1IXKA

Crystal structure analysis of methyltransferase homolog protein from pyrococcus horikoshii
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
305
Chain Sequence
LSPSMLDKLLRLGYSKLFADRYFQLWGERAIRIAEAMEKPLPRCFRVNTLKISVQDLVKRLNKKGFQFKRVPWAKEGFCLTREPFSITSTPEFLTGLIYIQEASSMYPPVALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNVEFDKILLDAPCTGSGTIHRTMDDIKFCQGLQMRLLEKGLEVLKPGGILVYSTCSLEPEENEFVIQWALDNFDVELLPLKYGEPALTNPFGIELSEEIKNARRLYPDVHETSGFFIAKIRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human p120 homologue protein PH1374 from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords Methyltransferase
total genus 103
structure length 305
sequence length 313
ec nomenclature
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F
A PF17125 Methyltr_RsmF_N N-terminal domain of 16S rRNA methyltransferase RsmF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ixkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ixkA02
1ZQ9A 3FTDA 1XDZA 2UYQA 4X61A 1YFLA 1FP2A 1EG2A 3P2IA 1O9GA 1JG3A 3EMBA 3THRA 3HVIA 4GF5A 3KR1A 5EQJB 2PXAA 3PT9A 3LDUA 5FCDA 1XTPA 5GP1A 3OE4A 4A6DA 5FTWA 5DWQA 4C06A 3TLJA 1QYRA 2NXEA 4HRAA 5LQUA 1O54A 4DA4A 2AOUB 4CKBA 3A7EA 2YX1A 2PWYA 3V97A 3IV6A 3BGDA 3MERA 5FHQA 3UJCA 4V0QA 3JWGA 5E2BA 5FUBA 3UJ9A 1BOOA 4CTJA 2AZTA 4AX8A 5CCBA 3DXYA 3EGEA 5DM4A 3ERCA 3M6WA 2IBSA 3FTEA 3KQOA 3PS9A 2KW5A 2ZSUA 3OZTA 1IXKA 5FA5A 5T67A 2ZWVA 2PGXA 2OB2A 2E5WA 3ELDA 3G89A 3F4KA 2LD4A 5K01A 4HTFA 5HIMA 2PX2A 2ZIEA 3FUXA 5LQJA 4OQEA 5KVAA 1NBIA 3LDFA 1ORIA 3HCDA 3E7PA 1QZZA 2OPBA 5LQAA 3FPJA 3IEIA 3GRYA 4QVKA 2ADMA 5EMKA 4E33A 3RW9A 4YMGA 2BH2A 1Z3CA 5CCXA 3KKZA 1XCLA 8MHTA 3THSA 3FRHA 1UIRA 4H0NA 2P40A 2GA9A 2ZVJA 4YV1A 1SVUA 3NJRA 1VP3A 2O07A 3EMDA 2P3OA 1V39A 2EFJA 3OZRA 3KQVA 4C05A 4M38A 4A6EA 3B5IA 3GXOA 3KQWA 4XUDA 5CVVA 1ZKDA 4PYIA 3SX0A 4YUXA 3BT7A 2AN4A 3LKDA 3P9CA 4RSRA 3PTAA 3VC1A 1P1CA 3G8AA 5M5BA 5FWDA 4ISCA 1VL5A 4PINA 4WVLA 3FZGA 5IH3A 1EQAA 3MTEA 3OFKA 5C0OE 1R18A 4JXJA 4RTSA 4QTUB 1EJ6A 2PWPA 3M70A 3T7RA 3HVHA 5FADA 4E70A 1JR4A 3KPVA 2IH4A 1X1CA 2BR4A 4YUWA 1PRYA 3SGLA 2PVCA 2CKDA 1WXXA 4U7TB 2YXEA 4XUEA 1M0EA 2IIPA 4RWZA 2G1PA 1WXWA 1NV8A 3P97A 2YXDA 4EQZA 4R6WA 5EMLA 3FPFA 1G60A 5DM2A 2G70A 4F86A 4DQ0A 3R24A 2ZWAA 2OXTA 3ORHA 3B7PA 2P3QA 1SQGA 2AVDA 3HVKA 3X0DA 1L9KA 4YV2A 3UFBA 1XCJA 3GNLA 3KR0A 4R8SA 2C7QA 1NW7A 3PVCA 4P7FA 4AUKA 1R6AA 2XVMA 4FGZA 3BWMA 5EEGA 2FYTA 1YB2A 4IV0A 5D1HA 1ZGAA 5K0LA 2PT6A 5E1OA 4GOLD 1XXLA 3DH0A 3GO4A 3A4TA 2R6ZA 4PGGA 1RI2A 2XYRA 4LWPA 4YUVA 1FBNA 3HEMA 3B89A 4HG2A 5GM2A 4PYNA 4ATNA 3OU6A 2ESRA 5K0CA 2I62A 4OA5A 3P2EA 4DF3A 1Y8CA 3OPNA 1G8SA 2OBFA 3FRIA 2HR1A 1SUSA 3FPEA 4R8RA 4RX1A 1DL5A 3NVKI 2YTZA 4NECA 2IPXA 4YMHA 3TR6A 3HCEA 2EJTA 4HH4A 2ZBQA 3AJDA 4GQBA 3P9KA 3WSTA 4EK9A 5GIPE 3LECA 3G88A 1YZ3A 1UFKA 4GOMD 2GPYA 3DTNA 4HC4A 4U7PB 5E8RA 5EZQA 2ZFUA 5FULA 2NXCA 4P7JA 4YUZA 5ICGA 3GIWA 2AOTA 5FQNA 1NBHA 5CVUA 4PIPA 5DXJA 3HCFA 3GCZA 4RTOA 3R0QA 4O29A 2NP7A 3SR4A 3FYDA 1UWVA 3S68A 5KS2A 1FJXA 1P1BA 2N47A 1U2ZA 2P41A 5LQNA 2C7RA 2V74B 5CVEA 4KIGA 2Z6UA 2ZZNA 5E9WA 2Q41A 2AOTB 2VZ9A 2CMHA 3GRUA 4EVIA 1KXZA 4QDKA 5EVJA 4POOA 4RVDA 2UZ4A 3EVBA 3PLAE 3MHTA 4KDCA 3I58A 2AOUA 1T43A 1RJFA 3EPPA 5EEHA 3LDGA 3OCJA 1DCTA 2PLWA 1JTFA 3BKWA 3MAGA 3UWPA 2IH2A 3VSEA 5DM0A 3IHTA 3M6UA 4CTKA 1KPIA 2O0LA 3VYWA 2BM9A 2UYOA 3UJ8A 5EMMA 3KQYA 1I9GA 4E30A 2O57A 3P8ZA 4E2WA 1KPHA 1JG1A 1JQDA 2VDVE 2ZBRA 3L8DA 5E2AA 1KIAA 1NW8A 5K0BA 2HMYB 3ELWA 3TFWA 3BXOA 3O7WA 3PFHA 5BW5A 1OR8A 3OFJA 2ZIFA 4OBXA 1BKYA 4CXMA 2FK7A 2YUIA 4PNEA 5K0JA 5DX8A 1G55A 5E1BA 3OZSA 2NXNA 1DUSA 1F38A 4QQKA 3I53A 4C07A 2VS1A 4KIFA 3EEOA 1NW3A 1P91A 2BR5A 4MIKA 4OBWA 3MB5A 1KPGA 3PX3A 3Q87B 3UBTA 5DTMA 5GM1A 4E32A 3JWHA 3GRRA 4M36A 3FYCA 3NVMB 1ZHFA 3AXSA 3DMHA 1X1AA 5H02A 4C03A 1XDUA 1B42A 1IY9A 2ZIGA 1N2XA 10MHA 3I64A 4PGHA 1EIZA 1H1DA 4EKGA 4RTMA 1NE2A 4DZRA 4M37A 5ICCA 5EPEA 3SMQA 3CC8A 2I9KA 2ZW9A 4YV0A 2Z6QA 5K09A 2ZLBA 3EGIA 1BC5A 3IYLW 3P2KA 2PJDA 4BP1A 3NWEA 3UJDA 4PCLA 3OU7A 3SSOA 4YUYA 2C7OA 1AF7A 5FA8A 5E9JA 3M4XA 5HZMA 3MCZA 3FTFA 3BWYA 5LR6A 4MTLA 3AY0A 3R9XB 2XVAA 3EGVA 4HSGA 3I9FA 2AVNA 2JH8A 2BZGA 5FWAA 2P1DA 2WK1A 1NW6A 4ER3A 3HTXA 5B1SA 4BY9E 2ZTHA 2UYCA 5CUQA 5DM1A 3FUTA 1L3BA 4LWOA 3MGGA 3NTVA 4C04A 1TPYA 2GB4A 2QRVA 3DMFA 3DOUA 1RI3A 5MHTA 4RTLA 5F2KA 1L1EA 3FPGA 2CL5A 3P9IA 4EMSA 2HV9A 4AZSA 4IWNA 4R6XA 3JWJA 5ERGB 5DSTA 3JWIA 3LX6A 4R05A 2ZULA 3GRZA 4C08A 4EKIA 2FHPA 1INLA 2PBFA 3A26A 3BGVA 3C3PA 3C6MA 3G2OA 2H1RA 3KQQA 3P9NA 1QAQA 5EHIA 4P58A 3TM5A 3BZBA 1JSZA 3U81A 5JR3A 4RTRA 1QAMA 2AN5A 2NXJA 4MQ4A 3UA4A 5EIFA 3LL7A 2OB1A 4LG1A 3TOSA 4C4AA 3FUWA 2B2CA 5K0NA 2PX8A 5DRTA 5EKXA 1MJFA 3HVJA 4ZTBA 3LBYA 5LQCA 4FS8A 1I1NA 3MTIA 2YVLA 3DLCA 3EVGA 2I7CA 1VPTA 1KP9A 1KHHA 3LGAA 5C1IA 4UOEA 2PY6A 3GRVA 1HNNA 1ZG3A 2ORED 3EVCA 3H2BA 1R74A 2PXCA 3GU3A 3NMUF 1FPQA 2ZCJA 5HILA 1G38A 3OE5A 3KQPA 3M6XA 4OX9Y 1KYZA 1XVAA 4B17A 4BLWA 1RJEA 3FPHA 2GS9A 3NWBA 5JUWA 3AXTA 4Y2HA 3TRKA 5KQRA 1AQJA 3B3JA 1VIDA 2XYQA 3G2PA 1WG8A 4QDJA 5E9QA 4KW7A 2H11A 2PT9A 