1IXKA

Crystal structure analysis of methyltransferase homolog protein from pyrococcus horikoshii
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
305
Chain Sequence
b'LSPSMLDKLLRLGYSKLFADRYFQLWGERAIRIAEAMEKPLPRCFRVNTLKISVQDLVKRLNKKGFQFKRVPWAKEGFCLTREPFSITSTPEFLTGLIYIQEASSMYPPVALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNVEFDKILLDAPCTGSGTIHRTMDDIKFCQGLQMRLLEKGLEVLKPGGILVYSTCSLEPEENEFVIQWALDNFDVELLPLKYGEPALTNPFGIELSEEIKNARRLYPDVHETSGFFIAKIRKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase
publication title Crystal structure of human p120 homologue protein PH1374 from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 103
structure length 305
sequence length 313
ec nomenclature
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F
A PF17125 Methyltr_RsmF_N N-terminal domain of 16S rRNA methyltransferase RsmF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ixkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ixkA02
1O9GA 4RSRA 1YZ3A 4EQZA 4RYLA 3UJAA 1G55A 3FYDA 2BM9A 4YV0A 5K0BA 4YUVA 4BY9E 3T0IA 1FP2A 3C3PA 4HRAA 2OY0A 5FHRA 2IH4A 5E2BA 1ZGAA 3HEMA 3T7SA 3EGVA 3PTAA 1XTPA 1EG2A 3OE5A 1ZKDA 1SVUA 4RTQA 5KVAA 4IV8A 5DX8A 3KPUA 4EK9A 5EVJA 4KIGA 5EIFA 1RJGA 5EEGA 2PSSA 3RODA 4ER7A 7MHTA 1NT2A 2NP7A 4PNEA 2JHAA 3BWMA 2VDWA 2I7CA 4PYKA 5ICCA 3JWHA 3GGDA 5EOVA 3B3JA 1AF7A 3OFKA 4C08A 4RVGA 2B9EA 2G72A 1IXKA 3BT7A 2IFTA 2GS9A 4CWAA 4PONA 5EKXA 1XVAA 1UFKA 2P7IA 2Q41A 1YZHA 4M38A 3HVKA 2AOTB 1VBFA 2I62A 3KR0A 3NWBA 4HC4A 1JG4A 4XUCA 5CVVA 4C05A 3LCUA 4HSGA 5HFJA 5T6BA 3KR1A 1O54A 2IH2A 2LD4A 5ICEA 2ZBRA 1ZG3A 3K6RA 2IBTA 4GOMD 1X1AA 3E05A 3ELUA 4HTFB 5DM4A 2JG3A 5DWQA 2V74B 3AY0A 3LX6A 2AS0A 5EQJB 3A26A 2ZIFA 3I53A 4ZTBA 1EJ0A 3MQ2A 5K01A 5E1DA 3HCDA 2O0LA 3B5IA 3UWPA 3OZRA 1WXXA 4R8RA 2ZIEA 2YUIA 1F38A 3GDHA 3SM3A 5BW4A 4LG1A 3HP7A 5EEHA 1DL5A 1JTEA 1NW3A 4KIFA 2OB1A 1BOOA 2PT9A 3UZUA 2YR0A 2PY6A 3SSOA 2B25A 1AQJA 4LWOA 1EIZA 2VZ9A 2IGTA 2YXEA 2C7RA 4KDRA 1NV8A 3GIWA 5K0GA 5EHGA 5LQRA 3KHKA 3BUSA 2Y1XA 2YTZA 4QDJA 3I9FA 1ORHA 3DMGA 4V0QA 3HVHA 4C06A 4DMGA 1IY9A 1NW7A 4KDCA 2OBFA 3P9KA 5DTQA 1SUIA 4DZRA 2G8NA 1X1BA 3M6WA 3E8SA 3EGIA 4RVDA 3NMUF 4MTLA 1G6Q1 1NW6A 2B78A 4M7RA 4Y30A 3TRKA 2IDJA 3FZGA 2VDVE 4P7JA 3CKKA 2G71A 3OZTA 1R8XA 3B89A 3FTDA 5DLYA 1YUBA 2O05A 3Q7EA 2XYVA 5E2AA 4QPNA 2AOTA 1ORIA 1WXWA 4MWZA 4X1OA 2O57A 1V39A 1M6YA 3DMHA 2ZBPA 2VP3A 3NDIA 3QOWA 3GO4A 4O29A 4RVFA 5D1NA 1KYZA 2AVDA 3VSEA 3HM2A 3KQVA 3ORHA 3MHTA 4HTFA 2OXTA 3CJTA 4PYLA 1JQEA 5EIWA 5FWAA 3G7UA 5DX1A 3UFBA 4E32A 3GWZA 3TMAA 3LL7A 5JUWA 3NW9A 1ZGJA 2WA2A 4QTTB 3GRRA 4NECA 3SR4A 3LGAA 3PX2A 4X61A 5FULA 5HIIA 3P9NA 3R24A 4KW7A 4DA4A 2BR3A 2CMHA 2HMYB 4RX1A 1I9GA 5C9ZA 4DF3A 3D2LA 3KKZA 4PIPA 2GPYA 4PIMA 5CM2Z 5FA8A 1UIRA 1Y8CA 2XBMA 5P8WA 3SSMA 1XCJA 4IV0A 2ZFUA 3MTEA 1R74A 5G02A 3FTEA 2AOWA 2VDUE 1M0EA 1NBHA 3ANXA 3GCZA 2UYQA 3UJ7A 3FUWA 5BW5A 3PT9A 1I4WA 1WG8A 3HCCA 2PWPA 3AWIA 3FPFA 2PKWA 3CC8A 3E7PA 4HH4A 2PX4A 3HA3A 4G56A 1VE3A 5HIJA 2IPXA 4MHTA 1P39A 1JSXA 2XYQA 4U7PB 3P97A 5FQOA 3S68A 4KVZA 4DQ0A 4YMGA 5EHIA 5DXJA 4E30A 5IKMA 4M37A 3TLJA 5GM2A 4X60A 1SQFA 1HNNA 4FSXA 2XYRA 1SQGA 2GH1A 3MB5A 4P7KA 2F8LA 4QQKA 2OYRA 2XVAA 1RJEA 5CVUA 5E9QA 4CXMA 2PXXA 3G2PA 3P8ZA 2PBFA 2YQZA 3KQOA 3M4XA 3O31A 4ATNA 4EKGA 2P1DA 2JH9A 5FA5A 2ESRA 3EPPA 1JQ3A 2OZVA 4C4AA 3MAGA 2ZWVA 1XJ5A 1P1CA 3DULA 5F2KA 1AV6A 1JR4A 3LCVB 1RI5A 2AVNA 2PX8A 2NNWB 2GLUA 2NXJA 2P3LA 3EVZA 5ICFA 1D2HA 3A7DA 1EQAA 1Z3CA 3HCFA 1FJXA 3HCAA 4RTMA 1MJFA 2C7QA 3MCTA 3KU1A 5DSXA 3LDFA 1FBNA 3GJYA 5T67A 2YXLA 3CCFA 3G89A 3QV2A 5FQNA 1RI1A 1XXLA 1VQ1A 3BGDA 3BZBA 5HILA 4C04A 5LQKA 10MHA 2H11A 3THSA 3UJBA 3EVGA 1M6EX 3FUUA 5EGSA 3KQYA 3BWBA 1HMYA 1X1CA 3G2MA 3JWGA 4IWNA 1INLA 4P58A 5EG5A 3SXJA 4A6DA 2PGXA 2N47A 1DUSA 3I64A 1R18A 3BGVA 1FPQA 2FCAA 4BP3A 3UBTA 3KR2A 3FPJA 1VP9A 4YUWA 3P2EA 2ZZKA 1BKYA 5K0CA 1KXZA 2B2CA 2DULA 3E23A 2ONYA 1WY7A 3TQSA 1I1NA 5KYGA 2PXCA 1NBIA 2YXDA 3BGIA 3CBGA 4A6EA 2AN5A 2QRVB 3JWIA 3I58A 5K8VA 4E70A 2P3OA 3SVZA 5EZSA 5FHQA 2Z6QA 2ZVJA 1RI3A 3WSTA 4PCAA 3DOUA 2BZGA 3FYCA 3TR6A 2EX4A 4QTUB 3DLIA 4E2XA 3HA5A 2ZSUA 3G88A 3NTVA 3QOXA 4GQBA 4M36A 4DKJA 2NP6A 3ELWA 4XCXA 5DT2A 3UJ6A 3F4KA 2P7HA 4OBWA 1RJFA 2ZIGA 1AQIA 2AZTA 3M6UA 2NXNA 5DM1A 5CVEA 2BR5A 2IP2A 4FP9A 2JH8A 4HGZA 4R05A 3LECA 5C1IA 3TKAA 3UA4A 4ER3A 3ER9A 1L9KA 3FRHA 4P7FA 3SX0A 2OO3A 2JJQA 3LKZA 4YMHA 2FYTA 1JG2A 1X19A 3FRIA 3TM5A 1IM8A 1U2ZA 2IBSA 3PB3A 2EJUA 2K4MA 3TFWA 4BLUA 4FGZA 3M6XA 3HCBA 1TPYA 1BC5A 2QYOA 3UA3A 3KPVA 3FTFA 4RV9A 3MERA 3HCEA 3B3GA 4XUDA 4C03A 5ICGA 2BM8A 5CCXA 3LBFA 4E2ZA 1TW2A 5DRYA 5EMKA 4CKBA 1KPHA 1B42A 1SG9A 2UYOA 3THRA 4RVHA 4C07A 2UYHA 1BHJA 3EVDA 1O9HA 3CJQA 1QANA 2QRVA 2AN4A 3U81A 5F2NA 2ZCJA 3DLCA 3R6TA 1R8YA 4BLWA 2PVCA 4MQ4A 1YF3A 3UJDA 5CVDA 4L7VA 2OKCA 4IKPA 1KIAA 2VS1A 4GF5A 3TOSA 4GOND 1JQDA 1X1DA 3M70A 2PV0A 2ONZA 4AUKA 5K0LA 5KQRA 4PYOA 5E9JA 1QZZA 2EG5A 2CL5A 2GAFA 5GOZA 5E8JA 5DXAA 3TM4A 3K0BA 5E8RA 3ELYA 2PJDA 4GBED 2O06A 3SSNA 5BXYA 4P7GA 3EVCA 2UZ4A 1R6AA 3A25A 3FTCA 4H0NA 4JXJA 5GWXA 