1IXKA

Crystal structure analysis of methyltransferase homolog protein from pyrococcus horikoshii
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
305
Chain Sequence
LSPSMLDKLLRLGYSKLFADRYFQLWGERAIRIAEAMEKPLPRCFRVNTLKISVQDLVKRLNKKGFQFKRVPWAKEGFCLTREPFSITSTPEFLTGLIYIQEASSMYPPVALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNVEFDKILLDAPCTGSGTIHRTMDDIKFCQGLQMRLLEKGLEVLKPGGILVYSTCSLEPEENEFVIQWALDNFDVELLPLKYGEPALTNPFGIELSEEIKNARRLYPDVHETSGFFIAKIRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human p120 homologue protein PH1374 from Pyrococcus horikoshii
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords Methyltransferase
total genus 103
structure length 305
sequence length 313
ec nomenclature
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F
A PF17125 Methyltr_RsmF_N N-terminal domain of 16S rRNA methyltransferase RsmF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ixkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ixkA02
3G88A 5F2NA 4CXMA 2PXXA 4C08A 3NVMB 4OA8A 4YV1A 5DM1A 3P2IA 1L9KA 1IXKA 1DUSA 4LECA 1TW2A 3GRZA 4V0RA 3EVBA 1FPQA 2NXJA 2P1DA 2C7RA 2NXNA 5DSXA 3M6UA 1N7IA 4X1OA 4E33A 3SXJA 1QAOA 2AS0A 5LR6A 1P39A 4P58A 9MHTA 4PNEA 4YUWA 5EGSA 4ER0A 1MJFA 3A4TA 2PX8A 3GU3A 4ER3A 2ZWAA 1R8XA 2WK1A 3TMAA 5KYGA 1EG2A 3R0QA 4RSRA 1VP3A 4YUVA 5BW4A 1NBIA 1ZGAA 3BZBA 3CKKA 4PIPA 4Y30A 3PX2A 2AOUA 2C7OA 4CTJA 2ZZNA 2AOUB 3MB5A 5EZSA 5DTMA 3MCTA 2P3LA 1Z3CA 3Q7EA 3CBGA 3NWBA 2YVLA 5EQJB 2HV9A 4UOEA 5LQAA 4RVHA 4CTKA 3PX3A 2PY6A 3UJDA 2GH1A 3EGEA 2IH5A 1EIZA 3LDGA 4X41A 1UFKA 3EVAA 3UFBA 2AR0A 2GA9A 1DCTA 2AVDA 2GPYA 3MTEA 3LCUA 1JSXA 1NW7A 5DTRA 4PGHA 4PYJA 1VQ1A 3BGDA 2CKDA 2Z6AA 2JH8A 2O05A 1QANA 4GOLD 1UWVA 2ZTHA 2C7QA 1X1CA 1XTPA 2NXEA 3G8AA 5EMKA 2DULA 5CVJA 1X1BA 4P7FA 5EIFA 5HFJA 3QOXA 3OU7A 2R3SA 3Q87B 4EKIA 1NW8A 3OZRA 4DA4A 1G38A 2XBMA 4F85A 3DMGA 3P9IA 1XDUA 3HVKA 4OA5A 4C03A 2HNKA 3UJ7A 3VC1A 4A6EA 2I7CA 1BHJA 4X60A 2ZULA 3A27A 5C1IA 3GCZA 2BR5A 2G72A 2PX2A 4HC4A 3CJTA 3P2EA 4RYLA 4POOA 5DPMA 5KVAA 2OO3A 3LECA 1L3BA 3EGVA 2EG5A 2ZW9A 2VZ9A 5DM4A 3MHTA 3SGLA 3ORHA 2CMGA 4L7VA 