2QRVB 2UYHA 2IP2A 4PYQA 1X1DA 1JTEA 2P8JA 4RTKA 1ORHA 3GJYA 2NP6A 2YR0A 4PIMA 2FRXA 1MHTA 5K8VA 2XYVA 3DP7A 5T64A 2AOXA 4RYLA 4PWYA 1Q0TA 2GH1A 1D2HA 5DLYA 5EKUA 5T6BA 9MHTA 1NT2A 4QVGA 1HMYA 2PX4A 5CVDA 3SXJA 4XCXA 4PCAA 2B9EA 2ZBPA 2NNWB 2CWWA 2O05A 3D2LA 3KPJA 2YXLA 2PSSA 2NYUA 4QTTB 3BKXA 4BLVA 4Z2YA 4QPPA 4MHTA 1TW3A 1KR5A 3O31A 5EIWA 4OA8A 4KRGA 4PYJA 3UA3A 5EGSA 4AZVA 2BR3A 1N7JA 4L7VA 1X1BA 3LCUA 2V7EA 3ELYA 5HIJA 3TPZA 3HP7A 3G2MA 2OY0A 4GOOD 2Y1WA 3DXXA 3CJRA 3HCCA 2H00A 3G2QA 3A25A 2QY6A 4X1OA 4XUCA 1RI1A 2B3TA 3UJAA 2JHCA 3CJQA 4E31A 3LCCA 4FP9A 4HGZA 3KR9A 4GOND 4PONA 2PXXA 2I6GA 3QOWA 2VDWA 3SSMA 3C3YA 2HWKA 2IDJA 1G6Q1 1VP9A 3KQMA 5D1NA 3UJ6A 2G71A 4PYKA 3SSNA 4E2YA 3KQSA 5GINE 2IH5A 1NW5A 3K0BA 3HA7A 4E2XA 3CKKA 1KYWA 3DLIA 3AWIA 5E1DA 4BP3A 3BWCA 3HM2A 3KR2A 3TMAA 1JQEA 3GDHA 4BLUA 5LQKA 1X19A 2AOVA 3TM4A 2B25A 1PJZA 4X63A 2EX4A 1VE3A 5DXAA 2GLUA 4FSDA 1JG4A 2IFTA 2OKCA 3E05A 3LKZA 1M6EX 5U4XA 1M6YA 1VBFA 2WA2A 3EVEA 3GWZA 3I5UA 5K03A 1RI5A 1JG2A 1NKVA 3HA3A 2JG3A 2YQZA 2GAFA 5ICEA 4Y30A 4AZWA 5KYGA 3CGGA 1D2GA 4RVFA 1N7IA 5EC8A 2ZZKA 3KPYA 3B3FA 2Z6AA 4MWZA 5EMJA 3HA5A 1RJGA 4ER5A 2P3LA 1RI4A 2VP3A 3CCFA 3ER8A 5FQOA 5DTRA 1JQ3A 1R8XA 3G5TA 2PX5A 5CM2Z 2FK8A 1YF3A 3MCTA 4X60A 3PB3A 2R3SA 3NDJA 4FZVA 3SVZA 1P39A 4CKEA 2HTEA 4CWAA 2PV0A 5K0GA 2ERCA 2CMGA 3K6RA 3UZUA 4LECA 1I4WA 4IKPA 2B78A 3TKYA 3NW9A 3T7SA 2C7PA 4ER6A 5KQSA 4G56A 1AV6A 3FTCA 4HGYA 5GWXA 1QANA 5DPMA 2ZZMA 5ICFA 2DPMA 5EHGA 1EJ0A 1IM8A 2JJQA 5E1MA 1JSXA 5HFJA 3TKAA 3VC2A 4GUAA 3CVOA 4FT4A 3G5LA 5CD1A 4DCMA 2IGTA 2P7HA 3KQTA 2PKWA 1NV9A 2QE6A 3DMGA 2OYRA 3HNRA 4GEKA 2AR0A 3UJBA 2G8NA 4ER7A 5DX0A 3A7DA 3R3HA 3RODA 3P71T 3KPUA 1VQ1A 4RTJA 5G02A 3SM3A 5F2OA 4RTPA 2QM3A 3BWBA 1WS6A 4K6MA 4PYOA 5HIKA 2IBTA 1L3CA 3EEYA 1TW2A 3MQ2A 4X41A 4E2ZA 3NDIA 1YFJA 3R6TA 2BM8A 2O06A 3DR5A 3ELUA 2FCAA 1XDSA 4PYMA 3EVZA 3LBFA 5DRYA 2JH9A 5CIYA 3ER9A 3HCAA 3A27A 3OU2A 1QAOA 4F84A 3ID6C 5HIIA 2EG5A 4DCGA 4FSXA 1BHJA 2G72A 4DMGA 5BW4A 3T0IA 4RTQA 5P8WA 5K0EA 4PYLA 4RVGA 3DUWA 4KVZA 1D2CA 5E8JA 3T7TA 4DM3A 5C9ZA 5K05A 2P7IA 1FP1D 1SQFA 3G8BA 3KHKA 2VDUE 5DX1A 2AOWA 4ER0A 3TQSA 1Q0SA 4GBED 4OQDA 5BXYA 1R8YA 1SKMA 3QV2A 4RV9A 3BUSA 5IKMA 3ME5A 2JHPA 2OO3A 4V0RA 3M33A 5DTQA 2AS0A 5EOVA 4F85A 3EVDA 4IV8A 5DSXA 4GC9A 1L3IA 3HCBA 3LCVB 5EZSA 3FUUA 3C6KA 1SG9A 4GC5A 5HEKA 1AQIA 3CBGA 3UJ7A 3LHDA 4QQNA 3FUVA 2K4MA 3O4FA 4AZTA 2DULA 5FHRA 1WY7A 1ZGJA 2A14A 4FT2A 4M7RA 1VLMA 3PX2A 4WXHA 3E23A 3V8VA 3KU1A 1EAMA 1YUBA 2QYOA 1SUIA 2EJUA 3G7UA 5DT2A 5HOQA 3GGDA 5EG5A 4CKCA 2Y1XA 1YZHA 1G8AA 3Q7EA 3EVFA 4QPNA 4RVHA 5GOZA 1O9HA 3BGIA 2WA1A 2IDKA 3E8SA 5CVJA 5K0FA 2AN3A 3DXZA 3DULA 5BP7A 3LPMA 2XBMA 3ANXA 1R00A 4P7GA 3REOA 2ONZA 3CJTA 3EVAA 5LSAA 5GIOE 4FR0A 1WZNA 4HTFB 2ONYA 3KPWA 2P35A 3C0KA 5F2NA 5LQRA 2HNKA 1XJ5A 4KWCA 1F3LA 2JHAA 3LSTA 3PFGA 2OZVA 3M6VA 4P7KA 7MHTA 4DKJA 1RJDA 3QOXA 4KDRA 3RIEA 3B3GA 2F8LA 4RTNA 2FPOA
chains in the Genus database with same CATH superfamily
5GV8A 2KWIA 2J9DA 3ISVA 1M5PC 3PTWA 5JTTA 3ADPA 4CGZA 2VG7A 1Y5MA 4UOCA 1XZCA 4KZKA 2OUKA 3LQ1A 1RJ9A 2PMKA 3C48A 4GX2A 4XCQA 2ZBFA 4P9NA 1U0GA 3AG6A 3I1YA 1IXKA 5IVKA 1L4FA 1J70A 3DGPB 4HYQA 3UHAA 3DHXA 4G5XA 4IG0A 3PWTA 2ZH9A 3T4UA 2F2TA 4BZWA 3T7RA 4Q34A 4BCDA 2QV7A 1E6VA 2NN3C 2YIMA 4MZXA 2IH4A 3W1EA 4J0IA 1YKSA 3M3PA 5AVRA 5J5VA 2HWWA 4NBTA 5ALTA 4N8OA 5KOJB 2PI4A 1IKYA 1PVOA 4LR8A 3BWMA 1PBUA 3GTYX 4D92A 1TFRA 2ZYDA 4CLOB 3AFIA 3HI6A 3RVPA 4E5SA 5GM2A 1N9KA 1I01A 1SIOA 4JJ4A 5LOVB 1SOUA 2H4YB 4OEHA 3A32A 1IAQA 3GP8A 1JBQA 4YS6A 5K3AA 5B6IA 5GIPE 2GEDA 3UCFA 1CUZA 4KIAA 2ZFUA 4RUAA 1IIRA 1TADA 1S2MA 1RTTA 1U80A 1IQ0A 2INGX 4R51A 1NX6A 3AVVA 4JQZA 3W64A 1EGAA 2O7VA 2P4EA 4C3VA 3GUHA 3W2HA 4UUAA 3IAFA 1LI5A 4OHRA 1KOHA 2C07A 5CABA 1RWMA 4A15A 3S1SA 3FB4A 4E30A 3OKPA 4IILA 1AHIA 2X4IA 3QX9A 2YUIA 4WASA 2YWCA 1C14A 4ZO4A 3BH0A 5FLYA 4RM2A 4Y6LA 3SMVA 4Y7DA 3CT4A 4DSIA 2YV3A 5LQSA 1RDRA 1NJ2A 3FGVA 4TYMA 2DWPA 4EG8A 4FW9A 3G1UA 4URGA 1N36B 5F4BA 1SC3A 3E4CA 5A9TA 1L5VA 5JRJA 2P0AA 1O95C 1KH2A 4MJKA 4WSOA 4CFZA 1QDUA 4C4WA 1XROA 2GM5A 1XTQA 1J5OA 3VH3A 4FFSA 4QUKA 2JI6A 1PGZA 4CYUB 1C3JA 2OB1A 4CMCA 4GP7A 1LW0B 2NNLD 2LDXA 2PN1A 2EP7A 4IPTA 3CWZA 3SBXA 2AJCA 1ZWKA 2VAWA 5I9MA 2QSUA 5I7RA 4LK3A 3CJ2A 3DBRA 3B70A 4X0EA 3KKFA 4RVOA 3NBXX 1ECFA 3D5EA 4LXHA 4WY5A 3IS9B 5AI5A 3EX7C 4DGSA 3VA7A 1G7CA 1I4OA 2CYBA 1VXRA 1G5HA 4KE6A 1U6JA 2WTMA 3OL9A 3DBHA 5IYZF 5HIJA 2H2AA 2XO7A 1HDYA 2Q7XA 3KUEA 5EUHA 3BRWA 3EEFA 4C7OB 2LDIA 4Z9YA 5HGXA 3DFKA 3FWKA 2RK6A 3I04M 3NHSA 4HNSA 5BNIA 1IC6A 3WBKA 1J21A 3V32A 2ZTMA 1WM1A 4MRAA 4ZQFA 3UAWA 2WA2A 1ZI9A 1PJTA 1EP3B 3ZU4A 4AK9A 2J6CA 2AKAB 3L0PA 2GF2A 2FPGA 1KDTA 1TR0A 3IXLA 4FGLA 4M5IA 4DLEA 3I2YX 3EEIA 3QATA 1R6DA 1HL6A 3LBAA 4NFHA 3FTNA 3LYAA 3BTOA 1NPPA 4MX8A 1WC3A 1I3CA 4O1IA 2YOHA 3E6AA 3NKVA 4G8BA 1XC9A 2YC2C 3LZ6A 4KX3A 1QHYA 3LLUA 4ZT7A 2B3DA 4EKDA 1R6UA 3CZ9A 1O6GA 3QKWA 5CDGA 3DOIA 4KN6A 2QTZA 3NS5A 4XEHA 3HXLA 1HPLA 1CQXA 5IVDA 3IOEA 4J3FA 3EYWA 3W5IA 5HCNA 1CS4B 3SAJA 3F7NA 5G3YA 4INAA 4KK4A 3Q11A 3WZ2A 5JDIA 1A71A 3HLYA 