4BP1A 4EVIA 2H00A 2OPBA 1N7JA 3BKXA 5CUQA 3P2IA 3I5UA 3PFGA 4DCMA 2H1RA 2KW5A 2EFJA 3DXZA 3OZSA 1FP1D 5DSTA 2YVLA 3C6KA 3ID6C 1SKMA 5EZQA 1F3LA 4QQNA 3KQQA 4OA8A 1NW5A 4PGHA 2E5WA 4R6WA 3VC1A 1G8AA 5BP7A 5GIOE 4CTKA 3GRZA 4E2WA 2Z6AA 3M6VA 8MHTA 3Q87B 4LECA 5F2OA 1EAMA 5LQCA 3HTXA 3OU2A 3OE4A 3G2OA 4KRGA 5CVJA 1D2GA 3BXOA 4DM3A 1RI2A 4ER5A 3CGGA 3M33A 3NWEA 3NJRA 4PGGA 4WXHA 2AOXA 1G60A 3GRVA 3HVIA 4OQDA 4YUXA 2PWYA 2P8JA 3B3FA 3FPGA 3KR9A 2PX2A 1ZHFA 2P35A 1OR8A 4PYIA 2C7PA 4PWYA 9MHTA 1Q0TA 4R8SA 2PX5A 3LBYA 4AZVA 3EVFA 1QYRA 2HWKA 5U4XA 4CTJA 2AOVA 3DXYA 5LQUA 3HNRA 4QVKA 1PRYA 2PXAA 3DH0A 3FPHA 1VIDA 1ZQ9A 2FK7A 3L8DA 4EMSA 4AX8A 2ADMA 5DRTA 2HR1A 3G2QA 3EVEA 1NE2A 3AXSA 1D2CA 3LCCA 3T7TA 3UJCA 4FT4A 4GOOD 2G70A 3H2BA 1RJDA 3VC2A 4B17A 2I9KA 2CWWA 2ZW9A 2PT6A 2WK1A 3OFJA 4KWCA 2HTEA 2ZZNA 2JHPA 2JHCA 3DXXA 1NW8A 5C0OE 3KQWA 4YUZA 5GM1A 2ZTHA 3EMDA 3IEIA 3FUTA 5D1HA 3P2KA 3AJDA 3C0KA 4HGYA 3MTIA 3A4TA 2P41A 5FTWA 4ER6A 4X41A 4PYNA 4X63A 5K03A 3R3HA 1VLMA 3FUVA 4R6XA 3EMBA 2GA9A 2BR4A 3PS9A 2DPMA 4RTOA 3DMFA 1WS6A 1JTFA 1KP9A 3ER8A 1VL5A 5K0JA 4GC9A 4U7TB 2ERCA 4PINA 4PYJA 4E31A 3DP7A 5FUBA 3G8BA 1JG1A 3KPYA 4OX9Y 2V7EA 3OU7A 4GEKA 1XDSA 2FK8A 1VP3A 4ISCA 5ERGB 4CKCA 2AOUB 1YFLA 2O07A 3R9XB 4UOEA 3ELDA 4ER0A 5DTRA 4RTJA 2FRXA 5EMJA 5KS2A 3RIEA 2ORED 5LQNA 1R00A 3KQPA 5K0FA 4RWZA 5EMMA 3ME5A 5MHTA 1SUSA 2PLWA 3A7EA 4WVLA 5FCDA 3X0DA 5CCBA 1QAQA 1H1DA 5FWDA 3MGGA 2BH2A 5GINE 4AZTA 5E9WA 4RTKA 1KPIA 1L3IA 1L3BA 2FHPA 1KHHA 4K6MA 4RTPA 3IYLW 4FR0A 3EVBA 3ERCA 4RTSA 3IHTA 3KQTA 5E1OA 3O7WA 4AZSA 5GP1A 3SMQA 2FPOA 4QVGA 4Z2YA 1NKVA 2C7OA 3KPWA 4DCGA 4RTLA 5DPMA 5K09A 2EJTA 3AXTA 2XVMA 1JSZA 3OCJA 2Z6UA 3NVKI 5K05A 3BKWA 2NYUA 2NXEA 2YX1A 4YUYA 3GRYA 1MHTA 5E1BA 2P40A 4OQEA 3FUXA 5E1MA 2P3QA 5T64A 3C6MA 2AR0A 2ZWAA 3EEYA 3KPJA 1P1BA 1YB2A 3FPEA 2IH5A 3LHDA 1QAOA 1VPTA 1XDZA 3PX3A 3PVCA 5B1SA 1XDUA 3VYWA 2NXCA 3KQMA 4E2YA 3BWYA 3O4FA 4Y2HA 4F85A 3V8VA 1DCTA 3BWCA 1KYWA 3LKDA 5HIKA 4QPPA 2AOUA 2R6ZA 3GNLA 3KQSA 1NV9A 5HIMA 5KQSA 4F84A 2GB4A 2HNKA 4GUAA 3UJ8A 1YFJA 4HG2A 2QY6A 1XCLA 3NVMB 3A27A 4XUEA 2IIPA 2IDKA 1UWVA 3G5LA 1N2XA 1L3CA 3DUWA 1JG3A 3P9CA 3T7RA 5HOQA 3HA7A 4PYQA 3CJRA 3CVOA 2OB2A 3G8AA 5JR3A 2ZULA 2QM3A 4CKEA 1RI4A 3LDGA 2CKDA 5LR6A 5LSAA 3PLAE 4PCLA 5DM0A 2G1PA 3EVAA 3UJ9A 2B3TA 5FADA 3TPZA 2ZZMA 1P91A 4V0RA 4AZWA 1N7IA 1EJ6A 2ZBQA 3REOA 3MCZA 3SGLA 4FS8A 3GRUA 2A14A 3TKYA 3P9IA 3LPMA 5DTMA 3NDJA 5K0EA 3EEOA 3P71T 2UYCA 3EGEA 4POOA 3C3YA 1KR5A 5LQJA 3V97A 4YV1A 1QAMA 2ZLBA 3RW9A 3PFHA 4MIKA 3OU6A 4GC5A 5DX0A 3B7PA 4OA5A 4E33A 1L1EA 3IV6A 4F86A 2R3SA 2AN3A 5EKUA 5EMLA 1KPGA 3DTNA 3GU3A 3HVJA 5HZMA 2QE6A 5GIPE 1G8SA 4OBXA 5DM2A 3OPNA 4RTRA 1PJZA 2WA1A 1TW3A 1Q0SA 3R0QA 4YV2A 2CMGA 4QDKA 5EC8A 4LWPA 4RTNA 3JWJA 4BLVA 5HEKA 3DR5A 3GXOA 4PYMA 2HV9A 5IH3A 4FT2A 5H02A 5LQAA 3LSTA 4FSDA 5M5BA 2I6GA 2Y1WA 3LDUA 5EPEA 4EKIA 4FZVA 5CIYA 1WZNA 1G38A 3G5TA 5CD1A 4GOLD 1T43A 5K0NA
chains in the Genus database with same CATH superfamily
5HCIA 3K0FB 1TA9A 2BEKA 4YRNA 1XLTA 3E9MA 5THKA 3V4MA 3MXTA 1Z45A 1BWQA 3OPKA 2WVHA 2SICE 4WN9B 2P7IA 2Y1DA 4GZ5A 1DJNA 4AY6A 1JLAA 3VSBA 2C57A 4JI1F 1N3IA 2XUFA 1FJGB 2FFJA 2ZANA 3P27A 4KO3S 2JGRA 4YASA 3BGSA 1GV0A 4BN5A 1LPAB 1DQZA 1NBOA 1TAQA 4DQLA 2GXQA 2BJVA 1ZIDA 2AYZA 3GFZA 1UZAA 4YCAA 2X14A 4QR0A 3DDZX 3Q8WA 4ADSG 1G5PA 1ZD1A 4LJLA 2C03A 4AKGA 5CEJA 3ZDDA 2GX8A 1LEOA 5HIAA 1B6SA 3J81U 1I3LA 2C54A 5B0CA 4JSRA 4M95A 4ACBA 2GVDB 4DV6B 1FNCA 1JQEA 3IO5A 1T9HA 5MGBA 2MZ1A 5TMDA 1GU1A 4PO1A 3ACBA 3G5MA 3TAPA 1DAXA 3ENAA 4DAOA 4CKYA 3O9MA 3OZGA 1C1BA 4CEIB 2WJHA 1VYAA 2WHPB 1OFUA 2F4VJ 4EL0A 5GOTA 3T5KA 3GPCA 2YKAA 2AZDA 2PS9A 4DR3J 2YXNA 3CW2A 4XLLA 4YY3J 4IVPA 3WGMA 1W5SA 3B6BA 4R7ZA 3TA0A 5L3ZA 2CQHA 2GSWA 1SVSA 1BHO1 5MN6A 1KMHA 3M3PA 3MB5A 3INRA 4MR8A 1HPZA 4E51A 3LP1B 4EY5A 1BD6A 3Q3VA 3GT4A 1FD2A 2XI3A 2Q0HA 4X64B 1QM9A 3KJFA 1VK8A 4PVCA 1EQAA 1R0LA 2DCLA 1FFWA 4PXDA 2HCJB 3G85A 2DFDA 1QB7A 2Y1FA 2JCYA 4U9UA 1I8TA 4NV0A 3SJBA 3C48A 1L8AA 3TANA 3T61A 5KTTA 3E61A 4BC7A 2M88A 1K9VF 2EGGA 3VPGA 2GHIA 3QUAA 2W0MA 1GMWD 4EJSA 3K6SB 1Q53A 4ES6A 3KUDA 4UFPA 4M36A 4BNNA 2DH7A 2C2ZB 5DM1A 1GZVA 1I01A 2F7VA 4HEA1 3NHRA 5LMUJ 4IIJB 5K6RA 1AXEA 5B6IA 1HD1A 3KKNA 4F4JA 1F2UA 4F4UA 3R5JB 3S99A 3EVDA 4RJJA 1QKKA 1UKCA 2I7DA 1CRZA 3R6TA 3NOOA 2KB2A 2GHPA 2YS6A 2V3WA 1UODA 4GF5A 3EBOA 1TKXB 2X8BA 2FPKA 3ABQB 3W05A 4QYWA 4ZVMA 1AZTA 1GKYA 2Z2MA 2PG3A 4NICA 1GKUB 3TRFA 1IK6A 1C2PA 3VR4A 4Z54A 4NZOA 2JIQA 2BE2A 3BHJA 4BU0A 4D9IA 1CUHA 4F71A 2VAWA 3SLRA 4GI3A 4U00A 3FSEA 3O0DA 1PLJA 3NP5A 1FW8A 2JLYA 1QAXA 2LXIA 3HS3A 5AQ1A 3OZXA 4X65B 5LQUA 3R0IA 3I6BA 4LF7J 3D6HA 1EFVB 4CL8A 3EVEA 2R8YA 1HOTA 4KR0A 3T7TA 1CT9A 3P52A 4K2AA 2CZ4A 5A5FA 1RQGA 1P31A 4F6CA 4XGIA 1DQRA 1PR9A 5MN5A 3KLFA 5BT8A 3M7IA 1QZUA 3QJGA 3ROXA 4DV1B 1DEHA 1YONA 4HQFA 4MRVA 2IV2X 1IKVB 2QG9A 2CXNA 3R7AA 1IZZA 4HI1A 3SQWA 3QF7A 3D31A 2HHQA 3WGUA 5D85A 2OCBA 3K4PA 2RMLA 2O2HA 4HH0A 3FNIA 2VA8A 1RE1B 4KRYA 4N5DA 2PZ8A 4BFVA 3HWSA 1OX4B 5BORA 2GZ2A 2PSDA 3P2YA 4NXNB 4RW4A 4LJRA 4IOLA 1RTHB 3OTBA 1Z4OA 