1IXKA

Crystal structure analysis of methyltransferase homolog protein from pyrococcus horikoshii
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
305
Chain Sequence
LSPSMLDKLLRLGYSKLFADRYFQLWGERAIRIAEAMEKPLPRCFRVNTLKISVQDLVKRLNKKGFQFKRVPWAKEGFCLTREPFSITSTPEFLTGLIYIQEASSMYPPVALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNVEFDKILLDAPCTGSGTIHRTMDDIKFCQGLQMRLLEKGLEVLKPGGILVYSTCSLEPEENEFVIQWALDNFDVELLPLKYGEPALTNPFGIELSEEIKNARRLYPDVHETSGFFIAKIRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase
publication title Crystal structure of human p120 homologue protein PH1374 from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 103
structure length 305
sequence length 313
ec nomenclature
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F
A PF17125 Methyltr_RsmF_N N-terminal domain of 16S rRNA methyltransferase RsmF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ixkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ixkA02
5K09A 3FPHA 1VIDA 4LG1A 3MQ2A 1QZZA 3EEYA 4LECA 4PWYA 4X41A 4X63A 1DL5A 5DM4A 4PYOA 5K8VA 1BHJA 2PWYA 3A7DA 1RJFA 2CMHA 3LX6A 1AV6A 4M36A 1EQAA 3HTXA 5EZQA 5BP7A 3NMUF 2B3TA 3H2BA 1MJFA 1QYRA 3OFKA 3P2IA 2XYRA 4KW7A 3UJBA 5HILA 1JQ3A 4AZWA 1JQEA 3EVGA 3SSOA 5LQKA 3MCZA 3FPFA 1V39A 3PFHA 4E2ZA 2NXCA 3GRRA 4GEKA 4R05A 1XCJA 3EMBA 4IKPA 5C1IA 2JHAA 4KIFA 2FPOA 1ZGAA 1WZNA 3EVDA 3HCBA 3LL7A 5DRYA 1X1CA 4RSRA 2ZZKA 3TQSA 3UJCA 5GIOE 1BOOA 3IYLW 3R0QA 4IV0A 4CTJA 3ME5A 1KPIA 2PVCA 3KR0A 5E1MA 3UJ8A 3LHDA 4DCGA 4RTQA 5KYGA 2UYHA 1SUSA 4HC4A 2JHCA 4RX1A 3SM3A 4L7VA 1SQGA 2CMGA 3LSTA 1QANA 4KVZA 4K6MA 5EHIA 3LKZA 3M6XA 2YX1A 3KHKA 4X60A 5E1BA 2FK7A 2OZVA 3NVMB 3GCZA 3P9CA 3LCCA 4HSGA 1IY9A 2NXJA 2ZVJA 4QTTB 3R9XB 5ICEA 4XUDA 5KVAA 1P1BA 2CKDA 2FHPA 3LDFA 5EIWA 3EVCA 2OB1A 3KQWA 1RJDA 2DULA 4KRGA 1EIZA 3E05A 5CVUA 1X1BA 2P35A 3NJRA 3KKZA 2GPYA 3MERA 5FULA 2G70A 4ER5A 4V0QA 1XTPA 4LWPA 3THSA 2HNKA 1O54A 3EGIA 3HCFA 4ATNA 1RI5A 2I9KA 5IH3A 3HCCA 2DPMA 5EHGA 5B1SA 1WXWA 2O57A 2EJUA 4QDJA 3TLJA 2P41A 5DX0A 3VYWA 1YFJA 1NT2A 3PX2A 4RTLA 2JHPA 2UZ4A 3G5TA 4P7JA 2ZWVA 2ZWAA 1KHHA 3GRVA 4AX8A 2AN3A 1NBIA 1RI4A 3PB3A 5DRTA 1JSZA 5EGSA 2UYOA 5LQUA 2OBFA 3IV6A 2VDWA 2QE6A 3FYCA 5T64A 5LQCA 5JUWA 4HRAA 4PYMA 3GRUA 3RIEA 2ZIGA 3HM2A 4NECA 2IP2A 4P7FA 4MHTA 2I62A 1BC5A 2GLUA 2VDVE 4CWAA 5FTWA 1WXXA 3HVJA 3EVEA 3JWHA 4PIPA 5HIKA 3SVZA 1FP1D 3PFGA 5KS2A 3LGAA 4PYNA 3V8VA 1I1NA 2PX8A 2WK1A 3BGDA 4HTFB 5GINE 5MHTA 3GRZA 2OXTA 1WS6A 2BR4A 3BKWA 4RVDA 2G72A 5DM0A 2AVNA 5CCXA 3ANXA 3EVZA 2PT9A 3KPVA 2AZTA 3CGGA 3IEIA 3AWIA 2ZLBA 2ZZNA 1F3LA 4Y2HA 1QAOA 3OPNA 5ICFA 2PGXA 3DXXA 3FUTA 5DLYA 4YUZA 5CCBA 3ERCA 1EJ6A 4UOEA 5DXJA 3DH0A 1G60A 1Z3CA 1UWVA 3KQSA 3OCJA 1H1DA 3UZUA 2A14A 5E1OA 5FA8A 4GC5A 3FRHA 4QTUB 2KW5A 2IFTA 4XCXA 4MQ4A 2AOUA 2ZBQA 3L8DA 4FP9A 4R6WA 5FQOA 3HCDA 3Q87B 4P58A 1INLA 4FT4A 7MHTA 2ONZA 5GOZA 2F8LA 4A6DA 1SG9A 5E2BA 2OYRA 2NXEA 1VPTA 1RJGA 2PX5A 2AVDA 3I5UA 5DTQA 1F38A 5HIMA 5K01A 3NDJA 5LR6A 1WG8A 5ERGB 4C05A 3G7UA 1RI2A 3CJTA 5CM2Z 2OKCA 4ER6A 3DXZA 3G89A 4U7PB 3CJQA 5F2KA 1NV9A 2AS0A 4AUKA 3E23A 2JH9A 2GB4A 5EIFA 4CKCA 3P9KA 2V74B 2NP6A 2CWWA 4Y30A 4JXJA 3KQMA 1NV8A 3DR5A 3EVAA 2JG3A 2ZBRA 3EGEA 2AN4A 2C7PA 2ZW9A 1VE3A 2AN5A 2VS1A 3DUWA 2NYUA 4BLWA 1XJ5A 4QPNA 4RWZA 1FBNA 5FHQA 3NWBA 2VZ9A 4OA8A 3B7PA 1L1EA 1NW8A 3TOSA 3DTNA 1D2CA 3UA3A 1P39A 3OU2A 3DLCA 3OFJA 1M0EA 3ELWA 3KPYA 4GUAA 2YXLA 1ZGJA 2YXDA 1VP9A 3U81A 5CVEA 3I53A 4P7GA 1N7IA 4ISCA 4PYKA 3FZGA 4LWOA 4RYLA 2O06A 5CVDA 4BP3A 2G8NA 1PJZA 4WVLA 3TM4A 3PX3A 3FYDA 3KR1A 5F2OA 3EVFA 4R8SA 4KDCA 3KQOA 5K0BA 3EEOA 3ER9A 3T0IA 1SVUA 2PXAA 1ORIA 2EX4A 1XDSA 3DMHA 1D2GA 4P7KA 3SGLA 4YV1A 5K0EA 3KR2A 2Z6UA 3HVIA 3AJDA 4C07A 3GNLA 3T7TA 2IH5A 3A27A 2YUIA 3GU3A 3E8SA 3OE4A 1DUSA 1B42A 3FPGA 3EGVA 2JJQA 1NW5A 2XYVA 4AZSA 4GOND 1VQ1A 5EKUA 1L3BA 5E2AA 2BM9A 5FADA 5GM2A 5K03A 2IPXA 1L3CA 2PSSA 1KXZA 5HZMA 1JSXA 3G2QA 3MAGA 3X0DA 3BGIA 2Y1WA 4PIMA 4QQKA 5EVJA 2AOTA 5LQAA 2C7RA 4EQZA 3UJ6A 3HVKA 1JG1A 3ID6C 2B9EA 2E5WA 3C0KA 1NBHA 3QV2A 2P3OA 1ZG3A 4M37A 1DCTA 5DX8A 3SSMA 2BM8A 3ELDA 4GC9A 3UBTA 3A4TA 3KQYA 1AF7A 3MTIA 4PYLA 1L9KA 4E30A 1G38A 3NWEA 4EK9A 1TPYA 2JH8A 5DTRA 5HFJA 4DQ0A 5LQRA 1P1CA 2LD4A 4YV2A 4YUYA 5DX1A 2PKWA 5HIJA 4QDKA 2CL5A 4Z2YA 1UIRA 3T7RA 2GS9A 4FZVA 4X61A 1KYWA 1EG2A 3V97A 5FWAA 3E7PA 1SQFA 3SXJA 5K0CA 4CKBA 3CCFA 4IV8A 4E2XA 4YUXA 2OY0A 3HA3A 4GF5A 3KQVA 3UJ9A 3FUVA 2P1DA 1P91A 1PRYA 2PWPA 3SR4A 4HH4A 1KIAA 1KR5A 5DM2A 4AZVA 4OBWA 1IXKA 5GM1A 5FA5A 1VP3A 3BWCA 2YVLA 3HNRA 5E8RA 3P97A 5BXYA 4OQEA 3DXYA 4C03A 3A25A 2G1PA 1ORHA 5FQNA 5IKMA 5C0OE 3PS9A 5FCDA 4MTLA 2YR0A 4E2WA 1R8XA 1ZQ9A 2BR5A 3LKDA 3TKYA 1YFLA 2YXEA 3HCEA 2P40A 4FGZA 3DULA 3UJDA 5K0LA 4EKGA 3JWIA 2IBTA 1R00A 3BKXA 4R8RA 4E31A 1QAQA 3P2KA 4EMSA 2GAFA 2YQZA 4GOMD 2PV0A 2ONYA 4PONA 5HEKA 2Y1XA 3KPUA 4C04A 1YUBA 1Y8CA 2N47A 3PT9A 4F86A 4YMGA 4QVGA 5DSXA 2O0LA 3VC1A 4WXHA 3MHTA 3F4KA 5FUBA 5FWDA 3TRKA 4PCLA 3M33A 2FYTA 5M5BA 3UWPA 3HCAA 4GQBA 3R6TA 4POOA 1ZKDA 4RTMA 5DM1A 4DM3A 2ADMA 2O05A 3UFBA 3LDGA 1U2ZA 1T43A 3G5LA 5E8JA 