1YULA 3L3CA 3DE2X 3E27A 3ZS8A 5I7VA 1SH2A 2HRUA 3HXPA 4P7GA 1YNSA 4Z3OA 4S12A 4NI2A 1EVQA 1V6HA 2J3QA 4WBXC 2LCFA 2NGRA 4ROTA 1X7GA 4HYKA 1DNPA 3MCAA 4C6TB 5C7YA 4UULA 3PT9A 2DCLA 2VF7A 2IY8A 1XELA 4D8TA 2QGFB 2JIDA 3A7EA 4NNOA 3ED1A 4B7AA 4F2RA 1X0VA 1Y9AA 2JBAB 1SRRA 3VU3A 4LF8J 1W52X 3ZJVA 2V69A 1F51E 4QYTA 5AE1A 3LDFA 3ZY5A 1R0KA 2Q1YA 4X7BA 3NASA 2RGRA 4ERNA 3OJXA 4R1MA 4LRFA 4DR5F 7YASA 2NTEA 4HVLA 3VAHA 4PPZA 3BSNA 3GXOA 4DV3B 1R3UA 4MSUA 4DMHA 4RWEA 3AR3A 5AVXA 4IIJF 1SJQA 4UU0A 4KPGA 5KFSA 2VSXA 4QTZA 2CFXA 4FYMA 1RBAA 2ILYA 4KYVA 1W5BA 2DNHA 2QSFA 2WAQD 2VSQA 1KEKA 2C97A 2U1AA 5T6MA 2WZ1A 2F3UA 4I55B 3PE3A 1OIVA 4DS4A 4FZRA 4MNTA 1HL7A 3S70A 5KTSA 2W48A 1M75A 3GG0A 1D9AA 1XVLA 3RR8A 3Q89A 4R81A 1RFGE 4GR5A 2I9SA 3UHFA 1QFZA 4HXFB 4ZHQA 3MCOA 4C01A 1U9YA 3QVGB 1QAJA 4RV5A 1WL8A 2WKRA 2HQIA 5DASA 3G71S 5KFAA 2BL4A 4CR7A 1OI2A 2Q9CA 4UCFA 5T8KA 5E8RA 2X6RA 3DFEA 2RHLA 1W7AA 2WD9A 2YHIB 4EI2A 1VFJA 2AKYA 2B4VA 1L7DA 1CEEA 1RT2B 4YI5A 1LVHA 3AC0A 1EFLA 1LI7A 4KHPF 3AVQA 2XYHB 5F0UA 2P0YA 4UTRA 5J2TB 2BR5A 1REVB 2JAHA 2CFOA 1HI0P 1SJ3P 1UQRA 2CL7X 3OLWA 4S04A 1ZRNA 3UBMA 1F1BA 1T8TA 4EKGA 4K26A 5BUSA 4MKVA 4TWIA 2HBQA 3RUDA 2R3VA 1OFUX 5D78A 1BXNA 1UP4A 3KEOA 4A91A 2WHQA 3ENWA 2D1FA 3LQVA 5KAPA 4HSGA 2CDBA 3ER6A 4CZCA 3H2HA 2XMTA 1NVXQ 4WNAA 1USKA 5F1OA 2QWXA 4NDZA 1J1UA 3THXB 1FB5A 5DSTA 3LVQE 2XRMA 1JNZB 4JLVA 2QRKA 1ZN7A 1MLDA 1E2NA 2AYGA 5TGZA 4NE9C 1QONA 1VI2A 2PX8A 1HO3A 3HVJA 2IE0A 4OG2A 1QIFA 4ZZ1A 1FZTA 3C1OA 1I0IA 2WV9A 5AMXA 1Y3KA 3OTOF 3IEXA 3NYWA 3DDSA 4JT9A 3A8JA 5FX2A 3MWJA 2O2IA 3GCXA 3IIEA 2X58A 4IHJF 1D09B 3HP6A 2PKRA 4V0SA 1JLEA 5HI7A 2QA4S 3L6CA 3CUUA 2DPGA 3QE4A 1OB5A 4DT1A 1L5GB 3S8EA 1HM5A 4PGMA 2DQYA 1VOMA 3W6NA 4RANA 4U7JA 3D1LA 1DJMA 3A1VA 5JVGQ 4ESHA 1MC4A 3LCCA 1TCCA 1Y3BE 4IKEA 2VDWA 1CJKB 2AX0A 4XWAA 2QSWA 3CNQS 3II6X 5F3DA 1O08A 4LSGA 3L7UA 4MV7A 2X0FA 2V3WA 4NI5A 3EIHA 3X2FA 2XUOA 3OZIA 1ZD1A 2OV1A 3Q3GE 3GCXP 2VG5A 5BW6B 5HE8A 4PC7A 1M33A 5JTUA 3W8FA 1TM4E 4LHSA 4EYOA 4GC6A 5ISMA 4Q9DA 3F6SA 2UV8A 5BSMA 2HHAA 3QVXA 1KXJA 3KC2A 5E3JA 1RLOA 4E3WA 4FPIA 5L3SB 3CMES 1YZ6A 5NULA 1P6XA 4WZQA 2HQCA 1NSTA 5A62A 4KSEB 1J2VA 3ZVMA 2B7BB 3QBVA 4CIXA 1RKJA 2BPOA 3CTRA 2DPLA 4ND8B 1Y7TA 4ONEA 1T6BY 2DPIA 1OFGA 3EGZA 2DJWA 1VJDA 1PQUA 3WLEA 3RB0A 3U4HA 2WB2A 2JEZA 1IZ0A 2VNKA 4NZ9A 5IBPA 1HEYA 1SHJA 2AS0A 4NH4A 4KMOA 5BSWA 4V0ME 2QT7A 1TKTA 1TV6B 4D4MA 1CJTB 1OT3A 2DLCX 1GL9B 1H2EA 2X9GA 2YZ2A 3HB4X 1G4UR 2YKMA 2RGDA 2NQ2C 3B6MA 3EFBA 2A10A 3JRXA 3SI8A 2YS7A 2IDLA 3CKMA 4EARA 4KVFA 4JJAA 2XTJP 5J1TB 1PN3A 1HMPA 3VVTA 2ZBGA 3INNA 4LRAA 1GZDA 2W9CB 2ALYB 4ODIA 3AP1A 2G1HA 4P8RA 1BCSB 3HBJA 2G5GX 4G0UA 4Y3UA 1H0KA 3F5DA 3NTLA 3V4RA 5GPBA 4K3VA 2QL7B 1C9JA 3PVSA 2ZCVA 2Y1LB 3IR6B 3R2DJ 3E0XA 1XMQF 1PZHA 3IBSA 1IWPB 1YZ7A 1KZ7B 3JWGA 1K8QA 1QTIA 4CTJA 2V4QA 4OUKX 1FDAA 5KOIA 3PFOA 2VBXA 2X1BA 3QT6A 1PJ3A 3NBYC 3A4YA 2VPZA 2FJWA 1IB0A 4H6VA 4E33A 3HZEA 5JJLA 4Q15A 2C2ZA 4XVQA 2E37A 4CG3A 4CUKA 2K6GA 2PUDA 1U94A 4BQSA 4L02A 3T3GA 1RHMA 4OYOA 2MJNA 2Z2ZA 1I33A 4ZYUA 2JAOA 3MRVA 1QGUB 2NUAB 2PRJA 1WHSA 4AY6A 5DM70 3HCNA 4QUBA 4MGIR 4CIBA 1C1DB 4KXVA 5AXAA 1C3VA 2J3JA 4B48A 2J7WA 1A2QA 1J33A 1L6IA 4PWDB 2M8DB 1SK8A 1AH2A 3BGRB 2OAEA 3FCAA 1DZIA 1V5WA 1Y1KE 2AOTA 1SHZA 3TL3A 2WF9A 1EFHA 1YLXA 2JA2A 4URQU 3FEZA 1ZMRA 1V5IB 4B6SA 2HSEA 5H3HA 4U7FA 3IE2A 3MBIA 2DHCA 2HFSA 1T9YA 3AYXB 3A4LA 2I7VA 2ZP1A 2IF2A 2IKQA 1JVBA 5TPZA 4JI1J 4E4TA 3Q5GA 3GZ4A 1C30B 4Z7YA 3U4AA 2V8OA 3L0OA 3Q22A 3L7CA 4EBCA 3JWHA 3EZUA 3E22B 3WNQA 3BE5A 2GMWA 2KM8B 5F78A 2C2OB 4YP3A 1WSVA 1COZA 1JHMA 1IL0A 3D3CJ 2CPIA 1D3AA 3SQGA 5FBWB 2C2MA 5FTJA 1S3FA 4LJ6A 4RFSB 2IZ0A 4Q1BA 1IUPA 3NTVA 4J9OA 4MWOA 1Y11A 4O63O 3CN7A 1Y6GA 2VPTA 4CW7A 3V6MA 1VB5A 3WE7A 2RFLA 4RTRA 3K30A 1N5RA 1DFIA 1UKAA 1CEYA 1FDTA 1WZ2A 1CUBA 2PZKA 3DAYA 4ZVSA 4QSHA 4DL6A 2WD7A 2H51A 3AXTA 3EIEA 5JE8A 1Q82T 1HTWA 4F4WA 4QDJA 3ZHUA 3GYXB 3AWDA 1PSDA 2VJPA 1G1MA 2AG8A 1NKSA 1J8DA 2OHXA 3IP7A 4PWYA 2E82A 2B30A 1EFTA 3O26A 5M2RA 2VKQA 2ASDA 2PK3A 3LXXA 4IS2A 3PYEA 4FCVA 4LQ3A 4B1FA 1JG6A 4R1PA 5JLAA 2DWQA 1AUOA 2CWDA 5LLSA 3NWGA 4DXLA 2XSFA 3QOWA 1YI2S 2NMVA 1SBHA 3M8WA 4ED7A 2C2XA 4EHJA 5LQDA 4C4ZA 4B3HA 2OFXA 2JBWA 3NBQA 3JSAA 1VQ7S 4NL4H 3GRPA 3C2PA 5AJ3J 1PAEX 1SXJC 3PP8A 4Y30A 4F0MA 1T3ZA 2XECA 3A6JA 2F67A 2ZSDA 3M83A 4V38A 4Y2QA 1LWOA 1R8XA 3KSDO 3PNVA 4MLZA 5A7GA 4F2WA 3I09A 5K8JB 2XZTA 1IQPA 5D3KA 3UMJA 1DV1A 3P5BA 2XGJA 2GXAA 5L1IA 3F6EX 3RCBA 3LYHA 3TOXA 2AR0A 3W5AA 2HVEA 5LZ7A 3MQ2A 2OPPB 4E2ZA 3BWVA 2VDPB 4CF4A 1CSEE 2CLCX 4AD8A 2CMKA 4G0WA 1KDZA 1QYCA 3HHKA 1JU4A 1OTHA 1QBGA 4F4IA 1XOIA 5D3QA 3LAKA 2OP1A 1DMRA 3QV2A 4V0RA 2AXNA 5JD3A 4WADA 1IBMF 5A4IS 5CB8A 3QLHA 1TF7A 4MUHA 2JH3A 1RKBA 2M2BA 5CD9A 4BC9A 3Q85A 4UQTA 3O8OA 3RLIA 4Q9HA 1T9KA 1CR1A 1WTCA 1VMEA 3AR2A 3UOAB 4ECAA 5CQGA 1V71A 3GFGA 1WVIA 3O83A 4BMNA 1N2ZA 2XXAB 4IF4A 5CCLA 3QJJA 2BRUC 1VJ1A 3NEJA 2C4KA 4OOEA 3BICA 1RYMA 4MIAA 2C8JA 1Q78A 1QWSA 4GRAA 3NBMA 4XLTA 4A8TA 3V48A 4KRYA 3L8MA 3MPYA 4BWGA 4WN9A 1RPZA 1V3ZA 3FVTA 1L1FA 3WGTA 4JOSA 5G1OA 1XNRF 1N2CB 