1IXKA

Crystal structure analysis of methyltransferase homolog protein from pyrococcus horikoshii
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
305
Chain Sequence
LSPSMLDKLLRLGYSKLFADRYFQLWGERAIRIAEAMEKPLPRCFRVNTLKISVQDLVKRLNKKGFQFKRVPWAKEGFCLTREPFSITSTPEFLTGLIYIQEASSMYPPVALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNVEFDKILLDAPCTGSGTIHRTMDDIKFCQGLQMRLLEKGLEVLKPGGILVYSTCSLEPEENEFVIQWALDNFDVELLPLKYGEPALTNPFGIELSEEIKNARRLYPDVHETSGFFIAKIRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human p120 homologue protein PH1374 from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords Methyltransferase
total genus 103
structure length 305
sequence length 313
ec nomenclature
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F
A PF17125 Methyltr_RsmF_N N-terminal domain of 16S rRNA methyltransferase RsmF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ixkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ixkA02
3SX0A 5T64A 4GOLD 1L3BA 3VC1A 2ZLBA 3A26A 3BWBA 2PLWA 5K0JA 2QY6A 1R00A 3VSEA 3PTAA 3E7PA 1I9GA 2CMGA 3FPEA 3O7WA 1XDSA 2ZZMA 3I58A 4BP1A 4YUVA 1EJ6A 4HG2A 3TFWA 1QZZA 1NW5A 1EJ0A 3NDJA 5C9ZA 3T0IA 1VIDA 4AUKA 5E1BA 5FCDA 5KYGA 1KR5A 4XUDA 4YV1A 5GM1A 4FS8A 3UJ7A 2ZW9A 2EFJA 3B5IA 2ZVJA 3A4TA 3JWIA 1SG9A 2AOTB 3AY0A 3EVZA 2BM9A 4RTRA 1SVUA 2YXLA 3TOSA 3OZSA 2AN3A 3DOUA 4KIGA 1BKYA 1DCTA 5LQJA 4E30A 5HIJA 5E9JA 4P58A 5P8WA 2EJUA 3GRRA 4LECA 2FPOA 2XVMA 3PT9A 4E31A 3LDFA 3LCUA 5DM2A 2IDJA 3ER8A 1BHJA 1VQ1A 3K6RA 5EEHA 3FUXA 4RVDA 1JQ3A 1QAMA 2YX1A 3OFJA 2IBSA 1EG2A 4OQEA 4PCLA 4RTKA 4G56A 3BXOA 1FPQA 3S68A 3EMBA 5M5BA 1F38A 4HGZA 2UYCA 1RI5A 5DX8A 3DLCA 3G2QA 3KQSA 3IHTA 5GIPE 4K6MA 4YV2A 2IFTA 3LCCA 4A6DA 4OBXA 2ZSUA 5DM4A 3TMAA 4MQ4A 1EAMA 3QOWA 3R24A 4FSDA 5DLYA 4AZTA 2YQZA 1EQAA 4ER6A 4QTUB 4RSRA 5K8VA 2B2CA 5LQCA 5C0OE 3SSOA 3BT7A 4EK9A 2OBFA 1R18A 1QAOA 1I1NA 4BY9E 5KS2A 3MHTA 2AOXA 5EVJA 3UBTA 2FCAA 4AZVA 3T7RA 1G55A 5DRTA 2JJQA 4YMHA 3HTXA 1ORHA 4R6XA 5LQNA 5CIYA 1JTEA 1G6Q1 5KVAA 3G2OA 3B3FA 4L7VA 4GOOD 3FUVA 1V39A 2C7PA 3FUTA 3KKZA 1FP2A 5EHIA 5GOZA 3I53A 4AX8A 4E32A 3HCCA 4O29A 3E05A 3DLIA 3EVEA 3GJYA 1N7IA 3NTVA 2H00A 1X19A 5CVEA 5FTWA 4E2XA 5GINE 3PFHA 4DA4A 5DPMA 3UZUA 3SSNA 1QAQA 3FPGA 1KYZA 1IXKA 4P7FA 4CWAA 1NBHA 3DR5A 3LBFA 3VYWA 4BLWA 1RI1A 1RJFA 2ONZA 4RTSA 4RWZA 3L8DA 4PIMA 2IP2A 3M33A 1X1BA 5G02A 4FT2A 3P8ZA 2P3QA 3LHDA 4OX9Y 2PVCA 2CMHA 2V7EA 4DKJA 3B3JA 3P9CA 3M6UA 3GRZA 2NP7A 3HCAA 1AQJA 3BZBA 3GWZA 1WXXA 4XUEA 2PT6A 4FP9A 1WY7A 3TRKA 5JUWA 4YUXA 2ZIFA 4MIKA 5D1NA 4PYIA 2KW5A 1BOOA 1XCJA 2VDVE 2OXTA 2UYOA 1HNNA 1O9GA 4U7PB 5IKMA 4IV0A 3OCJA 3FPFA 5DX1A 3DXYA 5ERGB 2BR4A 4GF5A 3UJ6A 2WA1A 1SUSA 3EVGA 3OE4A 3G8BA 3CJQA 5E1DA 3KPJA 1PRYA 2YR0A 3PS9A 3HVKA 3BGDA 4YV0A 1ZGJA 3MAGA 2AOWA 4RVHA 5LSAA 3PLAE 1YFLA 3B3GA 4GOMD 4GQBA 4PYOA 1WZNA 2EG5A 2BR5A 2ZFUA 5EC8A 3BGIA 3UA4A 5GM2A 1XTPA 5LR6A 1VBFA 4IKPA 3SR4A 1SQGA 5EEGA 1G8SA 1SQFA 4BLUA 1P1BA 1N2XA 2YXEA 3GCZA 5FA8A 2P3LA 5HOQA 2AS0A 3LKZA 1DL5A 1MJFA 4LWOA 5HIIA 4U7TB 3DMGA 3NDIA 4F84A 5ICCA 4YUYA 2FYTA 3TQSA 4ISCA 2O57A 4GC5A 5KQRA 3G7UA 4RTQA 3C6MA 3C3PA 3MTEA 3P2EA 4E2YA 2OPBA 4IV8A 4OA5A 1U2ZA 2IPXA 5E9WA 4ER3A 1FBNA 3M70A 2ZULA 4PYJA 2G71A 1WG8A 1NKVA 1XDZA 1ZKDA 2OY0A 3GIWA 3UA3A 5K0FA 5CCXA 2E5WA 2XYRA 5C1IA 4EKIA 3FUUA 2NYUA 5DX0A 3DXZA 4ATNA 3M6VA 3PX2A 3GRUA 4HTFA 3UFBA 3NVKI 3E8SA 5E8JA 3BWCA 3V97A 5E9QA 3G2MA 2JHPA 4M38A 1N7JA 2F8LA 3OZRA 4PWYA 4AZSA 1XDUA 2G72A 4PNEA 3HEMA 3MGGA 4POOA 3FPJA 5ICFA 2GAFA 2PXCA 3KQTA 1NV8A 3KQWA 3QV2A 2I62A 3CCFA 2ORED 4PGHA 2PT9A 2CL5A 2GA9A 2H11A 1Z3CA 2HV9A 3TM5A 3IYLW 4C07A 1G38A 3PX3A 3REOA 4CKEA 3TKYA 3AXTA 1KPGA 1B42A 4MHTA 2NP6A 2HNKA 3OFKA 1R8YA 4OQDA 4DF3A 2BM8A 4CTKA 1P39A 2QRVA 3AWIA 3OU7A 4KRGA 2WA2A 5DM0A 1NT2A 3EVDA 2PKWA 2YVLA 1P1CA 2P7IA 4GBED 1KYWA 3MQ2A 5DWQA 1YFJA 3VC2A 1QYRA 2UZ4A 4QVGA 4BP3A 4E33A 1JQEA 2UYQA 4E70A 4CTJA 2AVDA 3MCZA 3EVFA 5CD1A 5D1HA 4M36A 3HNRA 1X1CA 3CBGA 3EVBA 1ORIA 4QVKA 3ER9A 3G8AA 1JG3A 3DP7A 1VL5A 4R6WA 3PB3A 3KPWA 4PGGA 1L1EA 7MHTA 4F86A 1YZHA 2OB2A 1JSXA 3NMUF 5DSTA 5CUQA 2IGTA 5FADA 2OB1A 3KU1A 3DMHA 3NVMB 4DCGA 4EMSA 3NW9A 5BXYA 4F85A 2I9KA 3PVCA 5EMMA 3I9FA 5FHQA 3KQVA 3KQYA 3R0QA 4E2ZA 3ME5A 5GP1A 1IM8A 3TPZA 3R6TA 4A6EA 2CWWA 3EMDA 4QPPA 1RI3A 5DXJA 4XUCA 3KQPA 3THSA 4V0RA 2ZTHA 3HCBA 1ZHFA 2ZBQA 3GRVA 1D2CA 2AOUA 3FUWA 2Y1XA 1JR4A 3QOXA 1NV9A 2P1DA 3LBYA 3TM4A 1NE2A 1M0EA 4KIFA 1VP3A 2B78A 2G70A 2I6GA 2Q41A 2VZ9A 3MCTA 4BLVA 4C05A 5LQUA 1JSZA 3P2KA 3TLJA 4C4AA 4YMGA 1YUBA 2ZBRA 3KR2A 2PBFA 2HR1A 3ELUA 4OBWA 5EIFA 2AOUB 2AOVA 2H1RA 5CVUA 5CM2Z 3BUSA 1AF7A 3GO4A 1INLA 1RI4A 2BH2A 5HEKA 2VDUE 5K0BA 2IBTA 2IDKA 2O05A 5EKXA 4E2WA 1XXLA 1VLMA 3U81A 3SVZA 1ZGAA 5EIWA 5MHTA 2R3SA 2BZGA 1YB2A 2P7HA 2NNWB 3LSTA 4C08A 2DPMA 3HA3A 2FHPA 4ER7A 3P9KA 3Q87B 3MB5A 2EJTA 3HCDA 3P9IA 1YF3A 3R3HA 4RVGA 2PWPA 3NJRA 4Y30A 1X1DA 4DCMA 3O31A 2PX2A 3A27A 5U4XA 3LCVB 3CJRA 4X41A 2QYOA 5DRYA 2ONYA 3UWPA 4M37A 3SGLA 5K0CA 8MHTA 2QM3A 4ZTBA 2GB4A 4JXJA 4B17A 3ELWA 1KPIA 2AOTA 1L3IA 2PXAA 3V8VA 1RJDA 5F2OA 