3O4FA 2OB2A 2PT6A 2PX2A 3GJYA 4XUCA 1XXLA 3CBGA 4DA4A 2XYQA 2PLWA 5GWXA 1KPHA 2VDUE 1MHTA 4BLUA 4E2YA 2QRVA 2I7CA 3B3FA 2H11A 2ZTHA 3CVOA 5EQJB 4QVKA 4ZTBA 3UJ7A 1RI3A 3BGVA 2R6ZA 1N7JA 2Z6AA 4C4AA 5EMJA 2NNWB 4KIGA 1YZ3A 3FTDA 3KU1A 4M7RA 4RVHA 4ER7A 3C6KA 3T7SA 3VSEA 5FHRA 4B17A 2NP7A 2EFJA 3LDUA 1L3IA 4HTFA 2IDJA 3PLAE 4PYJA 4QPPA 1NW7A 2ORED 5DSTA 5CUQA 4E33A 4PYIA 5EZSA 3FTEA 3M6UA 2ESRA 1Q0SA 2P3LA 3OZTA 4PYQA 1SKMA 4HGZA 2IH2A 5EPEA 3FPJA 3M70A 1X19A 3M4XA 3VC2A 2YTZA 5T67A 4OQDA 3UJAA 4KDRA 1I9GA 5JR3A 2FK8A 3B3JA 3GRYA 2QYOA 4F85A 2PXXA 2UYQA 4E32A 2O07A 1EAMA 3NTVA 1FPQA 1BKYA 1R6AA 4U7TB 5K0NA 1VL5A 3RODA 4A6EA 2AOTB 2BH2A 1JG3A 1SUIA 3FRIA 3GDHA 4F84A 3BXOA 3P9IA 3K6RA 2WA1A 3CKKA 1X1AA 5E9QA 3QOWA 2GH1A 3JWJA 4DZRA 4RTRA 1FP2A 2XVAA 3BWBA 1G6Q1 3ELYA 4ER0A 8MHTA 1G55A 1IM8A 2HMYB 3THRA 5BW5A 4RTJA 1O9HA 3BZBA 4IWNA 4CKEA 5BW4A 4FT2A 5HOQA 4V0RA 3OZSA 3I9FA 1JTFA 2HWKA 3GIWA 1YB2A 4G56A 2B2CA 5EOVA 5K05A 4RV9A 5LQJA 3FPEA 3MTEA 5ICCA 3TFWA 4E70A 5DPMA 3MGGA 2ZFUA 2XVMA 4QQNA 1JG2A 2AOVA 2AOWA 4PNEA 3HP7A 5LQNA 3KPJA 2NXNA 2XBMA 3NDIA 2R3SA 3M6WA 1OR8A 3D2LA 2WA2A 3LBFA 1XCLA 5DTMA 5DT2A 3WSTA 1FJXA 2P7HA 3PTAA 5EC8A 3G2PA 5GP1A 1EJ0A 2V7EA 1KP9A 3B5IA 3P8ZA 4GBED 4OBXA 4EKIA 1XVAA 3BUSA 2ZCJA 2IBSA 2PXCA 2HR1A 5EMKA 5DXAA 5P8WA 1VLMA 2BR3A 4M38A 4YUVA 5KQSA 3TKAA 3OU7A 2EJTA 4R6XA 5K0FA 3GXOA 1HNNA 1D2HA 3C3PA 3P2EA 3GGDA 3TM5A 1I4WA 4C08A 4YMHA 2IIPA 3C6MA 1UFKA 4YUWA 3ORHA 1M6EX 2EG5A 4XUEA 3AY0A 2PY6A 4RTSA 1JR4A 3SSNA 1R8YA 2H1RA 4PCAA 3CC8A 3TPZA 3HEMA 3O31A 4BLVA 5D1NA 5C9ZA 5CD1A 4X1OA 5DWQA 3I64A 4FSDA 4RTPA 2Q41A 3LECA 1AQJA 2HTEA 3B3GA 4RTKA 4RTOA 3BWMA 1AQIA 2AOUB 2ZSUA 4GOLD 2QY6A 4PGHA 3C3YA 3O7WA 3P9NA 1ZHFA 3DOUA 2ZULA 3HA7A 4ER3A 4OX9Y 1NE2A 4RTNA 4C06A 3G8AA 2K4MA 4FSXA 3P71T 3EVBA 4MIKA 2P7IA 1N2XA 2ERCA 3RW9A 2QM3A 3LPMA 1WY7A 2P8JA 1O9GA 2P3QA 4DKJA 3IHTA 3REOA 3UA4A 5KQRA 3DLIA 2G71A 2QRVB 3GO4A 4PINA 3KPWA 3KQPA 5GIPE 10MHA 3I58A 9MHTA 4GOOD 2PBFA 5HIIA 5LSAA 1VBFA 1M6YA 3NW9A 3QOXA 3JWGA 4H0NA 2ZIFA 2AR0A 3GWZA 5U4XA 3TMAA 5K0GA 5F2NA 1X1DA 3G8BA 1TW3A 1G8AA 1YZHA 2GA9A 5G02A 3G88A 3DMGA 3AXTA 4EVIA 2FRXA 1RI1A 1KPGA 2PX4A 3HVHA 1JG4A 2ZIEA 3KQTA 4PGGA 3B89A 2ZBPA 2I6GA 2H00A 3OZRA 3SMQA 2OPBA 3TR6A 4DMGA 3FTFA 4OA5A 5CVVA 3FTCA 1RJEA 3BT7A 3M6VA 2IGTA 3ER8A 1XDZA 3KQQA 1JTEA 3A26A 1R74A 3AXSA 3S68A 1NW6A 4HG2A 3ELUA 4BP1A 5EMLA 4HGYA 5K0JA 3NVKI 2OO3A 3Q7EA 1JQDA 2BZGA 5CVJA 2IDKA 3HA5A 2IH4A 5H02A 3BWYA 5E1DA 3DP7A 2B78A 4RVFA 3SX0A 3EPPA 3MCTA 1NW3A 3R3HA 4FS8A 3LCUA 1R18A 2VP3A 5E9WA 3FUXA 1Q0TA 2UYCA 3DMFA 3G2OA 4AZTA 5T6BA 3CJRA 3G2MA 3KR9A 5EMMA 4FR0A 5CIYA 3OU6A 4RVGA 2C7OA 3EMDA 5E9JA 1HMYA 4KWCA 3FUUA 4CTKA 4DCMA 1QAMA 4BY9E 3K0BA 5D1HA 1KYZA 3PVCA 2Z6QA 1TW2A 1NKVA 4MWZA 1YF3A 4CXMA 5EKXA 3LBYA 5EEHA 2ZZMA 3LCVB 5EEGA 1XDUA 2HV9A 3OE5A 2FCAA 1G8SA 2B25A 2PJDA 4DF3A 4O29A 3FUWA 2C7QA 2AOXA 5EG5A 4YV0A 5ICGA 3R24A 3MB5A 3A7EA
chains in the Genus database with same CATH superfamily
2R8RA 3KNZA 1P3Y1 1LK7A 1IM6A 2H2DA 1WXGA 2A88A 3AERB 2DTEA 3BKFA 1J9EA 1Y5MA 2GV1A 3C4VA 1XU9A 3NEYA 2EG9A 4IV0A 1DFIA 5HCUA 4KQXA 3THWA 3OPKA 2GEJA 3GLSA 4UZSA 5ERYA 3LSTA 3TSOA 1EK5A 3EXHB 3LW8A 2PZKA 2HF9A 4GC7A 5AQEA 4UHDA 2E9SA 4F6CA 1O54A 1RI5A 1YRBA 2GM5A 3OOSA 1C4OA 2DY9A 1RIIA 2IHZA 1QHIA 1FFHA 4EAAA 1C4KA 3CUEF 4CGZA 1YB6A 3MAHA 1Q0UA 1R8QA 3ZHOA 1DQZA 4N0EA 1GVNB 1VBYA 4US1R 4JD5A 1U6BA 2LIPA 4YQWA 3TO8A 1T3HA 5FA8A 4C3MA 4EB6B 4IRKA 1VG8A 3MS7A 2IRUA 3G6XA 5FOVA 2BKLA 2CQBA 2LWIA 1LI7A 3DYVA 1C7ZA 1G6HA 4C0HA 1JFLA 4ZCRA 3UKOA 2DNPA 3GAFA 4ER6A 4GLFA 3BGUA 4P4NA 5L4SA 2D1TA 4EO7A 2TMYA 1LTQA 3SQNA 2WM8A 1JR3D 1BW9B 1EWTA 3AD8C 1Z08A 3I9V1 4NBVA 2X2PA 2XM3A 2K5UA 2VPXB 5DFAA 1QE0A 4ZC8A 3U6BA 2GBLC 1NQ5A 2ATXA 3DM2B 3KK2B 4N9WA 3AQ4A 1Q0HA 1D6JA 1XTJA 1MIOB 3BDAA 4E88A 3IQGX 2JJQA 5FWNA 3O44A 1PJCA 2PMHA 4N3CA 1BZYA 1LPNA 1M7GA 3BA6A 3PIIA 5AD1A 2DT8A 1FU8A 3CF2A 3CR7A 3L4BA 2ID9A 4U0KA 4Q12A 3D54A 1YB5A 4JI0F 1S6YA 8LDHA 2PUCA 1FA9A 1ZOTA 3WGQA 3M2VB 1FTGA 4PFSA 2QM8A 4TNOA 4NCIA 2CZVC 1IXKA 3PFBA 1VP3A 2C0QA 4B3GA 3UKDA 4NKRA 3P0FA 1J1UA 4OBBA 2C7VA 4J0EA 2GBFA 4RHYA 2J0WA 4YBRA 4Y2VA 3ZK7A 2DHCA 2O8EB 2C83A 2PMEA 2ZJ7A 3G4SS 1ISSA 1Z88A 1NDHA 1M54A 1RM0A 4ZAVA 3UK0A 3ET6A 2O4UX 2I9PA 3LDGA 3IE0A 3N07A 3H4MA 4MWDA 1UF9A 4PNPA 5DK4A 5LDHA 3V4VB 3ETHA 1MTOA 4O0MA 4B3SF 2Z5LA 3IIIA 1G5RA 3C5WP 1K4YA 4PPDA 5DGTA 1EWQA 4TKMA 2BDUA 2WWRA 1I9GA 4GNKA 3THWB 4CLEA 3WNVA 3BHJA 4BX8A 3UKJA 4M63A 1YS2X 2HJ9A 4LTMA 4F84A 2SNIE 4J4HA 3G96A 2V5AA 1UT5A 4B2IA 5I7EA 2QN9A 3OURA 4U4AA 4OYIA 3RUHA 2O1WA 1N6RA 3T4XA 4NONA 4X94A 4ZJLA 4A0FA 4UD6A 3KJXA 3QXCA 1VI5A 3VM6A 4R9UC 1BY9A 3M6WA 3KJVA 3O9VA 4I55F 2PMDA 3PEVA 3PNYA 2ZJ5A 4U7UK 5P8WA 4B3MF 2YN2A 3TKAA 1ZA1A 2ZE5A 2FDXA 2C97A 1NRXA 1P7ZA 2HWWA 4OX9B 2JEYA 1YTYA 4NH0A 4Q8FA 3IR7A 4PHGA 1N7GA 3BWEA 4P83A 1BNCA 4Q3DA 4QFDA 3LQVA 4OQXA 4YFUA 4ER3A 1WOSA 2W00A 2YMMA 3RW9A 1BX0A 3FOZA 4MUMA 2J48A 1ZI9A 4MNTA 4ZT7A 4GOOD 3SZLA 4Y00A 3GA0A 5FV7A 5E7QA 3GDFA 4LHEA 3AZPA 5BSMA 5JARA 2P9FA 2IYWA 2QXUA 1F9EA 2BJ7A 2ZYRA 