3BYRA 2NADA 4DLYA 4NC9A 2I0FA 3MS2A 1UKBA 3CCCA 3GARA 5JH7A 1Z33A 4M8SA 2E5WA 3HLTA 1T26A 2VICA 4Y8VA 4MVJG 3WFIA 3R8FA 4KKOB 3AUYA 1XCLA 2V7QD 1RBOB 1VCOA 4PZAA 2GA9A 2YKGA 2L69A 3LCJA 3BGUA 1Z5VA 5E7IA 3R0VA 5JMPA 4JI7J 2RKIA 3PHTA 2HLDD 3MTEA 3STTA 1RZ3A 3ONDA 4AUNA 4ZPDA 4FILA 4RJVA 4H7EA 2YJ4A 4GOJA 4QXPA 4ZVHA 3WX0A 1TA0A 2UXCJ 2GK6A 1YHYA 2F9LA 4GZMA 1K0FA 4WK1A 1QYXA 5D6OA 1BCRA 1Q20A 4B7UA 1THGA 5JJKA 5I51A 2W8KA 2HIYA 1KVKA 5F1PA 3U26A 5E1OA 3RC9A 3HVUA 4CMAA 1J5EJ 4Q0BB 3NP7A 1WKLA 4OP3A 2QJ3A 2AG6A 4R8RA 4F3NA 4C5BA 1IBMB 1ATIA 1BE0A 2V6JA 3VTFA 3RC7A 1GSOA 3A9TA 3FDJA 3CVYA 2ID7A 4F4DA 4L9RA 4RNOA 3R7WA 5DEIA 5J2NA 1ORDA 1YBHA 4CL2A 4KMMA 4Q2MA 3LDGA 2G4BA 4REMA 1K5DA 1XZPA 4KQMA 4RIGA 3UHPA 5KTPA 2P5YA 5E2AA 4PV7A 3RIMA 1HNVA 4DV5B 1Y6QA 1MSWD 4AFFA 2HWTA 4RW6A 3ZE8A 1SD1A 1S9EB 1GFSA 4HVTA 2PJRA 4MS3B 1A7KA 4ZCQA 2AJFE 3NOOA 1G0NA 1WDTA 4MAFA 2AV5A 2FC9A 3OQBA 2P0EA 4PAAA 6FD1A 5JCXA 1BTOA 1XZFA 2SHKA 5K09A 3MEDB 1FVFA 4V39A 3GSIA 3IUBA 3NGSA 3FBEA 1MFZA 2D8MA 3K7RA 1YTLA 1Z0IA 1PHPA 4KQHA 2TMKA 2CD9A 2UYCA 3E1SA 4X7RA 1KZ1A 2GASA 5A71A 5LM7E 1DQZA 3KKQA 3PXAA 4DIKA 3MUFA 2FHPA 2QIOA 3T1VA 3CCMS 4W5JA 3DHNA 1I94F 4F36A 4UT4A 1EM8A 2Q5FA 1LLFA 3H59A 1E0AA 2KM1A 2QYCA 1CNFA 4QOHA 4HNTA 2R2AA 2P6RA 4Q9KA 3SBEA 4AY4A 4EG6A 2WT9A 1QM9A 4JXKA 1HHSA 2PV7A 5H7XA 4JLSA 1XAJA 1I13A 3RADC 3TUPA 5CVDA 2ZJ8A 1QIMA 5HKLA 4X62J 4H0CA 3LQRA 1JEDA 1ZU4A 1NTRA 5TEWA 1GNKA 4BLOA 1R50A 4C2AA 4LF5B 1R4NB 4PPYA 2JIPA 3SOZA 1ADCA 1JFSA 3RAEC 4TMWA 1T9ZA 1H2VZ 1PVVA 4X20B 2QX0A 2E7ZA 1Y1TA 5D2CA 1J0AA 3HDHA 2ASEA 2JDJA 2QYTA 1C30A 1TKAA 1U98A 1OBFO 2MKHA 3BF4A 3V4ZA 4E5DA 1P1JA 4Z53A 2B83A 2ZUVA 5DTRA 1JDJA 4CO0A 5C7LO 4COOA 3G6KA 4J6EA 4E5PA 2PZEA 3PUZA 3C14A 5F73A 3VR1A 3TKAA 2BFFA 1NV9A 3LALA 2FY1A 4DSKA 1RGVA 3AR8A 3MM6B 3H2LA 3EHEA 4MR9B 4K8RB 4TMYA 4U9HS 4RR5A 5K6AA 3AB8A 3NAMA 3CZRA 2MLZA 3W5DA 4MCAA 2OD9A 1R8YA 3BR9A 3ME5A 4JKIA 1GR0A 5KTKA 3E5HA 1W30A 5FYQA 5J2UA 4G4GA 1QFYA 1E8NA 4ZJQA 3ZZNA 1XGKA 1VCTA 3ZE9A 3DO6A 2YY3A 4F93B 5EG5A 5C42B 2H3EB 1WI8A 4ML3A 2RD2A 2LCQA 1ADGA 4O4GB 1GFIA 3HYCA 5K3FA 4BLPA 3GJRB 3VYSB 1FHTA 3W8PA 2B8TA 3CIMA 2C0QA 5A6SA 3QWPA 1F3LA 4F11A 4F3KA 2BA9A 1IU9A 3STHA 3GMGA 2AGPA 1DG1G 5E3QA 1EE9A 5HG0A 1VQ6S 4K0RA 3AVOA 1Q7RA 3ROQA 2JLUA 2ZYAA 5IVIA 2J87A 2GJFA 1LW2A 4DV1F 2X2FA 3DLJA 4QOEA 1QYRA 1NH7A 5L46A 1RT9A 5DZ6A 3KVVA 3M7IA 1EDEA 1XLUA 5KT2A 1GL3A 1SVWA 4ES2A 3LT0A 1OYOA 1CQJA 2LV8A 4PXCA 4LV6A 1XQXA 4HKQA 4F8EA 2E5JA 4DMFA 1DIBA 1V26A 3RW9A 2ECOA 4ZK2A 1HOTA 1TUIA 4H0NA 2B34A 2FZGA 4UNRA 1SCJB 3M82A 4PYIA 1N6PA 4RU2A 3QI7A 1E6CA 3MPUB 4RTSA 1PYGA 4Y2PA 1DTTA 2JDID 2R1VB 3UATA 1V4VA 1VSTA 3NOCA 2O5RA 1GAJA 1XVIA 2V7QA 5IOLA 2G1UA 3FMBA 4IQ4A 4IQ8A 2HJVA 2WJPA 3BDIA 5IJ0B 3MMNA 2CJXB 3DVSX 2YWEA 4YJ2A 3A4TA 3F0TA 5E3AA 2IXDA 3S44A 2D0IA 2RF2A 5DCUA 5J63A 2P79A 1T4CA 1ZUNB 1NRJB 5CBPA 5KB3A 4RZXA 3DGEC 2ASYA 1U6KA 4EZBA 3MOZA 4AJHA 3TVYA 1S1WB 2EKDA 4CQLA 1XL1A 2HIMA 1GLNA 4B73A 2IVFA 1OBVA 4OXKA 4ZT3A 3WK7A 2J9ZB 4I8XA 2RHQB 2CN1A 2HQBA 1DARA 1NUQA 2E9ZA 3CRVA 5BR1A 3X3UA 4ARZB 2MSWA 3TJMA 3ZTTA 3UWSA 3B8HA 5F2EA 1I4LD 4L0DA 1T3NA 2QW8A 1NR7A 2V98A 1H2AS 4TVAB 1QD1A 1RBLA 3D1JA 4E4YA 4ZN6A 1O95A 3V8NA 5BV2P 2ZBIA 3N2KA 1J39A 2C8VA 2L18A 2FJEB 2HKIA 3RW6A 4CF5A 2BXJA 5ARDA 1JFVA 2H1YA 3U4QB 4LWOA 4QQ8A 4G09A 4XXHA 1LX6A 4YRIA 5JCOA 4DMRA 2XE4A 4DLGA 3RYFB 5T14A 5FV4A 4JBXA 4EJ0A 4QWAA 2C9YA 4BCCA 1MX3A 2I7CA 1HK7A 2I2AA 1HZZA 5L39A 4JR0A 2EKPA 5GONB 1C3OB 3PI7A 2BFEA 1GXUA 2ZM6J 3MN1A 4L27A 1A50B 4GX0A 4US1R 1ZHOA 4NU0A 4BRZA 4PIMA 2EKYA 2EK1A 3F7OA 5B0GA 2FZCA 3AERB 4Y2MA 1IDOA 2PX4A 3NAQA 9ATCB 4ANCA 1HETA 1Z2EA 5E6UA 3OZVA 1O0PA 4Z49A 2Q1WA 3U4MA 4DQKA 5CGQB 1X9HA 3C4QA 2KT5A 5GINE 3E9CA 3US5A 2WWHA 3ZK7A 1SVDA 5EJ6A 2C3OA 4DCJB 2VJBA 3C3XA 4DSLA 1ZRMA 3OQPA 4Y65A 1PFKA 3LZCA 3ZHVA 2J8SA 1NBMA 3H5RA 4K0KF 4EA8A 3V5NA 2HCTA 1MMLA 3HBLA 2Y4NA 1MQ8B 3BJEA 2NU7B 3KSBC 4G1UC 3JYTB 3CSUA 3TS1A 1LJLA 5FR2A 4DMUB 1ZM2A 4LJMA 4I2VA 4BS9A 2X9VA 4WXMA 4E7PA 2JH9A 4FBLA 4OQNA 1LV7A 1WX1A 3ZYZA 1MB9A 4EA6A 3DCAA 3AGPA 2N7CA 4LF7J 3IRUA 5G4KB 2A5YB 1NQ5A 2PHZA 3CLUC 1YJBA 2YRXA 3O9VA 3L43A 4P0QB 3IUJA 2QORA 5EE0A 4DLRA 1UKVY 4I68A 1QDLB 5M04A 5AI0A 2O2JA 1A3CA 5CNKA 2X9QA 2Y1XA 3H25A 1HDCA 5B3JC 3ET4A 2MQPA 3IG1A 1RAAA 2VDRB 2DT8A 3ANXA 3D0RA 2ONZA 3EPIA 1OAAA 1WIWA 1PGJA 5JS7A 4AY5A 4ZP6A 1XMSA 3GEPA 3SZLA 1E1NA 2UYQA 3VH4A 1J22A 1EKRA 5IXYA 5ALEA 1SKRA 5B4VA 1KAOA 4JLKA 1A4RA 3CXRA 2AOUB 1SC6A 5EI5A 4ENOA 2V65A 3CJ5A 3D7RA 5CCBA 4DV4F 1CIPA 5CNJA 5HKOA 2OPPA 1AQUA 1KJYA 1JLLA 3R6WA 1YZLA 3E7PA 5KFIA 3FPJA 4HWKA 1ZETA 1XJWA 3CO9A 3GMDA 2WDZA 1I10A 1LLCA 1SCKA 1TK0A 2YKNB 3M8QA 1JYFA 1P1CA 3G8AA 1Z0UA 2F3TA 1Q1NA 3MJDA 3WR5A 2WR8A 1OWLA 1E58A 1X0FA 3IFEA 2JK1A 4RWZA 2CJXA 4LJLA 1TTHB 1A69A 4CV2A 4QZVB 1JLCA 3QFHA 2OSBA 5BOSA 3DDUA 4M49A 5C5CA 1Y5NA 2RONA 3T7IA 4LWPA 4FE4A 1X1RA 2ENUA 1NJGA 3S5UA 4YJGB 1HNZF 1UXOA 1HT0A 3C5WP 3SQOA 2X0DA 4N0DA 1KFSA 3UWDA 1BQ3A 3B12A 3WQHA 1H2BA 1RKXA 2EFEB 5HVGA 4QBKA 4R0EA 1UKYA 1UW9A 3NNDA 3CR3C 4RHYA 1T2FA 1OMOA 2QMUA 