3HVJA 1XXLA 1B42A 2QRVB 1NW3A 4RTSA 1PJZA 5KQRA 3LDUA 2VDUE 3KPVA 2ZLBA 4K6MA 4Z2YA 2ZWVA 3BWCA 3MGGA 1WXXA 3OZTA 4PONA 1G60A 3GWZA 2B3TA 2E5WA 3DP7A 3VYWA 4CKBA 4X61A 2B9EA 5CVVA 4BP1A 1KPGA 2UZ4A 3B3FA 5DX0A 2PSSA 4RWZA 2P7HA 2XYVA 3DMHA 5D1NA 1Q0SA 4RTNA 3UJ6A 5GIOE 1DL5A 4AZSA 3G2OA 3M4XA 3EVZA 5LQRA 1VE3A 5LQUA 4R6XA 5HIIA 1WZNA 3F4KA 3FUVA 4FGZA 4FT2A 3BWYA 3IYLW 3VSEA 3CJRA 1OR8A 4PCLA 3FUXA 4B17A 2C7PA 1MHTA 2ZVJA 5DWQA 2PXAA 3U81A 5K05A 3TM5A 5ICCA 3SX0A 4XUEA 4JXJA 2YXLA 1IY9A 3NJRA 3GXOA 3MERA 5FCDA 1H1DA 3BKWA 3E8SA 4GQBA 1JTFA 4R05A 3KU1A 4HH4A 3DXXA 2NYUA 5LSAA 1TW3A 3SMQA 3KPWA 2NP6A 2XYRA 1FP1D 1XDSA 4PYMA 5E2AA 3BXOA 1NE2A 5GWXA 4KDRA 3NTVA 3T7RA 4H0NA 1ORHA 4RVGA 3A7DA 5FADA 5T67A 3TPZA 4Y2HA 2V7EA 5EG5A 2LD4A 5LQCA 4KIFA 5HOQA 2VP3A 3EMBA 3I9FA 1FJXA 1VLMA 4C05A 1JG1A 4ATNA 4EK9A 3B5IA 4LWOA 2IBSA 2BM8A 3AJDA 2WA2A 5FWDA 1AF7A 4E2WA 1T43A 3MTIA 3JWHA 2N47A 5FQNA 4FS8A 2B25A 1SUSA 2EX4A 3D2LA 1PRYA 3HCEA 3NDIA 3OU2A 5EHIA 3MQ2A 4YMGA 5CCBA 1G8AA 2OXTA 1ZGJA 1ORIA 2ZIEA 4YV2A 5FHRA 3HA7A 1I1NA 3OZSA 2R6ZA 4XUDA 2PT6A 1JG4A 3P9CA 2KW5A 3EGIA 3THSA 4CWAA 3CVOA 5CUQA 5EEHA 3HA5A 4E70A 3UJBA 2AOXA 2G70A 2JHPA 1F3LA 2OKCA 4M7RA 3I58A 5GM2A 3G2PA 2HMYB 2OY0A 1SUIA 1ZKDA 4PYQA 4HTFA 2IDKA 1VIDA 4HGYA 1VPTA 4RVFA 4DZRA 3ELUA 3HCCA 4HGZA 5FHQA 4P7KA 5G02A 1JTEA 3AWIA 5CD1A 5DX1A 3DR5A 3TFWA 3SM3A 3L8DA 5EIWA 3DLIA 2CMHA 4MQ4A 4QTTB 2ORED 4OQEA 5HILA 3BWMA 2ZBPA 2IBTA 3UZUA 4AZWA 2ZIFA 3B3JA 5DXJA 1UIRA 2ZIGA 5E1BA 4C4AA 2ZCJA 3KR2A 2NP7A 5GOZA 1YB2A 3HVHA 5T6BA 4RTRA 1JQEA 1O9HA 3PLAE 3OCJA 4DCMA 2OBFA 1EAMA 5DLYA 5FQOA 3B7PA 3BKXA 3M6WA 3HEMA 4E2YA 2IIPA 4RVDA 4PGGA 4RTMA 2IGTA 3G2MA 2I6GA 3EVFA 3UWPA 10MHA 3ME5A 5K0JA 2BZGA 5DXAA 4LG1A 1AQJA 1RI4A 1ZHFA 2EJTA 3UBTA 1EQAA 5DX8A 3A7EA 4GOND 1KIAA 3DH0A 3DTNA 3LSTA 5M5BA 3FPFA 3P8ZA 5LQNA 2B2CA 3PTAA 5GINE 3RIEA 4R6WA 4ZTBA 2H11A 3EVDA 3M70A 5K0BA 2JHAA 3HCBA 4PIMA 5KS2A 4LWPA 2Z6UA 2PV0A 2BR4A 3AY0A 5LQJA 4EKGA 3P2KA 2P35A 1X19A 4M38A 2P8JA 2ZZMA 5HIJA 5K0CA 3KQOA 1YFLA 5C9ZA 1L3CA 4WXHA 1JSZA 5E1OA 3SVZA 1IM8A 3EEYA 2WA1A 2F8LA 5BW5A 3BUSA 1JG3A 1VP9A 2FHPA 