4KDCA 2V74B 4ER0A 1AQIA 4PINA 4QQNA 1L9KA 5KQSA 4RTJA 2XYVA 2GH1A 3CGGA 4YUWA 3KQOA 4PIPA 2NXEA 3F4KA 3FTCA 3P71T 4P7KA 2Y1WA 5EMLA 3DUWA 1XJ5A 3M6XA 2O0LA 3GU3A 4GEKA 3HVIA 2C7QA 3I64A 1O9HA 4PONA 4YUZA 5FWAA 3EGEA 5EOVA 4PYQA 2GS9A 3G5LA 2ZZNA 1OR8A 1NW7A 2IIPA 1JQDA 4CKBA 3CC8A 3DH0A 3AJDA 3HP7A 1XVAA 1JG4A 3ORHA 1XCLA 2DULA 4RX1A 4KVZA 4HC4A 3KQQA 5GWXA 2C7OA 2ZIEA 2AZTA 3ELDA 2YTZA 3G89A 2XBMA 3OE5A 4C04A 2UYHA 1Y8CA 2GLUA 3FTEA 3LDGA 5EG5A 2Z6AA 1NW6A 1YZ3A 1TPYA 3FZGA 3BWYA 5FHRA 2PGXA 3G88A 4QTTB 5ICEA 4PCAA 5CVJA 1KP9A 1M6YA 5CVDA 3O4FA 5IH3A 1NW8A 2PY6A 1L3CA 4X1OA 3RW9A 1BC5A 3FRIA 4LG1A 4PYLA 3JWJA 3LGAA 3HVJA 3LX6A 3LKDA 3CKKA 3I5UA 3KQMA 4HTFB 3FTFA 1R6AA 2PJDA 5FWDA 1SKMA 5FA5A 3GXOA 4WXHA 2FK8A 4H0NA 5HZMA 4RTLA 4HSGA 3H2BA 2AR0A 3THRA 2ZBPA 3NWEA 4X61A 3Q7EA 2ZCJA 3NWBA 4GC9A 3UJBA 4FZVA 4MTLA 4QDJA 5F2NA 3WSTA 1RJGA 3UJDA 3R9XB 5FQOA 1FP1D 2JH8A 1TW2A 3M6WA 5EGSA 3CJTA 2BR3A 4RYLA 4WVLA 1RI2A 3UJ8A 4V0QA 2YXDA 3LL7A 4IWNA 2OKCA 1KXZA 2R6ZA 1D2GA 2N47A 3FTDA 5DM1A 2IH5A 5K05A 3EPPA 3HM2A 4RTPA 3EEOA 2XYQA 3B89A 1DUSA 1PJZA 2JHAA 5HIMA 2HWKA 5EZQA 4RTMA 1FJXA 5CVVA 2VP3A 4DM3A 5EMJA 3HCEA 2P35A 3DTNA 1EIZA 1NBIA 3DULA 3BKXA 3HCFA 5DXAA 1KPHA 3RIEA 5K0EA 1UIRA 3C0KA 3EVCA 2NXCA 2JHCA 3P9NA 2O07A 5FUBA 5B1SA 2ZWVA 3EGVA 3IV6A 4KDRA 5DTMA 2OO3A 3ANXA 5T67A 3T7TA 5BW5A 4CXMA 2HMYB 1ZQ9A 2VS1A 3BWMA 4HH4A 4C03A 4LWPA 5K03A 5K0NA 3GGDA 4NECA 1Q0TA 3M4XA 5JR3A 2P8JA 1D2HA 3JWGA 1T43A 3HA7A 4PYNA 2A14A 2I7CA 3DMFA 3EVAA 3CVOA 3FPHA 3B7PA 4Z2YA 3FYDA 5E2AA 1UFKA 3GRYA 4M7RA 3BGVA 5H02A 3SM3A 3D2LA 4EQZA 4QPNA 1VE3A 9MHTA 2ZIGA 4C06A 1AV6A 2P3OA 4P7JA 5EZSA 2ZWAA 1WS6A 5EQJB 3EEYA 3KR1A 3P97A 1H1DA 5LQAA 2QE6A 2IH4A 3SMQA 5BW4A 1VP9A 1JTFA 5LQRA 2PV0A 3ELYA 4PYMA 2NXJA 2AVNA 3A7DA 3HVHA 3KPVA 1G60A 4QQKA 5ICGA 4RTOA 1O54A 3KHKA 2PWYA 3UJCA 5BP7A 4X63A 2WK1A 3E23A 5HFJA 3SXJA 4OA8A 4AZWA 2ERCA 2PSSA 3A7EA 2B25A 3UJ9A 2YUIA 3HA5A 4RVFA 3FRHA 4R8SA 5DTRA 1RJEA 4DMGA 4ER5A 5K01A 3UJAA 2FK7A 1R74A 5EMKA 3GDHA 3OU2A 1SUIA 3TR6A 3KPYA 4EVIA 2QRVB 2Z6QA 3EGIA 2GPYA 3RODA 2LD4A 2CKDA 3A25A 1JG2A 5K0LA 4FT4A 4KW7A 2O06A 5F2KA 5FULA 2G1PA 1VPTA 3C6KA 2ADMA 10MHA 1WXWA 2PX8A 3G2PA 4EKGA 2PXXA 5CCBA 1IY9A 3ERCA 3OU6A 3JWHA 1ZG3A 4MWZA 5DTQA 2PX4A 4RV9A 4QDKA 3K0BA 1UWVA 3MERA 4GUAA 2IH2A 4UOEA 2PX5A 3LPMA 3SSMA 3T7SA 1MHTA 4KWCA 2JH9A 5K09A 1NW3A 3KR9A 3C3YA 3X0DA 3LDUA 2ESRA 1KHHA 4HGYA 5K0GA 1JG1A 1TW3A 3IEIA 2EX4A 2K4MA 5GIOE 2C7RA 2OZVA 3ID6C 1I4WA 4FR0A 4HRAA 5E8RA 3MTIA 2FRXA 3OZTA 4GOND 4Y2HA 4P7GA 4FGZA 4CKCA 5T6BA 1Q0SA 5EPEA 2AN4A 5HILA 4R8RA 5EHGA 3DXXA 3LECA 4RTNA 2JG3A 4X60A 4DQ0A 2NXNA 4XCXA 3G5TA 4FSXA 2P40A 5DT2A 3P2IA 5E1MA 5HIKA 1F3LA 3AXSA 4R05A 3BKWA 5E2BA 2OYRA 2VDWA 5LQKA 3KR0A 3OPNA 5E1OA 3KPUA 1HMYA 2B3TA 5EKUA 1P91A 2G8NA 1M6EX 3PFGA 1G8AA 5FQNA 2ZZKA 4PYKA 2Z6UA 2HTEA 3GNLA 2P41A 4DZRA 1KIAA 1X1AA 1QANA 2XVAA 1R8XA 2AN5A 2B9EA 3FYCA 3TKAA 5DSXA
chains in the Genus database with same CATH superfamily
2VQEJ 4N40A 1JJ4A 4DCVA 2BACA 4AJLA 2JVJA 3PQ6A 1L1FA 1FP6A 1SY7A 2GPNA 3OJCA 1EJ0A 2Z0GA 4C7MA 4UF4A 5LA6B 2EG9A 2XB2D 2HI0A 3RC8A 4DV5J 4KLAA 3EVZA 4DR6B 1D1SA 2P77A 2WYIA 4ASUA 4FE3A 3ZQKA 4LF9F 2V4RA 1ZH8A 1JLCA 4GMGA 4D8YA 1B7GO 4FFNA 2IBSA 1D0IA 1GA1A 5CBPB 1YUNA 3FFIB 2ZYGA 2ZSUA 4G5GA 1JLLA 3OOYA 4OHRA 3FTQA 2ZJ1A 5DJ5A 3EIQA 3L06A 3NOVA 3QBCA 4LBIA 3GRFA 1QAOA 1RWVA 1FRZA 5TT1A 1LSUA 3Q4GA 2HEKA 3RG2A 1XLWA 1AUQA 1FFGA 4JLSA 3ZLUA 1S9GA 2XVZA 5K3AA 1NBHA 4MV6A 1M8JA 4TXJA 4OX9Y 3PPXA 2HPZA 4WL0A 5AFSA 1OX4A 5MN5A 1Q0PA 4LY3A 5CD4H 4LHSA 3UT5A 2FPIA 1U0RA 1O9GA 2BBOA 3WRVA 3FWHA 1RM0A 3OE4A 4YCCA 3AERA 3NH6A 5FDLB 3O84A 1WZNA 2F1JA 4BTLA 2FWMX 2Q2NA 1FL9A 4EEZA 3BS4A 5AJZA 2V3CC 5TPWB 4Q02A 4NYMR 1VE7A 3T3FA 2AV6A 1UDBA 2QD3A 2F7SA 4IRXA 3USES 2BOVA 5KFVA 3HI4A 1FE8A 2ZSKA 3IPRA 1WAMA 1NK5A 2R25B 4M38A 1X7XA 2JRLA 5JHHB 4ND7A 2B4YA 4JFAA 4H15A 4LXHA 3VZIA 3Q83A 2IEYA 3ZDZB 1BHQ1 4HYTA 4C21A 3BR8A 1CTQA 2UYQA 4E70A 3T1YJ 2OCKA 1JXQA 4RPGA 4JA2A 2ALYB 1ID1A 1P7PA 2UZ3A 5CA5A 3OPXA 3GA0A 1O77A 4JI7F 2VAPA 3BG5A 4G5SA 3S1LA 3FHLA 2V94A 4ZYTA 3EDQB 3I8XA 3IAS9 3R6TA 4FZRA 5HZKA 3SBEA 1GGJA 1JJAA 4C98A 2PLRA 4LRCA 2O1SA 4ANCA 4HNVA 3UCEA 4DV0B 1X2EA 2GPWA 2CF5A 2NPOA 4LF6J 3BMNB 3ZXUB 3WRYC 3O31A 3TB4A 2GAJA 4XO0A 2WJ4A 2QM3A 1S3IA 3PXEA 2V8HA 2RD2A 4Q6BA 4L5CA 4KQ1A 3CRVA 3AJ1A 1L9KA 3H42A 4F72A 2CIMA 2O2CA 4LJ7A 1N34J 3GUVA 2IEBA 2DFDA 3AFOA 1RE1A 4DS5A 4GVLA 1N2CE 3ORHA 1AC5A 5CD4A 3UN5A 5JAUA 1VMAA 4UARA 2E4YA 5B64A 4NAHA 1CYEA 2H3EA 3PNIA 1FX0A 3T4EA 2R7MA 4KUHA 2WYUA 1BMQB 5L4NA 1LA2A 1ESZA 1FNNA 4RD0A 3J81j 3NHPA 2WBRA 1IKWB 2ZE2B 3ZZUA 3GWCA 3DFZA 2MSEB 4K0RA 1DTWB 2ZRAA 3KAJA 4ROTA 3A4MA 3MUFA 5F1YA 2ZTVA 1HSOA 3OPYI 4URGA 4BVLA 3I34X 5U1PA 3FBBA 5P21A 2ZROA 4D3SA 1N0HA 3DP9A 4K05A 2NQ2C 4PQEA 3X2FA 3HN6A 2NV6A 4D6XA 4IUFA 1I5OA 4JI2J 4BNDB 5FI0B 5J2TF 3OP4A 1TZBA 4AZ0A 2W58A 4NXNB 3COWA 4O59O 1YQWA 3K2IA 4I81A 4ZDNA 1XZBA 4D42A 5K9ZA 5BNTA 3TL3A 3B7GA 3W9HA 4BQRA 1R88A 1H6BA 1GYRA 2AT1B 3SKXA 2C54A 1UJ5A 2AEFA 4EUVA 1OY9A 5EQDA 5CG2A 1UZDA 4J3NA 5D4NA 