1FSGA 1GSHA 1M8FA 4F45A 1VCIA 1HSZA 1JJ2R 3OCWA 5B1SA 3M7VA 1LV5A 2IVYA 3OTDA 1W48A 4ZDKA 4P2SA 4JKOA 2FUCA 3SI8A 2BLLA 2V4UA 3I6MA 1SXHA 3WL8A 2JIMA 4NBNA 1N34B 5DH9A 2DU8A 5AKYA 3F4LA 3REOA 4DJTA 4RQBA 1U9IA 3AIOA 5AI0A 4ZRMA 2VHQA 1QSLA 5HQ3B 1L5HA 4DV7F 3TAQA 2HWUA 5IXUA 1OS5A 1TW3A 1NAQA 1K9MT 3X2EA 1N0IA 2I8CA 2WB2A 4I55A 3OWOA 4PZDA 5KQPA 1XD9A 4CMIB 3IVAA 5DYWA 2D7SA 1O9GA 1Y3CE 3K9WA 4Q9HA 2H4ZA 1KU6A 4MW9A 4EA9A 3T7SA 3B1VA 5KVAA 2E2WA 2J5BA 4HI2A 1OIVA 4CHTA 1CS4A 2RGWA 2XB2D 1K2VN 4KN9S 4DARA 4RGBA 2I8EA 4AY4A 3S6JA 2ZG6A 3DRSA 1RAEB 5HA5A 4LGYA 1CG6A 3FMBA 1V5WA 3A8JA 3B78A 4MW5A 4QUHA 4JGGA 5FOUA 1LA2A 1EWQA 4GZMA 5KFJA 1EHCA 2VXYA 5DT9A 1QFXA 3MTGA 4BEBA 4JV5B 2HKIA 4TS1A 1NW6A 5I48A 3UD5A 1KR2A 1LPSA 3VPBA 4HFNA 5D4NA 4B4UA 4AICA 3EZXA 3Q12A 4U7FA 1YRUA 5CA5A 1NK0A 4FHFA 3EBLA 1G21A 2FPSA 4LF9F 3A4VA 2IPLA 3PX2A 2EZ8A 4KODA 3RVLA 1KEVA 1KFBB 3KEQA 5LB4A 1N77A 3NCRA 4P0TA 3DT8A 4N0MA 1M5UA 4L3NA 1YS1X 1IXYA 3M2VB 2Y6UA 4UCQA 2I1QA 1H7WA 4PWDB 2FJPA 3EPRA 3ZTSA 4B80A 3EA5A 1LQ9A 2QSWA 1ZM9A 2VH7A 2CMKA 4OI1A 4DABA 2X1GA 3DV0B 4L0QA 1RHJA 2A9QA 1L4MA 4XWOA 4K87A 4J4HA 5KZMB 3FCHA 3FLAA 4J9MA 1YMUA 5AVOA 3EMKA 4WFXA 3EC2A 2BZSA 2UZ1B 3PHCA 2O3SA 4I4NA 5J59A 3LHSA 2B43A 3DLEB 1WL8A 3AONB 2R6CA 1RAFB 4DBQA 3WNQA 3KUEA 1MN6A 3GEHA 3VYVA 3WLNA 2QMUB 3W8GA 1VJRA 2QHXA 2P3OA 4G37A 1U0GA 3EVWA 1UEJA 1GT8A 1BS1A 1N25A 3SQGA 4INOA 1GGKA 3H17A 2QTZA 3HA5A 4GZ3A 4MMYB 5FH9A 2NP6A 3UJ6A 4JJAA 2V65A 2BJ3A 2WMYA 2ZE2B 3ET6B 3WL6A 1SUCA 1Y4ZB 1F2TA 5LLTA 3GJ4A 3FZQA 3U39A 5AXAA 3WHIA 4O4HB 4HNUA 4OL0A 2B6HA 2R84A 2UYOA 3AH8A 2LXFA 2VQ6A 5EWLA 3EA0A 4UZEA 1DTTA 4XQ9A 3BSSA 4Y1GA 4E8UA 1MTOA 1F1BA 3PBKA 4F60A 5K0TA 2QZPA 1TI7A 5H7XA 1J20A 5DJBA 1U4BA 3QVJA 3HKCB 1FJ7A 2AMCB 4FPRA 4UUPA 3AP3A 1IN1A 4Y00A 2Q43A 4K9PA 3CPJB 1Q5YA 3LH2S 3IMCA 2HO5A 1RKJA 4GG1A 5A7HA 1HOXA 1VE7A 3UW1A 4POAA 1S6QA 4OHMA 4RH1A 1HX7A 1VJQA 3CDUA 3ZDCA 2NU8B 2OZPA 3F7OA 3L8DA 4RHUA 5DYGA 3MS7A 1CJKB 5ECDA 3UATA 4RD0A 3ETLA 4G1FA 3DVRX 2QVYX 1CULC 3NGLA 1DDGA 2G25A 1SXJB 1VJTA 3QXXA 4YP6A 3L1HA 2FN7A 4ERXA 4RNOA 3RQIA 3OUYA 3STVA 1WZEA 2VPQA 2Y0BB 5KC8A 4PWUA 4COKA 4KSCA 3P0HA 3R41A 4GO1A 4KHPF 4V19X 3GA7A 3OU7A 3VU0A 2C5HA 4Z1OA 4WXOA 3ANTA 5BYRA 3ZCPA 5KG3A 3QJJA 4KFCA 3S1SA 1F0KA 3LVBA 5F3WB 3Q0AA 3RFUA 4NI2A 2DNZA 2EXUA 2EFNA 1UL1X 1VGRA 4DPKA 4TY9A 1CUUA 2HAFA 2ATVA 1WLYA 4DMMA 4AY3A 5BW8A 2OO4A 3IP6A 4G25A 4WE1B 4YCLA 2OENG 2B69A 3UB3A 2EFOA 3UI3A 3U1MA 3T1HB 3LKDA 3CVVA 4RZHA 1QO9A 4FOSA 2XZTA 4AQYJ 4REOA 3QNUA 2B4KA 3NVMB 4E0BA 3EXEA 4AYTA 3ED5A 1Y6JA 2H54B 3HFSA 2A5LA 3WVNA 4BHQA 1V3VA 2ZZMA 1HQCA 1U3UA 4O1IA 3TXYA 2AN3A 4RY0A 4BKQA 4BWFB 2ORVA 3VPSA 2O8CA 1NO8A 1UDCA 5KNCD 3ILIA 5HMZA 1A98A 3HUEA 3TGWA 3MPDA 2I1LA 2E9TA 5HEKA 3P6YC 1HZZC 1PS9A 5CT6A 1IDN1 1BX0A 2QDKA 3KG1A 3B85A 4EY7A 1N5VA 1RSZA 1MJNA 1UKVY 3B3JA 5JIBA 4BO2A 2KO1A 5FEMA 5AYVA 4NA2A 2PUDA 3I1JA 4YQFA 4JI0J 2A33A 1ZI8A 3LWDA 1SCUA 3BFPA 3K6RA 4EY8A 3CCSS 4HB2A 5D7NA 3W2WB 1WA5A 2XWQA 1PL7A 5FNVB 5FF9A 5IDYA 2ZDOA 4CU5A 2RK6A 1U6JA 3TSZA 3ETGA 2ERYA 4OGKA 2VD3A 2HNBA 3ETEA 5B55A 3ZCQA 1ACMB 4FNHA 2ZH9A 4YHHB 1QONA 3RW7A 3B1ZA 4X1YB 3LGHA 1MO2A 3G9ZA 4RAOA 5AHXA 2XQFA 4IQGA 5G3YA 1VTKA 1OKKA 2OV8A 4RIGA 4A5SA 4ECXA 3FHJA 2PX0A 5JTUA 2I6TA 1MO5A 2A9PA 4G1MB 2D2FA 4YP1A 4DLZA 1OGIA 2QYTA 2XYQA 2QN3A 2CKWA 4XYGA 2H1CA 1PWYE 3CNQP 2R7RA 2MQPA 3IDSA 2Z3ZA 4Y0VA 3RFCA 2VHGA 5AW8A 1MN7A 5EWMB 4U63A 1D2HA 4MS4A 3GLIB 5FI5A 1E1QA 1OBCA 5JNUA 4BZPA 1NNEA 4GIBA 1TFUA 4HAYA 1NU4A 3OSZA 2Y2UA 3SYKA 1WG5A 3E0XA 1U98A 4ZREA 2ONYA 1QHHB 2F8HA 2AQ4A 2AGVA 4BGVA 2QRVB 2EOAA 2H85A 1URRA 1M3SA 1S3FA 2R65A 2B8JA 3ZHBA 3NEJA 3MWYW 1O97C 5LL6P 2P75A 1NUHA 3KB8A 2AZTA 3M6UA 2HCRA 2V6JA 3IVXA 1UVNA 2JW5A 1NPYA 3I2HA 4TKUB 1R0RE 1U7ZA 5P21A 1PWZA 4FGZA 1W5FA 4IIDA 4P31A 2AYBA 1RP5A 3B6MA 3LBFA 4XVHA 5L53A 4MVYA 4A91A 2LEPA 2V1UA 3ZDFA 4A0GA 2KXHA 3R7BB 3T3HA 5KSZA 1OXTA 4IHKA 4RYDA 4FU0A 3R5SA 2PUBA 3Q0TA 3K8ZA 5AQEA 4KQJA 3SV3A 3F5QA 1QUEA 2Y92A 3O21A 3KOAA 1VOMA 1Z4KA 3VQTA 1TL1A 5FOXA 4YRKA 3HSKA 2GSDA 4RANA 1ONBA 3QLVA 1I2CA 4HWOA 3C6QA 2BEUB 4YRDA 3LG2A 4MI1A 1TK3A 2PMKA 4W6ZA 5KIAA 1I4DD 1X8XA 2D06A 1WKVA 3B6KA 1NHKL 3HHLD 3QIPB 3HV2A 3A6FA 2XQVA 1CJTC 4KMOA 4WZAB 3LY8A 3C3KA 3BL6A 5HBGA 2RHDA 1Z2CA 2I2BA 4ZO9A 3KOXA 2MHNA 4HB0A 1DTEA 4TU9A 3PXEA 4BS9A 3ZGXA 2H1FA 4DJ5X 2B4OA 4S0MA 1HNIA 4IGEA 2OV2A 2IZ6A 5ETQA 1FFDA 1EG7A 3HKBA 3UC5A 2HNZB 4KX5A 4DOMA 4R0JA 3IUYA 2Z2ZA 4G63A 3ND5A 1GNPA 2IXGA 2XA2A 4CLDA 3TIGA 4CEJB 3EDCA 1NPRA 4TL8A 1EUDA 5FUQA 2MQNA 3UWTA 2PZJA 4ZQCB 5CFOA 3RRHA 2RHMA 3TW6A 5HROB 1OXKB 2BRUA 2XXAA 1L3SA 2B99A 1FFEA 4Y2UA 3NAQA 1NVDA 1V7ZA 3MT0A 1AGNA 3UCFA 4HHEA 1YRTA 1LTQA 1YIAA 4JV0A 4C0HA 4RTRA 5TNXA 2ZT5A 4OH1A 4WN3A 4ZN3A 5CIYA 3C4VA 5IWAJ 3AA8A 3HCOA 5GY7A 2XZOA 5IAJA 4K2JA 1N5YA 4LJ5A 2HBZA 1U2SA 2B36A 3T5PA 5HXAA 4G0UA 3P3DA 5IVKA 1DXOA 2CXTA 1B74A 4HX5A 1OJLA 1CNEA 3D68A 2E66A 4KV7A 3ZTOA 4I5EA 2ZWIA 2WBRA 2P9JA 2CQ0A 1UFWA 1U7LA 3JQ7B 4X4TA 5EQJB 4GKKF 4RH3A 1RYDA 5J2NB 3ZTQA 1LDBA 4EY6A 3WWPA 2VG6A 1XQIA 4G23A 4BNMA 1VDMA 