5IASA 3W7VA 1NI4A 2P9ZA 2WSCC 3ILLA 1V1MA 3HUTA 1IZYA 4HAZA 4BKQA 1DRWA 1JXEA 4KUGA 1NXVA 3OF5A 4DCUA 1BD6A 2FSIA 2CQ3A 3MCTA 4O4JF 2C9DA 4K81B 1KC3A 4KOAA 2NTYC 2CQGA 3RO7A 4RVGA 3NUZA 4TROA 1QWOA 1HMYA 4YBZA 2XGSA 4KWIA 1AK2A 4RCVA 1XZEA 1GMUA 4NQZA 4WP3A 5IK2D 2ID8A 1QF7A 3OL6A 2AXEA 5D87A 3GGOA 4OYAA 3VGJA 3GRRA 1Z2ZA 1ULHA 2V2KA 2DWPA 1PLLA 4BVKA 1ZGAA 3TEMA 3W05A 3HJVA 1SJRA 2DYKA 2MYNA 3GV8B 1ADFA 1DAHA 2I1VB 3NVAA 4L7VA 5KNBH 2WUWE 1IHUA 4C7MA 4IMPA 1EIZA 3MCMA 3MERA 1UA1A 5L1IA 1X77A 3H4TA 1PIEA 5A8KA 1KY5A 3HCCA 1YKGA 2NGRA 3OD5A 3ET6B 1I4OA 3FOAA 5DN6A 3ML1A 4B3HA 4W1SA 1YB7A 1MV5A 1JALA 3DZCA 3PFGA 5ADHA 1NQWA 3H98A 5HP1A 1OJ7A 1P62B 3L6DA 1KRWA 4WN9A 4M5JA 3RUFA 2Y0BA 1OX5A 2JEIA 5IT9U 1FDAA 5SZJA 3BE6A 3GMIA 3VOBA 5TJHA 4Y65A 4FGSA 5AR1A 2WYVA 2X8LA 3DXZA 1B1CA 1N3IA 5GVQA 1OXUA 3PV0A 3ANMA 1VMEA 2PKRA 3TBKA 3BEDA 5CHCB 4Y2TA 3LQFA 4LF5J 5THXA 4BWFB 3KJVB 4YPVA 1AOXA 4MJ7A 3U81A 2G1UA 721PA 4A8JA 1VQOS 4LSMA 3M83A 3FDXA 4HQFA 3S1TA 1FRVA 1EFAA 3V6MA 3SGLA 2DR8A 2O3SA 4M9SA 2ZHBA 1P60A 3DGFC 1YVFA 3JQ7A 5HX7A 5B0AA 2C2NA 1MABA 4XGKA 3VPDA 2ZB8A 3HVKA 4DV3F 4C6TA 4MICA 4KC0A 3RYLA 1W75A 5KYXA 4H59A 3CD5A 4O02B 5G1NA 1XQWA 1OYVA 4U7FA 1JXOA 2CHQA 2KX7A 2GF9A 4NBTA 3RIGA 4YQEA 1LJ8A 3GJZA 4KIAA 2V54A 3HBNA 4WN3A 3PENA 1F9EB 1KIAA 4K4ZA 1V5WA 3QVUA 1QC5A 1WC3A 2Q6VA 2E4ZA 3WK7A 2Q6TA 5TDHA 2Q27A 3X2SA 4Y2XA 1NJ1A 1JLAA 3V3KA 1SU7A 1KJJA 2UXCF 1J8QA 1VYHA 4E31A 1D0VA 4E5KA 2JIQA 1U9IC 2OHHA 3VC1A 1Z7BA 4YCAA 1XIQA 5FI0B 3N2LA 1P1TA 3P9YA 4WJZA 2PRIA 1X70A 2BRUC 3PRKE 2YMPA 2YNHA 3GX1A 1P2UA 5JDIA 4MCHA 2DNMA 2COEA 4BDPA 1NN1A 4LF7B 2J3HA 4HVCA 1RRGA 5B7WA 4ZTZB 2OCKA 4RJJA 4JITA 3CR3C 3ZHSA 1ESDA 1UPBA 1JU9A 5B0CA 1WCWA 2FOXA 2JBHA 1QOZA 5JALA 3UAOA 5DK6A 9ABPA 2C1XA 3BR8A 1X80B 4Q01A 1F06A 3K53A 2ZUSA 3N6MA 2AFRA 4FD2A 3O8QA 2PHZA 4RLEA 1AX9A 1L7QA 2H1FA 3LRXA 1G21A 3WRYA 3IUSA 3V4OA 2Y0CA 1NVVQ 3TZBA 1JHDA 4JV5B 1QONA 4IW3B 3UHOA 4JT4A 1A2OA 5J2TF 3CF0A 1WDMA 2KLHA 4YMVA 2O59A 1Y6QA 5DT2A 2MQMA 4FEAA 4IIYA 3TK1A 1RYFA 1Y3AA 1AGXA 3UMYA 2LNDA 5HP1B 3KC2A 3L8ZA 1N2IA 3GLFA 4WN9B 5DHQA 3G49A 4ND4A 5IKXA 2Y0BB 5I7WA 3ENVA 6ABPA 5C5DA 5JJIA 1GX5A 2G9ZA 5KT2A 5BW6B 3ZWCA 4DWIA 3M9OB 1T2UA 5K6RA 3HX9A 4PFKA 1AUQA 3FRJA 4BJHB 2ZD1A 4YY3J 4HR7A 3M32A 1ZRMA 2FP3A 3CLUC 2XXJA 4JYAF 1EFVA 1VGVA 2A9QA 2HHHF 4WA7A 4E7PA 2GK7A 3NGLA 4JDPA 4CIBA 3L01A 2ZIEA 1UZAA 3LV8A 4QPDA 2QXTA 1UWCA 2HJSA 1LXNA 2IF2A 2G08A 3H13A 3SYMA 2BZGA 5E9WA 1R0BA 6FD1A 1KYZA 1K7XB 2CXSA 4HQLA 3JQ7B 1MABB 1V4VA 2IIBA 2HYIC 5TQ2B 5TPZA 4C6TB 1SXJD 1ZK4A 2OV8A 3O6VA 5JSUA 3GDGA 5KYXB 4IP0A 3T9ZA 1JIUA 5HNKA 4KXFB 1JQ3A 1V39A 5EE5B 4AP9A 2PKXA 1QC5B 2GKOA 1DKQA 2BUNA 3IULA 4AM8A 1JLAB 4YR2A 1QANA 1B00A 1VIYA 4JI7F 3NLCA 1TEXA 2HIMA 3OWXA 1WO8A 5SICE 1Y3FE 1PKEA 5ICSA 3OUTA 4OXQA 1CC8A 3PYDA 4AFFA 3ST7A 4ZOQI 2F48A 1WACA 4FK8A 1M1KT 4KMMA 3RHFA 2YNHB 5LQUA 2OFWA 3T1AA 5T64A 1HF3A 4OI2A 4FXVA 3LUCA 3ZH9B 3M7IA 5EE0A 2LXIA 1EFRD 2WVCA 4GSYA 1GPWB 1UJ4A 2O8BB 3T7JA 5E4YA 3O8OB 4OYXA 3RU9A 2C3MA 1UPUA 3RFXA 1S9EA 3IESA 4WL0A 3TVYA 3MUOA 3R0ZA 4ENSA 1ROFA 1UZDA 3O8QB 4JUIA 5LR6A 1G21B 5J40A 2OKCA 1E0JA 2G0AA 2R2AA 1JLRA 3UPTA 2RDIA 2WT4A 1T6BY 2A6OA 1K88A 4LVNA 4TTVA 1DAGA 4PPGA 1BA3A 4A73A 1I4TD 4DV6B 4UJ5A 5AVVA 2O06A 4DC0A 2G8NA 4UU1A 4RBVA 4HQRA 1B7YB 5KFCA 5ABPA 3KR2A 3CUNA 2H4JA 3GLFB 5BV1A 2F62A 1V7PC 1CJTC 4ILRA 4L16A 1I5OA 3LFHA 3IOEA 2X6TA 4TMZA 1VMIA 1WHYA 5A71A 2W6NA 4ED4A 3PD7A 5G3YA 4TYPA 3ADDA 4IDBA 1PT7A 2QLNA 1EWRA 3E0QA 3OJOA 2CNWA 1PBUA 1E2KA 2OBLA 1QE5A 5JVHQ 4GF5A 4F71A 5T5QA 2WK4A 1E3MA 2OG2A 4MHSA 2B8WA 4LYFA 4MV6A 4CW7A 2POQX 2BTQB 2I3GA 2R42A 2GHWA 3C46A 3AC0A 3ZLJA 4HV4A 3ETEA 2X1FA 4M5HA 2Z4SA 1EK0A 3G0IA 4FINA 3PFCA 5GAEU 5IDYA 1SHUX 5FL7D 4UZBA 3AGQA 2F9MA 2VFVA 5B58T 2HDNB 3M2RA 1IQ0A 3GCXP 3TPFA 1KGDA 3KG4A 3LG2A 4ZXPA 4QNNA 1BHO1 1W36D 3G5LA 2X41A 5AOAA 3RC1A 3TI0A 3HKEA 4CG0A 3I61A 3B3FA 3T5BA 3BGVA 3OQVA 3L8EA 5EMJA 5L4LA 2EFPA 5AW9A 2YX7A 1V6CA 2HBYA 3H5SA 5LP1A 5HZGA 3VAYA 2OO5A 2PV7A 3M4XA 2OT3B 2ZKLA 4Q1AA 2QYOA 5ETNA 5EXDA 2VHZA 1FX4A 4HX9A 3O8NA 2VQFJ 4HUTA 1XRMA 1MOQA 2AK2A 3WMGA 5IC4A 4IXWA 2HMYB 1E9FA 5IUJC 4F4YA 4HO1X 3HY6A 3OA0A 3HZGA 3U44B 1KI6A 4N82A 1T15A 4YAUA 3VWSA 2FGCA 5L6MB 2HN9A 1DLOA 4NU6A 3ZZYA 4CIWA 3R4CA 4MW2A 3T1QA 1S0NA 3CDAA 1TQ4A 2EHJA 2ZUCA 3MB8A 4TZKA 4QYRA 3U4IA 2X1HA 4EY6A 4LYDA 4DXAA 5HF8A 4DSOA 1NHUA 1RCXB 3P5TL 2VASA 2H52A 1S9EB 1USWA 4U39A 4PZEA 3D1HA 4DUGD 4MAFA 5G0WA 1O4WA 2Y05A 3FAKA 3QPBA 1FDRA 2FKNA 4XYGA 5HP4A 2M98A 1UJ6A 4NEQA 1T9ZA 4DCJB 1H2RS 4ES2A 1J0XO 1DTEA 4LE2A 4P7VA 3C7KA 3VSCA 1KDNA 3ZV6A 2QD2A 2V9CA 1W44A 1Y7IA 3PQCA 4D5EA 1Z0SA 1ZZEA 2A86A 3WAGA 4XJVA 1U1GA 2BMDA 4R98A 3LCUA 1P9WA 3DF9A 2BUAA 4CT5A 3AJ8A 2VXYA 4OXXA 2HRUA 1I5OB 3RJTA 4MQBA 2DY1A 1V7ZA 1FUUA 4OF4A 3G6ES 3EW9A 2WNHA 4X65F 4MWSA 2EZUA 3OIUA 4U2DA 4MB0A 3R6GA 4A0HA 2QMZA 2G06A 1ZIXA 2LE0A 1M5SA 4Q24A 3HK2A 2VWPA 2HPHA 3RSHA 3OFKA 1DIBA 4X66F 1MJNA 5J2PB 1UCFA 2I4NA 3CEAA 3M1AA 3RC8A 1NLMA 5K7SA 2CNKA 3OHSX 3NGMA 4BKOA 4OYPA 3WFZA 1E7YA 3IAFA 4S35A 3BBLA 1TM2A 4XWYA 