2IEZA 2FPMA 4ZO6A 4BEWA 5JPDA 5AW5A 3FOWA 5B09A 1LJ8A 1FP4B 2ZYHA 1DBPA 3T3MB 1BROA 2GKOA 3GMIA 1IEQA 1WW2A 3ANTA 4L95C 4Y9TA 2GAGC 3AXSA 4F04B 1Y5MA 4UQPA 1AIPA 1T0JB 2AN9A 2J6SA 1R7IA 3IP8A 1KIAA 4QO8A 4MW5A 4MPPA 4RNNA 1KS2A 3D1QA 2ZIXB 4I50A 3ZW8A 4PAWA 1WOPA 4EDFA 2CHEA 4IWXA 5ETRA 5GADI 4N01A 2I7VA 1ENOA 4OH7A 1E2IA 3FIUA 3KLBA 2G1UA 4F4HA 4JUDX 4G01B 4NBLA 3DRXA 4DG9A 3WLLA 3N8IA 2REQB 2F3PA 3U5TA 3ADDA 1GPMA 2PSDA 3W4JA 3EEBA 1QM9A 1UDXA 1P17A 3E7DA 4YRRA 2YIDA 2WAXA 1A9RA 3AR6A 4KQXA 3TOZA 5BURA 2VP5A 4TKTA 4TSFA 5B0DA 1H69A 3OF3A 1I1NA 3ZOZA 2I7DA 1E9BA 3PDHA 3VZRA 2C2ZA 2UVDA 3OZ7A 5KVAA 2P8IA 3AETB 2BGJA 1YR6A 2ZH6A 3GJYA 4WA7A 3EOAI 1M1UA 4DA4A 4ABYA 1A9ZA 1W4RA 1PJ3A 1RJFA 1TKTA 2CUKA 4PZDA 5JWOA 3TTXA 1A1VA 4V0MA 2V7EA 2VBWA 4C0BA 1R4NA 3FF4A 3TLKA 3QPIA 3E18A 2CNKA 1UM8A 2H5IA 5C46F 3VZHA 3F4BA 2H5EA 2W2PP 2HNBA 2Q2VA 1L5UA 1TM3E 2WABA 4EBFA 3JS9A 1SG6A 4L76A 1SU8A 1A77A 4C7VA 5KQRA 3DFKA 3D6VA 2CFTA 3HUEA 2DJ5A 2WONB 3DGPA 2ZRHA 1RMYA 2KG0A 2D7CA 4YTEA 3BWCA 4RKUC 1M67A 1I3MA 3LG2A 4ZVFA 3HB4X 3WHIA 5KOIA 3SSQA 4RY8A 2R8JA 4IEFB 5F64A 4BO5A 4DIFA 1MAHA 5B2EA 2BJ8A 1USGA 1VBXA 4J9QA 4M0FA 1JXMA 3MD0A 2VFVA 1BTOA 4LRQA 3WV5A 3AOBA 4E4RA 4OHKA 1VJTA 2DKOA 4OHFA 1XEZA 4CP5A 1IBKF 3M3PA 4O4JB 2IU3A 3UCUP 2JBAB 3CLRD 2QLTA 5EMMA 3TTYA 4OZ0A 2WFLA 4LVOP 1Z18A 2PGAA 3ME5A 3S7TA 2F4VF 1WHVA 5ETQA 4FX2A 3EZGA 2GZ2A 3DCJA 5FBKA 5HRAA 3QOXA 4N4AA 3QHQA 3A1NA 2XGGA 4XQCA 5A04A 5CCMA 2YDYA 3OIUA 2HIAA 4UBJA 4BJ5A 3JD0A 5EMNA 1CUFA 1SQ6A 3ISND 2CZVC 2A0FB 1YR7A 3ORQA 1T03A 2P9YA 4CIYA 4IKEA 1KBQA 2QSZA 3GYGA 1OMOA 2YVUA 4PIPA 3WHKA 4KFBB 3OBIA 1YKGA 1NQTA 4RUKA 2ZJ6A 3VKHA 1NNLA 4DQPA 3OCWA 4U67Q 2C3MA 2Q8NA 4EHJA 1GUDA 1BXZA 4MX8A 5C34B 4TTPA 3MD3A 4NYMQ 3KDOA 4K0KB 4MGIR 1YZ3A 5BQFA 3CB2A 3JARA 4CDIA 5D5PA 4HZGA 3CJKB 4F8RA 4J1TC 1DXOA 2W11A 3FGOA 1GR0A 4OYWA 3WNZA 8ATCA 3L7NA 1Y5LB 1VLLA 4UHEA 1JLBA 2J8ZA 4OVKA 4B4DA 2BFMA 3BOSA 4F8JA 1FEHA 4YJGB 3BN7A 2C97A 1QPBA 1BJKA 3EIFA 1Y42X 4I6JA 1UVJA 5ERYA 1DSSG 4U6QA 4GMKA 3QE2A 1F4VA 1MLDA 2PN1A 3T6BA 2FPGA 2QLFB 2K1RB 2VUSA 1HDYA 4QIEA 1JHMA 4LSNA 2FP4B 3BH7A 2OO5A 3Q5GA 2WP8J 4X65B 1JX6A 1PVDA 2RGAA 3JRNA 4X66F 3F71A 4ZCKA 3EVOA 2H1SA 3N74A 5KO2A 3LP0A 1O54A 1SHTX 3E23A 1VIVA 5AW3A 1U7OA 3OFNA 3OECA 1PL8A 1B00A 1OU4A 2BGLA 4O63O 4HVZA 5LBTA 3Q40A 1R0RE 1TKZA 3GVIA 2H29A 3ZTTA 3DDZX 4EFLA 3OL7A 3OEWA 4ACAA 4DZZA 5A71A 5IK2A 2HWYA 2V6IA 1WEHA 4IIJF 1K63A 2XKBA 4DDKA 4ICLA 3G9TA 4X71A 1U99A 1X4CA 2R2UA 3D1LA 4NQZA 2ZSHA 3NT2A 5LNK1 4YJGA 1H2YA 5AIBA 2OD6A 1E2DA 4UQOA 4CM3A 2Y8EA 1OT5A 4WP9A 2I4MA 1JLGB 1J2UA 1M5PC 4YRAA 2HF2A 3QRQA 3SCLE 3FSJX 1Y7HA 3FRJA 2ODQA 2CLEB 4BQEA 3H9QA 1SUEA 4E5VA 5JC8A 5DGAA 4HQ6A 5BT9A 4EFAC 1KFSA 2UZ1B 1SG9A 4P33A 1CVLA 2OXFA 1R64A 1EVQA 3KLVA 2D3UA 2AJ4A 2C4MA 5DRKA 2AJFE 1EI9A 4OMDA 1NP7A 3T9AA 2W9XA 1C1CB 1XRJA 1H3EA 3G6KA 3D0GE 1FYXA 3MM8A 1H05A 4U9UA 3BXOA 4RA9A 4R2XA 5CNJA 3UPTA 2PR2A 2R6R1 2VD3A 4I6EA 1QRUA 4QOGA 5L1JA 4ZCSA 4DS4A 1Q7EA 4QOEA 4DARA 3C8YA 3THYA 1LD3A 4JIMA 1ZZFA 4ZD6A 4DA0A 3GONA 4PABA 2XMDA 4G5RA 4IUCS 2O2DA 4TLAA 5LM7E 3IVRA 2WD8A 2G9UA 4K5QA 1XVUA 2CD7A 4C01A 1A5TA 1HFWA 1VL8A 2P75A 3ROFA 2EFOA 2CV0A 4HD8A 4LC9A 2VG5B 4Y6LA 1Z56C 4GL2A 3G3EA 3E82A 3B9RA 2DR0A 2MU1A 2I91A 4RFSB 5JHGB 5BN5A 4B48A 5HIIA 1SUBA 5DI3A 3WYEA 2EF0A 4YJFB 2YXBA 5AH0A 3QSYA 3RF7A 1PR5A 1QAXA 2ZIUB 1ISFA 2PH5A 2VFAA 4KK3A 3ZG6A 2E5LF 5JMOA 3HZHA 3WMGA 4LVCA 4YNBA 3SG0A 3MM7A 3GMGA 3MJTA 4IM7A 1NXQA 4UEQA 4N8SA 4ARZB 3ZD7A 4ED3A 3F9CA 4HJXA 4QAQA 1CU1A 1TA4A 2JFOA 2DKOB 4W5JA 4RIIA 4JV1A 5BUSA 1U0JA 2KYZA 4EHAA 3RAMA 3CZQA 2CEAA 1CC8A 4CO3A 1S1TA 4WPAA 1PFKA 3HLYA 2QSYA 2W6JA 1KQNA 3WLEA 4GKVA 3TSYA 4CUJA 2I2BA 1QRAA 3CZ5A 3VMMA 3W2FA 3ZHBA 3K7RA 2AOUA 4XIFA 4FXPA 2GM4A 2JNJA 1KKMA 3AF4A 4FDVA 3GO4A 3IPLA 3I5MA 3U81A 4ZYLA 4PWWA 3ZWAA 1CQIA 2QYOA 1NPRA 3DVLA 1FUUA 3WLRA 3DWGA 3ZE7A 2KO1A 4G23A 3OEHA 3QLVC 2Y1WA 1T5TA 2XGPA 1PBNA 2ZZNA 3ABZA 3R5CA 5AK6A 3RROA 1JG4A 2MYTA 4K3VA 1MTOA 1K7EB 2V6GA 4WHMA 1ODCA 3JB9k 2L9NA 3PI7A 4DN0A 5C18A 4DQLA 2PGXA 1VKNA 2YVQA 1G5RA 3FRIA 3KSBC 3CSDA 3VALA 4RJJA 5FAXA 2WHOA 4E4YA 2W8KA 2HGNA 1H7WA 3U7EB 3VYVA 3O5TB 4Q66C 1L7OA 2W6NA 5SICE 2EHDA 1DJPA 1X4GA 4C0SA 1ZD4A 4NCBA 3QEOA 2CJYA 2NXCA 5B1SA 4BKMA 2DHSA 2R1UA 4NBNA 3K0HA 1SM4A 1JBQA 2ZDOA 3TDNA 3E1GA 1IDN1 1RWOA 3LQKA 1E2LA 3GT7A 4HOYA 3EUWA 2VP9A 2R96A 1WS6A 3CD5A 3RC1A 4I1TA 2B2NA 4LRDA 4DRZA 4IHJA 1M6WA 2BI4A 4RNDB 1HDZA 1GT91 4JMPA 3RIYA 3WQQA 2J3MA 2RS2A 5FIIA 1T8TA 4QHTA 4KQ6A 1NXPA 5HKAA 1X80B 3QWPA 1MHTA 3KR9A 5AM5A 1RPNA 2PA8D 5LZ8A 3RVRA 3M8KA 3IEIA 2XRFA 1XXHA 3SJBA 4Y2HA 3UUFA 4KQGA 2W70A 4C5CA 4JI3F 1NR1A 3CCBA 4V0LA 4DBZA 3D1VA 4ZT3A 1NPTO 4CPDA 3EBLA 2CNOB 2JGAA 1S9GB 5EJ4A 2CYAA 2N0SA 1UP7A 1B6TA 3DEZA 2Z1NA 2DUUA 3V4OA 1U31A 2ZCVA 4G9GA 1L7AA 2CLSA 2XUDA 2HNYB 1JPVA 4DXLA 3D3CJ 2J41A 2VH5R 2GGPA 3LVRE 2WD7B 1O94A 1LRJA 2BM9A 4EHDA 5KSPA 4N0DA 2R9VA 1IAQA 3L8CA 1X42A 3M6LA 1IBMF 3QF4A 5BWOA 3FBGA 3TUZC 1QO0D 4RORA 4ZCRA 3AR5A 2H4YB 1G2OA 4BQQA 3A1FA 3A3NA 5J2QB 3QE0A 2GEBA 4IOCQ 4MB0A 3FFWA 1RT2B 