1KGSA 3RYCA 3M8PB 1OLOA 5EHGA 3ON5A 3PP8A 3G2IA 3ZNJ1 3E8SA 3NMUF 4BQEA 3WO0A 3CZAA 1H4SA 1Q15A 4A2WA 3MLAA 3QBEA 3FCWA 1E79D 5B12A 2Q5EA 5D1NA 3VSEA 3PUVA 1N6NA 1Y8QA 1IN5A 4ZZ1A 3SZRA 5C37A 2QTLA 3N8NA 4OHVA 5LMNF 4C1BA 5IARA 4GUDA 4NPOA 4JITA 2X0FA 2J7KA 2HGNA 3FTEA 1J1UA 1NZFA 8ADHA 4S35A 2CNOB 2XUQA 4TMWA 3NPMA 5IRCD 3CRVA 3C6TB 5NLLA 3CNEA 2HMTA 1H0HB 4KWTA 3OLXA 1GQFA 5KWJA 1JIUA 1C81A 4JGBA 5A2QU 4R69A 2IUTA 3L9XA 2AX3A 3OY2A 3G2PA 4KR9A 1D9XA 3OEHD 2PMEA 1CLFA 4IQMA 1CWUA 2ADFA 1VSTA 5DNVA 1JDJA 3BFVA 3BGDA 5ES3A 5LQKA 1YTYA 2E1RA 3K8QA 4AWAA 1PEYA 1HMYA 5EJAA 5FIUA 4WOPA 1VIXA 1CB7A 2OPPB 2XNHA 5FBZA 4UBIA 1USIA 2OXIA 3EMTA 5BN4B 1W8IA 2KN4A 1ZNYA 4MUXA 4DW8A 5FJJA 2Z1DA 5LL6d 2ZH4A 4E2XA 3QOXA 4S1TA 4TN1A 1Z56C 4YYEA 4D96A 2JWNA 2EZ4A 1J5XA 9ATCB 2EYQA 2O8VA 3AHHA 5JSZA 1UPCA 1Q21A 4MEAA 3CPEA 2BKPA 2FZKA 3UOGA 1LKZA 1N2OA 1CEYA 4LRUA 4AULA 1GFWB 3MLEA 2GM9A 1U3FA 1ESNA 4ARBA 4DHVA 4OIMA 2QJTA 1XRMA 1Q5VA 2AU0A 4R1PA 2VJKA 2XAAA 1XJCA 2QQGA 4O3OA 2WUFA 5KT5A 4NCXA 4Q43A 3NALA 1G8GA 5K14B 4JVLA 1BDBA 4LJ8A 2H1LA 3TUZC 3BFXA 5E8RA 1P29A 2W6OA 3GLRA 3OO1A 1GNKA 2F00A 4Y6IA 2YWEA 1YIDA 3A3NB 4LPSA 7REQA 1BG6A 1RPTA 2ZC4A 2N3ZA 4DUZB 2NV6A 2FX2A 3ETNA 2AWNA 4E2WA 3HHDA 2Q7XA 5ER9A 1FTSA 3HY3A 1C4CA 5JYCA 1VSVA 3KVOA 2Z3VA 2XQIA 5LP6A 2NT3A 3DBVO 3HD1A 4HAZA 1RRPA 3UDLA 1EPUA 1Z13A 1SKUB 4LOHA 2QMWA 3QF4A 2IAJA 1G18A 4G9BA 3SXUB 4IY1A 2H63A 1C3XA 4Q4HA 1I2DA 1OZHA 4ETMA 4C4PA 1Y82A 2WFAA 2EKBA 4ENSA 2WJJA 3ER8A 4MQEB 3T7AA 1YB1A 2PYDA 4CYUA 3G8BA 3KNAA 4MKXA 3HFGA 2OORC 4YQYA 1ORVA 1YFLA 2IU4A 2YBVA 2FRXA 4OKIA 2OD4A 5DDOC 1ZOPA 1LXJA 1Y4SA 2PO4A 5IS2A 1FC0A 3SN6A 3Q23A 2EIXA 3HC7A 2Y2VA 3CWCA 3VUFA 4B4VA 4U7WA 4FHGA 5E1OA 4DSTA 4MKFA 1Q12A 2ZB4A 4G0NA 4RLEA 3GVCA 3PNBA 1J23A 3UNXA 2GD0A 2BEVA 3WICA 1JV2B 3RHSA 1S3GA 3CD5A 1HDIA 1NJ6A 3CLHA 4MQ5A 5I3PA 4TMVA 1BSVA 4BVKA 3UJ8A 4GKJB 4XH9B 1BCSB 5JYBA 4PAQA 1Q11A 2B5OA 2JIRA 3KOOA 3QGGA 3DAHA 4UY8T 1PU2A 4CZ2A 5AJ3J 1O2DA 2HCBA 3KUKA 1MVOA 3RIXA 5EZYB 2NGRA 3DOKA 1YA6A 3Q8YA 1J39A 1XJWA 1G2QA 2WA1A 2GJ4A 3EA4A 4EI7A 3T5BA 1IN0A 2ZU6A 1UANA 4LF8F 2PZEA 4EYOA 4Y6RA 4QBKA 2WF7A 4QATA 4J0DA 2W25A 3EQZA 2W2TA 3MMBB 3SJ7A 1JEQB 5KNCA 4KMMA 2WM3A 4USHA 2IF0A 2JAUA 4K8RA 5JVDB 1DXHA 4IOBA 1KVRA 4EPRA 3G7SA 1N8NA 2YZ2A 2P3SA 5FO0A 4S0ZA 5HM8A 5KNDH 2Q6CA 5KFRA 3BS9A 2Q6OA 2QAJA 5THXA 4E2FA 2DKNA 4KFUA 4C05A 2VDQB 1GGJA 4X4OA 3BYZA 1EK2A 4A1FA 1T2NA 3S7RA 2LDXA 2VF4X 4FJ1A 1MH1A 5F64A 3W79A 2XUAA 4LOJA 3GR6A 1PYTA 2A1TS 3RAGA 2QVBA 3C85A 3QELB 4KYZA 3VU1A 4OHPA 3RRZA 4JC8A 3W5UA 1F4LA 3H7IA 4E22A 2VTBB 1U5BB 2IHBA 3WLKX 4I2VA 5AM2A 2HHSA 5AKXA 3TLBA 3AJEA 1ZK3A 1UBFA 3ZVKA 3MRSA 3IG1B 1MROA 4DWIA 3M82A 3MMPA 3MHYA 2YJ3A 4Z0NA 4ZJYA 5I45A 2XSZD 3C3EA 4BTVA 1WXQA 4DCNA 1KS9A 2A58A 4ZO6A 1ECFA 2WFLA 3NM4A 5FUXA 2A94A 1WKCA 5IT9A 1R6YA 5IJ0B 3P26A 4EJMA 5AI4A 4GI2A 5YASA 3QRRA 3MWDA 3U2QA 2EL7A 1WG8A 3EVNA 4Z6KA 2PWPA 3FGOA 1XZPA 2RT3A 2BEJA 2XTNA 1R0BG 1KEWA 2GO9A 2QSFA 4IG0A 1A5TA 4FFSA 1HFEL 3BE8A 3MPVA 2PSFA 4FI3F 2K5UA 5KFOA 2AVNA 1FJHA 4RHCA 1O08A 2N1MA 2J6UA 1HR0J 2PNJA 2ABWA 2R1ZA 4UY85 1CIVA 3KKFA 5JADA 3BC1A 5LM7E 3IUBA 1P77A 3QHQA 1NBIA 4DEXA 1I7DA 1SHTX 2W9CB 5J2MB 3SVZA 2ETXA 1FE4A 1R0CA 4Y0NA 4LCBA 5DT2A 2QT0A 3F4KA 4MW6A 3TZEA 1MVLA 3MD0A 3OLWA 5JMTA 3AHGA 3A11A 2YVKA 3CX3A 4E7OA 4IWYA 2XMMA 1K3FA 2G1AA 1JEOA 4PANA 5LYJA 3G0OA 1T34A 4LRDA 4XX1A 3J7TA 1R4MB 3NNAA 4IICA 3MGAA 4ED9A 3MFYA 1N6LA 4QICA 1XQVA 4LF6B 3FYUB 1B41A 2Q5JA 2VWGA 2DHSA 3E15A 3KFVA 4NP6A 4S1VA 3FVVA 4IH4A 3EVCA 1FLDA 1YFZA 4KN5A 3L8GA 3OZSA 2UUPA 4EFNA 1WD5A 4HLUC 2OOSA 4NA3A 1RI2A 1M2JA 3CMAS 1S9EA 1ZU4A 5TF4A 4J29A 5CNJA 2AMLA 1A8IA 4BNDA 5A3SA 1SXLA 5F1PA 3ZBTA 1MPTA 1IQTA 1FB5A 2ZE8A 5LJIA 4G01B 4ECTA 1WMEA 5FOQA 1J0DA 1YZVA 2W8BB 1GDDA 3A06A 2BKAA 2EJBA 4KT0C 5KT7A 3K9GA 4R6XA 4DLSA 2FR0A 4Y2SA 2JLUA 2ZJYA 1HBOA 3CF0A 4C01A 2HA6A 2FSPA 2WAXA 2X8WA 3HHLA 1VSQA 2H51B 4HWSA 3KHUA 4JI8F 1WXIA 1JJFA 2DXIA 3TG8A 4UT4A 1IBKF 3Q3CA 4I5GA 2FPRA 3ILOA 4QPTA 1TL7C 1WC5A 4Y2XA 3EE3A 1DC7A 3MF4A 2VDMB 3CX6A 4CE6A 1UOPA 5HK8A 2IIVA 5DW0A 5JCPA 3KU4A 2RCNA 4RTLA 4HKTA 2QPLA 1THZA 4OQLA 4X95A 4P81A 4WK6A 4ZHQB 5F1YA 3E4DA 3JD3A 3H4BA 2PYZA 4E3ZA 1CTQA 2DPIA 4HUTA 5BWNA 2F8MA 3KK1B 1E9BA 3EY9A 2YV2A 4QNMA 3G5LA 5EE0A 2HFSA 4FFPA 2ATIA 2Z5GA 3CJRA 2OSQA 3AQOA 4UDOA 1VHIA 3UYKA 3L7KA 3MAAC 2FSHA 5BXIA 1N1EA 4OZNA 3PEJA 5C2CA 3UPUA 2AGQA 1Y6QA 1OASA 2AI1A 5L3SB 3T1YJ 3X1MA 2BPOA 4QDKA 4URWR 4EPTA 4PEOA 2DB1A 3M6FA 4KBIA 5DNWA 3VC7A 2JI8A 1S7HA 2HA4A 5LQMA 2P6RA 4IAOA 1PUIA 5KYNA 4W7HA 1MVNA 4AXIA 1XKTA 2WSMA 2DBYA 3ZEAA 3M2UB 3BJMA 1IBLJ 2ACWA 1LV7A 4E4TA 4L72A 5HKLA 2R6AA 3UN3A 3K9FC 4NBSA 1WEKA 3GCWA 1BE1A 2YFQA 3BO2A 1UDBA 3KR0A 4MUMA 4O2AA 1F5BA 4ZA1A 1F5CA 3KK0A 5HMXA 4UBJA 5KFSA 3VH2A 4CNBA 2FETA 1TR0A 5K01A 2BCEA 4L0CA 4DDWA 3TQEA 3TW4A 1SBRA 2ADBA 2MZTA 1G3QA 4AZ0A 1N0WA 2DXEA 3E9DA 4CO4A 4GMGA 3SIPA 3C6UA 3M9NB 2V7GA 3W77A 1XTQA 2F4NA 1SRQA 3WKBA 2WYOA 1TF5A 2JA1A 3Q7QA 2WM8A 3A0UA 1NUPA 3TVYA 5TT0A 5TMPA 4N0EA 3IGNA 1G8HA 2HHWA 3IR5B 2ERXA 1KDRA 2Z08A 3VR4D 