1YJNS 1VKNA 1U1PA 1RWNA 3M3PA 2H5JB 3KEOA 2VXOA 4ZJZA 3M2RB 2I0XA 3PL1A 1O6GA 4JL8A 5KC8A 3UCGA 4EX6A 2CB0A 4U7JA 5KX5B 4ILLA 1V7QA 1RMYA 3GGSA 2ZB3A 1EKXA 1UK6A 3N2EA 1ML4A 4LQDA 2Y1RI 4HEJA 1CR0A 1ZJ4A 4KQ2A 2VRBA 1QX3A 3JRNA 2BR4A 1Z47A 1OY8A 3FGZA 4QIGA 2HBYB 2FAXA 3IP6A 2PGXA 1EJ6A 4FNMA 3B1ZA 2ZH6A 3K58A 3UCEA 3W6PA 5A8RA 4M5DA 4CM6A 5ES4B 2VPIA 4GLLA 2CZ4A 5JTUA 3MRXA 1Z15A 3NWJA 4BOYA 3QHPA 5SZTA 1N3BA 4LBPA 1WG8A 4C05A 3AD9C 3OJUA 1NV9A 2AS0A 2IOFK 2FHJD 3DD1A 1JJ2R 2ZBRA 1C8LA 3EA4A 2NYUA 4BLWA 1DLOB 4Y34A 2B7BB 1SBZA 1NQUA 3BFXA 1A5AB 2IL1A 2CVEA 3ZJTA 3GMGA 1T1RA 4LX0A 1NSFA 1W4BA 1TTQB 1ZMXA 4AL6A 4ZQEA 1FYWA 4D9EA 2LTAA 4LFCF 3CZAA 1O94C 1IVSA 2H9YA 3ZDRA 2KFYA 5B1HA 3R0XA 1SXGA 3EGXA 3PW0A 2FMHA 2EG1A 3TANA 4KTVE 4BMSA 1WP9A 3G6YA 5AESA 1MT0A 5DDOC 4YRSA 1UT8A 1D9ZA 1GUYA 1NVVR 3NBUA 1H94A 1D9XA 4E1VA 1IM2A 5IF9A 2YRXA 5BR8J 2X86A 3NC1C 1H73A 4XQCA 2FTKE 3RYTC 1XMIA 5HF6A 1XWIA 4G8DA 4GX5A 1JZTA 1A98A 2ROGA 1CR4A 1QH9A 2YNGA 1IAQA 4M8IA 4Z2AA 3HFGA 2FXIA 4MGEA 1LPOA 1YSJA 1N3LA 4EUSA 4H7PA 5KFGA 2YWGA 5E2IA 5BPHA 1A9YA 1AA9A 4F86A 1HNIA 1J8FA 2QD4A 3HPQA 3BWVA 1XL0A 2W1BA 5JH7A 2RS8A 1U9JA 3R6TA 4PN3A 1XWWA 4EW6A 3KP1A 1TQ6A 3R6GB 3IGFA 521PA 5FUQA 3H2HA 3HVRA 2WV7A 4WAUA 1SHKA 1VJCA 2DGOA 4LF8F 2H4HA 3K09C 3RVOA 2DGUA 4HNUA 5DNCA 3FPLA 3IP8A 3K17A 2FUNB 2CNKB 2VXBA 1X60A 4K4XA 2LP4Y 3SR3A 3ZHQA 1TK3A 1EVJA 1ULAA 3WLHA 4BEBA 1WSBA 1F6WA 2V0GA 1HWIA 4GUDA 4FLFA 1EK1A 1H5QA 1RWVA 4FKYA 1RWNB 1BVUA 3GG9A 2PZAA 3KDOA 3MR7A 2J5AA 1RRMA 5DPMA 2IM2A 3MGGA 3DDKA 2XVMA 1GRCA 1EQMA 4DLRA 2R3SA 3K5MA 5E9AA 2E1AA 1YHZA 3DMTA 3NOCA 1GZHB 1C29B 3TDMA 2MKHA 4BAUA 4QO8A 5I4BA 2XPCA 2XOKA 4L8YA 4BMZA 4K8RA 4D99A 5I42B 2F3SA 5A8RB 4V0ME 2UYYA 1HPLA 3IUMA 5C34B 3I5MA 3KNAA 3LPMA 2P3QA 1HH4A 2CVHA 4UQTA 3LRPA 2IWRA 5BYBA 4B82A 4LF6F 4YX9A 4NICA 4X3CA 3DUFB 1UJ2A 4W5RA 3L7PA 1PL7A 3R7LA 1PJQA 1X87A 5LSRA 1Q7BA 4UTZA 4X7MA 2GXAA 1XQ1A 5DHRA 3JWEA 1J70A 2NX2A 4EFMA 3BGLA 3KKEA 1DIHA 3W9UA 2XMCA 1JTEA 2B4OA 2WZDA 5KU7A 2EYQA 4HG2A 3KU4A 3ZNUA 5EIEA 1Y48E 1AJEA 1BQXA 2XT6A 3AA9A 5A5EA 4I5EA 4Q9HA 2ZWMA 2J3MA 1ZN7A 5FAXA 1XSEA 2EEZA 4LWZA 2F9DA 3A1WA 1HORA 1E99A 3EGXB 4X8LA 3LALA 1V11A 1S3IA 3I04A 4GKKB 5IT0A 4LZPA 5CQGA 5HIAA 2HZVA 3V7YA 1XEWY 2AMJA 2VWQA 1Q86T 2C31A 1VIDA 1DL5A 4OK5A 3AR9A 3QPIA 2E1CA 2BKVA 5GOTA 4IH6A 1FW6A 3VPSA 3RIYA 2YNGB 4RZSA 1UMBA 1YJ7A 3RPEA 8OHMA 3SM3A 5A1JA 3I9OA 4BNGA 2P1RA 1N4AA 2EP7A 3NMRA 3NEPX 3QLHA 4FHEA 4ZGGA 5MGNA 2B5JB 2G70A 4ER5A 2AN9A 4ATNA 3HP4A 4HLQB 3CPEA 2BEUB 4QDJA 1L4BA 3KHGA 3F6PA 3O6QA 1WZIA 2Q9CA 5GJCA 4E5VA 3ND7A 3JQEA 4IG3B 3V3TA 5JUWA 4PYMA 4ASUA 2WE8A 4FGJA 2YX4A 5CW1A 3HPRA 4LIPD 2JJ8A 3K5HA 4BNIA 2HK7A 4B0OA 3CM0A 4KKXB 4ALLA 3LPNA 3DNFA 3HKCA 4RZUA 2E4WA 2WFZA 4YMLA 4LRTB 4BNNA 3K8QA 3DV0A 3KYCA 3N8IA 1RWVB 1C1HA 5ERGB 1N9ZA 1Z6XA 5AOCA 4WERA 3NTXA 1ECLA 2JH9A 1H8EA 1M9NA 5D5QA 1VE3A 1G5TA 2VS1A 5J3JA 4LRUA 2I87A 1RM4A 4C43A 2OVFA 5DEIA 3GT0A 5BMVF 3Q24A 4I68A 3G7SA 3IOBA 4YJ2F 4LCBA 2WTBA 2ZM6J 4MQMA 4ED0A 2C4UA 3VR4H 1HDOA 3A27A 2ISSD 3D67A 4Y2KA 2PAFA 3E27A 1B42A 4K6KA 4K8RB 4K9OA 3ZHUA 1HR0F 1IJEA 3DKIA 2FOIA 2V68A 3NT5A 4OK6A 1HNVA 3A32A 3D0RA 4HDMA 2IZ5A 4OFZA 5AK0A 3A4TA 3TX2A 3NWEA 1Q91A 1IHPA 4WP9A 4RIHA 3J7AN 3RTEA 1MEEA 3JQJA 4AXBA 5L40A 4BNVA 1KO5A 3SFVA 2J4DA 2VJUA 1ORHA 2ZE8A 3FCOA 1GNKA 5LBTA 5BNFA 4QRDA 3AOBA 1BQ4A 3L95X 5I4KA 3G23A 3VDRA 3KPUA 2WF8A 3VGVA 2ZBDA 3EDMA 2OHOA 3FGOA 3PNVA 2C20A 4ME6A 4G4SO 4J1TC 3ZCVA 3BG5A 2OB2A 3JVEA 1UFQA 4GZ6A 1EVYA 2H1VA 2ZWOA 1NR7A 3TB4A 2QTCA 1WSAA 1CETA 1A71A 4FBUA 3ESRA 5FT9A 1VCIA 3SC4A 3TCKA 1RM3A 2FK8A 4LYJA 1UMBB 1O6BA 4ALJA 3UT6A 1U9CA 2A58A 4K7QA 1XL1A 2DSTA 2GPTA 2WM3A 1SXQA 3QLHB 2FEAA 1QV6A 5DHAA 3UK6A 3OZBA 4BATA 2BONA 4XQ0A 1U7PA 4NHEA 1GILA 1QSSA 4EP1A 1CXZA 1R7IA 2EP8A 2HKEA 4BFZA 3G2KA 4MRPA 1LWEB 1RQRA 2PZJA 1G9SA 1AROP 3RF6A 4QWCA 3STUA 2R7QA 1JS1X 1R5JA 1YO6A 2DCLA 1F8FA 1RYMA 3HKCB 2WBRA 3KAJA 5KJCA 5FWXA 3LM8A 1Z63A 4QR1A 3O75A 2OCPA 4DVGA 4DRXA 2JB9A 3DV0B 3KYCB 1K9MT 4KREA 1OWXA 2D1FA 4C06A 3CBQA 2P8JA 2C5EA 3HDSA 4M76B 3TD9A 3ZZ0A 2VTDA 3QF7A 2WB4A 4E5PA 2KB0A 4AJLA 5T4HA 3OZRA 2XMQA 2RHSB 1QDLB 2DVIA 3FOBA 3HE3A 1MMDA 2H29A 4O4GA 4FEYA 4BMPB 2RIPA 2DFKB 4NEHB 1XNQF 1C1DA 1C2YA 1QH1A 4FKBA 2Q7XA 3HZZA 2WIAA 2AG1A 4MUHA 2FWAA 2FMTA 4KL8S 1IJEB 3HB1A 4AMYA 1UXOA 4FX2A 3JPWA 2TECE 1HNVB 4NBWA 3MMXA 2J32A 4HDMB 3K0HA 5EA2A 2CDNA 4DF3A 4D0GA 3DTVD 2R8EA 3GH1A 3ZE1B 2EKPA 3CJ8A 1A9XB 1MJHA 1NFFA 3L7YA 1KOLA 4MROA 4DV0J 5GJBA 1SBCA 3I6IA 1FYFA 4GI2A 1LBIA 4YB5A 5EJEA 1NUSA 3LGXA 5TJ9A 3U6KA 3VH4A 1B14A 1AMOA 2DGWA 4L5AA 3ZQKA 4QTYA 5C52B 1Y37A 2ZBVA 4DA8A 4ZJQA 3IH5A 1XR6A 3NHMA 5H9VA 1V4NA 3QVGA 4GLJA 3CKLA 1P1BA 1N2GA 1P8JA 4XA8A 1CC1S 1TYDE 3SE7A 1E9SA 2C4MA 2PA3A 1D2NA 2G2OA 4US0R 4D96A 4Q3OA 2DPMA 4N41A 1XXHB 3MWDA 4LEIA 2PANA 1MD9A 2Z4TA 3BTSA 2E1PA 2DMRA 2EKBA 1HEUA 2ST1A 3Q8LA 4IF4A 4G5QA 4F9EA 4GIBA 4H0FA 4M98A 1P9OA 4M9QA 5AKHA 3OE7A 4JI5B 4ETZA 1D0IA 1LDNA 2YOFA 3IT3A 1NUHA 4BX3A 3SZUA 1Z5ZA 4NXMB 2R6R1 4HY3A 3E2IA 1EBUA 1IXRC 4H6PA 4MGHA 1VJ0A 3CJTA 