3SZ2A 1OFUX 5LP6C 4B7CA 2YJZA 1P0CA 1F60A 4K2HA 3BR9A 2V4JA 2RDDA 5AK3A 3U40A 3QXGA 2WV9A 1FMFA 4WKGA 1WXHA 3EMKA 3ESXA 2GA8A 5HJXA 1T9XA 3CPSA 2YPZA 1U6BA 2OPHA 1V45E 1T5LA 3LT4A 5HATA 1DG1G 3C6MA 2DITA 1QONA 2RHTA 4URWR 1OXKB 4TXLA 2C2GA 5C24B 3CHYA 5EXPA 3H5SA 5JAHA 1RLCL 1D4OA 5BVGB 3PG5A 5J2QA 3O03A 1NXTA 1R8YA 4ENTA 3DLLQ 3VDNB 3DO5A 2YHIB 3HP4A 3AL0C 5HQ8A 5CIQA 1JEEA 2J9EA 1STOA 3EF1A 1VG1A 3GHYA 3GGSA 2WINI 2B4RO 2X6QA 2I7TA 2Q1WA 1CUAA 1WUIS 2IP4A 3WKBA 4NLYA 3INNA 3UGKA 1PHPA 2EHJA 3QKRA 5H3CA 3I6IA 3KWMA 4QREA 3I9LA 1SKUB 5JEDA 1II8A 2EXXA 2HJVA 1YKFA 3BUSA 3OF2A 1OA1A 2KE5A 5KFDA 3FJ2A 2HQDA 4V2IA 5GZ1A 1EFDN 3WGHA 3HDGA 2E66A 1TP7A 1Q5YA 1T26A 5DYGA 4EZEA 3O3OB 3PHCA 4ZTBA 3ZZZA 3C7AA 2IV3A 1OY6A 3U26A 4ES6A 2QBYB 5FAKA 4RY0A 4DCJA 5LZ9A 3PGA1 5EMLA 4CR7A 3GFTA 1FBTA 4NONA 1MC5A 3WL6A 2IJGX 1JKHA 4XB1A 4EB6A 5JBQA 3QVSA 1I51B 3A9TA 5JS1A 3TEMA 3BWYA 3C8DA 3K5HA 4AL6A 5IAJA 3EWNA 4KO0B 1FEZA 5GJWC 1YE5A 1DAOA 1S72S 4JWKA 2HNZB 3SQGB 1IOWA 4MVJI 5EXTA 2PJDA 3I5CA 3CEMA 3DO8A 4QJ5A 3OLZA 4S24A 4NA2A 1U63A 4K9SA 3KEQA 4XYBA 3M6WA 4AJOA 3G2NA 4NMXA 3KZMA 4OREX 1C50A 2GJSA 4Q7EA 1UM9B 2PLAA 2WIBA 1YLXA 1LC3A 5MGBA 1P7VA 3PEEA 1E5DA 2P0AA 2O07A 2DPXA 1C8VB 2WE8A 4RMIA 4O2AB 3Q7TA 5K2MA 5DOZA 1K68A 4JUFA 3IR7B 5KYKA 4K0KJ 4CQMB 4EEYA 4EJFA 1SOMA 1UA0A 2JAPA 1E0DA 2W4PA 2WK1A 5CXQA 1NSFA 3M9WA 4J03A 5CBKA 4PFKA 3VZPA 3HDJA 3OR1B 5EGNA 3ZVLA 4JLUA 3ZY5A 1UMCB 4HLNA 2FVSA 4RA9B 1HBOA 2WR8A 2Y92A 1I80A 3DM2B 3L40A 1NONA 5IU6A 1L2TA 3BFVA 4EUHA 1SRQA 3C3LA 4H08A 3CZPA 5FUYA 3C6UA 4G5OA 1L5HA 1BCSA 4U5XA 4GVBB 4B3RF 3T15A 3T1QA 4LRUA 1JLKA 3K6SB 4YB6A 3SX2A 4GOLD 1U7PA 2PLWA 2PUGA 1P4JA 2OQIA 1C0UA 4O44A 1XIQA 1SUDA 4I6GA 1V8OA 1MA0A 2X7IA 1K3TA 4FX5A 3WRXA 1AQUA 2BUBA 4EFNA 1NDLA 4M9ZA 2MSTA 2A58A 1PJSA 1DKLA 3NCRA 3TD2A 5AKZA 3G6XA 3MEEB 1JYEA 4GPTA 4DWWA 2VTBB 3N7UA 5C1DA 3LDFA 4MI1A 2FHJA 3RKRA 1TMYA 5CAAA 1U8EA 2PUEA 2GYYA 4HUTA 1E4VA 2FETA 1NJFA 3CRQA 4O2BA 5NLLA 3GFRA 1VQYA 2W6PA 4GOOD 3H2LA 3I30X 2AMYA 4G1VA 1XR3A 2BGRA 1E69A 2FR8C 2VLIA 1EM6A 5JLJA 2HA7A 4R0JA 4ZDIA 3CVVA 5IT0A 1O96A 3DC7A 5DE3A 2B20A 4B5KA 1B2LA 5H4HA 3GJQA 3MAHA 4OFBA 3E5RA 1KRPA 2J0UA 3B3GA 1J0XO 2B94A 4C5BA 1OE0A 4F45A 4C7OA 4MKVA 3ND7A 4YP1A 1KVSA 4H4EA 3BORA 3BSSA 4BDTA 3WNCA 1IJFB 1WPGA 4B34A 1PNTA 2ZSDA 1EX1A 4QR1A 1MWZA 3WRYA 2XOEA 3LYLA 2IYWA 1VG8A 4ZO8A 4NLQA 3GELA 3EZNA 3RYCB 1ZPWX 2OBBA 2DC1A 2WMYA 3ZTPA 1N3BA 1XQ6A 4QWAA 4MHSA 3AEYA 4YAFA 2C1EB 4YT4A 2C58A 5J9FA 3LL4A 1CJTB 2F90A 4H6VA 2ZB3A 3AZOA 3AEQB 1ZMTA 4AWAA 2R8EA 2IVFB 2VJMB 2QTLA 1TV6A 1N36J 1WTFA 4KDEA 2V2ZA 4ERNA 1US8B 1A5AB 2W2OA 3LUFA 2HPHA 1RU3A 5EWMA 3DOKA 4DZ6A 2EFYA 1TUVA 5LQUA 4CVNA 2WWVD 4NPCA 4WMLA 1DO0A 2QRMA 4MR8A 1KZ6A 2LPMA 4XAQA 1X4FA 3N2NA 4OFWA 3M4JA 4EBEA 2HF8A 4KWHA 2DB3A 1Y9JA 4RU1A 4FONA 3VQTA 2BBWA 2YKOA 4GL4A 4KHRA 16PKA 4LV8B 2V74B 3WYNA 2ADOA 5AVRA 2ZRCA 1GP2A 3EGEA 4CV1A 3BTOA 5B57C 4PLCA 4INJA 1RWBA 2GBCA 3OQPA 5IYZB 2V03A 4O5OA 4L5IA 1RFLA 3TJRA 4ZANA 3SOPA 2XCPA 5CYQA 1L7DA 1E2BA 3IE2A 3KXLA 2CN1A 4NWBA 3JQ9A 3VJKA 1XTTA 1R8BA 1MJGM 1I5EA 4E1AA 2IEGA 1YWGO 2PMKA 1ZJJA 4KAJA 1JDBB 5T8KC 2A88A 5T7BA 1CJKA 3WB0A 1H66A 2VTVA 3FB1A 3WXMA 2W9CB 3AFMA 3BKXA 5DXAA 1Q16B 2NWQA 3D3BJ 5IZHA 5IWAB 3W8PA 1D9FA 4LIPD 3VDMA 2GRAA 1WXIA 2F1KA 5IN5A 3KR1A 1RWQA 2BFEA 2AQIA 2QP3A 5CDUA 3RFVA 3QE9Y 4GNKA 4MQEA 1FXDA 5J47A 2L19A 5I4BA 8ABPA 1CUWA 3W5BA 4KG7A 5DTRA 4NAVA 4JDPA 5GADU 2KT3A 4Z37A 1GT8A 2IU0A 2WG0A 3KHLA 4S1VA 5FPTA 3BL8A 4BTVA 2OO7A 3GLUA 4DOMA 2PX4A 2J46A 2CHGA 3LPMA 4WKNA 2IW1A 3GV7B 3T5MA 2QRPA 5K8JB 2XA9A 4X91A 1VI5A 4GO7X 1NSKL 4QUJA 1REQB 1C41A 1PWEA 3R5JB 4IH4A 4BVBA 1N0WA 4PC6A 3BHNA 3QFCA 1HMYA 3MS7A 1VFJA 3I83A 3C14C 2O20A 1TYAE 4ZKAA 5J2NB 1IK4A 2XZPA 1LPAB 5EP1A 4CL2A 2P4EA 3P9YA 3VZSA 2IM1A 5FCDA 1GXSB 3UC9A 5C8XA 4I5EA 4ID8A 1S5ZA 1T1RA 1DJ0A 5TXGA 2WUVA 3HRIA 1KVRA 3DMJB 4LCBA 4IYJA 4BNNA 3ER8A 2RGGA 1S59A 3BGOP 4PVDA 1FSFA 1FRFS 3UHPA 4AVYA 3UGJA 4R8VA 3C7DB 2A3RA 5EUBA 1WOYA 4MQ4A 5DLYA 4AZTA 3CJKA 4RW6B 1P7WA 4AF7A 1SCJB 3IQZA 4B4WA 5F1KA 1DC5A 1G1AA 3LQ1A 2DHCA 3C4QA 1BE1A 2VDWB 3PUZA 4MB6A 2V7XA 3C6TB 3OFSA 2GF2A 4WGFA 1FKPA 4KSYA 3H4DA 1YULA 3UXHA 4EM6A 1SHZA 3EVWA 3TNDA 4C6TA 1C8LA 2A5YB 3WIUA 3K8ZA 1NC3A 3PL5A 2PYZA 4JJAA 3SZRA 1D5CA 4UTXA 3BWDD 3I1FA 4TQ9A 1SV5A 4AJHA 1WD6A 2FQWA 4F4YA 1IJKA 3TB6A 5H9FJ 3V7WA 3NX4A 4BLUA 2J67A 1HWKA 2NW6A 2ORYA 4BV8A 1PT8A 1ECLA 1AB6A 1S49A 2O7VA 2NU7B 4PCVA 3P2EA 1OLXA 2H65B 3LS2A 3PGLA 4KKVA 3HDSA 1T91A 3MM9A 3JZIA 1FX0B 5ENDA 5FR2A 1WC1A 2DSNA 4OXYA 2OAEA 3OY2A 3PQFA 3PGMA 1N25A 1KOFA 4E88A 4EA8A 4Y2QA 1Y00A 4BZQA 1NVTA 1P2UA 1XF1A 4B7AA 4KRGA 1VQMS 4R5PB 2WSFC 5IWAF 3VC2A 2HNDA 2ONKA 4BP3A 4E33A 4L73A 5EESA 3IPCA 3FFXA 5IVKA 5H70A 4C3KA 2G7MC 2IXBA 3WO1A 1L1EA 2G13A 3DI6B 2YDXA 3BO4A 4PPNA 3L92A 3EZUA 3O1LA 4XDZA 2DNZA 2MEWA 3MD1A 4BBYA 3DHEA 4O2BB 1PR1A 1R9GA 3PSHA 4WH0A 1GPBA 5JROA 3TM4A 1VQOS 1KKUA 4KT0C 3TLJA 5I3UA 1XQWA 2AOVA 4F9TA 4ZOCA 3W2TA 5JRJA 5JCPA 1JLFA 1KYVA 4ERDA 4DPWA 4I2PB 1GH8A 4UUMA 4CR6A 4Q15A 2QXYA 4ER7A 2JIZD 1YA8A 2WAYA 