2Q1TA 2NLWA 2W7OA 2I5JA 4HAUA 4YJHB 4IV5A 5DM60 2G0IA 4TQUS 3CW9A 1CBKA 4UZSA 5BW5A 1NFFA 2F43B 2Z5LA 3M1IA 1Q5PA 4JOBA 3L6RA 4LDZA 3M81A 4EHFA 4YB6A 1K44A 4MT1A 3S0JA 3FJ1A 5IM4A 1GQRA 2CHVA 2XYRA 5TQ2A 2DQYA 2YZ7A 2YDYA 3WSWA 3TG2A 1P3JA 5ITSA 2F8TA 1TKTA 4RLSA 1T8RA 3ZW8A 4KR2A 4JBIA 1DTWA 2WMNB 1QX3A 1RBMA 1H3FA 3KBBA 3JSMB 1VJ0A 1E9DA 3S8SA 5EGSA 3OEHA 3N5KA 3IDAA 1EWKA 3D5TA 2X9LA 1PJ4A 2BJHA 1FNOA 4OXIA 3LZDA 4FR2A 3MXOA 3MUMP 3GD7A 1T1EA 4LZNA 4N40A 1TB4A 1Z2AA 1VRTB 3H90A 4X8LA 5KAMA 1TT7A 2JLSA 3KHTA 4TTVA 1TO6A 4NEHB 2BHSA 3DV9A 3F9CA 4RCVA 4P32A 2Q1LA 1W73A 4YCBA 4EH1A 1QS0A 2DGWA 2JZ5A 4AF8A 4MAAA 2OIHA 3QEMB 1GQSA 1U49A 1MQAA 3JASB 1RHMB 4MKIA 4UHBA 3PFOA 3SF8A 4LRXA 4V02A 1U8TA 1QV7A 4LFCJ 2ILVA 3QEOA 3G82B 4DN6A 5T41A 1HTWA 4AXJA 3PDNA 4O3SA 4WYLA 1CR2A 3LW5C 1KI9A 4FLEA 2QBYA 4LF5F 4ZPJA 4DCJB 1G8KA 4HJXA 2CSXA 2XMPA 1IN4A 1DKOA 4BP1A 1QH8B 3SC6A 4MP6A 2V5VA 1XF1A 1SKMA 4DUGD 4Z4EA 4EUVA 1O94C 3KKPA 4OP2A 5IZCA 3GG2A 1JGTA 1VE5A 2XA1A 5JFGA 3WKAA 3PVSA 2DB3A 1VQKS 3I83A 4IHJA 3IC5A 4DLVA 3Q4GA 5F7JA 1GX6A 2QTFA 2W37A 4NNPA 5J4VA 5A4MS 2NO6A 1QP8A 3CW8X 1YR9A 3K72B 1QQAA 1U1KA 2OESA 4IWXA 4NABA 1X5OA 3WRYC 3TNYA 3R3WA 4LFAJ 1WQ4A 2A5JA 1F6BA 2D3OR 4E5SA 3M2RB 5K0JA 3B48A 2VR1A 1T9WA 4DJDC 1BQMB 4EMBA 3ZHUA 3C15A 4TLRA 1TL4A 2B7LA 3MG9A 1ZOSA 4OSOA 4LIRA 5ULLA 1WIWA 4K3VA 3X0DA 1HQUB 1E6YB 3W5DA 4K05A 1K1QA 3AJ9A 3DDIA 4XQGA 1VJGA 4NYIR 4MB2A 4OH7A 5KYXA 5ADUS 2F4VF 2XE4A 2GJIA 2JFGA 2FA9A 3KSZO 4RJIA 4OJ3A 2PUAA 1GLGA 1QE1A 1ZRMA 1OXBB 1H98A 3GNLA 1J9EA 2VYND 1ECPA 2WB1D 1P2FA 1E1LA 2O14A 1DX4A 3K6KA 3VR3A 4NULA 4JI8J 5DBFA 2SBTA 4DMZA 3TQOA 1IBKJ 2WOMB 4Q39A 5LIPA 2HQCA 4YGYA 1CSJA 5FDFA 1ISSA 2FPGB 4MQFA 1TADA 1YQGA 2PH3A 4UDYX 3WGYA 1IYZA 2RC6A 2Z8XA 4CM0A 2WV9A 2HHCA 1IQUA 4EA6A 4LDAA 4GRDA 4O3MA 3FNHA 2LBPA 2Z83A 2CB9A 4UHJA 1ULAA 1NB7A 2PD3A 2GMJA 5LMUF 3DMJB 2Z58B 4K7JA 2GETA 3WTBA 1H6CA 3IAAA 4H1HA 4WFQA 2IZ5A 4Q0MA 1QM5A 1WW8A 3RBAA 3RSSA 2W70A 3BWMA 4HVAA 5BW6B 1PS8A 4C5AA 5KQMA 3Q8UA 5EKXA 2QRNA 3R6GA 2WUDA 3HVKA 1WDKA 4CI0B 2GBPA 1JFTA 1ZNQO 3KR1A 2CJXB 2WRZA 2B4TO 1UMCB 2J9CA 1TCAA 5KFZA 3HMKA 1CJSA 4XA8A 4AM8A 4IG3A 3W4KA 2EBEA 4R8MA 4CGZA 1YCGA 4WFBQ 2OZKA 3OFSA 2X8JA 3FDFA 1Z18A 1MPXA 2ISSD 3H5OA 3ONFA 3FMWA 3P9KA 1U2DC 3U80A 3NGDA 3GCGA 2ORIA 1W7WA 1VQ9S 1I1HA 3G5UA 2VT6A 1V39A 2J3DA 4LF7F 5J23A 1K98A 2ZREA 4X6YA 3TRHA 5D3GA 2A5YB 4TUYB 4FB4A 1HL6A 1K8RA 2G2YA 2OHIA 4A82A 4L5CA 1K97A 3TNLA 4OK5A 2XUHA 2HFZA 1OPXA 1SC4A 3H84A 2R0QC 5JWRA 4XXHA 1X8JA 4C48A 1FS6A 4IJ5A 2AGOA 3ZKWA 5FUVA 4OX9J 1I6WA 2CJAA 2IYGA 1X4AA 2ANCA 5I4MA 3F7TA 2RHWA 2JEIA 2DOKA 4EHIA 1XJ5A 3ZQ6A 3G4SS 2KVQE 2P3LA 5GONA 2H9ZA 2WUVA 4L3VA 1JECA 4YRMA 1RADB 4FR5A 3N39C 3D4PA 1JFLA 5BSUA 2QG6A 2VKTA 3CBQA 3SXLA 5T4HA 2AX1A 3UHOA 3I64A 3VNQA 1U1GA 1IM6A 2R8JA 5EDWA 2ZDGA 3JXEA 4A1OA 4NCKA 3TQSA 1LC0A 2VG8A 2V7WA 2WC1A 3BH0A 3PFEA 3HUFA 4B83A 4R0EA 1ZFNA 4Q03A 1FJCA 1JIVA 1C3OA 4Q8FA 1O87A 1PL0A 1LQUA 2HJ9A 3O3OB 4WKPA 4DBLC 4C3MA 1EE9A 3GT7A 4KE9A 4RR5A 2H17A 4S1WA 721PA 2D62A 2EJUA 3PYXA 3GYXB 4F5WA 1T6XA 3SSQA 1GPBA 4BLSA 3UO0A 1ZVQA 4UMVA 2WTUA 1GLNA 1EGQA 1MT0A 1A96A 2QL7A 1YF3A 4G6VB 1M9NA 3L4EA 4Q8EA 1YWGO 4OUDB 2PV0A 4UQOA 4RM2A 5BMVF 2O2JA 1RZ3A 3BFKA 4E6EA 4EU0A 4RD4A 2KMLA 4JKYA 3IH5A 2QX6A 4DIBA 3COVA 3RR7A 5BOSB 1NR7A 4MCHA 1QTQA 2P2LA 2D13A 5AKHA 1DAOA 1GQYA 1XMIA 4NYPA 3JPWA 3HO6A 3O5TB 5C2GA 1JH9A 1WV1A 3ICQB 3OTOB 2K3IA 3DHNA 2ODQA 2V0GA 1XPOA 4JQZA 4EF5A 4LF5J 1UXKA 1AYEA 2VQEF 3O8OB 2PT5A 1W59A 4O2BF 5EUQB 5CGZA 3NETA 1FTYA 3I96A 4RK7A 4IFEA 1GZUA 1DRJA 1XEWY 4X63A 1Z2ZA 4JI3J 4D4LA 1OHHA 2GA9A 2HJHA 3RHFA 4K9RA 4OB8A 4WA8A 4RHYA 4CIXA 1J0BA 5DHFA 3GN2A 3I01M 3PJFA 1RD4A 2MKYA 3ZY3A 3JQRA 3IRXB 3SEAA 2QA2A 2CFIA 1Y3HA 1O6ZA 3CMQA 3D7LA 4ZP6A 1S12A 4AZSA 4L27A 3F49S 2IY8A 4I6JA 1L4FA 4KLNA 4IJQA 2XDYA 5H3LA 4JLPA 5C25A 4TYBA 1FFCA 2CNDA 2ZUBA 4WLOA 3MXHP 3TSAA 4DSNA 4H60A 1THGA 1OKKD 2KJQA 3GNTA 4F85A 4GSYA 1BH2A 2AOUA 1TK9A 2RFLA 2HNKA 2MR5A 2XLKA 1A2OA 2C5SA 3GPIA 4CM3A 4IVRA 2C7PA 9MHTA 1P5JA 4J0HA 3ZWMA 3GRUA 3U3KA 2V6BA 1GPJA 2RK4A 2OILA 3PEVA 2Y0CA 3I2YX 7ABPA 1FYEA 1HL3A 5A8KA 3BYPA 2XITA 3JY6A 4DNQA 2LPMA 1OLUA 1P7ZA 4IEFB 2J5RA 3G0GA 1R9NA 4OYMA 2X2PA 5DLFA 3T15A 4ZVGA 3CC2S 5KSYA 2MQLA 1S7GA 5U4QA 1E1QD 2JJ4D 1OWMA 1VQPS 1M5VC 2ZOSA 2FI1A 3FOCA 1UZUA 4F11A 3SYLA 4UATA 2C8VA 4KYIB 1VQ5S 2W8ZA 4NJEB 3JWHA 1ZK4A 3MM4A 3TPCA 4R5MA 5IQ6A 1SPBS 3N28A 3O2QB 4CU2A 4F5ZA 1JG4A 2XOXA 3PNOA 3HG7A 2I2YA 5AW1A 2AS0A 3SQXA 3KAJA 1ZEJA 1I0ZA 1LPOA 2GLTA 3DXBA 1YAJA 2MSTA 1DZ3A 1X7VA 5A8WB 4IRUB 4NWIA 2RK3A 1JJHA 4KB7A 3G9TA 4XASA 5F1KA 1UMJA 1SZDA 3INGA 4DYVA 3AKEA 2XC9A 1F4PA 3C7KA 1BDIA 1E9CA 4Y98A 2ODEA 1XA4A 4LY6A 1LDGA 1PJ5A 1VBMA 3ZZPA 2H4WA 5FBLB 1RQLA 2JI6A 4D8VA 4X8OA 1BE0A 2YJNA 2B6NA 4CIVA 5JXJA 4DDHA 1C3VA 5SZHB 2VATA 3GV8B 1U2CA 3I8OA 2NZJA 3H8WA 4CGYA 3MW8A 2WU3A 4I2QA 4EG6A 4ZVQA 2YBDA 2FSIA 5CW2A 4BCBA 2J9RA 4JBYA 2O0MA 5BO5A 3PQ2A 2B30A 3TYTA 3UVJB 2EU8A 3HHPA 4AJPA 4UQTA 3RPEA 2ESRA 2NXJA 1VL6A 3FMOB 1L7NA 4PQYA 2HHLA 5EP3A 3GYGA 3VAHA 2J8AA 2HSWA 