUNA 4P0PB 5JOQA 1P0PA 3ADDA 4DLTA 4OUDB 2KLHA 1M5SA 4YAOA 2VUIB 4LJYA 4LF9F 1SU4A 4K0KB 3ZCPA 1J27A 3HN7A 1JZTA 4TQUS 4RANA 3CT4A 4UQTA 1JXAA 1XKLA 3FHOA 2CHUA 4Q47A 4WOCA 3PFGA 4Y0NA 3WLRA 4JU9A 3MZIA 3C4VA 1F8YA 3T1NA 3C16C 4QTTB 2HIAA 3QIVA 1N5MA 1A5TA 5LMNF 1UM9A 4PABA 4I3HA 4LSZA 3A2LA 3MM8A 2HU5A 1CJUC 4NABA 2Z8YA 4JV1A 1KH1A 4DN0A 3L4JA 1YBVA 1IB6A 1KDYA 3FYHA 2Q9BA 4ZVVA 1SO8A 2O6LA 5EIWA 5T7BA 4YMVA 3V2UC 3IP9A 1OCEA 1DBSA 2XZTB 2WFLA 3RREA 4CO0A 4KC5A 3BYRA 3D3EA 3L8MA 3G2QA 1WEKA 3NHLA 3HCEA 4U95A 4HS9A 2GBLC 1KYYA 4J0KA 2IKSA 4OEHA 2MSWA 4IH1A 4GI7A 3A13A 2UVUA 4C8KA 3OF3A 3QU9A 4IJ6A 3HDTA 2XUQA 4WU2A 4WJZA 4FF4A 1Z7WA 4DLLA 3CTMA 4ZAXA 3KG2A 3WHKA 2O3QA 4KQMA 2MYUA 2QD2A 4LRBA 2F5GA 3MRVA 3IMFA 1L7EA 3WI7A 3WBKA 2J6CA 3RTDA 1PZMA 4U6SA 1XLUA 2H29A 3WKBA 1LSSA 5JH7F 2FW8A 5BYBA 1JKFA 2A18A 3DHXA 4I1UA 1GTMA 4WP3A 3CBGA 1DQRA 4KQFA 3RI3A 1DAIA 1CVRA 3E4DA 4GKKB 5KU7A 2VT6A 2NUPA 3O9ZA 2PEBA 2KHDA 3ABRB 1Y11A 1AQ6A 1DQYA 2CYAA 1FYEA 2I4OA 1LA2A 3DZFA 4DOMA 3PHLA 5E1BA 3KHHA 5FNVF 1NJSA 3GIWA 4O3FA 2HBYB 3MEEA 2WWTA 3CX8A 2WPDA 1TVRB 1LV8A 2MEWA 5FADA 1XEXB 4Q4HA 4G23A 5D5QA 3AW8A 7AT1A 1BE4A 4C1NA 4K9PA 1N56A 1T3ZA 1NZDA 3IQGX 2IYWA 4WZAA 1MFPA 4IQFA 1EB0A 1BROA 1YJTA 4K6OA 1HQ2A 4GM4A 4IIHA 2PTHA 2EXXA 4ZVNA 1NDPA 4XVRA 2ONYA 2J85A 3DCIA 2HMYB 5I4BA 1NDLA 5ALKA 2R8BA 1CEQA 2RGBA 3FGPA 4ZYZA 2OCLA 2HADA 3MMCA 3UJ7A 4NULA 2EFEB 4DBVO 1GKUB 2BM8A 1QHXA 1ZJ4A 3B5EA 4BV9A 1ESDA 3IT1A 5IM4A 3MURP 1ENPA 1R6AA 4X5OA 3HHLD 2APJA 2Q1TA 5DHPA 4DCGA 2R7AA 4M1MA 3T5PA 5C1OA 1O5TA 5JCOC 4IXNA 1UMDA 5ICCA 5TQ0B 4JS0A 3AEXA 2X6TA 2R7TA 2IPOA 1WSVA 1BE6A 3NDBB 4WJKB 4PIPA 3TIVA 5J2NA 4EMSA 2L18A 2O8DA 5HMMA 5K0NA 3LBNA 1IPHA 1ADBA 4B7AA 2UUCB 4DDHA 1KXZA 5AW8A 1CJBA 2HU2A 3UJ8A 1UW4A 1KZ4A 3O9MA 2P5VA 2K7JA 2AMYA 1H0RA 2HGSA 3RYHB 3ZWQA 4OHXA 3ZE8A 3MMSA 2ZFHA 3T54A 1XZIA 