2W4IA 5KSPA 3UE2A 1TXGA 4XTTA 3SSRA 3DA8A 4J3NA 4LBWA 3FWPA 2BJ1A 3MM5B 3UHOA 2B8QA 2YNMA 1Q8LA 2RGNC 1J5PA 1WJ9A 3GJ3A 4FUQA 3WB9A 4KQJA 3PX3A 4DUPA 1FFEA 3GZJA 2DC1A 3WOVA 3NVMB 2P2SA 5BQPA 1FTCA 3ANLA 3VV2A 4I1YA 2VCHA 3OEEA 2VQEB 4U2DA 3QFWA 3DKIA 2KXNB 1VHQA 5KPJA 2RGYA 2HADA 3BB4A 5I9NA 1QX3A 4DDHA 2EBEA 3JXOA 5JSKA 3PEEA 5ETKA 3NPMA 3SFTA 4MROA 2DY9A 4UATA 3H42A 2ONJA 3OXFA 4LFAF 2Q49A 4Y2IA 3EAFA 4ID5B 3NVDA 2XEXA 5CBPB 3GJ4A 6Q21A 4L74A 1NU6A 2DVIA 4MK8A 2B43A 3IS9A 1T4BA 3IJPA 2HJSA 4KQ1A 4ZEOA 4X6UA 3H6HA 2BGRA 1A8IA 3M1IA 4M99A 1X15A 1ZC4A 2XMWA 4I9HA 2HSEB 3ROZA 3ABZA 5FLXU 4K81B 4YB8A 1EVIA 3PPYA 1HBUB 4YONB 4BASA 3J80A 1W1IA 3WGOA 4BNNA 2HMAA 2Q1UA 4LOLA 4OA8A 1IKXA 1ZLYA 5A9SB 4CLKA 2QZJA 1QQAA 1U4NA 3HSZA 5M2PA 3H2UB 3DZBA 3PFKA 2N75A 3BM5A 3HD1A 3F3SA 1SV5B 3G23A 4ILRA 3UIEA 3TDKA 3AI2A 5D3MA 4AYBD 2VYVD 1ZMOA 1XP5A 1FP7A 1L5LA 1L5OA 1CRZA 1FJGB 2HFZA 2J5AA 1QGUA 1WOOA 2VUSA 4CO2A 3K2EA 5EC8A 3W6UA 3ZKWA 4KQIA 3ER8A 1BHSA 2FK8A 1M6VB 1SZJG 4TN5A 1RTDA 4DS5A 3TSAA 3WKBA 4IUFA 1Z5NA 1IOWA 3OIGA 2V8GA 4LSLB 3BFPA 2VWGA 1UTAA 1G1XA 1RE1B 5EJ5A 4AL4A 3IHKA 5A6VA 5I9SA 4M60A 4UUNA 4WK4B 3HCAA 3EXEB 2AYYA 4V02A 1X8XA 1GPLA 1QGZA 3EZNA 2H4HA 3TJAA 2ORIA 1T5HX 4I64A 4PRKA 3V2HA 1B8UA 3KAKA 3SN6A 3MOIA 1TZMA 3KLEA 3LQYA 1KO8A 2Y3IA 3GB9A 3MBKA 1ZJYA 4KXQA 5B2EA 3L8GA 2WJVA 4P81A 4L5JA 1S0UA 3GI1A 4UQOA 2WFZA 4CLYA 4HQ6A 2O8NA 4OL0A 2V67A 2O9JA 4PSUA 1TK8A 3GGCA 3R20A 2V1XA 4ZP8A 1NLZA 1TTQB 3RARA 2DEIA 1NFFA 3PITA 1SV5A 3R0XA 2OZKA 4N3NA 1GYRA 3MTGA 3N2GA 1L1QA 2CLMB 3TO8A 2F7SA 2E18A 2HAIA 4DMLA 4X64F 1BOOA 5BMOA 4NBLA 3O4RA 4NJMB 2ZB8A 4KV9A 2P75A 2AMJA 2UVDA 4FBMA 3RVNA 2BKVA 2ASVA 2BDUA 1V41E 3KKZA 3QFCA 4DQSA 2PPLA 5EHHA 3D64A 3VHRA 4GO5X 4H7JA 5CJJA 1JXVA 3MT0A 2WJJA 3K0FA 4XB6B 1ZISA 4J1TC 1P0MA 3VZQA 1PJSA 3K71B 5G0RA 2X0EA 3RFXA 1PX2A 1UBEA 2VHEA 1E0JA 1XMQJ 1TJPB 4BNDB 2WNHA 4KR2A 2DEJA 5BMVF 1E1QA 5A8WA 2Z2JA 3ZTYA 1K88A 1HPZA 1SOVA 1UWKA 1H4VB 2BOVA 3FYUC 4HEHA 1Z28A 2W0SA 2D0OB 1Y8CA 1SCDA 1PWZA 1VJ5A 1RE1A 3EBLA 1R4ZA 4CLHA 2DYKA 5HMMA 1WC4A 1X80B 3X2EA 4LRSB 4F38A 3GJ8A 2HLTA 1U09A 4FQ5A 1LZLA 1AUSL 2FFHA 2REBA 2OPRB 1I1HA 1P6TA 1ZZGA 4FXVA 4D4KA 3UWPA 2PL9A 1WJGA 4WFZA 4MGEA 1GM5A 1JEQA 4UM7A 1WMFA 4U00A 3G8SA 3H2SA 1DZ3A 4HQ0A 1Z4NA 5J4KA 3L07A 4I9UA 1T35A 4GMGA 2W2VA 4JJKA 4JUFA 3PD7A 4FVMA 1WXIA 3IDSA 1N9ZA 5K20B 3D3KA 3J7Z5 3GRCA 4M36A 3FYCA 1U7OA 2D1QA 2WCXA 3B3QA 1KVUA 1FYVA 4B9AA 4Z9FA 4KHPJ 1XLWA 4FF1A 2ZR0A 2H5JB 4UTXA 3MC1A 2F4VJ 2WUEA 4RLSA 5EHXA 2XJ9A 3AF1A 1BOFA 1X60A 2KI2A 2BELA 1CUHA 1DY3A 1OGYA 4YQFA 3AOBA 3OC6A 3L8CA 5DI3A 4GH5A 4FNHA 3M2VB 3OJUA 3WP0A 4NCIA 3DOFA 3FLEA 4Q3DA 5AK4A 2ZU6A 5DP1A 4RMJA 2FV8A 1GRCA 5TNXA 3MQFA 4EENA 1RHJA 2DFKB 1YRWA 5D7BA 3HBAA 3ICQB 3A14A 5D4PA 2CCJA 4OQYA 5MF6A 3MGBA 1R74A 2JEJA 2OHFA 2Q0SA 4RMIA 1RWUA 1KLNA 4CLDA 3RGWS 5LBUA 1NU4A 2XYQA 3FCVA 4KPCA 4IUYA 3ROMA 4F4HA 3B9BA 5JYCA 2JGAA 4ELUA 5D3ZA 4LFBJ 2ZAGA 3RT9A 4B87A 3DM2B 3WLAA 4UAGA 1X9IA 4RSGA 4J9NA 1NLFA 4M46A 2C3UA 3DXXA 1G3UA 3N6NA 1LQTA 5C5EA 1SKUB 3QJPA 4F12A 3IJEB 1NJ5A 2IC3A 3C3DA 3ZDXB 5JSQA 2XVXA 5CYPA 4C43A 2WM3A 1N2SA 3UT5A 2CXPA 1JG4A 2IFTA 4Z4CA 1UFRA 3D4JA 1TCVA 1RQ7A 4DFMA 4IQMA 1G3QA 3U6BA 2BDPA 5CM2Z 4YXWD 4YR3A 3BXGA 3UPFA 3C3AA 3PW5A 4KGDA 2QM0A 3H1EA 3L8EA 2G9ZA 5AM4A 5C35A 3EZYA 2VAVA 1J9GA 4ZT4A 5CXTA 4C2BA 2OCKA 2ATCA 3OIDA 3CO5A 3ABSB 3CU5A 3H9EO 4IH6A 2FSIA 3IXMA 4ZGBA 3F2IA 3EVZA 3E01B 1A8QA 4M9SA 1Q12A 2PGNA 3BF8A 2VHQA 3FSRA 1NYQA 4MKFA 2C4NA 4N3CA 1XLTC 3SR3A 1W46A 3CCLS 2VPIA 3GDOA 2Y66A 4BEVA 2VKTA 1T9TA 1LDEA 4RH0A 2B7CB 3MR2A 4C4OA 3MEDA 3QXSA 4GYJA 4B43A 1HE4A 5E6SB 1R00A 4X91A 5I42A 4JLMA 2DKFA 2EC2A 4KWCA 3GYBA 4G0NA 4ICLA 3PC3A 1QSSA 1SXGA 2OLJA 1S96A 1KK1A 2GJAA 4LRBA 3CONA 4ZKDA 2DITA 2WB4A 1RIIA 4CO5A 2BCJQ 5H16A 1JQLB 1D07A 4GP9A 3H5YA 1EK0A 3CZPA 3OPQA 5FBLB 1XIQA 2JVKA 4WYLA 4JB8A 3FEYB 2XNHA 3SHTA 1CR2A 3C3MA 4KQKA 3Q7PA 1GFZA 3WGUA 2I2CA 3RGIA 1A7JA 5BSUA 2P2CA 4KYZA 1RMQA 4PZUA 4OQLA 1QB7A 3OSNA 2UXDJ 3DRSB 3UR3C 5KNLA 4E6PA 2AN4A 4JYAJ 1OX6A 2CZQA 3DZCA 1CEXA 2NO4A 4DDFA 2A3JA 3SE7A 4YUWA 1A4IA 2YXEA 1OY1A 4A82A 2IL1A 1RYNA 3GXBA 1MB2A 3QENA 3R5GA 3MWEB 4AD6A 4IDBA 1DJQA 1O5OA 1UFWA 4C3MA 2DBZA 4Y98A 3UUEA 1ZA2A 4GOLD 3OFVA 1VPWA 4UY8T 4ZMSA 2GJIA 4CUJA 1B0AA 1RWWA 3WO1A 4YRCA 4MA0A 4OBBA 4E51A 1NJ8A 3I5AA 3VSAA 1R5BA 2FW6A 5KFGA 5KEIA 2N47A 5LM3A 2ZZNA 3V3TA 2UZ4A 1M8JA 4WI1A 3MAHA 3AUFA 4CKZA 1KJWA 3UC5A 1T43A 2NR0A 1Q14A 4P35A 4CCYA 1UP1A 2KQUA 5E3PA 1JL3A 2CY0A 3I4CA 4H4KC 4LF6F 3TFWA 3P4YA 3PUWA 3RUAA 4R2HA 1G5RA 3KJEA 5ANRB 2ZKLA 3PJDA 5ES4B 3I53A 3C6UA 3EEOA 5E95A 3CF4G 3ZW8A 3BTSA 4EHAA 2XY5A 2WVDA 4R0NA 1DBIA 2C4UA 1YUMA 4P80A 4ZD6A 5J40A 2QVYX 3W5YA 3TB4A 5K3BA 1T1RA 1QG2A 2XV1A 4GVPA 4E07A 3IQFA 1DQ8A 3S6EA 1UDRA 2YZ7A 2I76A 1EVZA 3O8QA 4ESOA 4QYWA 4EG7A 1NLUA 4CT8A 4LNUB 3IOMA 2VF8A 4RENA 3ZV7A 3PYGA 5KOXA 4I99A 1WDKA 3A6ZA 4XVCA 4NCBA 1GSAA 3PXXA 3OF5A 4ALZA 3U3OA 2ZQYA 2IWRA 4JGGA 2MQOA 2DK2A 2YHUA 1ZCBA 5ALZA 2PA3A 1DX9A 1VZ3A 3U61B 5COAA 3FVWA 5TGDA 2CUTA 5FP0A 1L3VA 2FZGB 4BZXA 4I6WA 