3QFTA 1R6DA 1NMYA 4R9UC 1FKAF 4P58A 4BLQA 1E2BA 2AUNA 5AI9A 4TTSA 1S1XA 1NVTA 1I51A 3HBLA 3BDAA 2GO7A 1N6IA 4AQYF 2WTEA 3AU8A 5LKAA 1XPJA 1R31A 3A3PB 5HBMB 2AG5A 2P7HA 2ZOMA 1YQXA 4A26A 2R8KA 2PRZA 4ZVLA 2ZXEA 1JHDA 2VJQA 2H08A 4DG1B 3G59A 3C3BA 4QQFA 1C4XA 2EK1A 4LDRA 3D4JA 4Z4IA 4CTOA 5EXSA 3NOGA 1B42A 3Q11A 3GLGA 5EXDA 1TM2A 2R87A 1W36C 4J16C 2X9NA 3CN7A 3ZW9A 1TTQB 2IEIA 4Q9IA 1Y3DE 2XXJA 5M29A 1BCRA 3IUEA 2OT3B 1VMBA 1T0UA 3R6LB 4CLLA 2BABA 2NZ2A 4JI0F 2JATA 3VAZA 1U3WA 4WWSA 5AD1A 4B2LA 4R8SA 2FMTA 2AK3A 2R4TA 5KBYA 4DUGA 3HNRA 2EC5A 4UTVA 4OI2A 5KX5B 4MH8A 3HR4A 2RILA 4QRIA 4EGSA 3MT7A 1Z37A 4TVKA 3RSGA 1FDTA 4EB6B 5KHOC 3OF3A 3GLGE 4YP5A 2XB9A 4EF4A 3K71B 3HPOA 3DHXA 1RYYA 1PZFA 5LSLA 1FXUA 3PRDA 5LLDA 2PT7A 3JS5A 2X6RA 2BR4A 5BSEA 1PNVA 1X4FA 5TIIA 3K7RA 2G9ZA 2C83A 4PHCA 2ZRQA 4A0FA 2WI8A 2ECFA 1YTLA 1IHOA 4M1ZA 1YZ7A 4Q3OA 2JFVA 2DHXA 3ZTTA 4YIKA 1FJEB 4RTPA 4M0LA 1R0YA 2JRSA 1SQ5A 4GI1A 1ECJA 2VQEJ 1FVQA 2NXEA 2RB5A 2Z8YM 3QNWB 3F4BA 2BMBA 4N5SA 4HEHA 2AZ4A 1RM4A 5FWYB 1UZNA 3O4FA 2CIMA 5M2QA 2NZYA 2IE8A 5JS1A 4W9NA 3EAQA 4JGIA 3MJHA 2F1JA 2BX6A 4LXGA 3TLEA 4Q93A 1MEOA 1QC5B 1E7YA 1U0EA 4HN2A 3RB3A 2B4YA 4EITA 1E0KA 2G9NA 4QPCA 2VYNA 2VDWB 5EZ6B 3U7RA 1L1EA 1ZTWA 3TAUA 4HUJA 1HFWA 1NNSA 3IE1A 3JQ8A 3C1OA 2U1AA 2EFYA 1E60A 1YKGA 4A8YA 1FNBA 3EGWB 1J33A 1BEUB 3WL5A 1I24A 2OQRA 1N8RT 1Q7GA 1CG2A 5H83A 1GAEO 3DZHA 1HT0A 4ICLA 2VNKA 3M8SA 3PTAA 5BOVA 3FBEA 2FVYA 3DM9B 3IWLA 3F6RA 1NK4A 1B93A 3HDJA 2I38A 2P9FA 1MB3A 1IK4A 4ZYZA 1A0OB 4M38A 3NWBA 2HHTA 3OPMA 3GMGA 3R2JA 3GUUA 4WJZA 5TGDA 1SIUA 2V54A 3DDSA 4MZXA 2LUOA 1ODCA 1T8WA 2HREA 2FFQA 4KPGA 1F0XA 1DG3A 2JJ2A 2VKRA 2W6NA 1PJAA 3Q8QB 2GZAA 3VZSA 5BWBA 1KSFX 3U3OA 4AYXA 2I80A 3N2YA 4HY3A 2D7DA 4MWGA 1GQOA 3QQCD 1KBOA 2DGOA 1FSSA 2VJYA 4OFZA 1D6NA 3RVSA 4EJ2A 2AJFE 4RESA 2FZ4A 3O90A 4L8VA 4MWZA 1HQEB 2Z1MA 1KYZA 4N5IX 1GPAA 1XE3A 1SIBE 2PLRA 4CLTA 5D3ZA 3ZD8A 2C5FA 1AXQA 2RDIA 1M1ZA 4DL3A 4ZV4A 3FRZA 1SC3A 4YJFB 3SCZA 3DJYA 1VRWA 4PNZA 2G1HA 3WJ7A 4LZWA 1PTKA 5DCYA 3HVRA 3UMMA 1HEIA 2GRAA 3AJ1A 2XUKA 4B09A 4ZI3A 1JIQA 4JLUA 2NTEA 3BMOB 3T8YA 3S2ZA 4H4CA 4LZZA 3OM1A 1NI4A 1EB0A 1F1JA 3O31A 4HDNA 3WHLA 1YQ9A 1U1IA 1U26A 5FYDA 1GUFA 2VF7A 4OXYA 4KPEC 1M1UA 4C8KA 5KFMA 3C98A 1T05A 4L9WA 1Q8IA 2DNQA 1JKJB 2Y1GA 1WPGA 2DULA 5J5CA 1WTAA 5KYGA 1W87A 3QENA 5GZ3A 1LD3A 2BYCA 1AMNA 4BMSA 3SFZA 3DOUA 3PHHA 3SQMA 2OQ2A 2QAGC 4YI5A 1OPRA 4GYKA 2J3JA 3MD3A 2ENWA 4YAEA 1J8VA 2YNMC 5CA0A 1RTIB 4U2DA 2E9RX 4WD3A 4EDFA 1PGQA 5JSQA 4L2IB 1H2TZ 1GNRA 2Z56A 3C8DA 3MRTA 1B43A 1SC1B 2EG1A 3W9UA 3BAZA 2P9TA 1NVVQ 5IWAF 1HA3A 1KAHA 1QZZA 3IX7A 5E3IA 2SXLA 4H7PA 4YO8A 2AYEA 3JQKA 2ZSFA 4I99A 2QLMA 4HFMA 3G6ES 3DQQA 4PCVA 4KRGA 1M67A 2HMVA 3HVIA 1GU0A 4D4HA 2IA0A 1B6RA 1D9ZA 2PX2A 2GAAA 2J3LA 4K7QA 3FW1A 5EGNA 5EJ2A 4US0R 5TQVA 1FE8A 3LBIA 1QLJA 1W47A 1NVFA 2CYYA 1KR4A 4FNIA 4AU1A 1Q77A 1WP4A 1JHAA 5CCEA 5KJ1A 1RWQA 2WIDA 4EO4A 2FG5A 1RWWA 4MRPA 3SQOA 3MIZA 3PFIA 3DFKA 4PSCA 3IMEA 3ZNQA 1VGYA 4KQZA 5DTRA 3CD6S 5K3OA 4JP1A 5D87A 5MHTA 4BCDA 4PRFA 4PAGA 4GXRA 2MGZA 2QRRA 1P9OA 1EJ2A 4XLZA 1YIJS 2X6TA 1PGOA 1R8CA 2FY1A 4TVSA 4AN0A 2ZE6A 4MHOA 1GQQA 4IMPA 5I8ZA 2HYDA 3JSXA 2D9OA 5GVQA 5E1BA 1D8YA 3ORYA 5IAGA 1ZX1A 2NYVA 1DRUA 3RFXA 3MJRA 4R2KA 3N0RA 5MN4A 1W1UA 1ABBA 4E03A 1QRSA 4OB6A 4XW2A 3LP5A 2QTCA 2OFXA 3WWCA 2PFKA 1LPBB 5EHQA 4H7FA 3MCZA 4I9GA 2KYXA 3LAKA 5K2MA 4POOA 2R9LA 2EP8A 2ZD1A 3E2EA 2ZIAA 4D3HA 2FB0A 3G86A 1KI1A 4UBMA 2GEJA 4HLNA 3NCQA 4RGVA 3QWFA 5JAQA 3G6XA 1JFVA 2HMWA 4H3SA 3VDXA 5TPWA 1C1XB 4NA1A 3VKFA 5AUOB 4EYEA 3CWZA 4ED8A 2AD1A 2DY9A 3QVMA 5KFQA 1ZUD1 3FHOA 3WYFA 5ARBA 3LY5A 2WIGA 3DOMA 2L42A 1VCMA 4MP3A 2AFIA 2EG2A 3FGZA 4F5YA 1QKIA 4O8CA 3G2JA 1YFKA 4ENQA 1S1MA 1QH0A 1VJDA 4X44A 3DCAA 1KRHA 1S0MA 2J0UB 2JGJA 2XMDA 1E2HA 1ZG3A 1GA1A 3GLFB 4GOMD 3QKSA 2GA8A 1JDNA 1PHPA 5JJIA 4QJBA 4Q3EA 4Z9XA 3MCOA 3ZDQA 4RKQA 3LWMA 4OK3A 3NUQA 3RK4A 1CQMA 3GIWA 4QYIA 3C5EA 1BQEA 1GT91 4J1QA 1ZK1A 1FK8A 2JJMA 5TB5A 5LLSA 4D3DA 1YDEA 4LGMA 1JYEA 4Q4CA 2AOTA 5F78A 2AFIE 2V4MA 2EBUA 3H87A 4I68A 4IF6A 4KHZA 5DS7A 1AA6A 1KZ4A 5BRJA 4PY2A 4MMZB 2B8EA 1CUGA 4MS3A 4KBGA 3TECE 1GSIA 1Y8CA 3DAOA 1LDNA 4QUIA 1E63A 3BBCA 1YS2X 3V6DB 3H1BA 3I4LA 4IP0A 3S1AA 3CJ5A 1AHPA 2YASA 3J7YI 3I12A 1FP7A 2VJVA 4N5NA 4G9EA 5AK6A 1B26A 1CRPA 2ZR8A 2Q8QA 1OLXA 4AJHA 1V3TA 4BJ6A 3V2UC 1Q7RA 2W2QA 4H7HA 4DPOA 2IX3A 1Q3KA 3S8MA 4I4TB 3PHIA 1U3VA 1RQNA 4YJGA 2B9WA 1S1TB 3M4ZA 2HS0A 1TZMA 4CNQA 3Q7IA 4M22A 3THWB 3AOBA 3H3FA 2ZI9A 3OR1B 1XNRB 1B0PA 5BN1A 2EBGA 1W5AA 5BV1A 3F8TA 4GO5X 1LU9A 1TEHA 1XMSA 2ZHAA 4X91A 1SNYA 4BNWA 5EMHA 3FYCA 1RBLA 5CFMA 1ZD5A 1CZNA 3TX2A 4UF4A 5EFOA 2IV7A 1TYEB 1DAIA 3GV0A 1YIOA 2FLPA 5AJ3F 4R05A 2IRXA 4BCAA 3V9AA 3C97A 2QN6B 2QROA 3VV3A 4JQOA 1T5BA 5CT8A 4B3GA 1V3UA 1E1RD 1U8AA 1MJGA 4H4MA 4KN8A 1E4OA 3X3UA 5JXGA 4RY8A 1PL8A 3SX2A 2DR2A 4PCUA 5K8IA 2WM9B 3C5HA 1I5OB 2PMCA 3E1SA 2VPYA 1NSPA 1IRXA 3IJRA 4JI5J 2IM0A 2EG9A 2DNOA 4KGMA 4CM5A 2CVQA 5EIXA 4UHEA 4BLRA 4HXGA 2QIPA 4GSKA 4PGGA 1G60A 1RT2B 3TOVA 1A8UA 4B8ZA 2EERA 1TPZA 2IEAA 4ZQIA 3ASYA 5GTDA 4NYJQ 