4UM7A 3F5MA 3FCOA 5I7UA 2YTZA 1D1PA 4QX6A 1HX7A 2WSMA 4Q9HA 5ED4A 3NHRA 4S2EA 1QORA 1I0LA 4OJMX 3QLHA 3SDEB 3HUTA 3JQ7B 4MEJA 4MKRA 4M1TA 4MB2A 1JT9A 1IKVB 1R27A 4Z2YA 3R44A 2B99A 4E98A 3KT3A 3A1SA 3K7EA 1Z82A 5DZ7A 1QO0D 2R7RA 2BLNA 4NFHA 4KV9A 3WGJA 4P9NA 1NXPA 3OEYA 1DEKA 2FPIA 2UXCF 2YH2A 2CFTA 3GFFA 3PV8A 2IJGX 2Q6IA 1EU1A 2B7CA 2W00A 3SOPA 3I4PA 1MZVA 4GP7A 4LMZA 3IP0A 3GV7B 1N2CA 5JMTA 4IKAA 1N6RA 3Q12A 5KFWA 3EODA 5HYVA 3ROGA 1K1EA 4OAPA 4OHBA 1M34B 1CY8A 2B4PA 3SFVA 4AIRA 4Y6GB 4GYJA 4Z2XA 1NNI1 4BMSA 2IF2A 2VDQB 3K1ZA 4DNFA 4C11B 3PGLA 4OQNA 4O6VA 4ZDNA 1TL3B 4GPBA 3PTLA 3FPSA 2QFJA 4DV6F 1FY2A 4EK2A 1OFUA 3TNDA 1JB0C 5C1PA 2R8PA 1B43A 1EFKA 1MEEA 2AJTA 3D7SA 4KRFA 1EZ4A 4IZHA 5GV8A 3K0AB 2DKNA 4LBYA 1H7WA 3TI0A 4LGMA 3S27A 4GG1A 3GB9A 2VOJA 1SV5B 1GTJ1 2O5RA 4R41A 5LA6F 4B71A 2VH2A 4MPPA 5C42B 4XDDA 3QYPA 1TK0A 1ECFA 2IC3B 5IUJC 4TTJA 2LA6A 2C4KA 1WJGA 1U0EA 4PYNA 1DRWA 5J1TB 4LJ4A 1GNKA 5M7EA 3CUNA 4IFVB 1GGKA 2ZE6A 3OR2B 3C6MA 2EFGA 5TLSA 1KLMA 2IHYA 4R2XA 4AN0A 1RWNB 2R1TB 4UAUA 2OKCA 1XDDA 5IJ0B 2WNIA 5LKRA 2N4DA 4C8MA 5J47A 1CSJA 4OX9B 2I6QA 2RIJA 4ID5B 3CGWA 4Z0TA 4C0JA 1UVNA 4WZMA 1LV5A 3MAQA 3VOBA 2FG5A 4B8ZA 2CXPA 3I4FA 1DLIA 2HEKA 5EPEA 4QAJA 3EGEA 4QL3A 1PS0A 4YREA 2AF4C 3A6KA 2QYSA 1OXMA 3G7SA 4KE9A 1MHPA 3MTQA 3EXYA 2HK2A 4BNNA 2BYCA 4XD2A 5JSZB 3M8PB 2OO3A 2D5AA 5BR7A 2CNLA 2ZRNA 3RD5A 3OA2A 4W90B 4LMBA 5HS4A 5BVGB 1NH7A 3IE2A 3RS5A 1KJWA 3V1UA 4TLBA 5B2FA 5IK2A 1OI4A 5C5IA 1T91A 4Q6WA 4DMZA 4KR7A 1N8NA 3KVVA 4EHNA 4HLQB 3WL5A 3A4NA 3VR4A 2AVDA 1K73T 4XWAA 2JGIA 2HIGA 1Z26A 3IDFA 1P9LA 4H77A 1UVLA 5B3JA 5ADZA 5T14A 3V2IA 2PJRA 2AC4A 4BV3A 1ZD8A 4C6TA 4K4YA 4PYQA 2B51A 1YFZA 2BM1A 2KG0A 5EP3A 4A27A 1VCHA 1QX3A 3DV9A 4LF6F 2G08A 1K68A 5DK4A 3T9BA 1VJCA 1ZBQA 3MPYA 3D59A 4JVLA 2Z3ZA 4RCZA 2DXIA 4J9PA 4X85A 3JD3A 2W4CA 1VLHA 4RX6A 3A28A 3M6MD 4TVSA