4DR1B 2X41A 2G4VA 2DUJA 4YRQA 3EG9A 4JEUA 3U09A 3HKCB 3UK1A 4YB6A 1QU2A 4JBYA 1AB6A 4P75A 3BKXA 621PA 2ENWA 2W42A 3OAAD 1EUCB 3OTBA 4MS1A 5H3LA 2IV3A 2Y6UA 1B99A 5C1PA 1YACA 5CA0B 2CPZA 4I2QA 2G71A 3HZOA 4KRWA 4JKOA 1P75A 2PQMA 4USIA 3KJHA 1UADA 1CUIA 2CPXA 4UHEA 5FPTA 5J5CA 1GZUA 5AM1A 1DCKA 4N5SA 2BBSA 3WGMA 4ZLJA 3KPYA 1CS4C 2XCRB 2ERRA 3LKVA 1A9OA 4M5HA 3GFHA 3D6FB 3VAZA 3LUHA 3M81A 1EK5A 1ZP6A 3QAEA 1T15A 4USHA 5J2UB 3NORA 3W2WA 3MMSA 3S81A 3HVTA 1X7XA 3HLUA 4RV4A 1J09A 3PX4A 1SIZA 3OTHA 1IPFA 1U0SY 4R1LA 2QLJA 4V1CB 2B21A 2VTEA 4JLUA 2DBYA 1PFUA 2IBTA 1WS6A 4FYVB 1L3CA 4GMHA 1Y8RA 4JC4A 1HPZB 3QPAA 2OP0A 1BHJA 1HQEA 3FPLA 5MN4A 4RVGA 3ESYA 3NG1A 3KMSA 1TKTB 1TV6A 3SC2B 1QSGA 3D8RA 2AKWB 4RW8B 1S1VB 4I7FB 5DTQA 3QIPA 1Z5OA 3HCBA 3GLFE 5E4FA 1OFUA 1P2UA 5FHRA 2XWJI 1E3IA 2EGHA 2Z57B 1RXSA 3PY8A 1TUGA 5HQLA 2QIFA 4CG1A 1MJGM 3C3BA 3OECA 1G7TA 3DFMA 1UK9A 2WZQA 3GLJA 3BKTA 2OO7A 3M1AA 1Y3CE 1Q84A 2XZDA 1E0KA 3KK3B 3V6DA 3ZHQA 4L4SA 5F52A 2PR2A 3OE4A 1T02A 1RZMA 4PG7A 1KBZA 5LMCA 2WK4A 2VAXA 4PPQA 4YMTA 2DHSA 2ROPA 5AIBA 4QASA 3O1HB 3L7IA 1WZEA 1WUJS 5H3CA 5L7YA 2UUBB 3MW8A 3U9SA 1XCMA 4KYIB 4IRKA 3MJRA 4G9EA 2B56A 3MELA 3DUFA 3I5YA 1WAMA 2VZ0A 1J25A 1SPBS 4EO6A 1R0WA 4GM4A 1LUAA 4EQZA 4NBRA 4PW0A 3GDFA 1JHOA 3ORHA 2R60A 1Z82A 1P7WA 2PYIA 4Z2XA 4GKVA 4N01A 3KYCA 3BS4A 1KH3A 5KYNA 5ETMA 3PPXA 5JJCA 5ECDA 1YDHA 2YBVA 5KNDH 1GQFA 1EE2A 3COZA 1VYTA 3KWMA 3RK0A 3FFAA 1HTTA 4KN8A 3C6BA 1TEZA 1G8HA 5KQMA 1V16A 4MRRA 4G0YA 4BC7A 2MJUA 3IIIA 4ID9A 4RTOA 1V2GA 2AZ4A 2X5XA 2WFAA 3ES9A 1P1BA 3V1TC 3CRMA 4IZIA 4IAOA 2LQ8A 4Z4FA 4UU8A 5I42B 4ISBA 3H6GA 2O0LA 1Q83A 5LJLA 3U17A 2QQ0A 4KMSA 2IUUA 4D9GA 2HXSA 1RSZA 3IHWA 1RT6B 2AYXA 2PUTA 5J2NB 4PPDA 4OD0A 4COKA 5JECA 1P5HA 1XR6A 4WA8A 3AXSA 1FP4A 1FXWF 4I69A 2A86A 4KGZB 1LXNA 1QVAA 4FEGA 2VQSA 2KFYA 3PLRA 1WHTA 3ETHA 1FFYA 4P7VA 3GK3A 3TLAA 5EYPB 2FHSA 4HHUA 3OXLA 1KEPA 1WMBA 3OLBA 2ZIUB 5DWDA 1SU8A 3RYCB 2DHDA 5KAMA 5BORA 3BSYA 2QT0A 3N59A 5DYNA 5KWJA 1QKIA 2V5AA 1JDPA 2CPHA 5LYJA 3TNYA 2NU8A 2VCEA 2FX3A 4CGYA 1VPVA 1BA2A 3PEUA 2HGNA 1G3OA 2N0SA 3DP9A 1IHXA 5EWJA 3AB3A 1S3GA 1HFWA 2P65A 5FD1A 2XB8A 3NKFA 4RJIA 5KFNA 1FKAF 1ESMA 4GVBB 2X7XA 1PK9A 1YBVA 3CWQA 4WU3A 1M1GA 1M6NA 4IGIA 4R8VA 2P9EA 3FCEA 1O0CA 3SF8A 2VWQA 5A06A 2PMHA 4LIWA 3ET6A 3CURA 1XK6A 1CEQA 2QA5A 2BUNA 2EKNA 3QEKA 4UM9D 3QE9Y 4K1LA 3RJTA 3R5FA 1S4QA 2GN4A 3UOGA 1P2SA 2GK4A 1XMBA 3F5SA 3KR9A 4YMLA 4KJZA 2V7XA 1ITPA 4PQRA 4Z1MD 1XEWY 4JJEA 2IBKA 5IWAB 1G6HA 4I1PA 1TIKA 4A27A 4HDSA 1ADYA 1VYUA 1GFWA 5C5IA 1KHWA 4LMBA 1N4DA 5IJAA 3CD5A 4O2BF 1XIVA 2BABA 2WF5A 4FBUA 4DG9A 4X65F 1BH6A 3FJ1A 4MIOA 4R9RA 5BWMA 2UKDA 4PCQA 1EHCA 4F2HA 2FGKA 1SVNA 1DG9A 3C14C 3K92A 2OEJA 4FIZA 2HK8A 1RWXB 5HVHA 3FYHA 4LBYA 1DJNA 1JNXX 2XWQA 3S4YA 3V8PA 1SKSA 2FWPA 3FPAA 3HN7A 5C8YA 2MGZA 1N5DA 3CXUA 4BO7A 5I7AA 4D5EA 3FZQA 2R7OA 3PJRA 1EZ1A 3TSZA 2I5JA 4REOA 3OR1A 2WABA 4X41A 1ZU5A 4R1QA 3G6VA 3KIPA 4DY6A 3T1NA 5C46F 1QAOA 1JDBC 3SS7X 2YNGB 4C1NA 4Q0BA 1VIYA 2J9DE 3H2GA 4ES6A 5E7OB 3S2EA 1A8HA 5JROA 2B8WA 3RREA 1YVFA 5LP6C 1LSOA 4NASA 2W2LD 3QLVC 1C41A 5EUBA 4GECA 1P8GA 3C6KA 4XKJA 2BBEA 4D3ZA 3CBGA 2QSZA 2A0KA 4RADA 5MFPA 4JB0A 1OZ0A 2FTRA 2ASLA 4ILMA 3P45A 2FQYA 1BUXA 2EL7A 4AO7A 3SX2A 1OASA 2BHSA 4DWIA 2FLWA 1R9NA 5JDIC 3PEWA 3AHJA 2B5OA 4IDPA 2QD1A 3OZ7A 1H5NA 1YJ9S 4DCPB 2JFWA 5LQRA 2Y1OA 3CW2A 4EQ6A 1F06A 1NSYA 3EMBA 3ONQA 4H6PA 2R7MA 1MAWA 3E48A 3TLJA 5E41A 1K98A 5FDLA 3C97A 3R5TA 4H1TA 4MB6A 3DE7X 1ESCA 2DTDA 2HF9A 3G2NA 4KRFA 4HYEA 1F0KA 3H18A 3JU3A 3C3KA 3HCDA 2DXEA 4F21A 3OA0A 5TRTA 1NAQA 2NZVG 3BH6A 3VNSA 2OCPA 3K9NA 4IGAA 3K4QA 2BSAA 2OUGA 2A33A 3QRPA 2JGNA 2RIPA 1YKWA 2W4MA 3SGLA 2GPTA 4RQUA 2VLIA 2Q4EA 3W9SA 1NASA 1BROA 4ALMA 3EIWA 3DLAA 3GFFA 4WLUA 4O4JA 1DTWB 4ZT2A 3WTBA 3GCWP 4WZBE 2BFAA 4XOUA 3MEEA 3CLSD 1I3OA 3OU6A 5BQOA 3SLRA 3OX2A 3CH5A 3K7EA 2OBFA 4EG3A 1OFTA 4JYBA 3RKUA 4ABYA 2YTZA 2I54A 4G5FA 2IJFA 4FDLA 2HOQA 4WFIA 4DDKA 4XAKA 3Q86A 1N3LA 1B74A 1DXOA 3UVJA 3PGMA 1CVJA 1E5LA 3S68A 4K6KA 1TL5A 2GYYA 1S6PA 1LWFB 3ZEIA 4EVIA 4KDCA 3JZFA 4PY2A 3F98A 3JQ7A 3I39X 4MKRA 4HH1A 4JN6B 1X8LA 2HUNA 1KZ4A 2Z2LA 1EFCA 4O3FA 5DZ7A 1ORWA 2O48X 1CJVA 1T0JB 1C9KA 3SQDA 4ZOQI 2I71A 3EZ5A 3OZSA 1WETA 2W1BA 5AE2A 4DV0B 4EY4A 2X3DA 3R7SB 3JQBA 3LPNA 2WYVA 1S1TA 3ZX4A 1RWKB 1BA3A 3M2PA 5GJVC 2HWXA 3SIRA 4ZVOB 5A76A 3GLSA 4BMVA 1M6WA 2CE7A 1SBNE 1JE1A 2IS2A 1JBKA 2QUBA 5ITHA 3HT0A 5J1EB 4YUYA 3BE8A 2GBFA 2I7DA 4F06A 4E1AA 1ZYUA 3ZE2B 3FG9A 4DZ6A 2P69A 4BO5A 4ECTA 3H5TA 1P2DA 2CLFB 1QP4A 1ZM3A 3AUUA 4FGWA 1FRKA 4ZC1A 3TGPA 5GONA 4RVNA 1DE0A 3SCIE 1R0CA 3DV2A 1NVBA 1R5NA 3IP0A 3IR5B 3RRKA 1H2WA 4MQBA 1IHDA 1M6VA 3QVLA 3TZHA 2IYLD 3H2BA 2ZWIA 2YQ0A 2VRCA 5GZ3A 1KOOA 1A1SA 2OK8A 2XDYA 4B44A 1XVAA 2ZAYA 2OORC 3CJKB 2FHMA 4B9MA 3BQ1A 5JZVA 1J4AA 1O5IA 4KW7A 2RC5A 2PT9A 1FMFA 1VLVA 2GCPA 1L4GA 4UQPA 3QU9A 2ZWMA 2QY9A 2N3OA 3TSYA 4DFKA 5ENDA 2C29D 2XGSA 4O5OA 1FTNA 2HBRB 2MZTA 4I3FA 1IR1A 1S89A 1A9RA 2Z2XA 5F8MA 3HN6A 3SY8A 1CC7A 1F2TA 2HZVA 2AOVA 1PYOB 4L1KA 4X63A 4J0KA 4V3CA 2BJEA 3TW6A 2E1CA 4AL5A 4EJMA 