4NI2B 2QLMA 3AJRA 5HCUA 4PGFA 4F46A 3ILXA 3QEBZ 1FD2A 5A76A 1W2BR 1NJ1A 2D1SA 4RZUA 4ZRNA 1Z15A 4NBTA 3HU2A 1D9AA 4DCNA 4BCCA 2BMWA 3HUUA 3OKCA 4ZTZB 3TBFA 2XGQA 1MWQA 3MWEA 4OU4A 2MSNA 3IAFA 3RREA 3KMSA 1Z5VA 4YEAA 4OOEA 3ZIAA 2V58A 2YZMA 1BC5A 5KFWA 1OF1A 3JW8A 5E4TA 1HPZB 4URFA 4TKMA 4LXIA 5C7LO 2H51A 1ISGA 3S4YA 5DTJA 2CLHB 2BEUA 1FY2A 4Q9HA 4NCKA 3LT1A 2BEWA 4K40A 1IAVA 2F7VA 4MPJA 1JHRA 1V3ZA 4L72B 2O54A 4DR2J 1N2CB 4OX7A 3LY5A 2FZ4A 5LDGA 4E22A 1HY3A 1QH9A 2X3GA 3KTAA 4Q3LA 5AVSA 4TT8A 3DCAA 4N3BA 1JU9A 2WZQA 1H2AS 2JRSA 2GYVA 5HUHA 3IO3A 3ZHQA 4J9KA 4JBGA 2QPOA 5LYJB 2ERCA 4GKJB 1NRKA 4K5SA 3H2KA 1L6RA 5KX5F 3Q6MA 4EW1A 2XDWA 2GXAA 4ED1A 1WMSA 3EGWA 1W85A 4BFZA 4Y98A 3DAFA 2JD2A 2FSHA 2MJUA 2FFAA 3PGKA 3R3VA 3M6AA 1T9GR 1QTNA 3HY4A 4C5AA 1JU4A 3JZAA 1JAXA 1Y1LA 5CYMB 2YWBA 4EVRA 1TA0A 3KKLA 2R4TA 1GJRA 1O0PA 2YKMB 2DNKA 1DELA 4NYIR 4TWRA 1NP6A 4NP6A 3B54A 3NAHA 4Q4LA 5AW4A 2J6UA 3EXHA 2PHZA 2Q3HA 2AJDA 4FFVA 3ZVRA 2FR0A 4HN4B 1OLSB 1WIWA 3L7PA 3TFWA 3IVGA 1NW5A 3MS4A 3WKCA 5AW8A 3HUFA 2DCUB 2AFHE 1I6WA 1S1WB 4FS8A 1OFIA 1WCV1 3VYUB 1E1NA 4EI2A 3GFQA 2C2YA 5FBWB 3IKTA 1JMKC 3K9GA 3S70A 2LW7A 2LEBA 1CY7A 3B3AA 1NQAO 1VQ1A 1GQ2A 4EJSA 1IN6A 3FKBA 3LQYA 3IHTA 1NKTA 1UP6A 4QPCA 4J1NA 3OR2B 3LP5A 1M75A 3GR0A 1YQXA 4R41A 2WSMA 3PWZA 4GYYA 2Z8QA 2CY0A 4DV6F 3ORRA 2HBYB 3D67A 2XWXA 3FUTA 3FF1A 1G7RA 4AX8A 4G8JA 4K26A 1TAUA 4B8YA 4X62B 1SA0B 4B6RA 1VIYA 1RPAA 4RW0A 2P5YA 1KY4A 2J3EA 5G02A 3SJUA 3EISA 3HCAA 4AKGA 1FDNA 5THXA 3SM9A 4MQFB 3GVCA 4J16C 3CUKA 1JALA 1E20A 2NIPA 1IJEB 2MGZA 5DX1A 5DJBA 2DNHA 1S1VA 1THTA 3IILA 1TEVA 3CZCA 5LD2B 4N5NA 1BD3A 1W2GA 4BX9A 2BFAA 4ZC8A 1E5LA 4MVJA 2FQ1A 2Y99A 4IXMA 3TQSA 2XCIA 3T7CA 1L5MA 5LA6F 1TCUA 1OXSC 1O5IA 3MMCA 3UDEA 1E9RA 4KAXA 1SELA 5BY2A 4HDOB 3E1SA 5KAPA 3L6DA 4CM9D 1CUHA 4DNPA 2D5IA 2UZ1A 1J8VA 1BZYA 2B7BB 3K8OE 1GQQA 2WSLA 1RQXA 5CP8A 3F46A 4HB4A 4BLTA 1NLFA 1E0JA 2ZCUA 5E7JA 3ER9A 1QFZA 1Y8AA 4IHAA 4NZ6A 4NBVA 4FIDA 4PGGA 5A5FA 1HLDA 1JSXA 2CE7A 3LLUA 2VATA 4IZHA 5H82A 1W7AA 1EUCA 4L6V3 5KIAA 4QULA 1B93A 2GKGA 2JHFA 3JQCA 3H1EA 4ZA1A 3N0RA 3I3OA 2AMVA 4Q45A 2EU8A 1BWQA 4Q05A 1Q1ZA 5KFXA 2XUKA 5JDCC 2PI5A 4PWDB 4C43A 2QN2A 2RHLA 2FJWA 2EOAA 2R60A 2X8WA 1WL8A 5HEKA 2IBTA 2VPZB 2FLKA 4N8NA 4G1MB 2CPZA 1IQ0A 4FHGA 4LOIA 2OP0A 1IWAA 4ER8A 3HDVA 2I87A 3CX6A 3ZDBA 1CUGA 4NKRA 1G5QA 2CVEA 4M37A 1I7PA 2H85A 4RBUA 5JRDS 1USVA 4QASA 4EFMA 4ALZA 5IC4A 4NZMA 1V48A 2B34A 3RYIA 4HEA1 4BAUA 2XI2A 1PGQA 3GQCA 3BXHA 1JZQA 2AYXA 2CWDA 5IVIA 1RKUA 1QHSA 1GEEA 5HRUA 4X84A 1G21B 2W7AA 3RTBA 3PZBA 4C78A 3H2GA 1DHRA 4IMIB 4TTRA 1WCWA 2FZ5A 2CQGA 3V9AA 4PYLA 4P2XA 3VZCA 2Q3PA 4XWKA 1KI1A 2ZPUA 3QPCA 1HR0F 2RUGA 3W64A 4F25A 3OKAA 1XT6A 1NZDA 4IUDS 1FDAA 4TV9A 3M8YA 3H90A 5F9NA 3KTQA 3ICLA 2V3VA 1JAZA 3I0SB 2Y3IA 3L4KA 2XYQA 1L7BA 4NCGB 2HN9A 5E9AA 1EBUA 3UT5B 1KPHA 1R66A 3C0KA 1GNPA 1X5TA 2JHCA 5JIBA 4CLXA 4C6SA 3T7TA 5EHHA 1P5RA 4MINA 1LPSA 3IQFA 5HMZA 4ZAFA 3FCCA 2AD5A 5IHXA 3GFYA 3HULA 4DS3A 1E66A 2ZIGA 4TSFD 3HKDA 2VHTA 3T9CA 5FLXA 1WSBA 1RQNA 3K0AB 1ZI6A 1K92A 2O8FA 4WEOA 1URNA 5BYQA 1HYBA 3VX4A 1X94A 3C41J 4FHFA 4QDZA 1SHLA 4PLWA 3C74A 3B3QA 1KP6A 3LWLA 3Q8MA 1Y1PA 3ND5A 3D59A 3G8DA 1WXWA 2FJ0A 2FN9A 2IZ6A 4MI3A 1F1BB 2JH9A 3ADPA 1O6XA 2HIQA 1QQTA 3C3YA 2JHEA 1TM4E 2P11A 4R40A 3U1BA 4CQNA 4ZODA 4P92A 1RKQA 4BJHB 3B8EA 4TZTA 2Q5FA 2E29A 4I67A 4IIHA 2EEZA 2B9EA 5JVGQ 1CB0A 2C7BA 2BKLA 4RXUA 4YBRA 4JY7A 2HSGA 1UBJS 4MCAA 1PFQA 5IDVA 2DCUA 1TVEA 2EYQA 4OO3A 3PWKA 1U8UA 3NGTA 1D2EA 2DIVA 3MXHP 1KS9A 2QL7A 2ZXEA 3C8ZA 1DC8A 2Q1YA 1JR2A 2C20A 1R6BX 4BBPA 3EICA 3PEVA 4C4XA 3HHNB 2QZJA 2I2DA 3UFXA 4UEOA 4J1TA 4WFQA 1A3CA 3MZIA 2AQHA 1EDDA 4B3RB 5M5BA 4HGZA 5DX8A 3I2IA 5E2QA 4DAEA 4CT9A 2ZAMA 4PFSA 3PJGA 2KBEA 2JSXA 3NONA 4GP6A 2QTVB 2Y1JA 5I7FA 1VB3A 2OBFA 1ODSA 3FNIA 5IT4A 1UKEA 3FVWA 4WFKA 4C3ZA 2AFIB 4GP7A 4A4JA 1H2TZ 3O8CA 2ASJA 2GZMA 1BN6A 3HWRA 4CWAA 4DUGD 4XYEA 4QIWD 1CYDA 4PIMA 2B98A 2RKIA 5FWYA 4UOFA 3HSDA 1XRQA 1WXXA 1ZAYA 3OEHD 2WZDA 5REQB 1NYTA 1M1ZA 2DF8A 1Q8KA 2D3O1 5LSAA 2FNAA 1R0ZA 3M7VA 1H72C 2V5HG 5E0OA 1XRSB 5I9SA 3OTIA 1L6IA 3H8WA 2V9CA 3U17A 7ADHA 3C4VA 4BLGA 1CC7A 3P94A 4DYVA 5KFLA 1WVMA 1HPZA 2FZCA 5ICFA 1CB7A 3IQGX 4LDRA 4N7TA 2QV6A 1OPIA 4AX4A 3RTGA 4NLPA 4R54A 4HLBA 3DWIA 4BCDA 2BDTA 4DR6J 2YVLA 4X44A 5I3CA 3EXHC 4CTJA 2VPXB 4GPIB 1TZCA 2XYPB 3LNTA 4JUIA 1W49A 2X15A 4WYWA 4IF6A 3AKCA 3B2QA 3EG9B 1XRPA 3S6EA 2O7RA 1RBLA 2XBLA 1X8LA 2EAUA 3DYIA 1L5YA 4MGEA 4F04A 2FXVA 2ZAGA 1XFDA 2HMWA 3RB0A 3K05A 4NK4A 5MF6A 2QUHA 2DCLA 1JSZA 3JATA 2GNOA 3ZV6A 2X23A 3E9ZA 4YO7A 1ZR2A 3GYXB 1FQJA 3C8MA 2I6UA 1P31A 1G4AE 4BMVA 1L4UA 3S2SA 5I3UB 4EGJA 3CZMA 4EO8A 2VJDA 2QVBA 4NY1A 1LWCB 3I2YX 1G8HA 4TTAA 3A27A 1JNRB 1JJVA 3MMSA 1NK6A 2ATEA 3W2VB 4X3PA 1NN5A 3HXQA 5L6MB 4LJ4A 3ZGZA 1W0JD 3ES9A 4A8TA 4R4JA 3UGQA 2DHXA 3BFKA 1U2GC 2MKIA 1L7QA 3I76A 1BS2A 1JDPA 2ZUEA 4ZIWA 1OIVA 1ODKA 2RJOA 2H9AA 4M9UA 4D4GA 3FDJA 3V8BA 2XMUA 4BKPA 1VLYA 3QLJA 4MR7A 1MENA 2AW0A 3LGAA 4CLZA 4WXRA 2X5OA 4AXJA 4TV9B 1R6AA 1MEOA 3PDUA 4LHZA 3NWEA 3FYHA 2WSEC 1G0OA 2NQPA 1RJGA 