3KL4A 2V69A 1EVZA 4M9RA 5KKAA 2HY7A 4EKYA 1SAYA 4P5PA 3HY4A 2BDTA 3G6YA 2ZYAA 5H70A 4WLNA 3KQWA 5A4DA 3G0DA 3EMDA 4HO1X 4RLQA 1FYFA 2NTYC 4BUJA 5F4BA 3C16B 2H2FA 3B8HA 4P3PA 3O84A 2IQ5A 1MT3A 4PYJA 4AZ3B 1DI0A 2UU9J 3IBCA 2PMHA 2DUMA 3DV2A 1Z36A 1YOVA 4X8MA 2R8HA 4C98A 1M7GA 4QGFA 4PTZA 2UYGA 1RMYA 1EU1A 3DEIA 1J22A 4BEWA 5JZMA 4W5NA 2HRRA 2IY5B 2LCIA 5KB3A 4KIUA 3JQAD 3A1NA 1S9GB 2GHWA 3NUZA 4QLBA 1GTJ1 1VQMS 2J5QA 2Z2IA 2J6TA 3LSYA 2GCOB 1Q84A 2YJGA 4RJVA 3OR2B 4QYRA 1JHMA 4QRHA 3LFHA 4FD2A 1DC6A 3SC4A 2KHDA 1XZEA 1B14A 1CC7A 1TMOA 5E3JA 3W1YC 4ZP1A 2NXCA 4BNJA 2M9MA 4F04B 5K8TA 4ZIVA 4HG2A 4HNQA 4MWBA 4RF2A 1H0RA 5T14A 5JH7F 1EIYB 1YVPA 3NTLA 2AB0A 2CQIA 3GDWA 1HR0F 4IXMA 1V3SA 1Y5LA 3OL8A 1B0VA 3WC4A 4J9PA 3K5OA 3OL9A 2QMHA 4HQOA 5ESDA 2XGGA 1Q79A 3HVTA 3CY6A 1IJBA 1JKMA 4QGSA 4D97A 5C8YA 4HGNA 3IR7B 2VOJA 4LCEA 2G7MC 4YQEA 1NUTA 1DJOA 4YQZA 3VHXA 1G38A 3E9RA 4N8SA 3A6ZA 1GARA 1UWKA 2EKNA 1GZ7A 1CC8A 4BEVA 2XY5A 3IKJA 3NFRA 2W1BA 1W6UA 3L0BA 3R8YA 1OILA 1KNXA 1QCZA 1TZKA 2BHTA 3PC7A 1A04A 3QWUA 2J1LA 1OYYA 1AUOA 3QW4B 3FYHA 5J2TB 4LVNP 2Q41A 5CMLA 1TUGA 5AW9A 1LBQA 1ZN7A 5D7BA 1G16A 4LDNA 4GQAA 2W01A 5ECWA 2IYSA 4YRBA 2PUJA 3NKYA 3FEZA 5I4CA 2Q4OA 2BOAA 3F6SA 4KDEA 4HZGA 2XLIA 2YUIA 2JEYA 1T1IA 4KIFA 3GJQB 5ERXA 3X44A 3L41A 3AEQA 4K26A 4A4DA 4AP6A 2XSJB 3DEAA 3H1GA 1K6IA 4ENTA 3DL0A 2R1UA 4MCJA 3IOEA 4OPMA 2VJDA 3KZNA 4LCJA 3RVBA 5K3DA 2FE4A 2WSLA 4S1PA 1RS0A 1S01A 3R24A 4FMDF 1PFUA 3RJZA 3HLTA 5AHWA 1DPFA 2CCGA 3X1YA 4O6VA 3EH2A 2DNPA 3UEOA 4DTIA 2NVUA 3ENKA 3OQHA 4AE5A 1DIGA 1NP3A 1FTRA 4R7GA 4EGAA 4B74A 3CC8A 4QOJA 3UWMA 1DRKA 5HKOA 4BX0A 1LXCA 1P2SA 4EYSA 4EUSA 1QQTA 3TXXA 4XWTA 3RI3A 1T9GR 4ECVA 3LYUA 5B64A 2Q3LA 1A7UA 2AF4C 2OZVA 1U63A 3CT9A 4IUFA 1ML4A 2DNMA 3RV4A 4EW2A 1HY3A 1AG9A 4OJ1A 1HG0A 4RFSB 4RPJA 3IBGA 2BUCA 1YWXA 1JLCB 3GLVA 2JIOA 1UJCA 1GUDA 2GHQA 1K6JA 1KXZA 5L3RA 4XYEA 1I1NA 2CV0A 4DZZA 2D8AA 1ZH5A 3TUIC 1DLJA 2Z6QA 1NJXA 1C9JA 1Z2NX 2WYWA 3TGPA 2J4FA 3EIFA 4TROA 3BXGA 4PN3A 1TYZA 3K0FA 3B51X 3FA2A 1QVVA 4FP9A 5C1IA 2XYPB 3IOMA 5JWOA 2W7TA 2JZCA 3DNPA 3L6EA 2FIUA 2WDZA 2K4MA 1PSZA 1ZP6A 4WN9A 4I19A 2G08A 3TOCA 3T1YF 2C28A 3VR3D 4BQQA 1FFGA 5DRYA 2OSBA 3U40A 3R1HA 2X7IA 5HMYA 4U7CA 3RLIA 5C1BA 3HJNA 3RS2A 4O02B 2GILA 1TYAE 2QZ4A 5JHGB 3IFSA 5F9LA 5CURA 3K0BA 3ADAC 4ZVPB 5LZ2A 1KLMA 3SSNA 4DF8A 2BHNA 3R3SA 1KVIA 1IBLF 5LN1A 3T6KA 1HBUA 1TK0A 2YIVX 3EX7C 3PWSA 2NU6B 2C2YA 1G0NA 5FWNA 3LNTA 1Q6ZA 2Z6AA 1SHZA 2CK3D 5LQCA 2R68A 3MWKA 3C6BA 2RF2B 2PRKA 1TQ4A 4RPLA 2GVDA 4IMJB 1DWPA 4OOFA 4Q3CA 1GZ3A 2AMYA 3HDTA 1HKUA 1ZGZA 1KJJA 5CZXA 3ZTYA 1GRVA 5LD2B 2AIRA 2QN1A 2JFXA 4BBYA 3UN1A 1X7XB 3ILYA 4QYMA 1APBA 3JSRA 2WHPA 3EFBA 4ZI5A 1XMOJ 4O44A 3KSMA 2XZDB 3CUYA 4O4IA 3NWOA 4KXFB 3HYLA 1V9SA 3IHWA 2F59A 2PA3A 1SKWA 2C4WA 4NK4A 1NVEA 1E1YA 4CCSA 3I9JA 5AVKA 1IXRC 3N7AA 3KTAA 4QXAA 4Q05A 5CCLA 5BN5B 3VDRA 3MMAB 3HFRA 2HQGA 3W7AA 2O8BB 4U67Q 2Y1IA 1Y7TA 5FV7A 3D6JA 5DBEX 1WZIA 1VPTA 2XR1A 4RZIA 4AJ4A 3K6SA 1NV9A 3H5IA 3VX3A 5IP5A 3TZKA 1DQYA 3KM0A 4ND2A 1KU0A 1RI4A 4CH7A 1IZ8A 1E7SA 1N7IA 4WFNQ 3KKEA 1QO0A 2OO5A 2AX4A 4IKOA 2QG4A 3A4MA 1UPBA 3DBHB 3U4AA 4NBTA 3MINB 1QD1A 3SZ3A 2O1WA 4TVAB 1YI0A 3DO5A 1PT5A 3UNYA 5BV2P 4KXVA 3GJZA 1Q0SA 3W3AH 3ZIAA 4MYHA 4AYWA 1C8LA 2J9FA 3HCXA 5AW2A 3BQMB 1O0BA 1T3ZA 2OA0A 1GNTA 3OPYB 1PZNA 1K8QA 1ZGAA 3L6DA 2ON6A 3AVYA 5AUQA 2G6BA 4GR4A 5EPOA 4CTAA 2HIMA 3JATA 4RVGA 1UPFA 5HQJA 5AXNA 2DQKA 4LFCF 1BQXA 1Y4DE 3KWMA 4XDHA 3UCZP 1MB2A 4BO6A 1WP9A 4GPAA 1IWGA 2QXYA 3ZI7A 2WRMA 3M8RA 2WOOA 4F4AA 2HU7A 3REGA 3URMA 2N7CA 3ICOA 2HNDA 3AZQA 1RQ7A 2MCFA 2ATEA 2Y1XA 1IKVA 1TVEA 3C14C 2H7YA 2R48A 2RRAA 4ETIA 5J2QB 4AN4A 1WZUA 4KGVB 3DXSX 3CCBA 1VC2A 3A9UA 3FCXA 3HLYA 4KFTA 2FOIA 4OQFA 4RV5A 3AEUB 2NUAB 5G1NA 3G0CA 1JT2A 2X6QA 2JZOA 1A9OA 1K5DA 1RTHA 4AFNA 4NNOA 1UR5A 5LZ5A 3BGFA 5K5MA 2AOWA 3H5AA 4LFAF 1GV1A 1U45A 4KC0A 1FX2A 4RKYA 5MGNA 2YQ1A 3TK1A 3AJRA 3U4MA 4FSHA 4PU0A 4NJOA 1JX4A 1C8KA 3AAWB 3FG9A 4TVOA 4MKBA 1ACLA 3GJ8A 1Y9OA 3N05A 4A10A 3RRMA 4D9MA 3OMWA 1NI3A 5U47A 4QTXA 3E3MA 1P80A 1OHHD 2I87A 1FZQA 2DRBA 5HQ3A 5E3AA 2JHGA 2WABA 4C3UA 1UZHA 4HZIA 221PA 1AN9A 2QUHA 4BP3A 2O8EB 1GGEA 4TOIA 4F2SA 4BMPB 1T5TA 1E2DA 4BFCA 4CMIA 3DNMA 3JZMA 2MY7A 4GMDA 2FPPA 1SL0A 1RJFA 1XZGA 2DPXA 4ER3A 5CFQA 1X77A 1VIYA 2GM5A 3BOSA 3BBBA 3OQPA 4ECRA 1XTKA 4JJIA 4W99A 2PGNA 3I3OA 2A6MA 1BC5A 1ZMTA 2YV1A 4LSLA 4DR1J 5DE3A 4I5FA 1C30B 1KAGA 4B3MJ 4M0EA 1K47A 3PRYA 1HEUA 1F12A 2BFAA 3VPHA 2YPZA 4WK3A 3H05A 1E1RA 5K0ZA 3IAS9 2CL5A 5JQWA 1XMQB 4ECSA 5DO9A 3IOYA 1CIPA 3J7AC 2ZTMA 5H82A 2QXTA 2BJWA 1RIFA 1VPDA 4XB6B 4EO8A 1UL3A 3ZHTA 1DAHA 4QGAA 3NWEA 4G5SA 4XKJA 1C7FA 3PC8C 4DDKA 1VIDA 3K5LA 4ENUA 1FKOB 1BE4A 2GQQA 2BDPA 1GL6A 2Q2NA 1C9KA 2KJWA 4ITSA 2JDID 3PWZA 4KKVA 5CFNA 3MI7X 5DO2A 5C24A 3I0NA 1WVMA 4HTIA 5CNMA 5KFIA 3WZ2A 1GGHA 2IYVA 1X4DA 2DBQA 2PQ0A 2WYVA 2Q1XA 1JDBB 1IAVA 2ECOA 1GAWA 1R5BA 4Y9UA 3O75A 3JD0A 3GBVA 4UOHA 4FGUA 5DBGA 4BVAA 3DV0A 4RBTA 4PZYA 3KLOA 1I6KA 3ZJ5A 3DVQX 3FZ2A 2DGQA 4V0NA 2AFRA 4YDQA 4D3XA 4I4CA 4Q3BA 3EHDA 3FI0A 2UZ1A 4HNHA 3UJPA 