2AIRA 2PEBA 1FDDA 3BULA 5DNAA 4ECUA 2YKMB 1MF7A 1T5SA 3ZHOA 4IO1A 1R7IA 1BWQA 5KG1A 4O3MA 1HBUA 2R7QA 4QJ3A 4IMJB 4HFJA 4GYYA 3KJQB 3UZUA 3QBJA 1TU0B 3NEYA 1RTHB 1EDBA 2CJYA 4PEVA 2VHWA 4YIKA 5DW0A 1Z0DA 3ZPXA 4ND2A 3AM4A 4BN4A 1TMGE 2Y8WA 4TXJA 1DX4A 5DKFA 2CC2A 3D7SB 2C8KA 4RH3A 2HWUA 2CPDA 4MW5A 1NFRA 3BMOB 2YH0A 3J7YI 4EG5A 4TKUB 4P6QA 4DCGA 3R7LA 3VRHA 5J1SB 4U0JA 4PSDA 1RKUA 2B0JA 5BW4A 1J2TA 4MYHA 3T3DA 1U1DA 4O2AA 1LXCA 1NPYA 4OB6A 1WG4A 3UGTA 2OO3A 1YBFA 5ED4A 3N86A 4Q8EA 2ZTUA 4TL7A 3S27A 1EFAA 4I2PA 1P7ZA 1UBJS 2Q66A 5L95A 1B23P 4MRMB 1MOSA 3DO8A 3DBOB 3N6XA 4A9AA 4ECEA 4EI8A 2N1MA 4YV7A 3BK7A 3HYLA 1L7NA 3IUQA 3N2ZB 4JL5A 1VE1A 3BGOP 2CB0A 4EB6A 2P35A 3BIOA 3MSXA 4UJ3A 2WNSA 3NR2A 4AS3A 3DCJA 2WILA 3WV5A 4D96A 4PZYA 3OZXA 1GXSB 4NMXA 2NO7A 2A35A 4IWYA 1A9YA 2Y1FA 4RPJA 1ZUHA 3WL6A 1XK7A 2IHVA 1PVDA 3ZZOA 5JD4A 3HJUA 3OIWA 4LFAB 4HP8A 4DT1B 4PR0A 1BCSA 2LCWA 5CYFA 1EWQA 1Y5NB 3I0RA 2BONA 3CLTC 5IM4F 1SVUA 2DGQA 1AW0A 4W5WA 1D1PA 1QTRA 3RYIB 2C54A 2Y6VA 4YXWA 4GRSA 4JI3F 4ISCA 3RUHA 4G4IA 2V0GA 1A2KC 2NS1B 1G8KA 4X62F 1VHFA 4NZPA 1YMVA 5CYQB 2WUFA 1W1UA 3CUEF 1JXQA 3G8YA 5JHHB 1G98A 1ZUWA 1C0TB 4KPYA 2OFFA 2EQ5A 3CE6A 1IHPA 2OIHA 4MQLA 3BSWA 3I01M 1RI2A 1U7WA 3ZNUA 5C24B 4BMYA 4ZA2A 3DTVD 2WKSA 1ZCAA 3IV7A 3QNUA 1KFDA 1TUBB 3LSYA 2DQKA 1P60A 4EMDA 3H9UA 4CQJA 1ZVMA 4KO0B 3WWYA 2IYFA 2UZAA 3GLIE 3P2JA 1U2ZA 1QTNB 3EQ7A 2BKUA 1N52B 1SC4B 4RVDA 1U9ZA 2IS6A 3S2ZA 5EEHA 3EX7B 1TKXB 1Z0AA 1W2GA 1UOQA 4YAIA 1E1RA 3B1YA 3BXOA 3GD7A 3E9NA 1FFWA 2JFZA 2F9MA 3LD9A 2AG1A 3WRYA 4TY8B 3H6KA 2NYVA 1DDOA 3G6ES 3F46A 5FI1B 2B9XA 2IUFA 1KDOA 3GFSA 2WD7B 5JAMA 4BVKA 5KX5A 4CU2A 3KB8A 5HUJA 1CUXA 1HE5A 2A67A 3IR7A 5EWFA 1MRNA 1FVHA 4WX2B 3IP1A 3A2MA 5LU9A 1NW9B 3GOHA 4Q6WA 1QIGA 3EXIB 1C0KA 4C0XA 4UOGA 3ZU3A 5FRDA 4M95A 4C9DA 4MVJD 1ZD4A 1YVUA 3QUQA 4ZVEA 1J5XA 4U6SA 2CIMA 3M6MD 3OQ6A 1QQ7A 4V0MA 2JZNA 1WMEA 4LOAA 3P2YA 4JB8B 2ARKA 3E22A 4BNLA 2PSSA 4EVSA 2F48A 3ZVNA 4B3XA 4X1OA 4DL4A 3W2IA 4UZSA 4PONA 3V4OA 3FHCB 3UH0A 1WNFA 2WNIA 4IFTA 4NDAA 2PZLA 3WZMA 1QRTA 4AP9A 4TM8A 2FZEA 2CJQA 3QU2A 5HMZA 4G4JA 2DX7A 1CBUA 1PEDA 3ML1A 5CM8B 5KFCA 4YDSA 1C50A 1FVQA 5FUQA 5KYGA 4DR2J 1N7IA 2DNYA 4DQDA 5BQXA 2RBGA 3DNFA 1GT8A 4ZZ0A 4K8OA 2H65A 2PX5A 3AP3A 1J00A 4W63A 4NG4A 4QOIA 3AR5A 1N3YA 2PMFA 1T0TV 3MINB 4YB1P 2Z1NA 2BOAA 5INTA 4DWJA 1D5WA 5CH8A 2VF3A 4ZOAA 2B20A 2GJ8A 1LW6E 2JEOA 1H2XA 3EXHA 3N8KA 4EDFA 2NUBA 1YQDA 1U8FO 5CTJA 5DMXA 2BTEA 3OQ2A 1USGA 1Y7LA 3OE7A 4EMTA 2QL9A 2B1JA 3L7BA 1X1EA 1JEEA 1PJ2A 4MJXA 2HLPA 1M2JA 1D2CA 4WW0A 5TPWA 3O3NB 2D69A 1ZZNA 2W43A 1D6SA 4BO2A 1EFVA 1TRKA 2HHWA 3M6FA 3Q8MA 2WSSA 1YB1A 1J5EB 5B57C 3CXCR 2Z2YB 4QFBA 2O8DB 3SICE 3JYOA 4RGYA 1TVEA 3C5EA 2AJTA 3O90A 3WHLA 1MABA 2ZETA 2XA1A 1CUCA 3GT7A 2PG3A 4EW3A 3F5QA 1FKPA 1E98A 4D8XA 5GVQA 3JB9k 4D56A 4TWZA 1NVAA 3PCTA 1GP2A 2B5JA 4WESB 5CDSA 1HHTP 3CMQA 3T19A 3D6JA 3TQFA 3IRWP 2Q8QA 2JRLA 4CO4A 1JG3A 2H2GA 2BAGA 2HRZA 4DIEA 2E9SA 4A6PA 1R6YA 4TVBA 4P84A 2BQ3A 5KJ6A 4RK6A 3SP1A 2VJMA 1NEEA 2AJLI 2EBGA 1MIOA 5TV2A 6REQB 2I91A 4JOQA 2OPBA 1FDSA 3NTOA 4C8LA 2ZH2A 2M4MA 2GLXA 1DTQA 1ULRA 1ND6A 2DPYA 3IESA 3KJQA 1DIOB 1BMFA 4PINA 4KE5A 2CF6A 2I2XB 4QTUB 5ALKA 1M74A 5KNBA 1VS3A 2ERXA 9LDBA 4N0QA 3V8BA 4YP7A 2R8PA 1C2PA 2WYUA 2GCNA 1DTEA 2NSCA 1HBMB 3KG0A 1NUEA 3M89A 2W5UA 3ZVLA 5DJ5A 4YIHA 1Z26A 3UR0A 3M2VA 5JNVA 4NLTA 4Q1VA 1EK1A 1TYDE 4CLRA 5AKHA 2ESRA 1RYEA 1ZEJA 4LDJA 1BVYF 4YMHA 2Y76A 4FBGA 3DI6B 1Z88A 3HCEA 4QWMA 1UZDA 3BCSA 1LH0A 1UBMS 1Q4RA 2MDAA 5COBA 1EM6A 3P52A 4NXNJ 1NBHA 1Z4OA 3T1HF 4HAXA 1TGVA 3NP9A 4X00A 4AC9A 4OSPA 1S79A 4D3HA 1Z73A 1JKJB 1P6QA 2RQMA 3OJFA 3LY7A 4C8YA 2O8BB 1ZMBA 4ZHRB 3KYJB 5DB4A 1SXQA 1UWBB 1NW8A 4X1YB 2M6LA 3H9BA 2XOXA 2DNPA 4WGGA 2JAPA 2HTFA 4N6GA 3WLQA 1IOVA 3MHYA 3ADOA 1RWOB 3AU8A 2Q4BA 4DR7J 2XR1A 5AQ1A 4YV0A 4LA4A 5J1PA 3OP1A 3CD0A 5G0WA 1A8PA 1P1IA 1PUJA 4EK2A 1TT5B 2FETA 3CDAA 1O97D 4ZTUB 3HJVA 5HAOA 1P4JA 4JBNA 5KFJA 4K4SA 1HEUA 4PLZA 5KBYA 4HUQA 3G8CA 4Q3KA 5A2QY 4KL8S 3O6VA 3P9IA 4ZJPA 3OVSA 1Q8KA 3KVRA 1H73A 1I5RA 1IBLF 1GTRA 4Q01A 3ETGA 1G2PA 5H83A 5JVDF 3EF3A 4ZPCA 2C7VA 5BRNA 5LA6B 5KFRA 1BE6A 1ID1A 1HWJA 3CLTD 4RPCA 1PT7A 3T94A 2BQUA 1LW0A 4O0MA 2YZKA 3T5CA 2AF6A 1C81A 1YQXA 3GG2A 1I6WA 4PUOB 4ETNA 4FD3A 3U6KA 1ENZA 4OQZA 1RAHB 3SEOA 2YNFB 3DOJA 2BTOA 3H1GA 3E7FA 4BJ5A 1FXSA 1AXEA 3SCJE 4BQQA 2QY6A 1JJFA 5L8RC 2O0KA 4NOKA 3QWAA 1T11A 2O2YA 5JDCC 2FMFA 4MRNA 4DHVA 3AVTA 3L40A 4BEJA 1E69A 4JI4J 3CT9A 1C8LA 5A04A 2OOKA 2DKOB 4OH7A 1WV0A 1VBFA 3PE6A 4UBLA 1GMVA 1WUHS 2Z95A 4L72B 1C7QA 4ANDA 1TKZA 2ATLA 2QXYA 3ENNA 4AVYA 3HA5A 4D82A 4JI5J 3NUQA 2GAOA 2JLZA 2EJVA 2AQ4A 5TS3A 2YWBA 1VKJA 2O3SA 5AVQA 5I01A 3OD5A 1R6BX 2C7PA 4UBKA 4D80A 4RF4A 3FROA 1NVTA 3HBFA 3GT4A 2NO1A 4AQDA 1ZKMA 2R8GA 2P7HA 1DQYA 2VQFB 3C1AA 2EKQA 1E3WB 1JKHA 4PZCA 2B4YA 5H80A 4P4UA 2OSRA 1W0KD 1Z6ZA 3TCXB 4RW7B 3K5OA 1GQQA 2ZE7A 1ZL2A 4LZPA 5K0ZA 2K8GA 3ZLJA 1OSCA 4MIEA 2XMVA 3W06A 4NXMF 4ZQEA 1L3IA 3QGIA 3DOMA 2EKBA 3DTVA 3ECAA 4PSAA 3DE0X 1Z39A 4A8XA 3JSMA 2WTBA 5GJWC 1ZYQA 1C0EA 5KFPA 5LB4A 4JSYA 4DPYA 