4FPIA 1C14A 4FBLA 4TL6A 4C4ZA 4UY85 1WHSB 2BRKA 2YXDA 5D0HA 1G0NA 2V8PA 1IKWA 2BMEA 4FVTA 2VPWB 5HR5A 2HWKA 4LZAA 1YSCA 2I55A 1WB5A 3ONVA 3RBVA 2DG2A 1NT4A 4Y65A 2GK6A 4CXMA 2YBDA 2ALJA 1U0HB 4K9QA 3R27A 1Q2XA 3T7IA 5H8WA 2QXTA 5CCLA 3RBEA 2ZM5A 3GG0A 2JEJA 3UJNA 1U80A 1JR3D 3E8XA 3V55A 1H2FA 5ADHA 1N5VA 4HHUA 1Y82A 3OLYA 3PCOB 3PD1A 1XEWX 1FKOB 3IWNC 1N2HA 3TLAA 4CQMA 2NYAA 5HOEA 3H13A 4GG1A 1NXXA 4XIYA 1RAGB 1VRWA 2A9PA 3EW9A 4IXNA 2VH7A 2KJQA 4KBYA 1E3LA 3K35A 5KTOA 1NR5A 4PQUB 2V4UA 1Q95G 4PC2A 1IBMB 2HHTA 1T8RA 3IXMA 2R5NA 3ILVA 4ED6A 1C9EA 3DVAA 1KXJA 2XGMA 3DL7A 1T3OA 3TVDA 1DJNA 3F5MA 3I9OA 4MW7A 2W9AA 2FRXA 3AW9A 5CFPA 3U1NA 4FYPA 1UDWA 3ZJUA 3DMTC 3ZIAD 3P1JA 2IPNA 3U44A 3H04A 3TCKA 5KJCA 3ZXXA 2GCOB 3ZY2A 3TPFA 3EYZA 4L50A 2I4NA 1N5TA 5DS7A 3RVNA 1JN0A 2HA2A 1TGYA 4KZKA 3NALA 2I2AA 3T0IA 3W0LB 1DMSA 3OJSA 2PK3A 4IDNA 3EX7C 3E3XA 1RPJA 1MRNA 4I46A 1GUAA 1A2QA 1ZWLA 4DR4J 4M3NA 2HSZA 1OYEA 1IVSA 4FOPA 1JLAA 5I7EA 2FMKA 3R6DA 4PRZA 4MVJE 1KI4A 3RV4A 5LMNJ 1ZS6A 1IMOA 2JGFA 4QU5A 4Y0AA 3NEPX 1WF6A 1FJ2A 3FZYA 1RZRA 5C31A 5IX8A 4RZ3A 4JOQA 5FLKA 3MM4A 5D5QA 3MJCA 3NDRA 2XMKA 1KL7A 3NHUA 3EULA 2D0IA 1LDNA 621PA 4WESB 3SSNA 3F41A 3NRBA 4DN6A 5LWQA 1BFKA 3ZWBA 4WAUA 5CW2A 2O2SA 3KLGA 2VJKA 1OXMA 3SIPB 3FOFC 4RE5A 3V7FA 1SD2A 4IIBA 3LHFA 5IC6A 2K3IA 5A8RA 3RIGA 1PSWA 2MY8A 2EFQA 5T4FA 2MB0B 2I3GA 4L3VA 5LR6A 1J0DA 1XZHA 1AOXA 2B51A 3KAPA 3H5YA 3HXTA 4E4TA 5CURA 1TF2A 1EZZA 1JXAA 1JFFA 3CMAS 1E1QA 5KOYA 4NV3A 5LKAA 2E1AA 2G5CA 1RAHB 3WK8A 4TVBA 4C8KA 3FLMA 2X2FA 2JHPA 2WT9A 5KTPA 2N7YA 3CC4S 3F6EX 2QRGA 3SXLA 1S5PA 3MXTA 2UXDF 3VBCA 4ZT4A 3W5CA 1J2VA 1P39A 1RT7A 3SYLA 1VJDA 4A4DA 3PDWA 1C4CA 3BD9A 4QGSA 2YIVX 1E1RA 2H1CA 3DDHA 2BMVA 1N9ZA 1AQ6A 3WADA 3PTWA 1QV9A 3RS5A 5JO9A 2EBWA 1GO2A 1P6UA 3OUYB 1NM5C 1BJTA 1SR8A 2PGIA 3L8MA 1YI1A 4ANFA 2DNRA 4IDHA 2KB2A 2Z2IA 2YQ4A 1NV9A 5AR1A 2JGLA 2G1KA 3K7EA 1X1SA 3WYGA 2ZRJA 1T6ZA 5GY7A 4BWMA 2H1RA 4QEKA 1C3EA 4TQUS 2FGKA 3PNSA 3K5PA 1UFQA 5MHTA 1KO7A 4YRGA 4JJ8A 1QU3A 4N76A 2EW1A 4RVCA 1PT6A 4CO1A 3DOIA 2XITA 5L1KA 2QYSA 1BWVA 2L0XA 2M7SA 4X4VA 3ZHXA 3RB3A 1A8PA 4AN0A 5FYQA 4AYWA 1K5HA 4HWKA 3HE3A 1YJ7A 4NBWA 1J1IA 4OPMA 1K8QA 3QX7A 3UK2A 2IEDA 3TIFA 3BXZA 1R8QA 2BN4A 3K6SA 1FIUA 4Z9FA 5BYRA 3F73A 4F4WA 1N8NA 1AK1A 5IS2A 3ZLBA 2E5FA 3HHLD 3TZKA 4ESOA 4JHLA 2DNMA 3OTQA 3D4OA 3RSHA 3PFEA 1UJNA 5K45A 3PL1A 2WCXA 1BC6A 4RYLA 2BR3A 2DWOA 4WWSA 1JKIA 1VKJA 2M70A 4EY8A 4KV7A 1F5SA 4Z7QB 5J2PB 1BQMA 3CRMA 3EZ9A 1Z16A 4L57A 5HP1B 1RTDB 1O57A 2ZYDA 3AVYA 1CK4A 3SR3A 3GLHB 1FVXA 1G5PA 3LP0B 4X4QA 4DU7A 2ID4A 5HVFA 4M60A 4JBNA 4I8IA 4LSNB 2Q6BA 1GMVA 3KX2A 1N32B 5C2GA 3Q85A 2QNBA 5B3AA 1QE5A 1O94C 4AZWA 3VSAA 3I0NA 2EYUA 1S2LA 4MAFA 1QHGA 4DQXA 2OI2A 3UI3A 2ATCB 2D74A 3TR6A 1K3FA 4LJSA 5A6PA 2J7KA 4EMBA 2PX8A 1DAEA 2ZD1B 1J56A 3ICPA 4U8VA 2RQKA 4LVOA 2UUBF 2QR3A 4C0HA 2ESRA 3O73A 3DV2A 4D44A 4K9PA 3OHBA 4HPJB 4TQSA 1HRDA 3EE6A 1D5WA 4MWEA 2I80A 3ZWQA 1NPYA 3UPDA 2JEFA 4F3CA 4M86A 3FR7A 3R8YA 1SURA 2V7GA 2RD5C 3UW1A 4LF2A 3VOTA 2H5JB 2P41A 2QMQA 3NXZA 1X1AA 1SNYA 3H84A 3FBWA 1BX1A 3CUUA 4PC7A 2P6NA 1YBFA 2ZZMA 2J09A 4A48A 2J07A 2XRZA 4XGQA 2AV5A 2IYFA 4FR2A 4Z8XA 2DPYA 3RYTC 4UTNA 2DJIA 5ESWA 1ZPVA 1UZNA 2C88A 2BL4A 5A5EA 4A8YA 5DQHA 1JDTA 2Q9UA 2DWPA 4XFKA 3UV7A 4URVR 3EDMA 1U5CA 3ET4A 4RVDA 1MV5A 1ULUA 3BGFA 1HYSA 4M0UA 1L5LA 3G8CA 1A8QA 1XBWA 1NJXA 4JROA 1JQGA 5DLGA 4FR5A 1FTRA 2R48A 3OX1A 3QXJA 3FSGD 4X8LA 2XOXA 2JHGA 3M8ZA 3MYYA 1GRVA 4E09A 2EKLA 2RHRA 1JKJA 2NVOA 1KGDA 3C5CA 4ZCLA 1QAJA 4O29A 4E5NA 4WTYA 1ZR4A 2O0MA 1TE2A 1Y1TA 1RABA 3I52A 2C5GA 3QI7A 3LUCA 2IWHA 1S02A 1H98A 5L1IA 1LLDA 2CMHA 4BXOA 3PXXA 2WVEA 5LXYA 2ZUVA 1WY7A 4KYUA 3EXFA 4F71A 2NVWA 1NASA 2GCGA 5HP1A 4PY2A 1OQAA 4HGOA 3KTAB 2JLZA 4FS1A 4RVSA 2R751 5A9SB 4R1UA 1GITA 1Z5OA 5I7UA 4TKVB 4A82A 1F17A 3U02A 1XCOA 2FYTA 3EPGA 2ASVA 2OPBA 1TR0A 4MYSA 4ZAVA 4CLSA 3WGVA 3DE7X 5LP6F 1YIAA 3E7FA 4MYCA 4EB0A 4M0PA 2JIRA 1WMDA 2OM2A 3NDPA 1I94B 1H38A 3H2JA 3DRRA 2LCFA 1AB5A 1NMQA 3U0VA 4UMVA 1BQ3A 2Z4TA 3TL2A 3GFVA 1DBDA 3QWAA 4B47A 1TZ2A 2WRZA 4OJKA 3ONWA 5C35A 2PVPA 1ORIA 4MVJF 1OX4B 2ZGVA 4XCQA 4GKKB 4KGZB 1LX6A 3GLGB 5L3RA 3NW9A 3M1IA 4I4TF 5DN6A 5GMKa 4CEHA 2IC5A 3W6OA 1MKYA 3RZAA 3A3NB 2B69A 3W2GA 1PT7A 4DV2F 3KV1A 3DLKA 4RGBA 1JAYA 3KL2A 4GI5A 3TLXA 1QO7A 1N3IA 1U09A 1ZMXA 1KEZA 3T3GA 5IJXA 1EHIA 3E3OA 1MQ8B 3FNGA 3DLGA 2HK2A 1LRKA 5DRYA 4D8UA 2CVIA 6FDRA 3AIOA 2JGEA 2M8HA 4MS4A 2GK3A 4HKQA 1SO8A 3U09A 4HH1A 1Z38A 4NYZA 2ANBA 4WKBA 3OT5A 5IYZF 4ZZIA 1Z0AA 3SYNA 3ZEAA 1NVXQ 1GM5A 1JEYB 3PUHA 3ETEA 1N52B 5IM0A 4MDEA 2XY7A 3QGIA 1E79D 3E4DA 3QITA 2QYCA 1ZJ6A 4FBMA 1N6KA 4J0KA 3E2PA 4LG1A 5IM4F 2W6JD 1JPUA 1B73A 3PRDA 4OB8A 1NAHA 2P5UA 2RIJA 2NU9A 1XU7A 2DH9A 5H16A 4WADA 2GETA 3GEPA 4ECEA 2I1RA 1TZKA 4R25A 4DLEA 4DX7A 1ZS9A 5DNAA 2WNHA 3ULHA 4PLGA 2JFFA 5FLXY 1IWGA 1HQUA 1POXA 2XS7A 3C1TA 3ZDXB 3C19A 1Y3DE 5KFIA 2QT9A 3TLEA 2VTDA 2QN6A 1ZZEA 1GTJ1 1KIMA 1TT5A 5KWSA 3ECSA 3H5VA 4QGFA 2W48A 3MAQA 2JVKA 1EK0A 1XL0A 4XDGA 1KZGB 2BCGY 3U3MA 4PTLA 4HQNA 3PQEA 3WMXA 1D2MA 5BWMA 2Z6QA 2Q6OA 