2O06A 3NDJA 4GBED 3TM4A 2OPBA 3G89A 3HA3A 3KQYA 4OQDA 2PKWA 4E32A 2JJQA 2NXCA 5EVJA 4FSXA 1D2HA 3FUTA 1M0EA 3KQTA 3FPJA 1Y8CA 3DOUA 5E1MA 4RTJA 4V0QA 1I4WA 4MIKA 3FRIA 4QDJA 3G7UA 3FPEA 1O9GA 3M6VA 2PJDA 4MTLA 5FWAA 3R24A 4P7JA 3OU6A 2VDVE 2YUIA 3TOSA 4AZTA 8MHTA 4HG2A 5CVEA 5CIYA 2AZTA 3P9NA 3WSTA 1NW6A 3A26A 3KQQA 4YUXA 5EHGA 4F84A 1SQFA 2O0LA 3HCFA 3BGVA 3AXTA 4RV9A 5DSTA 3ER9A 5HZMA 3DLCA 3ER8A 1WY7A 4PYLA 3LCVB 2GS9A 5B1SA 4E2XA 1O54A 4QTUB 2O07A 3KR0A 1X1AA 4XUCA 1P1BA 3LKDA 3P97A 2YX1A 2HR1A 1HMYA 4EVIA 3FTEA 4QDKA 4MWZA 4RTOA 1QZZA 4DKJA 4O29A 3EPPA 4PYKA 3TKYA 5ICFA 5K03A 2BH2A 3FTFA 3LHDA 3OE4A 5DRTA 3EVCA 2PX4A 4DMGA 1RJFA 1XCJA 4FR0A 2YQZA 4PYNA 3R6TA 3M33A 2IH2A 2H00A 3KQVA 5DT2A 1ZG3A 7MHTA 5EMLA 4C07A 5ICEA 2QM3A 1KR5A 3SR4A 3BWBA 4AUKA 3LDFA 1WG8A 1XVAA 5EOVA 3REOA 2QE6A 3PT9A 5HEKA 2P3QA 4U7PB 3E7PA 1SQGA 3UA3A 2NNWB 3C3PA 3AXSA 3O7WA 1KPIA 4RTKA 2UYHA 2PVCA 3MCZA 2ZZKA 5MHTA 4R8SA 4RTQA 1D2GA 2GLUA 3OE5A 4PYIA 3RODA 5GP1A 2G71A 2ZBRA 2UYCA 1EJ0A 2Q41A 3UJ8A 3K6RA 4GOOD 5E2BA 2VDWA 4OBXA 3NMUF 1RJDA 3DULA 1ZQ9A 5BXYA 2FYTA 3DUWA 5E9WA 2FPOA 1KYWA 3LGAA 4HTFB 4QPNA 4QQNA 1M6YA 2FRXA 2XYQA 2ZFUA 5FUBA 2PWYA 2Y1XA 1WXWA 3B89A 3K0BA 3RW9A 4EQZA 2PWPA 1XJ5A 2Z6QA 4MHTA 2FK8A 2BM9A 4QVKA 4F86A 2ZBQA 3KPYA 1XCLA 3G2QA 4WVLA 3V8VA 4GUAA 3HCAA 1KYZA 4PWYA 1YFJA 1NKVA 3T0IA 5CCXA 3IV6A 2H1RA 2K4MA 1XDZA 3TR6A 4ISCA 3EVGA 4KVZA 3FTCA 2OZVA 2P3OA 5K09A 2AOTB 2ESRA 2OB1A 3CCFA 3R3HA 4IV8A 5DM0A 4M36A 3PFGA 4XCXA 4DM3A 3TQSA 3CJQA 4DCGA 2G1PA 3HCDA 4P7GA 4FT4A 5EEGA 5GM1A 2YXEA 4PINA 4KIGA 5T64A 3KR1A 3OFJA 3PVCA 5IH3A 4QQKA 1YUBA 3G8BA 1QAMA 3HM2A 5U4XA 3IEIA 4YV0A 3GRUA 2QY6A 2FCAA 3MAGA 3E05A 5C0OE 2UYQA 4QVGA 1RI2A 3DXYA 1R18A 1G8SA 3I5UA 3ID6C 5EPEA 2CWWA 1Q0TA 5GIPE 2IDJA 5FA5A 4BLVA 5K0EA 2IFTA 3GDHA 5H02A 3R9XB 3P9KA 2OB2A 1L1EA 1YZHA 1VBFA 4KWCA 5HIMA 3QV2A 2YXDA 5E9JA 3SSNA 2ONYA 3FUUA 4GOMD 1JG2A 1NW5A 1RJGA 3G5TA 4ER6A 3PB3A 2ZSUA 4HRAA 3JWJA 1TPYA 2FK7A 3KPJA 5DTQA 3VC2A 5KQSA 1YF3A 5HIKA 2B78A 3NW9A 1JR4A 2AN5A 2ONZA 2P40A 1SG9A 3B3GA 3CGGA 3FTDA 1G55A 4G56A 3FPGA 1AV6A 4CKEA 2EJUA 3GJYA 4RTLA 1F38A 