3AP2A 3SU8A 1J8MF 4BN5A 4R9RA 3POTA 3DUWA 4TTRA 3WQBA 3KK1A 4JA2A 3SI8A 1OE0A 3OU2A 1XEZA 1II0A 2AT1B 2VJKA 3QLVC 3IIJA 3ZI4A 3SFZA 3TW0A 4C87A 1YJ5A 2CHVA 3GFGA 3I2FA 1TFUA 4GXNA 2PLRA 4WKOA 5F21A 1POWA 1U2TA 1FNOA 1YIJS 1DI0A 3R5HA 1E1NA 2E5JA 2ZBEA 2PMWA 4DRXB 4O0NA 2IWHA 4GH5A 4GLBA 1DBWA 4CQLA 3VR6D 2YQ3A 3YASA 4J0FA 3Q2IA 1F6DA 3AVTA 4RPFA 1K5DA 4USMA 5HFNA 1VZ2A 2VHEA 1II9A 1Z17A 5LJ3Y 4H18A 2UZ3A 3PUVA 5B37A 3ECAA 2ZK7A 5ED4A 4O4GB 1GV0A 5JAPA 1VPVA 1VRCA 1C1DB 2PIAA 1QH1B 16PKA 4ERNA 5J23A 1UEXC 5MGBA 2EKYA 4EJFA 3RSZA 2XWJI 1LBHA 3VAGA 2DPJA 4H2DA 4G9EA 1KVJA 3TLCA 1RK8A 3JRXA 4AYBD 1EUQA 1S1VA 2J33A 2XYQA 4X5OA 2GPJA 2YHSA 1O95A 2HA7A 3AVPA 4A8MP 1Q1EA 1A8QA 4RZQA 2H18A 4E33A 1WSWA 3VHLB 4ZYXA 4WV3A 4H9GA 3UJAA 3DU5A 1KVQA 1JG3A 3QVGB 3BWBA 1IZZA 4BFXA 3ZC4A 1O9HA 2MSDB 2VUSA 3IGVA 4OOFA 1W9HA 4PZYA 3OEED 821PA 5EQFA 5F7OA 5H9WA 1CIPA 4N9QA 3UAZA 5AHKA 5F7JA 2P90A 4ZALA 3MWDB 4C11A 5ALVA 2VF8A 5EC8A 1LWFA 3ZNPA 3QNWB 3NBZC 4JIMA 4HOYA 3KQUA 2JPDA 1CLEA 4EX7A 3B3AA 2IIPA 4TZ6A 4F25A 4FS1A 3WK9A 1V8BA 1X4HA 4OY3A 3GFZA 4HEHA 2VT7A 4Z3OA 3O31A 4A8TA 1L1QA 3RUEA 2QTRA 2FFJA 4EUKA 2NPFA 3A9RA 1C1YA 4DV2J 3RR7A 4E13A 3LCMA 5IT5A 5A2QY 3ICCA 2WOMB 4ECTA 3KUKA 3MWJA 5KQRA 1ZH8A 3CZ9A 1WUKS 4NLXA 3RSCA 1T6YA 1ECBA 1ZXXA 3OJXA 1V8DA 5HKOA 3KK1B 2ZTLA 4MKIA 3NGDA 2AD9A 3TOZA 5HMWA 1CY4A 4GKVA 5FLXA 3ITEA 4Q9AA 5JXGA 4K9LA 1BDIA 3GDWA 3ADOA 4HGYA 4RIEA 3HDHA 1XTVA 4LQLA 1CZUA 6FDRA 3BWYA 4JJFA 2CEAA 2YFYA 4I2NA 2SKDA 2PFSA 1QGZA 3FWZA 1YU6A 2GESA 1KZHA 1ZM9A 3R0VA 4X4PA 3WL4A 5MN4A 2EC5A 2C7BA 4B73A 1TC2A 2PMWB 1R7RA 5LQMA 3REQB 2A9FA 1K7SN 1ODSA 5CXXA 4CQLB 4ZREA 1HHQA 4EA9A 4XCVA 4YLEA 1NOKA 4MLPA 3KZXA 4YQZA 1I94F 3WNDA 3IQZA 1HDYA 4RD4A 3IYLW 1NG1A 5EWJB 3M9XA 2ENUA 2R3VA 3QVXA 1KNXA 1QYWA 2J59A 2NXJA 4KH0B 2VONA 2G7MC 4WP8A 5KVAA 3VSDA 1WSDA 2QK4A 5FRDA 3X44A 2O5RA 5LYJF 5D3MA 4F9FA 2ZEJA 2QMHA 1GMVA 1PKUA 4LUCA 5TT0A 5JNVA 1DG9A 2H1WA 1SM4A 1LI5A 1U0RA 4AJ1A 4LKOA 1SHLA 3B5JA 4LMPA 4XD7D 2V8BA 5FTWA 3V80A 3EISA 4I81A 5HIKA 5GY7A 3P26A 2EBGA 2MZJA 2YPYA 3K32A 4WF9Q 4M1KA 3EXEB 2R9VA 3KPVA 1I6LA 5JAZA 4V0KA 2Q66A 4P93A 4QXMA 2IEIA 3ANLA 3H9QA 3HUFA 3EWSA 2PLNA 3NHAA 1E6WA 2OTJS 4ZPWR 4IKEA 5DN9A 4U8YA 2ZC4A 3G7NA 2V6AA 3P5BP 1KAHA 1KDOA 3PGKA 3IFSA 3MHPA 3ECCA 5FTMA 4AUNA 3ABOB 5K8JB 1LWFB 2W6IA 1GARA 4EO6A 2W71A 1YV9A 3VYSB 2RQ4A 2PEYA 4JC8A 5KSOA 2HFSA 5U9CA 4KITB 3O90A 1T3OA 3RS9A 2JZNA 1P0CA 3RADC 2X0KA 4IG9A 4JOBA 1FWPA 1OROA 3PEHA 4TQSA 1JG1A 2E5WA 3T5CA 3QV2A 2W11A 4OJYA 3UTCA 4ZXFA 3DL0A 1U5AA 5KT4A 5HFJA 2CD7A 2YC4C 2WE7A 2JA1A 3SR0A 1H1LB 2JKZA 3GFRA 1ACJA 4RQAA 1CT9A 2VQEF 3AWDA 4GGPA 2W2VA 4N40A 3C66A 1F2UB 1RCOB 3C15A 5FDLB 4N5MA 3OCUA 1RBMA 2EG2A 4J9VA 3Q22A 2QVYX 2XTNA 1JLQA 1K98A 1Y4DE 4IDQA 1ZCZA 3WMWA 4DZ6A 4DF4A 3ZLUA 1E1CB 1R6DA 2BEFA 3QT6A 3UWPA 1S72S 2E55A 1I0ZA 3K31A 3ENWA 1T1GA 1RYZA 3CBGA 4CQMD 1RAHB 4JGBA 4ZIRA 3VSEA 4EPWA 4NPAA 2RT3A 2HF7A 4MPPA 5CUQA 3M4ZA 2J0QD 2XGJA 3P7MA 4KDRA 2F1IA 5EERA 1QMGA 4L5YA 4L75A 4MKRA 1E6CA 1R0SA 3RJMA 4JK3A 1OW3B 4FF4A 4ZQGA 2RI1A 1W6RA 1AKQA 5JJKA 4URGA 5EL0A 2WJIA 5EMHA 4GPIB 1A4XA 3PHGA 5JQGA 5D3MB 4F4CA 2FX5A 2KJVA 1GFIA 4LRFA 1Z13A 3TCNA 3ONQA 3KPJA 4IS2A 2ODWA 2G9OA 3ICOA 3HP6A 3H6KA 5I7RA 4NAVA 3T1YB 5CM9C 1QAJA 1DOAA 4HHJA 3NANA 3GR6A 3WC4A 3H5TA 4ZP8A 1EFHA 3Q8XB 4RMJA 4J0JA 1OI3A 1UFKA 2O48X 3M7VA 5HGJA 5EIAA 3R1LA 2QZ8A 1KOJA 4WFYA 1RCUA 2HEGA 3EDCA 4HQ6A 3AY7A 3MWEB 1V1RB 2JAPA 4UAGA 1TTPB 3TUPA 2KQUA 2I71A 3C1TA 5COQA 4IGIA 1CDEA 4FGWA 4UZCA 3RZAA 3MOJB 3LX5A 3O4VA 2QXYA 2XSFA 1PHRA 2RH5A 4DQXA 5T7BA 1E1KA 3BH6A 2W2PA 3UHJA 3ZV4A 3HVHA 3D7SB 4GX0A 3WGGA 3IJPA 4R84A 4UUPA 1TVEA 4QULA 3ZU2A 3GJ0A 2YH2A 4BUCA 3PE6A 1P9YA 4OATA 2NZJA 5CGQB 2Y1OA 4BQPA 5EGNA 3UC5A 4MLDA 1GDDA 3OOWA 2CYYA 1F17A 2JD2A 3JVUA 1N34J 2IYRA 4DCMA 1L5NA 3SEAA 2VHUA 4ITUA 1VRQC 2ZM5A 4PGAA 3UH1A 2FY8A 3ABZA 5CDUA 3FUWA 3ISVA 3FSGD 3IO5A 1AH2A 1VIMA 1THGA 4KO8A 3RAEC 5DHTA 1Y1PA 2FMXA 3TGLA 1JEYA 2GNAA 2N3OA 1THZA 1C8KA 3Q8VA 5IJZA 3RM3A 3SEFA 3C15B 3M6XA 5E1BA 2DFVA 1WB4A 3DQZA 3PSHA 2J9CA 1JLQB 4MKAA 4J9QA 3W63A 2ZYGA 1JJHA 2C9CA 3LVQE 3PX2A 4IFYA 4PXBA 4TMFA 2ZWAA 5JADA 3V6JA 3I82A 1NBIA 3PB3A 3CCMS 1M72A 2FZKA 4FS2A 3RWOA 4LBHA 4ZIRB 4MFBB 3ENQA 4W9NC 4E12A 3T5LA 1MA3A 4FFPA 2WYUA 1RI7A 3KJFB 2DO0A 4UOQA 5AXLA 3UO0A 5LP6F 5FOWA 4ND3A 3GLRA 4KO0A 4RMNA 4D92A 4EEKA 4JB2A 3EZ2A 4BKMA 2WM9B 3QLUA 1FESA 3RJMB 2R8PA 5K01A 3X1KA 4OQNA 1XMXA 4B3DA 4XARA 5JQGB 5E6RA 3P9KA 1GPUA 3PNIA 2B0CA 1AZSA 3WLJA 1E2GA 4QTZA 3TRIA 4W4TA 1BQNA 4V39A 4WJLA 1AKTA 4WXRA 3D66A 3KSBC 1J2EA 1R43A 2QF7A 4Z53A 4A10A 5CFLA 3WYGA 3VTAA 4XTRA 4DAOA 2V6FA 2HHJA 4MUBA 1VMKA 1L0BA 2BFNA 1P1HA 3R76A 2JVKA 2PGAA 3K2IA 4P81A 2RU3A 3EJMA 4M1WA 5EVJA 2W2TA 4DMKA 4FWBA 3EZYA 1RRFA 5SZHB 1N88A 5SUHA 3DU6A 1FRIA 5TGTA 5IC5A 5J1EA 4FKXA 3RYHA 4K86A 3BH6B 2HU2A 1Z12A 1O2DA 2PUTA 3KJHA 4YYZA 3M1LA 3L8CA 3P0IA 4A7PA 3IB3A 3JCZA 1MN7A 1WKVA 2B0JA 3UN5A 2V67A 4DBLE 1F4PA 3FH0A 1J2YA 1YFLA 2KHZA 3EX7B 2BEVA 4NXNF 2YH0A 4BP8A 1LV5A 1W4AA 4QYSA 1V3ZA 3GXBA 4X4SA 2WUGA 3VZIA 3F4KA 