2CKDA 5AP9A 3OI7A 4C2BA 3ILIA 4DR3J 2HGMA 2H48A 1Z28A 4OJ1A 1JT2A 5D2CA 2W71A 2PBRA 4P80A 1I2MA 2ZE2A 1H94A 1CZOA 2Z57A 2P0EA 3OJUA 1G20B 1K9SA 2AWOA 1OFVA 1YVFA 2W0MA 3C43A 1IKVB 1M73E 1K47A 4NZ0A 4UDNA 4EW2A 4R2MA 2Q27A 2E5HA 4Q1DA 4Q1FA 2OC4A 4QOHA 2BKAA 3O95A 3CDAA 4EDHA 1T3LA 3E7PA 2PE8A 2Q5IA 3ZD6A 2Q5CA 2ADFA 3CW2A 1AS2A 3ZBPA 1KHWA 1HYHA 5E3AA 3RBZA 3W5YA 4J9SA 2QRZA 4D0NA 3FBFA 4IQFA 5MN6A 3HSJA 2JAQA 3ZBUA 5CB6A 2R7RA 3CKLA 3FR8A 4LBPA 4CFZA 2GPJA 4DLGA 1S9FA 3HQ4O 2X7HA 4MPDA 2Y4OA 4XVRA 3T5CA 2B1GA 3LC7O 4QTUB 2IXGA 5KYYB 4WK0B 1ZI8A 4K4UA 1B6GA 3RNOA 3THTA 3PUWA 4QE3A 4KJXA 1R6VA 5ALIA 4QJBA 2H2FA 3LC1O 1Q1BA 2JD1A 1M5OC 3VZQA 5BNZA 5GGXA 4N8OA 4LK2A 1KH1A 5LMNB 1CW2B 4HDGA 1KMHB 4UZFA 3O1JC 2AG1A 1FXWF 4URSA 3ZQUA 1AROP 1QO0A 1HETA 4B4UA 1VRCA 5GOTA 1RRVA 4JL8A 1Q53A 4QJVA 2P2ZA 2ODNA 4BNFA 3PZPA 4CL0A 4I1VA 1OWLA 3AR3A 3H5NA 1NIJA 4P5DA 1RHKB 1GZ3A 3HI9A 1E32A 2R8PA 3A36A 1C3LA 1UJ4A 3FEXB 3MMBB 3EZYA 4FNOA 2CNLA 3GIKA 5EGYA 3CUNA 2VONA 4DR1B 3AEXA 3CV3A 1HXHA 5BV1A 4E0BA 2VJAA 1ABFA 4K9NA 3VR0A 5CA0B 3OFKA 2C7GA 1YTLA 3WQPA 4MS1B 4C11B 1JVBA 2A5LA 4WY8A 1GUYA 4KGVB 4KQ9A 4BMCA 3PHEA 3LF2A 4CYUB 3W06A 3QLUA 4E14A 3I8SA 4YAKA 1D04A 4C4YA 2VOJA 1S1VB 3VI4B 1Y9ZA 1NSQA 4B31A 2YKNA 4Q9JA 3EXCX 1EBFA 3ZY3A 2OIHA 1B99A 3S7RA 3GG1A 3KZKA 3OTGA 1PEAA 2PXHA 2RCYA 1C1XA 3VTAA 1CC1S 5IT9A 4B3XA 3EK2A 3VNAA 4Q21A 2IOQA 3UFXB 1RIIA 1DG9A 3EJ6A 4Z49A 1G3QA 1ZXXA 2H4WB 2C7OA 1OB5A 3C16B 4BHTA 1EKRA 1AURA 1E9FA 1PL6A 5LMCA 2OGTA 1R8PA 1PJ4A 1GGNA 1Y5IB 4DLSA 2R84A 2FJEB 2RHHA 2BMFA 4O3NA 4IWNA 2C4TA 1NVDA 2JZNA 3DAHA 1QHXA 1EUDA 1GTL1 2V2VA 4MS3A 3DOJA 3O4HA 4ZO9A 4LR8A 3CNQS 4JC4A 1VKRA 1XMQB 4DEVA 4AZ0B 3FNNA 3QUCA 1IK6A 4DL4A 3EPJA 4S1WA 3AV3A 5F8MA 5EPUA 3JVVA 1L4EA 5IVDA 1VCNA 4A2CA 2J5AA 3BHIA 1BXGA 4R01A 1AUOA 4ER5A 5DNEA 2CZQA 1UXIA 4EVIA 3UNGC 4D9GA 4WBNF 1YRAA 2ZE8A 3AZQA 2EKZA 5DCYA 3FYUB 5EIXA 5I9IA 3K0FB 1ISJA 1ULAA 4CTOA 3AI7A 3O3MB 5HK9A 1R89A 1GNKA 4I9FA 2VJLA 3ND6A 4FGZA 4LYEA 2YOGA 1Q0SA 2IOFA 4ECWA 3CVUA 4L16A 1VL2A 1GG9A 3CSKA 5E2BA 2R47A 1CUEA 5DO9A 4ZOQI 2QV0A 1SZJG 2VUIB 3FSGA 5EJFA 1ANKA 3A26A 2ZEJA 5DP1A 3LQ2A 3K1AB 3M32A 3W77A 3B60A 4Z9AA 4YRIA 4INZA 3BM7A 4XI9A 4ZHRA 4B3RJ 2Q3FA 2VUUA 1QGOA 4UCQA 2WUFA 1ULTA 3OSNA 4RUAA 2HKIA 1ADBA 1EEHA 2ZK7A 2ZUUA 2PZMA 3IC5A 4HWGA 1H3FA 1OLXB 1HG0A 4XD7D 4NYIQ 2A2ZA 1ZTTA 1IYZA 1JNZB 4EK9A 3B5EA 4ZLNA 4ZGGA 4LBWA 3C16A 1FFXA 1SC1A 4OIXA 4K3UA 1HNXB 4JSTA 1WBDA 2W8LA 4BGEA 5TPZA 3AD8C 3LPDA 1OC4A 4RADA 1D9DA 3R09A 2AFHB 4BC1A 1BGVA 2ECQA 2IZ0A 3BICA 1TO1E 3I28A 4GFDA 4EHKA 5KPJA 5AKYA 4A8JA 4N03A 4NQRA 3PP8A 1UPPA 4BBAA 2ZTSA 2HQSA 3HCNA 5CH7B 1XVTA 1KNZA 3GBPA 3DZDA 3C2PA 3WP1B 2MR6A 1RTHB 2VWHA 4ND8A 1E7SA 1CERA 1PR0A 4AG3A 2DR3A 4W7HA 3BXFA 3CF6R 3H5RA 2PMEA 5TPZD 4H7IA 3PIPQ 3A13A 4K6KA 3H99A 4TU8A 4R16A 3M9LA 3O2QB 1MVNA 2V7QA 3DGPB 1GPAA 3OSUA 1XQIA 3DEKA 1RBOB 2E82A 2J0SA 5ITZB 5AKHA 1TL7A 1QVVA 4X64F 2B30A 2VRCA 3AKYA 1L5SA 2ZRPA 2CL5A 5LB2A 2ZJ0A 2Y67A 3BREA 2Q5QA 4PSCA 4QODA 2I33A 1UJBA 2IRXA 4BIIA 2FDRA 2BJDA 2PAAA 1JEYA 1V3TA 5KAKA 1NXSA 4KITB 3ANYB 5IFLA 3PEWA 2AE2A 3Q8RB 4R6WA 4JLAA 3FNEA 3ZHVA 5KDDA 4M7WA 1SJ1A 2UAGA 3RG6A 2BFBA 4WJZA 4FYYB 2RE1A 3OV7A 2ISQA 4MAAA 5BV8A 3RHTA 4BFTA 1U2DA 1B14A 2WBMA 3EIXA 4EPTA 2EFPA 2RSQA 2LMIA 5J2UB 3H1FA 1JKFA 4F26A 2XTZA 2Q4OA 2HA0A 3N2ZB 2R3SA 3JQEA 4C08A 4UC0A 1ZSYA 5M04A 3SD7A 3WOVA 4DCSA 4W4MA 3R3HA 2QZSA 1CXZA 2ONYA 2XQIA 1QCDA 2B1RA 1RKVA 3U61B 4YCMA 3AB4B 3M6XA 1IUOA 3DB2A 4NCNA 3ZI4A 4MMZB 4Z9XA 1P19A 5ALQA 4DR5J 3G8TA 4GLOA 1RZVA 3M2VB 1J8YF 1EB9A 4J9VA 2F62A 3Q3EA 2ATCA 3QW4B 4CLFA 3GUHA 3Q98A 1XRNA 2FHMA 4OJ3A 1TJPB 3DNCA 3OZDA 4BNXA 5LJ3Y 4Q4AB 4O4IA 2P62A 2IOYA 4XDYA 5AVJA 4HQKA 2ZBPA 1D03A 3SI7A 1E2PA 2ZSEA 3DHVA 3G0HA 5I7VA 1N36F 2O3QA 1UZLA 3IP5A 4O2LA 2VF7A 2WKRA 4H4KC 3HCWA 1ZNXA 2NT4A 2QM7A 5AMXA 2H9IA 4MW2A 5AUQA 1NR7A 4PR6A 3EA5A 1UIRA 5LQDA 3D31A 3F1LA 2MGZB 4Z3DA 1Q7TA 1HF3A 4COKA 1SVDA 5KFUA 5BNFA 3Q7SA 3BCUA 4F12A 2FPGB 5DNYB 1LLUA 2F67A 2PEYA 3T8YA 4GGOA 1DCMA 3U19A 2OPQA 4QYMA 1N2IA 1LWNA 1ZW6A 2C61A 5HFJA 1MG5A 3G71S 1SCBA 3F7OA 1Z83A 3MM9B 4XWOA 4UMEA 1N1EA 1JNYA 4G1PA 3L7BA 4MVWA 3H17A 5AKEA 3EEFA 1HI1A 3R0VA 2FMUA 5HVHA 2OFPA 4TMXA 3IOBA 2QMXA 1U9IC 3TTTA 4DPYA 3ZR4B 1D1TA 3K31A 1ZBTA 4NL4H 1EG7A 3QTBA 3VO9A 3PFBA 4LGMA 1SWWA 4JQCA 4PR0A 5J1SB 3NTOA 5JDCA 1RDRA 1SBQA 5LPNA 5C81A 5KNCA 5JAQA 3VJLA 2TYSB 4KWIA 4ZHSA 1OHHD 2X9GA 4JS0A 4D82A 5I4KA 3UWTA 1GEHA 3D7LA 3LY7A 2WSSA 5KOJA 1E59A 2WSYB 4HWTA 1PG0A 2AMLA 4CM6A 3C7CB 2H6EA 2MQMA 4BNZA 3RRKA 1TRHA 3OIYA 3F56A 2WEKA 1LNZA 3CUSA 1N6RA 3OCCA 5E9JA 1QIKA 1P7YA 3JYLA 3TXAA 1R3UA 2F9LA 3H1TA 3QXCA 1PD1A 2NYHA 1G63A 4P5PA 1HQ2A 5FB3A 3FUXA 2WTMA 5AW6A 3X1ZA 1XN4A 4BWJA 3IEKA 4NPAA 3KHGA 3VPFA 2HLDA 2FHKA 4N54A 1N0IA 4U00A 3IGFA 3VVLA 1XR5A 1RRGA 4GO1A 4H3VA 4I4BA 3N9IA 4YRDA 3H5LA 1PUXA 4XRRA 2AXEA 5KT6A 1COWA 1JFVA 5FBRB 2ZUGA 4EI7A 3WBKA 3C3CA 2W2KB 1TCAA 3KJHA 4M0MA 1Q74A 4C6HA 4P53A 5D3MB 1IPFA 3PKMA 1LVHA 1UC5B 2A86A 1DFDA 4MUAA 2OXTA 1W9MA 1UEIA 2FQXA 3RVPA 1SKQA 3RR8A 1XKLA 5FP0A 