3UJAA 4A6DA 5K01A 2IPXA 5DM2A 4BLUA 3HP7A 3UA4A 2P7IA 5E8RA 1FBNA 1AQIA 3G5LA 4ER5A 1KHHA 1RI1A 2AOWA 1BC5A 1BOOA 3I53A 2IH4A 1RI3A 1I9GA 4C04A 3GGDA 5IKMA 2QYOA 3HNRA 5DRYA 3LL7A 1R74A 4BLWA 2GB4A 1NBHA 3FUWA 5F2KA 3TLJA 4KDCA 3QOWA 5EMJA 4GC9A 5K0LA 3JWGA 3TRKA 4AZVA 1P91A 3ELWA 3SSMA 3ELDA 2V74B 5E9QA 2ADMA 5EMMA 3X0DA 3A25A 3UJ9A 5FULA 3NWEA 4KRGA 1N7JA 4RTPA 3KQPA 5ERGB 2AN3A 3I64A 2I62A 3EMDA 3FPHA 4GF5A 4E2ZA 4PYOA 2OYRA 4DQ0A 3E23A 5EKXA 5F2OA 3SSOA 1JQDA 1X1DA 2JHCA 5JUWA 5EZQA 1R6AA 1M6EX 3IHTA 3GRRA 3O31A 3KQSA 5CM2Z 4C06A 3KPUA 3LKZA 3HVIA 2AOTA 4IWNA 1NV8A 2AN4A 4GEKA 4BP3A 2YR0A 2HWKA 3KHKA 4OBWA 4BY9E 4X63A 3T7TA 2O57A 2VS1A 2IP2A 3JWIA 2DPMA 4U7TB 4ER7A 1NV9A 1SKMA 3CC8A 3FZGA 3FYCA 2PBFA 3P71T 3FRHA 5ICGA 3BT7A 2PX5A 3KR9A 5EKUA 3LPMA 1HNNA 5D1HA 5BP7A 2G8NA 4NECA 2PXCA 2XVMA 2UYOA 5CVUA 5E8JA 3NVKI 4QPPA 1D2CA 3GIWA 3LCCA 3GRVA 3C6MA 3BGIA 1JQ3A 1U2ZA 4FP9A 1FP2A 5K0FA 3EVEA 3UJCA 1QAQA 3PS9A 3O4FA 2BR3A 2HTEA 1BKYA 1RJEA 2AOVA 4PCAA 3C0KA 4E30A 2JG3A 1NT2A 3S68A 3DMFA 3DXZA 2EFJA 2AVNA 3ERCA 2ERCA 3C6KA 4FZVA 4IKPA 4KW7A 2A14A 4R8RA 1WS6A 1G6Q1 3V97A 5FTWA 4E31A 2P41A 5JR3A 5CVDA 4CKCA 4EMSA 2YTZA 4DF3A 4IV0A 1R8YA 3TKAA 3LX6A 5EC8A 3THRA 2JH9A 2Y1WA 3ELYA 3H2BA 4RX1A 5FA8A 3KQMA 1SVUA 3GO4A 4YUYA 1N2XA 1L3IA 5K0NA 2PT9A 3PFHA 1INLA 3LBYA 2QRVA 3HTXA 2I9KA 1EJ6A 4YMHA 5K8VA 2PGXA 3KKZA 4FSDA 1YZ3A 1KPHA 3OPNA 3GRYA 1P1CA 3LBFA 3OFKA 4GC5A 5LQKA 1QYRA 4AX8A 1RI5A 1R00A 2GAFA 1V39A 4M37A 2XVAA 3M6XA 3EEOA 3C3YA 4OX9Y 1VL5A 3FYDA 3GNLA 4HSGA 3T7SA 1KP9A 1KXZA 2CL5A 3ANXA 3KQWA 5E1DA 4YUZA 5K0GA 2PLWA 5P8WA
chains in the Genus database with same CATH superfamily
4GRDA 3NVMB 4BJ3A 3AIIA 3PW7A 5K3FA 1OREA 2W8ZA 5ARDA 1A2OA 3CRMA 2G7MC 2PX8A 3ZE8A 2XLJA 3MM7A 3GY0A 1PZMA 3KJFA 2GAAA 1FY2A 4XGKA 4GUDA 1I7PA 3JTMA 4E09A 2GEUA 4AUMA 2CJXA 4I4BA 1PAUA 2WW4A 2DETA 1S99A 2AKYA 4QARA 1X1BA 4YRKA 1Q7CA 1WOYA 2D7CA 2QX0A 1R0YA 3FDJA 3NANA 3P94A 2I6WA 1T15A 1BHJA 4RW4A 3W63A 5HO4A 4POOA 2VF2A 3C70A 2ZI3A 3MHYA 2JJ2D 3O3CA 1L5NA 1KDYA 3T1HJ 1HNXB 2D2XA 4E3ZA 3PW0A 1NSQA 4FYPA 4TXHA 2XYGB 4CKBA 3Q83A 2AH5A 5FUMA 