4L5CA 2EC2A 4FQ8A 1KKUA 4H77A 3QOYA 5TT1A 1EFPA 3AAWB 3ETCA 4R31A 2WJ4A 2HWIA 2VDUE 5TNXA 1ZITA 1ML3A 2ZTHA 3V81A 1XZNA 1HXHA 1JEYB 1QYDA 4BMNA 2A92A 4RZHA 2ORED 5DSTA 1PGOA 2HHPA 3AJAA 3Q41A 4C3ZA 4GVPA 5LMUF 2VH2A 3G0OA 1XK6A 3A31A 2AQ8A 2JGRA 1PDOA 2WA1A 5ALYA 3GFXA 3HSGA 4MIEA 4HLCA 4FDLA 3VPXA 1REGX 1QM5A 1KF0A 1G59A 1YJRA 4TS9A 2QRUA 4EECA 1ONNA 4IFYB 3JSXA 1QJHA 4BNMA 1UPMB 2HRYA 1NBWB 5CFMA 4OSPA 2QSWA 4Z5XA 3S81A 3SG0A 1FJXA 2HCJB 1LUAA 3VTIA 2PXCA 5TR9A 2BEJA 1DWQA 1X7HA 1H23A 1F8UA 3CB4A 4ZPXA 4RO0A 3K94A 3EXYA 1NYTA 1JXAA 2HXYA 4KO0B 2WKWA 1G3UA 1L5SA 3OZ7A 1SOVA 2CSUA 1WVMA 3O1HB 4LDRA 3BSFA 2GEBA 3P71T 1AQYA 3CZ4A 5I9TA 2EGUA 1IBMB 4USIA 3DM9B 1L5YA 2VOPA 4RW6A 2L9WA 4FE3A 1G1XA 1QFYA 5E6RB 2PDAA 1AZTA 4DA0A 3QJPA 1AZSB 3JZIA 2RI0A 4MZDA 2HCTA 5GAHU 1BQNB 3KLMX 4UNNA 2MHCA 1NXXA 1OXKB 3E18A 4W6QA 1FJCA 2ZJBA 2RKBA 5IOLA 1U0NA 3AXSA 3CLRD 1GV1A 2J6HA 3C1OA 4OJHA 2AJ1A 1AUSL 1CEEA 3ESXA 2C4WA 4P5PA 1N36F 4Q43A 1U1FA 1GNQA 1GG8A 4MUNA 5FL3A 2C0PA 1FOEB 3C5HA 2QMXA 3EXCX 1MQ9A 3MILA 3NEAA 2DCMA 5I9MA 5EXXA 1CVJA 1WEKA 3JAWA 4MIWA 1N5IA 3NH6A 3LP0A 4B6EA 1G0NA 4MA0A 5J1EB 5HJ5A 3RYHB 1JH8A 1HQUA 4K4YA 4AMBA 1ZA1B 1Q8BA 4HEA1 3RT9A 2AFHA 1QIHA 2FLWA 3IR7B 1G9XA 4CL3A 1IVYA 1HTBA 5TC4A 5E1MA 4Y6SA 3W6OA 4YXWD 1ULSA 4MVJE 4YHHJ 1SUSA 3PWSA 3S8SA 3CO9A 1HETA 1NLUA 1XJ0A 4GR9A 1W34A 3HJAA 2BEVB 3PFNA 4H08A 4DEXA 4GYYA 1LSJA 1LBEA 5DMXA 1Z2DA 3JPYA 1EMDA 5IKPA 4JP1A 4C8LA 2KHCA 2UXDJ 4DR3B 3BYRA 1VBNA 5GADl 5KTTA 1ZAXA 1YZYA 1EFPB 1GT91 4LVUA 1XEAA 1K06A 2FLNA 2CLOB 2ZYTX 3STVA 1ESZA 1NI4B 3EPLA 2IP2A 4P7FA 3V81B 1V1MB 2AXQA 3ZX5A 1M5OC 5IVDA 3TYXA 2XULA 1SJ3P 2O2IA 3V4IA 4YJDA 1WPQA 3T7EA 3FRZA 2PMCA 5E3CA 4PWZA 1XRRA 3EICA 2VDKB 4ZVEA 2QAGA 1P1KA 2XUKA 3LF0A 4A23A 2QPTA 2EYUA 2JC1A 1FFDA 2PCLA 1UETA 4JI3F 3TSZA 4FWIB 1UAGA 4XWWA 4LF7J 3T3NA 1MV8A 3SIWA 1T2NA 2OK8A 1GQEA 3HBMA 4QA9A 4FMPA 2YXDA 4P7GA 1YKFA 3TQQA 1G3OA 5CDFE 5AJVB 4R81A 3EEOA 5J5CA 1P0PA 4C07A 221PA 1VFJA 4UOGA 3OLBA 3T38A 4C30A 1I24A 4Z0HO 3HYLA 1Y1TA 5A8KB 1NXOA 3K1AA 3QVSA 2JX2A 1KEWA 4PZLA 4XVHA 5F5XA 3ORSA 1Q0NA 4RHXA 2R7KA 2RAVA 3VNBA 2XGGA 1QX4A 4C97A 3T9AA 4RW6B 2YRWA 2TRSB 2MKCA 3EG9A 3MM6A 3NCPA 2WKSA 1IBLF 1J42A 4UUXA 5CYJA 3IVAA 3G82A 2AYMA 2ZRDA 4BCAA 1XYYA 1YA6A 4EHJA 1OLUA 3G9ZA 1ZU5A 1KY3A 4HNHA 4R5PA 3PWZA 3TW8A 3I1FA 5LJLA 1FNDA 4WBFA 1T3ZA 4UVGA 3RGGA 5KFDA 4ZK2A 4QW8A 4R2WA 3DT6A 5A4DA 3FQLA 2O0LA 2ZGVA 2GVDC 3NTLA 4IRDA 4HYEA 4AK9A 3UWMA 4UOCA 1DC5A 3L0IB 2WG0A 3JAWB 4A8JB 1TKZA 2L08A 2HDHA 3LP0B 1HQUB 5EZ5A 5IJ9A 3OY2A 5JYBA 3UY4A 2AFHB 1MRZA 3ZVRA 1IH8A 3E58A 1MO3A 2JZ5A 4AD6A 1RZRA 3N7UA 1XDWA 4AJJA 1E7RA 4KHPJ 4DSNA 4YMSA 3B1XA 1Z36A 4XOUA 3MCNA 3ICWA 5IMSA 4E22A 4ZOEA 2BJHA 3O38A 3EUAA 1PKXA 4MPTA 2ECQA 4LAFA 5AUPB 4XPEA 4NLYA 1DJLA 2B43A 4A0RA 1N5RA 1J25A 4KQCA 3PJRA 2QP4A 2Q1UA 5CYQA 1HBJA 3KZNA 4RPIA 4EFLA 4EG1A 3GGDA 1WQ1R 5ETMA 2A1TS 4ECYA 4Q7JB 4BVFA 1EX7A 4X3OA 2QAGB 4A8WA 2G4LA 3JD1A 3LAKA 3DPSA 5DP2A 2GZAA 1D09A 4HBZA 3OP1A 1GNRA 4KBGA 3TXAA 1OPRA 3S40A 3IXLA 1IR0A 4CLRA 1Q92A 1GG2A 1Y9AA 3U4GA 3IT2A 4EY7A 1R3DA 1U1MA 3DEJA 4CIYA 3R5AA 1M10A 1QM9A 3TVZA 1RT1A 2XGPA 4WFKA 5CITA 2WUVA 1AGPA 2NO7A 4MW7A 4G9GA 4JSRA 3MQ4A 1R9NA 3F5MA 3M2UA 5J4YA 2JJYA 1VRWA 1XGKA 4RZ2A 2QSUA 3CMES 2HZAA 3KVNA 5HQTA 1KDRA 3QPVA 3A6HA 5J47A 1PN3A 2ZRMA 3D6FA 4BJ5A 3K1AB 5JAIA 4MQLA 4COOA 2FHOB 2ZZMA 1QD1A 1H4TA 2BBSA 3KJQA 1B76A 4I4TA 3SICE 2ZPUA 3HLUA 1YX2A 4LVOP 1H66A 4HN4B 2VPPA 4EK2A 3F2VA 4DV6J 3CNOA 3MM6B 1VLZA 1QKIA 3DDSA 5E4FA 4EKEA 3G82B 2GBLA 1E2QA 3JQFC 4LDJA 2I67A 3FRYA 4Z4QA 3BIXA 1UFOA 4FUQA 1JBKA 2GHPA 1WZNA 2Z2MA 1X1CA 1UZNA 4CGYA 4R5PB 3ABIA 3I4PA 1XZKA 3EYZA 2V7UA 4H1WA 4DR1B 1CC7A 1TYEB 2ZD1B 1V9CA 2GO1A 4JBGA 2JAOA 3M32B 2DULA 4CR6A 4ARUA 1BXZA 1EFVB 2QEQA 5I3CA 4RTLA 4FDAA 1GZVA 1HW8A 1JR2A 4AX8A 5EGSA 5BSKA 1BVYF 3UTDA 3AOAA 3RASA 5IJ9B 3WOVA 1OXTA 2M3DA 2GIFA 2UVQA 2LQBA 1Z74A 4ZHQF 1O3YA 4FE7A 3ROPA 4XGRA 1Q1AA 1AV7A 3F2IA 4J03A 1Z3CA 2I3ZA 1JMTA 4AULA 4TTJA 1RTDA 1YZTA 2JIZA 4URZR 4B9SA 1NQVA 2DG2A 1XPUA 3ZWXA 6Q21A 1F0KA 2WPDD 2VJAA 1LPBB 5AVUA 7YASA 3UGKA 4ZVUA 4DWWA 3UCUP 5CYQB 3BORA 1E61A 2QN8A 3W77A 3JYNA 3W5AA 4C3VA 4CH7A 2CBGA 2MHNA 1YKWA 3HVIA 5IZ4A 4BZZA 1IBSA 1PGNA 3IE1A 2J4CA 3DOFA 2VZ0A 4XX1A 2R25B 5BPFA 2QA4G 3ZJUA 4WK4B 1D09B 1IQUA 1PK8A 4I1TA 2J9RA 1XPJA 4AY2A 4JOSA 3H97A 2NUPA 4DWOA 3HMQA 3SDSA 4OZLA 2YBDA 4CLRB 2OESA 1D1UA 2LD4A 3ZNNA 1E7SA 3B13B 3N8GA 1RT1B 3CCFA 3A3PA 3AOCA 4ZLLA 4PC3A 1S3SA 4KWTA 4LZZA 4QOSA 4NMMA 3ZLVA 1BH6A 5ADZA 1U6KA 3M2UB 3AI2A 3DV9A 4P3XA 1AT1A 2WWYA 4QG7A 7FDRA 1ODIA 2Z57A 3WMEA 4GOMD 3MPVA 4BLQA 1E2DA 4JLJA 3IDSA 1ONBA 1HLGA 2QG4A 2ZRJA 1ZD1A 3QITA 3LQ1A 1CULC 3BSNA 4HYKA 2ORIA 3A3YA 4I6WA 3KJQB 3NS5A 1GHTA 5DBEX 4HK4A 3SBMA 5T41A 3R7DA 5T6MA 5B4TA 3G68A 2ACKA 3FG9A 4DARA 3ESYA 4DMFA 3BFPA 2R11A 1JT9A 4K6OA 3FPKA 1A7JA 1YZQA 2GAJA 5CPBA 4A8XA 3TPCA 5G4LA 2ESRA 3U7HB 2QTLA 3M70A 2PRJA 1J23A 3TINA 2HNZA 1RYBA 4CETA 2PXXA 3DLKA 3AEYA 5LZ2A 3EE3A 3LXMA 4F8RA 4CLYA 1LLUA 1KI3A 1Q95G 3QMVA 1Z0DA 1T5OA 2ZJ2A 1MZPA 3EFHA 1SVMA 2N75A 