4LT6A 3U6KA 4BNTA 4YRQA 4HVCA 3ZPXA 4JJ4A 4N8DA 1SOVA 3TEMA 1UWLA 4OX9F 4L5JA 3JQAA 4MCIA 3RHTA 3LUKA 1Q0TA 3D3WB 4ZMRA 2C99A 4RUAA 3EGDB 3GC6A 3I52A 4OYYA 2FZGA 5JXSA 4DL0C 2H2DA 4BGDA 3WGVA 1KY5A 2IW1A 3QGMA 3GNQA 3NXKA 1S8FA 3FCYA 2ZE2A 4F5DA 2MDTA 3F5FA 4LN1A 3RTDA 5KWIA 1NXIA 4ZT6A 3HMQA 1MN9A 3KEMA 2W9BA 1QZ3A 3P9IA 2Q1UA 2XUZA 5IVPA 5M7EA 4YV1A 3PTZA 2G09A 4O4HA 2KBFA 3RC3A 4FI3C 4X8HA 1I3KA 3HHEA 4C29A 3KLBA 1C3LA 4Q15A 3A1DA 2ZS9A 2YWFA 2GHRA 4I50B 2FHSA 4RUCA 3HJUA 3C2PA 4DY4A 3GMSA 1CUAA 2F6RA 3HXLA 2FXIA 3FYDA 2CL7X 5FHRA 1YRAA 1CLUA 1JK9B 3OW2R 1X70A 4DILA 4EK9A 2B1QA 2K7KA 3HA2A 3FHCB 2NCKL 4FYXA 3EAGA 3CJ2A 2VVTA 1QSYA 4A6XA 1UAWA 1UW4A 4QIFA 3SHTA 1NSYA 2DNYA 1GYQA 2PS1A 5G4DA 4M1MA 1PZHA 3E1GA 5DNCA 5HP4A 3JQBC 1FU4A 1VJ1A 5EIOA 1MIOB 1M54A 4EBDA 3QPIA 1RK8A 2HRYA 3KJVA 3NMAA 3VPAA 3CJ0A 4MX8A 2QNIA 3V8EA 1NW7A 3RWOA 4F56A 1CE8B 3NX4A 2B35A 2M8HA 4M83A 1AW0A 2JD2A 4Q7EA 3GEIA 3SZOA 3CE8A 2WG2A 3HM2A 3UFBA 3QUCA 5GGXA 1H2VZ 3OKCA 1ZGJA 4MMOA 5DZ6A 4OTZA 4KO4S 1U2FA 1TK8A 2HJSA 1UBMS 3IV7A 1WB4A 1M2VA 2YKNB 1TLTA 2ZFUA 4G2NA 3T5CA 3ZZOA 4XDDA 1I2ZA 4GMXA 4JI3F 3UV6A 4PICA 4RIIA 1Y3KA 1SFRA 2DPJA 1SXJE 3EZLA 3QTTA 2QTHA 1DBPA 1SQ6A 3POTB 4Y65A 2XMZA 1RRCA 2FKAA 3CRMA 3UD3P 1R66A 3KLEB 4MUEA 2MKCA 2WVFA 2IU3A 2YQZA 3QX8A 4F93B 2Y77A 4USTA 3A7DA 3HCFA 2HKEA 2F67A 5HMWA 3MCTA 4X4VA 3NMRA 4B32A 4RKRA 2YN4A 4BVHA 1OV6A 4BJ5A 3KR2A 4IH7A 2LA4A 2HN9A 5ESRA 4WMLA 4ZJLA 3FKBA 4I56A 3A9CA 2R4QA 2ZXFA 1J2YA 4J2OA 3ZC3A 3M6LA 4GL2A 1M34B 5FL7A 3HGQA 3AIKA 3PGKA 1B7YB 2ONCA 1X9HA 5FLXY 3CLSC 3H4DA 2BBEA 1YCHA 3UA3A 3MMZA 1DTSA 3L09A 3OJSA 3OH8A 3SOPA 5ICMA 4CIYA 4KPUB 1II8B 4MQ4A 3WK4A 1VL8A 2PMDA 3GJ6A 2Z3WA 2O3RA 4DTCA 2CG8A 2PJDA 3BSNA 4ZCTA 1SWWA 3H2VE 1ZRHA 1NQWA 2AKWB 3T5JA 2H1RA 2B8TA 1C7ZA 3GRZA 5KT3A 3BM7A 3SU8A 4YRJA 1RHKA 3DJFA 5KREA 1O5TA 2O8FB 3GRVA 4L57A 2R6HA 4L95C 1U94A 3SNKA 3ETHA 1QV6A 2UKDA 3LTNC 4P80A 4H7DA 2PXAA 1V8PA 5K9ZA 5HRUA 1XHEA 2CK3A 1E61A 2XNDA 5T8KC 1G4AE 3QJYA 1IJEB 3FNQA 2ZW9A 4K6HA 4KWCA 1ZBQA 1RWUA 3QVUA 3K70D 3MJSA 4U7UK 4WVFA 3USCS 3EC1A 4D82A 1S3IA 4P38A 1UPUA 3R3HA 2HQOA 4TMZA 1SWVA 1Z0UA 4OI4A 4UZFA 1QVRA 3A58B 5JD6A 4BXOB 5DOZA 1C9DB 2JJ2D 3CLTC 5FUBA 3VYSB 4DAEA 2DK2A 3T7IA 4UOEA 4HBGA 4JYZA 2OM2A 2EFHB 1GNQA 2ZKIA 1JJAA 5LOVA 3NHAA 3LWZA 5CYQB 3PVZA 2RJNA 2GN8A 3C8ZA 4U6SA 4BE4A 1U0RA 2PL5A 2YHIB 5FUWA 3KALA 2PX6A 4TWRA 1DCKA 3JALB 1UAAA 1QHHA 3P9YA 1V5IB 2VBIA 4BVLA 1WELA 2NYAA 3WJAA 4D45A 4JX8A 5T57A 2CYAA 5KSWB 1P0QA 2YRXA 1E9EA 4WACA 3KNZA 3ADBA 3P2MA 3JRWA 3WYBA 2QE5A 3C24A 3QZUA 1I1GA 4PQGA 3C3XA 4YJ2A 1XWLA 3EDOA 4NLSA 3M05A 3FI9A 1TP7A 1YDFA 4M5HA 1HBMB 3LP0B 5LQJA 2D6FA 1P27B 5ARCA 4NEGA 1FFSB 4JC4A 2IM3A 1YJBA 5DGTA 3R7BA 1FDSA 2I2XB 1TTPB 5BURA 1KDPA 1HI9A 3RS0A 4UTPA 3D5EA 4GOLD 2QMEA 2GGSA 2ZU0C 4FZ3A 2ZJPQ 2OY0A 2ZSKA 1KFSA 3GJTA 4FYIA 4R3UC 1C50A 1N1MA 4HDCA 2VAMA 1EWTA 2YMQA 5JY1A 4V0MA 1L3KA 4UNNA 3CNBA 4RF5A 4QWDA 3GRAA 5ER6A 2RH4A 4Y0FA 2PWAA 1KJQA 3OTQA 2KFZA 2BEUA 4TYYA 2Y27A 4CR6A 3PFBA 2FZEA 3LX6A 4XSHA 1HMPA 3OC6A 2EKQA 1NE7A 4P4SB 3HP7A 4X85A 2Z2XA 2M32A 4D79A 1U6BA 5LVAA 2VTVA 5L39A 3GFOA 4BTLA 1JZTA 2Q3DA 3VKVA 4Q37A 4L8GA 2MJNA 2PPLA 2DGTA 3ETMA 2E85A 3ZD6A 2FOLA 1GP2A 3NYQA 4V0ME 3G02A 3PKMA 1DO8A 3OT9A 1IEXA 3F71A 4DSAA 1Q7LB 3LIPA 2FLNA 4EW6A 4UW2A 3M5WA 5HIIA 1LWEB 4TWZA 4E14A 2ZE5A 2ZQYA 2BE7A 4OI3A 2JF0A 3R5DA 1K5HA 1BJTA 1HDEA 3N0TA 2GM3A 4EPVA 1OFGA 4WZAE 3KYDB 4IF4A 4G56A 1B0UA 3HN7A 4MV3A 4DA8A 1JLFA 2OYRA 1IOVA 1BO6A 3DO6A 1DO2A 5HROA 2GJSA 2JH9A 5ICSA 621PA 1EUCB 1U2GA 1BGVA 2X58A 4FCTA 2I0FA 1MA3A 1JDVA 4F8EA 3QV2A 3BMCA 1RI1A 3WYAA 4PPGA 3UFXB 1E58A 3QYFA 4WTOB 3ZE7A 4GVBA 5A05A 1V1JA 2FF7A 3LPCA 1GUAA 2FRDC 3DONA 3IAXA 2Y67A 1OW3B 2G1JA 4NOHA 3OIVA 4IIXA 1II0A 1XP5A 3BMQB 4LBYA 4D41A 3EUWA 4GQBA 5DYTA 4ZYVA 5LJ5Y 2XLCA 1CZLA 1HV8A 3QLUA 1EGHA 1T02A 3LDHA 4HDRB 4A8OA 5BYAA 1OAKA 4AJNA 1RYZA 4RMGA 4I1TA 4X7BA 4BBZA 2C1XA 4FYWA 5KFPA 1YKFA 1MAUA 4O25A 1MWQA 1IHPA 2BFFA 3JWPA 3M34A 1KPHA 2C7GA 2A0WA 2UZ3A 4CM7A 1R0BA 4ZV9A 3W04A 3QUBA 5J2NA 3IQDB 2IDMA 4B3FX 3QEBZ 1QU2A 4GKAA 3LNCA 4WDQA 4ZOLA 4J8PA 4MZDA 3W6ZA 3CC4S 3A9RA 4NBWA 4FFOA 1WF0A 1XIQA 4P3YA 5M2RA 4HH1A 3BX1A 1V3RA 2A59A 3EMVA 1B7GO 2WD7B 2DY0A 4CF3A 5E9AA 2QMQA 4QWBA 5LWHA 2O54A 3S7TA 1WUIS 5A3QA 1FS4A 4HT7A 5LM3A 2P9ZA 2TMYA 3TI0A 5CB4F 5CTAA 1AB6A 3GDOA 4OLAA 2ZRMA 2OUGA 5LJLA 4RU9A 2FK7A 3N0VA 2HR1A 2JA2A 3AY6A 2Q3PA 1RJDA 2Q27A 3GG0A 2H7CA 4C6HA 2GDZA 2OZLB 1YS7A 1R16A 1NYTA 2HF2A 4FDTA 3IP0A 4Q1FA 3FUVA 4G0YA 3BF7A 1TUIA 5CDUA 1M8PA 1XNQF 1NQUA 4FUQA 2Y93A 4ECYA 2R5NA 4M6WA 3RS3A 2GN6A 2JDIA 3TQFA 4A36A 3N7TA 2CYBA 4EZEA 1K0VA 4OV6A 1XBWA 4UE6A 3ZNPA 3FAKA 2C7BA 3VZRA 4CO3A 4I9FA 2PLFA 4CV0A 4B6PA 1N52B 4F4IA 2GERA 3D1OA 1A9ZA 4WU2A 3E51A 2CLCX 1TKDA 4Z2YA 4ZPXA 2ZUAA 5K09A 1WOPA 3U7HB 2OPPA 4KHRA 5BN4A 1JLBB 6REQB 2JLCA 5E1MA 1A2KC 4WCFC 1TM4E 4E2YA 2AF6A 2G82A 4EI8A 2FFRA 5BUQA 4R2JA 3R9XA 5SICE 1VPVA 4KNWA 9ATCA 1RYRA 1RXOB 4UHFA 3RC2A 5C7PA 4CM9A 4ZMBA 5A1TA 3L77A 3D8RA 5EE5B 5DI9A 4R9SA 1UAGA 3W8NA 4PLGA 2QE6A 2OMKA 2E6UX