3RG2A 3GYBA 1ZCJA 2D3OR 3JQFA 3TRJA 4C9BA 5DWQA 4Q9IA 2KT3A 5BY2A 1BIFA 2E5FA 1ZD8A 3NM6B 2F4VJ 2CJAA 4AYTA 4NE9A 4N5NA 3TPZA 1GPJA 1I7LA 1YVFA 5FBLB 4CL8A 2JGMA 2RGBA 1PVOA 1PJ3A 3E1GA 1SXJE 1GVNB 2XOEA 5LXYA 2P65A 2Q5CA 3D2LA 3HCEA 4D56A 2R00A 1E98A 5JOQA 3TTWA 5FV4A 1ULBA 1O97D 3FCAA 1KLMA 1EFCA 4OZNA 4NPCA 3NAGA 4OK6A 1J49A 3AHGA 2P9TA 3HKBB 1PNQA 1QVAA 4I5FA 1M2GA 4WK0B 2AW5A 4K4XA 1PJSA 3ZGVA 1I2DA 1M8GA 4DCMA 3OVSA 5HMMA 3T9CA 3NS7A 2A0KA 4FYYA 5T7BA 4FCCA 5CYQA 3HKCB 4MXDA 3TTSA 3SF8B 4GP6A 4QW8A 3UN2A 1TK8A 4BKPA 3WMRA 3CLSC 3IPLA 4HBZA 2OCBA 2HBQB 4Y2GA 4K4UA 3ZGLA 2HUNA 1Y6JA 2GYVA 3JYHA 3AHIA 1HK7A 4GBED 1YDLA 4O8CA 1HO3A 3M8PA 1XJCA 4NFSA 3H04A 4QC2A 3TVYA 5IAGA 3AGPA 1S77D 3BAZA 2IHZA 1G63A 1C0EA 1QG0A 3UDLA 2EK6A 3JAMY 3OKAA 1OYDA 4IJUA 5GAEI 5G3YA 5ES4B 2JEGA 3C6QA 4LWQA 3EPPA 3Q89A 2FZGA 3A4LA 4QRDA 3JD3A 5TRTA 2PCJA 3KLEA 3CZMA 4WNIA 4JI6F 4CM9A 1SWWA 4KAXA 3ICCA 4TSFA 3MCWA 2PVCA 5CM9C 2X8LA 5KFNA 1Y0HA 3I4HX 5K6AA 1VS3A 4LXHA 1VZ2A 3VR3A 4D02A 1RQ0A 4AURA 1C7EA 1WCIA 5DZSA 4NMXB 4TWAA 3AESA 2Q1SA 4TT3D 2QE7A 3A8IA 3BBPA 4KQ6A 3AIKA 1TL7B 4XGRA 1RAAA 4MB2A 4UBNA 1Y3CE 2Q3MA 1Z6PA 3RIYA 2DCUA 1PNTA 1PJLA 3RS7A 2GCPA 4Q7AA 5G4KA 4QQKA 1CK4A 3IMGA 4WFAQ 4YQZA 4OUDB 2JJ1A 1TL7A 3M1VB 2XQJA 1NR7A 1U2TA 1D04A 1V2GA 4FFPA 4B6FA 1A50B 1LRLA 1XP8A 2WY2D 2P30A 4NXNJ 3N8HA 4R7GA 5SYAA 4L0CA 3O82A 4EPXA 3F78A 1W4RA 3LM8A 4OHFA 5TNXA 3OTOF 1IBMB 1RTJA 5EKSA 2AOWA 1JLFB 4HZGA 2LKZA 1F5CA 2GB4A 3TQHA 3EEIA 5IQ6A 5GGXA 1HE3A 3RTBA 5HBMB 2D2IA 1J2EA 1MIOA 3W77A 4GPZA 4V3BA 3U4QB 4ZCSA 3CJKA 5BT8A 3HVIA 1Y81A 1D1UA 2FVPA 4QYIA 4TXJA 4PY2A 3OJSA 3MWJA 3E4DA 2JCBA 4I1UA 1H4SA 3KV1A 2PBFA 3P71T 2G5PA 5EKUA 2EAUA 2FSGA 3W9HA 1FJCA 5CGQB 1G19A 1XWWA 2IYXA 1Y00A 4M9RA 3WC0A 4LDAA 4TQRA 3M4JA 4S2EA 4DYHA 3EGNA 2B6HA 1Q81T 3KKQA 4FCWA 2IODA 2XDQB 1WC6A 5B1IA 1ZJ5A 1CZRA 1EJ6A 1RT4A 1KPHA 3PXGa 3A3YA 4F3YA 3A6PC 2FUCA 3VU0A 4KXLA 5JCOC 5T3YA 1GDHA 3V1UA 4Y9TA 3BRWA 2L2QA 5CEJA 3W9BA 1R0AB 3JAWB 5LR6A 2FWAA 1J99A 1Y6QA 1NAQA 5EX3A 1W52X 1YKSA 4MUKA 3HB5X 3T5CA 3CCJS 4EQ6A 2A0FA 1IQZA 1YHYA 2JSXA 4CF3A 1I2ZA 2EJBA 4OX9B 2IS2A 