2WEKA 2ZATA 2JFGA 5YASA 5KDOA 4ECVA 4XPZA 5KMGA 4MZXA 5EFOA 5IWAB 3CYFA 3A70A 2C99A 1IXYA 2VIHA 4XSGA 4ON9A 3QGMA 2JS7A 2PY6A 4FYYA 4RY2A 3U3OA 1LXJA 4HBGA 3NT4A 2DR9A 3R8XA 2A5GA 3D1LA 4M5IA 5HKKA 4B6SA 1Z5UA 4RHFA 1OYWA 2FJEB 4O3QA 4CG2A 5DE3A 3OQOA 3PCOB 1N48A 4WGGA 3HKEB 3WGTA 1F1BA 1FY2A 2G9VA 1X9SA 3I58A 3LY5A 4ZJYA 3LY9A 4HRVA 4YAJA 1C9YA 4FC7A 2H00A 4ZVUB 2J5QA 3GL9A 4PZ0A 3KKQA 3VZRA 2BBOA 4J6FA 5CGZA 3STXA 4UHBA 4B4WA 3Q0AA 2P4UA 1PTJC 4E5SA 2JHEA 1JWBB 3CEMA 4NY1A 1PQWA 4DR2F 1J4AA 1L1RA 3WRWA 1GEHA 1G6KA 5IC4B 3UGQA 4XTCS 4MV1A 4OI1A 1T0UA 3SDBA 3G2MA 2H1OA 3G2XA 2ZR8A 2X51A 1S8NA 3FMWA 2JFKA 2L3MA 1X86B 2F8EX 5CTAA 2WICA 1KI6B 1VLLA 4GOKA 1G20E 1ZPDA 1QVGR 1ATZA 4NEZA 1OAOC 1EH5A 3TJZA 2NUPB 3HVAA 1RYDA 3NXSA 2K7KA 2YQ1A 1JW9B 3CLTD 4JP5A 1R4ZA 3MJRA 5HILA 4ES1A 2ZRBA 2ZRPA 3AJ9A 3PFHA 3A3PB 2JCBA 2KBFA 4RETA 2B2XA 2GK3A 2CJFA 1KQSR 3RVLA 4CM4A 4WXOA 1U31A 1VFNA 2IYEA 2XS7A 2PKQP 4BO4A 1LF0A 3DL4A 2ZQYA 1EHWA 2Q3BA 2G17A 1JHRA 1QVWA 1AT1B 3RBZA 4LTDA 2NZXA 2Z57B 3MJ4A 4JC0A 3STYA 5JO9A 3E9QA 5H70A 3GLQA 1VPEA 1AFIA 4LQ9A 4EYGA 2W43A 3G2IA 1KZ7B 1C3XA 3TNDA 1H9CA 2BJVA 1BS2A 4P36A 4C48A 3ZVNA 2I62A 1B43A 1B99A 5BR7A 1VYVA 4FMBB 5KVCA 2B92A 3MCAA 5IBRA 3PUJA 2JF0A 5KHLB 5LNK1 1YK1A 1U9IA 5DIZA 2MT9A 4OLJA 4FMDB 1QU2A 2W4QA 2F8LA 4R01A 2VA8A 3U17A 2BRUA 4PSAA 5AT1A 5CBPA 3OBBA 1QIDA 2D7DA 3F5DA 5TMEA 2G4BA 1QVVA 1W2BR 3ZCRA 4PZDA 2G83A 4Z1OA 3HYSA 3RJ9A 4V19J 4KRFA 3SS8A 2JAWA 5KMGB 3QUBA 1HFJA 4PAWA 1ULBA 1GIAA 3KR1A 3GROA 3ELBA 1NI3A 4B3RJ 2B5VA 4ECXA 4EG7A 2HQRA 2UUBF 2C2MA 4Z1MA 3OZFA 1S8FA 3VHXA 2Y1WA 2EQ5A 1P5JA 3WDOA 3K35A 3GW8A 1F1BB 5A4JA 1KAQA 1JWWA 1RZ3A 4URWR 5DBIA 3IV7A 2ASJA 4D81A 5CEJA 3O21A 1MR3F 1AF4A 3L5KA 3LC1O 1XZJA 1ULTA 3AETA 1RU1A 2HH9A 2NXWA 5BXYA 4N8NA 3CCUS 3AU8A 4M5DB 2WF9A 3NORA 2QUJA 1IB0A 1DRJA 3N01A 2GJAA 2BQRA 2QRNA 3T5MA 3QAUA 1MFZA 4I1UA 3IEVA 1G7SA 2YNFA 2FUG1 2ZSJA 1S1WA 2VZEA 3VZSA 2C88A 2JEZA 1I01A 4QYWA 4OZ1A 2XZDA 2BGWA 5KINB 4PQGA 1GAXA 1QKKA 4OJMX 4WLEA 2HVEA 1PGQA 4K0RA 3ZNQA 4PVCA 4O2AA 2DHHA 3AR5A 2BVNA 4LE0A 4ICLA 2C77A 4JBHA 2IYQA 2IF0A 3A6FA 4CM4B 3FTEA 4H3HB 4INZA 1Z8DA 2BGGA 2VF7A 3GNQA 4RV5A 5C42A 2AP6A 2OQVA 2YXBA 2JAHA 5JU6A 1U1EA 4GKKJ 4KI7A 1UVNA 4DV5F 3S55A 4HTIA 2XVAA 2UUCB 3FEYB 5EVCA 4DR7J 4GSKA 1HI9A 1WMFA 1N33J 2LV8A 2BW7A 2XO7A 4M1TA 3R23A 2E3JA 3UFXA 1YJWS 3TAXA 2RC6A 1XCLA 1IVNA 1X5TA 4FNAA 3OXLA 4I8DA 2ZCJA 2Z8ZA 2JLXA 4MO2A 3WKCA 4KO1S 4A16A 4NASA 1Y80A 4LF9J 4R6XA 5FAKA 3DNMA 5AK6A 3EIUA 3QMWA 1GNSA 5GAGU 4AMZA 2H17A 2F40A 4G01B 3N6VA 1HNIB 1CUEA 2BOVA 1G2IA 2QNBA 3AUKA 5JH7B 1DTWA 2ROPA 5J2UF 1JIQA 3UUWA 2IYAA 1CIVA 4S1VA 1IY0A 4GBGA 1MX9A 4AX4A 5AT1B 3RKUA 2J9ZB 4MP8A 4QDUA 1U25A 3QFFA 2IQ5A 4EELA 1NXSA 3DOMA 3DTTA 1KH2A 3WDKA 1DQNA 5KVQA 1Z0UA 2FN4A 3ND8A 4LT6A 4K4VA 1RWPA 1S1UA 1Q1ZA 4H4KC 1QIFA 4M0LA 3J81U 2IM0A 3EW7A 1OF1A 2G2YA 1JHVA 2ZH9A 1XXHE 4HAXA 4U67Q 3RLIA 3O2IA 3PW7A 4MP3A 4HT3B 2C2MB 5EEHA 1HW9A 4NEYA 1TQLA 2V6JA 1JB9A 1RLOA 1U8XX 4ZU1X 1DKRA 4ZT2A 1A4RA 5A7HA 1EK6A 4BZPA 4OXIA 3PLRA 2N42A 5DW3A 4CCSA 3ZWAA 4CPDA 2E9TA 1UWBA 3DZFA 3H5RA 3AJ2A 1IWAA 4NABA 4TN2A 3T6JA 2E66A 3ZWPA 3TCXB 3WLOA 5GGXA 3VNAA 1E98A 1N5KA 2WIDA 3OTOB 3T1HB 3VGSA 3VNRA 5AVSA 1KYYA 4OU5A 2DFPA 2LDBA 1JH9A 4MW9A 2YNFB 3GLHA 1S1WB 1AZWA 3Q5DA 1NJIT 1NJFA 1OGJA 3D2BA 1WD6A 3W64A 3CNEA 4Z51A 3TLJA 2XZDB 3CD7A 3SF8A 2DNKA 2JFVA 4ZAZA 5LDDC 4R8KA 2AN3A 2QS9A 1AUXA 3U4MA 2X77A 5F0UA 1AUDA 1QU3A 2G88A 1JMKC 4PAAA 1BXGA 2I5PO 2B82A 1J5EJ 4ICLB 5FOXA 4LN1A 2GHRA 2QUHA 4ITRC 2D1RA 5AOVA 4O4LF 1N52B 5F7ZA 4YRNA 5C42B 4XQGA 1V11B 1FRHA 3PGMA 1ZIYA 4O1HA 3NGXA 2JRLA 3R3TA 1GAWA 2ZIZA 2MMYA 2QRKA 3LC7O 3G89A 4EUEA 2PA8D 4AKIA 2YKMA 4Y6OA 4OQ4A 2VOEA 4G5XA 1K6IA 3UFXB 2J3IA 5J4LA 3C98A 4JLAA 3V2HA 2NVBA 3D31A 2XQCA 3FVYA 3HB7A 2CJBA 1YZKA 2RSLA 3X1WA 4XIGS 3KVOA 3OC0A 1X1EA 3PC8C 3ILOA 4AG5A 3GTYX 5GZ1A 3IIEA 2WTXA 3T94A 2BJWA 4TLCA 3RVPA 2V69A 1LQ9A 4AZSA 1NJSA 4UY85 5FR2A 3IB6A 1PNVA 1XR5A 1OILA 1HYQA 3N2IA 2XCTB 2CLLB 3P0HA 3Q88A 4Q8EA 1JNYA 2XC9A 1JHMA 2V96A 1WHVA 3MOIA 1CIJA 3DOMB 1E0AA 1TQ8A 1KYWA 2E7VA 4MUYA 2WJ3A 1RHUA 1HKHA 5BSVA 1UPXA 1P27B 2XUZA 5KSWB 1RWPB 3H1BA 4AZVA 1S1UB 1VSBA 3R5KA 4DL0C 2ZAOA 4BFUA 1E8MA 3GY0A 2C8JA 2R6GA 2H57A 3F6YA 3NIDB 2C5FA 4D9GA 1C8BA 3PHJA 4I5FA 1DGQA 2FN7A 5IV4A 1KO7A 3JAKA 3K30A 2Y1FA 2MOKA 1QSGA 4K0KF 3CONA 5KNBD 5H81A 1ZWLA 1L5UA 4FIDA 4YVFA 3BD9A 1FMCA 5FFMA 1FUYB 1UWBB 3R5BA 2LXFA 3WGVA 1MB4A 4YCMA 4RIFA 1NP6A 4JLKA 4IIEA 4N54A 1W85A 1E5VA 2ZUDA 2IFXA 1XZAA 5L53A 4R2MA 4D8XA 1ENZA 4NH4A 1O77A 2DNQA 3GLHB 3S1SA 5BW4A 1ILWA 2AF4C 4HTAA 3RNLA 3SF8B 1NBME 2KVIA 4E70A 5JS8A 3J7A1 3BVPA 3FMGA 2V4QA 5LQNA 5JCPA 2A5YB 3H5LA 4KGZA 3LF1A 4AURA 1OLOA 5C25A 4BHTA 2RH9B 2XADA 4LIWA 5GP1A 1N2EA 2PQ6A 1BXGB 3T3EA 1EUYA 3MUFA 2XZOA 2NLWA 4EGJA 2Z8QA 4MV9A 1SWWA 5J1SB 1MC8A 4JBXA 3FHOA 4J5OA 1Q15A 1R37A 3CIOA 2VTEA 3LUGA 1M2JA 1J22A 3H1EA 5I7AA 3UG7A 4ID3A 3LE8A 2J0EA 2GAIA 2YKMB 1N6LA 1IB6A 3KCQA 1VGRA 3JD3A 1R50A 1VMDA 3P20A 3CULA 2JWNA 2PYDA 3CKMA 3PIOQ 3HU2A 1U04A 4M54A 2LLZA 4WFJA 4RCZA 5BT8A 2YWHA 