2Y0DA 1M9NA 3T3DA 2G1HA 1CV2A 4HV4A 3NBPB 4XSHA 3PUKA 3HG7A 4WBXC 5B5SA 2WBLC 2X9VA 3M70A 1EP1B 3KZNA 1S8FA 3QMPA 4AS3A 4PGAA 1KARA 4PHTA 1Z4QA 1MB9A 1T1EA 1N57A 1Y6ZA 1JMYA 4ARUA 1DP4A 2IDZA 1HI9A 4L85A 4TN5A 3QV2A 1TTPB 1W87A 2HV9A 3CRW1 1I7QB 3IURA 5IP5A 4FBTA 1EQ2A 4Q2MA 4QICA 6AT1A 1IBRA 3FVTA 3R5KA 3KRTA 1N3LA 1WO8A 4RZ2A 2HVEA 3COPA 4U0KA 3HNOA 4JKIA 1OI3A 4LF9B 2KB0A 3IAS1 1GQFA 3ZTYA 4EMSA 1TVRA 2Y4NA 3ND9A 5IABA 3LWMA 1WXDA 4E2ZA 4D6PA 3A9UA 5KT5A 1RI3A 3RVBA 1E2UA 4L8YA 2FI1A 5DW3A 4U7UK 3PKYA 1JS1X 5DLDA 1K4MA 1IQUA 4GD3Q 4KQIA 1RT1A 1R10A 3MRXA 2YWCA 1KF0A 1T4GA 3UO0A 1XXLA 3FMFA 5CDHA 2J9YB 3GFSA 3IGNA 5IK2D 3GEBA 2P2YA 4PXCA 1I1GA 4OX6A 4JI8F 2PWPA 1DQNA 4AXXA 1VOTA 4CCYB 1T3SA 3MUOA 4NSNA 2O5DA 5EI5A 4FF3A 1W48A 2HSEA 4ALJA 3WX8A 3K5LA 2GVZA 3W9IA 4F3OA 1WEKA 1PFYA 2RGBA 2X14A 1SBCA 2ZKUA 3AHFA 4O0MA 1W1UA 1C7IA 3S1TA 2KG1A 2Y1CA 3KEOA 2D5BA 4TY9A 3MTJA 1LPPA 4JI3B 1BVRA 1T36A 3BYRA 1PFGA 1KEUA 3SFZA 3R7NA 4P35A 4DV4B 2OK8A 4QELA 3JCZA 3RBAA 1J99A 5GADl 1X7XB 5B30A 2OV1A 3IMFA 4ZV7A 1GRRA 4OGLA 2QVLA 3R7LA 3PQDA 5E3CA 1Z6ZA 2ZI9A 4CTMA 3LQRA 2DH6A 1Z0JA 3OQVA 3BGLA 3MF4A 2BDPA 1C3JA 1QK5A 2GVDB 3D4IA 1M1GA 5EMJA 4AMUA 5FLEX 1MQ9A 3A1WA 1T15A 1SKWA 3EVCA 3ENAA 4K81B 1NKEA 3I3SR 3YASA 4HATA 3SDEA 3ON5A 3QKSA 1JXVA 2ADCA 4I4NA 3AR9A 4O3SA 4WZZA 2A5JA 1NSYA 5LQAA 3O4VA 2QD1A 3KJVA 1EK6A 5ED4A 4QDUA 1VQ9S 3W2WA 4DQIA 2HMAA 4B82A 3SXJA 4Z4EA 3IOYA 5C51B 4ALIA 4CLHA 2GGSA 4HB3A 3SNKA 3ZJ5A 1GKYA 1ZRHA 3BAFA 1M2VB 9LDBA 3H40A 3V2IA 3P9RA 4LMAA 5EKTA 4N56A 5FL7A 2KZZA 4QDKA 5LMNF 4HB0A 5FX2A 1U0EA 3TJ9A 3DMRA 1T29A 1LPBB 3RYIB 5C3MA 4UEKA 2VPXA 1TMGE 5HILA 2IM3A 5JOQA 5A3QA 1E1CB 1EVYA 1F1JA 2CYBA 3W1EA 1QTMA 4A8WA 3H9GA 4JA0A 1GTSA 3RB6A 3WZMA 5DSXA 3HC7A 2H1YA 3T95A 1Q22A 4WKYA 3GEIA 3AONB 4G0PA 5C5DA 1FNCA 2ZWPA 2C57A 2F6RA 1XZGA 3IWXA 1U4BA 5JISA 1IUPA 2COKA 4NZ7A 3FOZA 2E7ZA 2IM0A 2YXLA 1FRLA 3B6IA 4HUQA 1Z74A 4ZI7A 4CM8B 1ZPDA 4CT8A 3CE9A 2CK3A 4A0QA 5CDGA 5HF9A 5C7IO 1IQPA 5EE1A 3SDSA 1PG5A 3MM8B 2DQKA 3VNUA 1E7YA 1BQEA 4D9FA 1KORA 2DYKA 2FMIA 3LPAA 1MB0A 2VYNA 3AA9A 5CLLA 1FP2A 2X58A 2MXYA 2YY3A 2F4NA 1AGXA 3ENNA 4QLOA 3IVCA 3SXUA 3M1YA 3TDMA 5KFBA 5J1TB 4KRYA 5J4KA 1BDIA 4FP9A 2ZIFA 3BA1A 1G6OA 3GMTA 1XUOA 2IHBA 1AY0A 1HNNA 2EK1A 4GR4A 2M6LA 1G4UR 3WJ7A 3CCRS 4C89A 3HYCA 4RK1A 5JJLA 4JBHA 1UADA 2XB9A 1EVZA 2LKZA 3PNKA 1FFWB 2BYTA 2HZVA 3BF8A 1UBEA 3OOEA 3V9PA 3TTVA 1RLOA 2F17A 2Z5LA 2GCPA 4C3LA 3R7BB 3C3PA 2C03A 2CB0A 1XDZA 3PC8C 1KBRA 1E1LA 2FLVA 3KOYA 3K0AA 3IT3A 1G7CB 1SB6A 2ZRFA 1U28C 1THZA 2ZIWB 3TANA 3C1UA 4TYMA 1J33A 5DW0A 2VRWA 3OG9A 2VHWA 1FI4A 4XIJA 2EFEB 4TMKA 5FD1A 2H7CA 4F92B 3JQFC 3INTA 3NS5A 4LFCJ 4HXYA 5TARA 1E4EA 3DZIA 1QP0A 4USUA 5CJ2A 1NP3A 5HF5A 3RUFA 4TXSA 3CIFA 3QXXA 4F50A 4MQFA 1O96B 1P5JA 4Y9SA 1GFIA 3KKNA 1CJBA 3LWDA 5FEMA 4D1YA 3KAKA 3ZLVA 1JFTA 3N0WA 1KQKA 4FKZA 3RSLA 4UHCA 2ZBQA 3GRVA 1HZJA 3ESAA 3Q8KA 4YR7A 4NLGA 4GR5A 1S7GA 3K5MA 3JVUA 1EUZA 4YMGA 1K97A 3VV2B 3OICA 4P36A 1HT3A 5KPDA 3CKMA 3O1HB 3H9UA 5FIUA 2MQQA 1DY3A 4HGPA 2DHQA 4OZLA 1S89A 3ELWA 1YG0A 4KC0A 3RS9A 2GEUA 4YONB 3W9UA 4DJTA 4ZOEA 3GJXC 3WYBA 4YUZA 1UBFA 2IYLD 3OQHA 4MWGA 4GMFA 3RGWS 4CKBA 4WUVA 5BSKA 4PNHA 4KNYA 4TLQA 2PMCA 4I55A 5BWBA 3ABSB 4QGBA 3I0MA 3AVPA 3TJZA 4NXMJ 1N2JA 2DT5A 1VMBA 1YJXA 4RGYA 2CLLB 4FLFA 1K6IA 3ZLJA 4ZO4A 3LYUA 2KLBA 4DV2J 4DNFA 4P73A 5DM7Q 3WAGA 5LZ2A 4L8WB 3TGLA 4RTLA 3FCHA 4HSGA 4TQAA 1GPNA 1S2OA 1FP1D 2WW4A 3DMDA 5C5JA 3G8YA 3I8OA 3LL7A 5DM1A 2RHOA 1Y10A 1OWNA 2YVKA 3BBPA 5EJ6A 2C2OA 1VLVA 5ESRA 4H1VA 4M9CA 1L7MA 2C8JA 1FFHA 1WI6A 5LU8A 1WDLA 2QLNA 4J94A 4MUJA 3GJ8A 3I61A 3JWGA 2V6AA 5DGHA 1T9WA 4I66A 1WLSA 2A9FA 3G82B 4DPMA 4O4JF 1PJCA 1N33B 2YS7A 4X8MA 2BP7A 1BXKA 5D85A 3EEYA 4M1ZA 3ZHOA 1ODIA 3LLMA 1VJWA 3ZH9B 3ZCUA 2OORC 1DT3A 5IZCA 2XBUA 1BUXA 2WWRA 4IMPA 2PUBA 1PP4A 3DBLB 1I13A 3QWFA 2ORIA 2KHCA 4Y28C 1N54B 1H2RS 3D0RA 1G21A 1B43A 4C2AA 2WI8A 4RIGA 2Q6KA 1HWIA 3H9CA 4PSDA 3P45A 1CFJA 2EQAA 1WCYA 3BH6B 4B3IA 2DBQA 5JALA 1RT7B 4PLVA 1T6BY 5BYAA 4I6YA 3BK1A 1RWMA 1GADO 2GFIA 1UT6A 1YVUA 4RK4A 3DXXA 4QPJC 1QQ5A 1O7JA 3VTZA 1YIJS 3GXBA 1ZDMA 1VHJA 4UOZA 3KPUA 2LU1A 3HJVA 1M6HA 3DG9A 1MW7A 4ILLA 5FQNA 1S7IA 5HWSA 4U95A 4NBKA 3I2JA 2HADA 3ASUA 1ZH0A 2QY6A 3PPYA 4LJ5A 4TWZA 5AI4A 4DRXA 4IDOA 3LK6A 5ADUS 5ETLA 1F5NA 2IZ1A 1NSTA 3EIUA 521PA 5TB5A 2HC9A 4W98A 4ZDKA 3B5IA 4B45A 3SF8A 1F8GA 1HEUA 1PZEA 3TOSA 5HK8A 2C1ZA 1LLQA 4AKEA 4OJNA 3AF0A 3UMGA 3NLCA 2DLNA 3HJTA 3QI2A 2B7CB 3AGQA 3EJMA 1U2CA 1G21E 2A0WA 2NO5A 3QYFA 3QPAA 4NU8X 2O8BA 2B36A 5FJIA 3ZIUA 1TKXA 5IANA 2ZXFA 1WDKA 2H7XA 1VE5A 1KK3A 1ML4A 4YJ3F 2QNRA 2X1HA 3G9QA 2D3TA 4MV1A 3P0EA 1MAVA 4LJ9A 2BSXA 4UNNA 1CR0A 4YDSA 2LBPA 5L3QB 4GYJA 2EPIA 4OHPA 5C1BA 1AKNA 3BK2A 5G3YA 1XTIA 4XVCA 2QLBA 2J6IA 2H4ZA 3IERA 3UCZP 1A9SA 4A36A 5K3CA 4F4ZA 3X1JA 2LYVA 2C98A 1RDFA 3O8WA 2V97A 4QYXA 3BGIA 3UA4A 4LUBA 3NI2A 1MIOA 1SQ5A 1YRLA 1W46A 3G2JA 2RHGB 3O2IA 1CJSA 5HUJA 2I9PA 2WOOA 4IV8A 1JHYA 5AOAA 4DC0A 1IONA 3FA2A 1O0BA 2O2YA 2N75A 1G17A 5J5CA 2OTJS 4RACA 2PUWA 1IN7A 2OZLA 4FMCB 1XZEA 1M6VA 1BLUA