4TLLB 1XQ6A 3F6BX 1G2PA 1FX0A 3A12A 3TIVA 3ILIA 2AVDA 1SU4A 1W4AA 5IJ0B 1DSSG 1UWLA 2ZTHA 4JB3A 5KSPA 2R0QC 1DCKA 4DA4A 1LTQA 2DQKA 1VMKA 3IBFB 2VQFF 4B48A 1YRHA 5AM1A 2ZULA 3HWRA 3GDFA 1K68A 1NPYA 4G8BA 3G49A 1NW3A 4Z8XA 1V3TA 4DXDA 1P2BA 3IWXA 4PONA 4AZ0B 5AW1A 2F8HA 1HFKA 5B2EA 1CSJA 5L1IA 1R2QA 1TKRA 2JLFA 1GR0A 1ODIA 2ZG6A 1WUHS 1JG7A 1CJMA 1CUDA 1R0ZA 2HEKA 3O2NA 1QE1A 3PNYA 3PT5A 1ZD4A 4IR7A 4BFTA 3QV1A 2H8GA 4O4LB 1UVNA 2BM8A 3IGNA 4DTCA 4YOEA 4CLEA 1QHFA 4OHXA 5BW6B 3NP9A 1ZR2A 4YONB 4HKQA 2FHKA 4JV5B 4BFWA 4OI2A 1QM5A 4ZDIA 1Z2PX 4OQQA 1WHVA 5FNVA 2O0JA 1JLFA 1BGWA 3QA9A 4DZRA 3Q6MA 3KNZA 4Y65A 4IHJA 4GKJF 1W26A 4P4GA 2QA4G 4ZQHA 2WZQA 2HF7A 3EWIA 1GPNA 4D97A 1DJOA 1VBYA 1M1NB 2VC1A 3K0KA 5HS6A 2EPIA 1Q82T 1FDVA 2XTNA 5HWSA 3NGMA 3UJNA 2MKJA 3PO4A 1ZSYA 4WW0A 4LA4A 3OEWA 3MCMA 4B4KA 2ID4A 3X44A 5FA6A 4XVRA 2YKNB 2GCEA 1KEPA 3V33A 1GUFA 3MPDA 1QE5A 1NXXA 3DOUA 3MOGA 3K1ZA 3CO0P 5G0SA 1Q8BA 2G4CA 3RHZA 5JAMA 3V1KA 2D9PA 4C8LA 1HLPA 3OVAA 3SEFA 1QK5A 2AYGA 3TGWA 2WYOA 2JKVA 1WXDA 1FS4A 3VWSA 2HVEA 4DL0C 4RF5A 2PD6A 3P9RA 4UOCA 4NCHA 4ARZA 5JO9A 2AEJA 4JHLA 3SZMA 4WZZA 3Q2TC 1FRMA 2MKSA 1T3TA 4YEDA 2YNIB 1F4PA 2CVIA 2O0MA 4IMJB 5L7TA 4E1VA 3HCXA 4CLOA 3EDQA 4NI5A 3R5TA 3OE5A 2CPZA 4U67Q 1J20A 4NEQA 1YRAA 3KLOA 3T3FA 5D8DA 5EWEA 3WX8A 2HW8A 3L1UA 1MMFB 1FNDA 2BEWA 4DSKA 1YZ7A 5EJ6A 4RLHA 4LXTA 5EXPA 4M0FA 4ZVMA 3WWPA 4CCYB 4M5HA 4CLTA 1JSRA 2YDXA 2R6R1 1GZHB 4JLOA 4KQCA 1NMYA 2H4FA 3K8OE 1P27B 3HH8A 1G0NA 4V0KA 1ZPDA 4CWBA 3C6ZA 1JG2A 5A6VA 4TN5A 3SQOA 1X8JA 3ZNPA 3FTDA 5BQFA 4LZWA 5JSZB 1GTEA 1I4OA 3WK8A 3M32B 5K8TA 3ZHVA 1GPAA 1GN8A 2LCFA 4XK8C 3UMMA 3K0CA 4JI5J 4J9KA 1NR1A 5K0LA 5LPNA 4FQ5A 1OY1A 3ELWA 4P8RA 1EWTA 5HYVA 5IF9A 4RNCA 2AN3A 5FDLB 5DYTA 1EFRA 1U8AA 4IDQA 2JEYA 5CYJA 2FLLA 4QUIA 4R8KA 1MX1A 1VSQA 4DHVA 3WY9A 5IG2A 4Q4LA 2AN4A 1FS6A 2ROGA 3ZTYA 2Z2KA 2O57A 4DIKA 3R9WA 1F0PA 1H3NA 4ZLJA 3HXQA 3LX8A 3SHQA 1BHO1 3H4MA 2QT9A 2QN7A 2H17A 3HKZD 2HFVA 1AUSL 2RI0A 2GK4A 3QW2A 3L5KA 3EBPA 3GMIA 1PVDA 4O0IA 5CNMA 4C5AA 1P61B 4I6EA 2YOHA 3BXHA 5DP1A 4Z9FA 4D6PA 4FKYA 2PGXA 2H1OA 2V3CC 1QUEA 2X42A 2GBFA 4TMYA 