4NXMJ 3I52A 2P5SA 4UVDA 2VG5A 3ORYA 1NNEA 4DJDC 3DMFA 4KY3A 4DE5A 4MJXA 1TZMA 3L0PA 1FD2A 3H2ZA 2LA4A 1HNXF 1TMJA 4YRMA 1FNMA 4W5HA 4EATA 4JASB 3R9LA 1PJ7A 1TYAE 2DBZA 4AMGA 5DNYB 1QCDA 2WAQD 3NMUF 5KVVA 4X71A 5MAOA 3PZPA 1I7LA 3TWZA 1RHUB 1NVTA 4IIJA 1OXBB 5CBKA 3TBHA 3R7BA 2XT0A 2DK2A 1W0JA 3UBMA 4EA6A 2J0XA 3Q72A 1O94A 4UASA 3CE8A 1M5KC 1E2MA 1TKRA 4N1AA 5FWXB 3QVWA 2G9RA 2N9UA 1FF9A 3QY0A 2COUA 4LFAB 1BXKA 1HZZC 1PP4A 4YXFA 1SO8A 1KWMA 3CCSS 1FYDA 3HCFA 5JC1A 3NWRA 1U7ZA 4TTAA 1H2UX 3LWMA 3AF1A 1BMTA 1RI4A 1T94A 5ITSA 2VAVA 3IV6A 5BXIA 5A04A 3MLEA 2HAEA 1J5XA 2VUHB 1W85B 3OBIA 1G16A 3GQVA 3A3NA 2V03A 3W2VA 2CL0X 3NHBA 2AJCA 4WY8A 3SZRA 1OZAA 1YOBA 3A9TA 4QTUB 3RS2A 4NLRA 3NJ4A 3WX8A 2ATVA 1CLUA 4HLUC 2TMKA 4FT4A 3WL8A 1J9ZA 2KWIA 2AJ2A 1H22A 1IIBA 1JVNA 2NXEA 2XRYA 4RR5A 1Y9JA 4RM3A 3KOWA 1W8IA 4MGYR 4F9TA 1KFDA 3BAFA 2AI1A 3K09A 3W2GA 4C7KA 2IXAA 4PQAA 1EVLA 1P39A 5C25B 2AYZA 1B8OA 1CYEA 3DKDA 1Z9BA 4P2GA 4DIOA 2HW3A 2G1DA 2W58A 4DIFA 5DYTA 4CMIA 4M99A 2WVFA 1NZJA 1DMSA 1XDSA 3GNLA 3P52A 3M49A 3NT2A 2VH7A 1SJFA 3SQMA 1NJGA 2CB9A 2E44A 4KNWA 2V1UA 1AS3A 1P8AA 2APJA 3QY9A 4BBPA 4OMDA 1UC4B 3L7CA 3D1QA 4PAGA 4P6QA 1QUEA 5FFNA 3JQRA 4C76A 3DBVO 4N6OA 2FB0A 3VZDA 2WAAA 3ROKA 2NIPA 1GPAA 2JFYA 4IS3A 4ARVA 2F17A 5L3SA 1EP1B 3V9PA 3THPA 3G0GA 1NSPA 3F7OA 4E5NA 1XMJA 2HSJA 1PR2A 3C3CA 4RK1A 3GLKA 1NW4A 2YXEA 3BXZA 3VNSA 3G0CA 4FOOA 1FDOA 4HX5A 4J1NA 1T10A 5PNTA 4UTXA 4ZCIA 3VAIA 4LYYA 1BMDA 3HCXA 5F8JA 1OAKA 4FI3F 4QYZJ 1FXRA 1U09A 3POTB 2I2CA 2NUHA 2JLCA 2P5UA 1KFEB 1WB6A 2ADMA 3IC5A 2AV5A 5CLLA 5EJ8A 3HVUA 3NONA 4DA4A 4WWSA 2GFHA 5B08A 2CE2X 4ZP1A 5EQJB 4YTEA 4G0PA 5AVWA 3R7BB 3PLAE 1HHSA 4QPPA 4L74A 3DRXA 2F9JA 4EHHA 1XQVA 4F56A 4IVPA 3VC2A 3WS7A 4K9MA 4ZS6A 3NHUA 4X64J 3DEZA 1U0FA 1RYYA 1EK2A 4GEGA 5DW0A 3R7NA 2Q45A 3WYFA 2JI6A 4O4IA 2J8SA 1S7IA 3O0TA 3ZE7A 4DADA 2BD0A 4OAQA 3G79A 2LEAA 5CLIA 4EPRA 3LGMA 4DKXA 2AOWA 5DISB 1V3SA 3HSYA 5EHNA 2RB4A 5DTMA 2DKNA 3QATA 3MT0A 3C87A 1KKMA 1ISJA 3HBJA 4IKOA 4Z0NA 1KXJA 4OGLA 2JGAA 4Y2QA 2HLPA 4RTSA 1V8OA 3A3NB 3UENA 3W2VB 4DN9A 4B71A 1NVBA 2JCVA 3BSWA 4YMTA 1GG5A 2FG7C 4GDMA 1JNXX 2EL9A 2CHEA 5F35A 4NVRA 4EA8A 1E7QA 5CYOA 5ER6A 3ZDQA 4Q9NA 2XT9A 3RF7A 1S1VB 5IAEA 2Q0SA 4I3HA 5FTJA 2GZRA 3S8EA 1H6AA 3D4PA 5FD1A 3KMQA 3LY7A 3QOFA 4NFSA 5U4XA 4LOJA 3N28A 2INGX 4KPFC 2AZXA 1F6BA 1UCNA 1TE2A 1LF5A 2FSUA 2PX4A 4HAUA 1WDWB 3S7ZA 4DIBA 1F2TA 5IHXA 1OTHA 1RJEA 4ZVPA 3M6VA 1ZKMA 2YZ7A 3RKSA 2Q1TA 1ENOA 1H1TA 6REQA 2OUKA 3DE5X 4CMIB 1NMXA 2IH4A 4PRZA 1V26A 2RDJA 5AHRA 4TMKA 3KLOA 3GG2A 2WF6A 2V4ZA 2UYCA 4CG3A 4GPBA 4JJGA 1AKUA 2YWKA 2P69A 3DFFA 3FI0A 5L9AA 3NBKA 2X0NA 2FEXA 3VA7A 4I1OA 4KQHA 5B2ZA 2D2XA 2FPHX 1E6YA 2A9KA 2PJDA 3CPSA 4ZRMA 4C11B 1TGYA 4PG7A 2Y1JA 1SIZA 1DBQA 4BAGA 3AB8A 2HEKA 4X63A 1E2NA 3OQ2A 4WXYB 2HMTA 2CZCA 3EVWA 3V7WA 4ZHRA 5D8HB 4FHGA 2JGLA 2YVUA 5L3SB 3IAAA 2IKSA 4KYVA 3BICA 2CL7X 2PVCA 4L4YA 4KLAA 2DQ4A 5EJ9A 3NH9A 3FCYA 1VLVA 3ETJA 2DHAA 1N1GA 3LKZA 4X60A 4R68A 2RKOA 3GBSA 4YP3A 2I99A 5MDHA 1ZICA 2P2DA 1VHQA 1JLBA 2I03A 1I8TA 2XEDA 4HDRA 4Q03A 1Z22A 4E0BA 1OLSA 1YFJA 1SC4A 4TV8A 3TLAA 4LR8A 1ORTA 3G9UA 3OTCA 3REFA 1CY1A 1Q12A 5DQGA 2C3PA 4JI8F 3OT5A 2X13A 3Q3IA 1URNA 4J6EA 4JOCA 3VAFA 3EUFA 3F98A 1WJGA 3JQAD 4ZU6X 5ADWA 4KPEC 1YRLA 2QI9F 3SOPA 3DLAA 1FB5A 2JDIA 3FOFC 1W581 1RJWA 3D7LA 5CT5A 3VJRA 3R7NB 5DM7Q 4J1TA 1E3JA 4O4IB 1PT8A 3C48A 5HVFA 4II3A 4UEWA 2PX5A 2GEUA 2V9WA 4IILA 4LBZA 5F9LA 4DPYA 2FSHA 3RVNA 4GYJA 1JA0A 2AA3A 4TLAA 3UVEA 1I0IA 5B0GA 3IMFA 1OX4A 4Y30A 1ODCA 5AJ3J 3E9RA 1AGYA 4CM3A 4FTWA 4R3NA 2C4NA 1YS4A 3O4RA 2IYYA 2BBTA 3D7MA 4UBLA 3OE1A 1OSDA 2NTJA 2BFDA 3Q3JB 1QO0A 1Q50A 4Q05A 3STWA 3WSVA 5K0BA 2BGMA 1S76D 4O3SA 3VKUA 4LYHA 4UUQA 1QQ6A 3OSZA 1D6SA 5JTTA 3OL8A 3WWOA 5LQSA 1VQMS 3J80U 2W2MP 4DGQA 4KT0C 3IQDB 3PEUA 1TKXA 1NBHA 5HCIA 4TYWA 1E79D 3CIMA 2ANCA 1UQTA 2HWHA 3OZAA 1A50B 2JZOA 3ESAA 1XD9A 2G82A 3PHLA 2FW1A 2C2XA 1F2TB 4ZVPB 1NF2A 3NBXX 2AIRA 5E8RA 3N53A 6REQB 3QO9A 3GVIA 4ISBA 4R3WA 4IIFA 3SS7X 1M74A 1S0UA 4FBMA 3T1TA 3A4NA 4QEKA 1RXWA 3PXDA 2IDZA 1J5OA 1BEUB 1DG1G 2VU5A 4ZI7A 3E7FA 4D9IA 1JAXA 1L9XA 2DR5A 2OBNA 5DHPA 2HREA 1E6YB 5FTKA 1NVWQ 4UW2A 3LCJA 5DTIA 1WMSA 4PW0A 4M60A 2OZEA 4ZHRB 2FW8A 3TMYA 3MTDA 2RGWA 1P6UA 4JX9A 4M21A 3V4RA 1LX7A 4DDHA 3HO8A 3OZTA 2QRPA 1EP9A 3WMXA 2NV6A 3AHJA 3RS5A 1QG4A 1NTRA 5C7OO 4BEWA 5FYQA 4X62B 1E2EA 4RVSA 3DBOB 2Q7OE 4BFTA 2RE1A 1JLBB 4YT2A 1ECJA 4D8VA 3MJEA 4RBUA 2LKZA 2R6CA 1N8NA 2WJZB 3DHWC 3DL7A 1L7EA 3NOXA 4TV8B 2DPYA 1UOOA 2BHNA 2BN4A 1QAXA 4KQGA 4QAJA 3CJ0A 1RU3A 5F0WA 4BRWA 1R6VA 2AZDA 3WC0A 5E3RA 1ENPA 3TSAA 1ZN2A 1BD4A 2V7BA 4YMHA 4M0FA 1XN9A 2F3RA 4PG6A 1YR3A 2G40A 4RC9A 3QUSA 2MLXA 1COWD 3CCZA 5EIOA 3K8YA 4PFJA 1BN6A 1KZYC 2HLDD 2JVRA 3N2NA 2CHGA 4M5NA 1MFPA 4OP2A 1ONOA 2HU8A 5HYVA 5JXSA 3KKMA 1OX4B 3T9CA 5C18A 1E1QD 3JATA 4R5MA 1E64A 4B3TB 5G02A 2C2WA 2ZWIA 1Z5PA 4X93A 4M8SA 1QHXA 3LF2A 4I9FA 4Q39A 4M9CA 1MB3A 2ZE2A 3BO3A 2VI5A 2IZZA 2JFHA 3L7MA 2PIIA 1IYZA 1JL3A 4TS3A 4X00A 3L1KA 4RY9A 5EIXA 2A9JA 1GSOA 5T6BA 3PKMA 5IKOA 1R8HA 3HPOA 3CMAS 3OZG<