3KYLA 1CR4A 3KQKA 3A6LA 4LBIA 3D68A 3RSCA 2C1EB 1YI0A 3ZW7A 4JHLA 1KMCA 3LQQA 3PC6A 4R7TA 2GEKA 4LGVA 2H29A 1NIPA 3LM8A 4JYAB 4MDEA 1APSA 3SK0A 2H1SA 1SU6A 1FK9B 1XDZA 4X61A 4KE8A 1QV7A 1XA4A 1H98A 3JD3A 3E58A 2HWIA 4YT4A 1P6UA 4W7HA 2VT3A 3N8IA 4H54A 5F3WB 1S6OA 3DEHA 3FPBA 5DLPA 4E5NA 5KI6A 4MUJA 5A4KA 3UCZP 1Z6XA 2UXCB 3ZW9A 2IOYA 4BKMA 5F51A 4A4DA 4IG3A 3EOAI 1PFWA 3BGFA 1D4AA 1Z6TA 2X3YA 2RG1A 2XQIA 1G20B 1T4CB 2HNYA 2VRNA 3COPA 4I66A 4RSRA 4WVLA 3AILA 1MRSA 3RANA 3UW1A 2QG9A 5HP4A 1UQUA 1J56A 1X1TA 1QVRA 1ATZA 1Y42X 5CP8A 3HUFA 5JXGA 1FFHA 2Q07A 2HBZB 3C7DB 2DPXA 3CVUA 2QD5A 3Q3HA 3QEMA 1ULSA 1DC5A 2VI5A 4X84A 5KKAA 2DEUA 3LP1B 3GC6A 2WEKA 3JALA 5EHQA 3HVTB 1X7XB 2G28A 4K87A 1YB2A 5KSWB 2YASA 5FFNA 5EJGA 2ZKIA 5DVZA 1AYEA 1LFDB 4QXOA 5AHOA 4HWSA 2R62A 2JBHA 2A0XA 4IOMA 1M5TA 1X4AA 4OZ3A 1L4KA 1N2IA 2Y0EA 4IX9A 3RTGA 5ABPA 3AEKB 3EGXB 1CVLA 4TLBA 4MYRA 3WWZA 2SNIE 3H8SA 1FDBA 2V7BA 4ALIA 1QRAA 5C1OA 2R0QC 2VNJA 4MWDA 3Q41A 4GU5A 1I6MA 1P9LA 2H2IA 4C11A 1YSJA 2UUAJ 4QQKA 2KFNA 4TUYA 4Y2YA 4TKLA 1H8EA 5LZ5A 3OR2B 4CRWB 5CEFA 2VJQA 1IEQA 1N2XA 1M2HA 5TY0A 3DYBA 1SCAA 2FEXA 1RRGA 1GGFA 4AG3A 2JFKA 2PIAA 1IN0A 2CFTA 5SYAA 3FHTA 5JMNA 2GDJA 2R7WA 2R8KA 2IYWA 4DLLA 1RC8A 3SF8B 1FVSA 2BZ1A 3HNOA 2GO1A 2HAEA 1JQBA 1GUBA 3H1BA 2NCKL 2B1QA 5AIAA 3KVOA 5K8MA 1HWLA 1MW9X 4C6HA 3KQQA 1O0SA 4GQIA 2EIHA 1X6VA 3MMAA 2W9XA 3MEQA 2F9FA 3H99A 1V1MB 4CH1A 3GV7B 4BO1A 3ZWYA 4X4PA 3SQWA 1XHLA 4YBRA 4BNKA 4TQRA 2JKVA 2RBKA 1GGVA 2J3EA 3Q3CA 4Q39A 2PKXA 5I4IA 2BJDA 4KI0A 5BRJA 1CK4A 4G1FA 2ERYA 2WJ6A 4UASA 3LUFA 3E3LA 1R8HA 3RH0A 1AB8A 1VJGA 5HJ2A 3ZNOA 3RBEA 5CT6A 3ENZA 4LF9B 3S7ZA 3K2QA 3N5BA 1PDWA 1GDTA 2WMNB 4CTNA 2W2KA 5BN1A 2V7EA 1EJBA 4HRXA 4X1KA 4RVSA 2BH9A 1GKYA 3E15A 1YRXA 1H3NA 4MDFA 3MUEA 3ICWA 3PL1A 3N3AC 5BVGA 2F4VB 3MAAB 1GNQA 2DFVA 1WCIA 3VR6H 1UJBA 3OO1A 4P2GA 2G9RA 1AKVA 1OSNA 5FO1A 1YS4A 4L6AA 2H9ZA 4KWEA 4MA5A 1KZHA 1R0YA 4NYJR 2XMJA 2BM0A 2IYSA 3VQTA 1TT7A 4B46A 4TS4A 4R68A 4HT5A 3VX4A 4KVAA 4H27A 4RACA 3QV1A 1QHNA 3B38A 1RWQA 2LQJA 3CF2A 3NNNA 1R6TA 2SKDA 3LX8A 4BRWA 2CDAA 4MV6A 3ISTA 3OHPA 2PA8D 3ZD7A 4A8JA 2I2DA 4NNJA 1R10A 2LTAA 1VQ5S 3KPUA 3R6GA 1N1GA 2PFKA 3GLUA 3EXIA 3LXRA 4O1HA 1MG0A 5IAOA 2WG1A 2FUG6 4WL0A 3FOCA 4BZZA 3WLPA 4JP2A 2AR9A 5BPFA 2PS0A 4JSRA 3IR7B 5DHTA 3CG0A 3X1ZA 1NJIT 3DEAA 1Q0SA 2BR0A 4QJIA 1UJ2A 1HKAA 2VDKB 5DSXA 4Y0AA 1P72A 2XCPA 1SBQA 4IQGA 4MV5A 5IZ4A 1NDKA 2IVYA 1RCFA 2QRQA 5C3MA 1FW6A 2FZWA 1G7SA 3EF1A 3QGMA 2O8EA 3Q7QA 4G0MA 1COWA 4TT3D 4QM7A 4X66J 3MGAA 1Y48E 4MR8A 4BXOB 5DNYB 1VSBA 1Y3AA 3ZDBA 3DC7A 4URUR 2IODA 2CQGA 4AROA 3L18A 3SVLA 1UPMB 2QE5A 5C7OO 3THRA 4UKDA 4R2XA 5AVVA 3GQVA 3QLTA 2KZZA 5B08A 1UXKA 2ZT6A 2F17A 3H1FA 1I6LA 4HR2A 2QYHA 2QLNA 2D5BA 4DNPA 2LD4A 1OQAA 5I5EA 4E11A 2O1EA 2VP5A 4I1RA 3MVEA 2UZ3A 5AHWA 3QA3E 5FIIA 2V8BA 3G8QA 2NSDA 3W7VA 5KO2A 2FB9A 2I3BA 1SC1B 4GKKJ 4N5LA 4DLKA 1LTHR 4Q1EA 3MTJA 2H5JA 4BX3A 2KBEA 4LX0A 4CM4B 2IIPA 4LVCA 5ADVA 5AUPB 5CHYA 4NOLA 3B4MA 4IDKA 3DXSX 3UWTA 5FLEX 4M5LA 4YBZA 2PA0A 3SV4A 2QX7A 1JEAA 3TEGA 4JC5A 4CKXA 4ZYWA 4AWXA 1KDRA 2B61A 4TZ6A 4OMCA 8ATCB 1G4HA 3NC4A 3ITHB 2HMIA 4GOMD 3IT3A 5EZQA 4A6XA 4P7JA 2H1VA 1E7WA 3DT9A 2DFNA 2NP7A 5T8KC 2AT1A 1GZ5A 1H2YA 1IEXA 3LS2A 5K3CA 2PM8A 2ZE2B 3IULA 4F5DA 4YR9A 4Q8FA 2RH9B 4X92A 1KPHA 2WJGA 1D8ZA 4FM9A 4KIUA 3C7CB 5C53B 2FVRA 2YJ6A 4Q7MB 4U8HA 5BYAA 3OVMA 3Q9UA 1OXXK 1P2FA 4KE9A 5JIBA 3U56A 1XDUA 3O74A 4O2AB 4E09A 4R2LA 4RIIA 2G82A 2CXEA 3M5WA 4J03A 3NCPA 3A13A 1CVRA 1GPWB 4ER3A 1IZ9A 4MR9A 2AEFA 4JI2J 1NXSA 3NEPX 2X5JO 4ME6A 3NC1C 3ZNNA 4AKIA 3BD7A 5DI9A 3KK2B 1OKKA 5C80A 1FDUA 1U8CB 2AIRB 5K7SA 5BWCA 1DC3A 1H8ED 3MM9A 1AM4D 1JKXA 3T5JA 4N12A 3C19A 3MI7X 1CJUC 2GYWA 4XM2A 4CIYA 1BE8A 5HDBB 5FTLA 1OGIA 1VRUA 5DYGA 2IXBA 2EP8A 5GADl 1VQKS 3WG9A 2DKNA 3C16B 3MWKA 4II7A 3KZ1E 1WF6A 1CIVA 5E9QA 3AINA 4Y1GA 5JI3E 4S3MA 1TEXA 4NU6A 1ORHA 1QH0A 3UQSA 1IBSA 3N7TA 3EWSA 3SZ2A 1D9XA 1ZIYA 4QTTB 5E2IA 5LJIA 1WF1A 4RMGA 4AULA 4HS4A 2Q6OA 1UT5A 1TECE 2BE9A 4M9ZA 3H5UA 1HQYE 2PANA 2IHTA 1K6XA 1M2KA 1OLUA 5EXXA 3USCS 4AP5A 1GADO 2QP9X 3DMYA 5K2MA 4KYUA 3DDCA 4GE0A 1XDBA 4FOPA 4E1BA 4F4XA 3LKZA 3VPHA 1WSRA 2FPIA 2Y1IA 3LGNA 3HL4A 1T9XA 5I3ZA 1HQKA 4E0BA 1GSIA 2MHNA 3R4VA 5ES3A 2MPUA 3I45A 5KQSA 2ZHAA 2Q3FA 5DPMA 4FNOA 2WUGA 4BAZA 1RABA 2OV4A 3HNRA 5BPHA 2Q1LA 2V1UA 3A8KA 1UR5A 1HNIB 3F1LA 2B1GA 4NLXA 4OZ1A 1EB8A 1NSAA 3AF5A 1QHGA 1UVKA 3PWKA 1OLSA 3P4UB 2H5IB 4RUBA 5LQMA 1L4MA 3LLCA 1T0HB 4O3OA 1PNOA 5A1JA 4JS0A 2ETXA 1N54B 2JHPA 3DNMA 3M6AA 1QO9A 3LLMA 5F9LA 4AZTA 3ADDA 4X9XA 4PQEA 2C78A 2BGKA 4H59A 5KDDA 4WV3A 4Y2TA 2AWZA 1H23A 1HYBA 2H2DA 2GV1A 3WADA 1TJ4A 5IJ9B 4YP6A 1WKBA 1RXOB 2V7GA 4C5AA 2SECE 4CLTA 4GL4A 2V9CA 5CW1A 2CQ3A 2PX6A 2VPXA 3L6BA 2LZ0A 4DV2B 3I1JA 2FVQA 3W3ZB 4ZVUA 3B6KA 4HEJA 1Z4KA 4E08A 5CNIA 3EYAA 1AGXA 4MWSA 4HRAA 1TFWA 3FMWA 3IV6A 5CB6A 5BXIA 1E1LA 2I65A 1HC7A 4XE5A 4MV8A 3CUKA 1IBCB 4Y6GB 5CT4A 1DIRA 1QCDA 1EX9A 1YE8A 3HN2A 1T0IA 4C4PA 4FX5A 3B1XA 4QVKA 5GZ6A 5IABA 1SEPA 3QZ8A 2QUJA 1MU2B 3BCRA 4KBFA 3DNCA 4C88A 3BXFA 3RSQA 1ACMB 1EQAA 1V8FA