3PJFA 4ID9A 5BN3B 4HX5A 4LV5B 2P1DA 2AGOA 3CSKA 4RK6A 4WZMA 3S1AA 3OZCA 3POTB 1YS4A 3DE0X 3HGTA 5AXMA 2JCSA 2Q2QA 3OSUA 3X1XA 3LFUA 3DNFA 5LDGA 3RU9A 2QRGA 2AW0A 4FUTA 5L9AA 1G9SA 5EQJB 1M1ZA 1WE2A 4UZSA 1TYAE 3ZVLA 4DFJA 3BDPA 2WP8J 3IBCA 4ZVSB 4LY3A 1GA4A 4C7XA 4P31A 4W63A 2EYQA 4JV0A 1LI5A 2P9BA 4PM4A 5JRDS 4URYR 3ZV4A 1A8QA 1W96A 2XHEA 4DV2J 3FMIA 3DDWA 2R5NA 1N5VA 4WXYB 1CRQA 1W2IA 3CR7A 5K4GA 4LR8A 1U9JA 4NPHA 3W8GA 2HCFA 1W47A 3G2OA 1ZW1A 3QXCA 3GZNA 2C7PA 1HL7A 2A5DA 2ILTA 4DSZA 4Q5IA 4KGKA 5FWYB 1WETA 1N36J 1SJ4P 4G23A 1ZOIA 1K73T 1BS2A 4R9VA 3VPSA 5GONF 4PPZA 2WTEA 4S0ZA 4NDNE 5IKOA 1JDZA 4FHDA 2VJLA 3I4CA 3OJWA 1QX3A 2PMDA 4N39A 4GZ5A 4W4MA 3ZZUA 4KGMA 4QNRA 4LBVA 4X6LA 2Q3DA 5C7PA 5U9CA 5ICMA 1X9IA 2R11A 2XE8A 4HUQB 1ZD9A 4C4SA 4Q03A 1QO7A 2IAJB 1Z45A 3DLIA 4J0IA 4ZVUA 4A2WA 5FWNA 1H65A 3T1QA 3A4MA 3KJVB 4RUCA 5LYJB 4X4NA 3VZBA 2RT3A 3NGTA 1CUVA 2EWVA 4LOJA 2ZH7A 3R7BB 2H5LA 3QK7A 5DOVA 5E7JA 2YYYA 3AF1A 4UQPA 4DUZB 2Z8QA 3QAEA 1TAGA 2QMXA 3GJ3A 3K15A 3NDPA 1KDTA 3MTBA 1IXYA 5IT9Y 4IVPA 2VYVD 2ZOGA 4M38A 1X8DA 4JYZA 4ZJZA 3CZ4A 3I4FA 1CU1A 5TMDA 4BNGA 3Q2KA 3WAGA 4M5DB 4OJMX 2Y1LB 2YFKA 4XEHA 1HNWJ 3D8HA 4OQPA 3O8RA 1N56A 1LWFA 1MV5A 1Y5NA 4EHIA 4O29A 2APOA 2F6RA 3LTEA 2RG7A 3PRJA 3HZOA 3GELA 2UZ1B 4B0PA 1SNYA 3NCTA 3HR7A 1VJDA 2NAPA 5KSZA 2D62A 2RILA 3RODA 3R23A 5KT6A 3PJXA 1RRFA 1W73A 5HFAA 4CLWA 2EZ4A 3EZ6A 3V3TA 2ECQA 1CIPA 2XYQA 4ED7A 4BC7A 2DHXA 2XNKA 2RKIA 4BC0A 4ISCA 3EC7A 5J2MB 5ALGA 4DWWA 4YN3A 3HYRA 5ETRA 3AV3A 4P7GA 2XGOA 2J45A 3AHPA 4AT1A 4B9TA 3IEIA 3TZKA 1NQOA 1HDCA 2PMEA 3B8HA 4KIJA 4PG8A 1VBFA 1Y5IA 4W1SA 1Y3KA 2BBTA 2A35A 4XX1A 3TLKA 2CXTA 4NQZA 3LKVA 1ZOTA 4D4HA 2VONA 4GSLA 4FFRA 2CQDA 4JV5F 2M8DB 2IPXA 4ZVRA 4XX0A 1FBNA 1SBYA 1XR7A 3PUHA 2X7HA 4I2NA 4G41A 1U2EA 3HSSA 3CXUA 4G5HA 1P91A 3PEEA 1YE3A 3TEMA 4E2ZA 2E9RX 1PL8A 3Q0TA 1G4UR 3IHTA 3CGIA 1QGZA 2W93A 1Z63A 4IOMA 3E9YA 1RRVA 2GM5A 4DLLA 4OI1A 1C5KA 4L8WB 1DC7A 2VD3A 3PX4A 3Q0EA 3DFZA 4TKTA 2D5AA 1M2VA 5E6RA 1Z62A 1FX1A 3BCUA 3TL3A 2ZDHA 2HHTA 4C8KA 3ZGNA 4MRAA 4Q4AB 2ADFA 4YP9A 1T6ZA 1MA3A 4ZVOB 1XCOA 2PZFA 2YVKA 4V02A 2GI4A 2OILA 3LX6A 2V7WA 5EWJA 2J0UA 3CT4A 4LQDA 3DVQX 2HIAA 4JBNA 2PGOA 3DFFA 2XYPA 4B3TB 3MAAB 2OK7A 3FTQA 2FP4A 2AZXA 4TLRA 2RU3A 1E64A 2JX2A 1FDSA 1X77A 3AJ2A 2WD9A 3DGVA 4KOAA 1G3IA 1HWYA 5FPSA 1IXKA 2WSSA 1WMFA 3HXKA 3V6DA 1Q6ZA 3AI2A 5HA5A 4GS5A 3HCOA 1QHHB 3DHWC 3OL8A 3F47A 3D9QX 5IM4A 1X80B 1P2GA 4CLFA 1VQSA 4FOPA 1K9VF 4PGMA 1EVKA 3F5MA 3T34A 3DWIA 3D0QA 4G0YA 3J81A 4AE5A 3R3XA 1YZGA 2II6A 2R1VB 4U2BA 4PXDA 2A30A 5DYWA 3WMXA 1Z2OX 2ON6A 4BNDB 1HE5A 3U1BA 3TSAA 4M8NE 4AJ2A 2XB6A 4DR2J 1CQPA 1W0KD 4H60A 2BFDA 3GSIA 4IEEA 5JI2E 4C0HA 2IY5B 1YE8A 3O9ZA 1VHTA 1VKZA 4YHHF 1A98A 5KQRA 3A11A 1AQUA 5EN1A 2IY8A 2YWBA 2V63A 1MFPA 1GTVA 4DGQA 2HMWA 5DX0A 1F2UB 1WKVA 4YYEA 3MJVA 1T7PA 5FUXA 1L5SA 2E5LJ 1UJ6A 1IR2A 4G8JA 1TO2E 2BV3A 3X3UA 4BNKA 4ECEA 2ZITA 3OZBA 3BFJA 3FRJA 4OHRA 1H2EA 2RGDA 1G4AE 2CCKA 2FPIB 2W9CA 3EW9A 5JNWA 1B93A 4LY0A 2QT7A 4RZQA 5A06A 1T0IA 2YXNA 2W9CB 4IX9A 1FJXA 3ZWKA 1T3SA 2G1JA 4BX2A 2FNAA 1AF7A 3JWHA 2QG6A 4FX2A 4YMGA 3B78A 3K6SB 1L5YA 1ENZA 3N01A 3PUIA 1AS2A 3EA0A 1Z33A 1CBUA 1K6IA 4LRYA 3FZYA 1T26A 5FPHA 2A9JA 1HE1C 2W37A 3BJIC 5A4IS 4P92A 3EZLA 4HGOA 3ULHA 1FYEA 4PLHA 2HA5A 1KMMA 2FSSA 4R9UC 1L7VC 3FWZA 2UZ0A 3UAGA 5KFBA 2X6TA 4ER8A 2DBZA 4MP3A 4RA9A 3DTNA 5F76A 2CL7X 3ZBPA 4R1SA 1N2OA 3QKRA 1Q0LA 2B4UA 1QNLA 1YSCA 3DZHA 4JUDX 4ED6A 1Q2XA 1A82A 4OX7A 1II9A 1KU6A 1D4OA 1NR5A 1JU3A 5J9FA 2GCNA 3DMTC 4IVQA 2GEFA 4HYYA 3AL2A 4A1FA 5SYNA 3QHQA 4MIKA 2VP4A 2XWJI 3V4VB 3LO3A 1U7DA 4MUFA 4AZTA 4OYZA 5HZMA 3IAS6 3QSIA 4P0PB 2QP9X 5C7YA 1QTNA 1UANA 4OX9F 1VA5A 5ICFA 1SC3B 1SUDA 2IVFB 1T0TV 1LBEA 2QTVB 4YO7A 5CB4B 3A1CA 3G8QA 1LPBB 2JEZA 1ND6A 4MICA 3B1KA 1ZH4A 4AG3A 3P49B 4A46A 2IIQA 3HK2A 1LCIA 3FCVA 4BKQA 3GILA 2Y76A 3LW5C 2JFNA 1KONA 3OHPA 1IBCA 3PZPA 2ABWA 5DJBA 4JI5F 2JLGA 1H2YA 1NC1A 2BGKA 1R8AA 4FZ5A 3CCFA 2R8BA 3QKTA 4DM3A 3VVMA 3K59A 3HCDA 4PSDA 1M76A 5BSKA 4N4AA 1AQLA 1QS0A 1ZQ1A 1A9RA 3N2IA 2ZUUA 5J2QA 1N34F 4IM7A 5D3MB 3W9UA 4R1NA 1TZMA 3AEUB 1NUAA 1JLSA 1F8YA 1F2HA 1Y1LA 5C34B 5AQ1A 4RTLA 4OHMA 2X0RA 2P7IA 4O44B 4OK3A 1OWOA 1W2HA 3DS8A 2W6ZA 3THYB 3IVGA 4FBTA 4OXKA 2I1LA 2K06A 1P4RA 3SSMA 2XZTA 2JJ8A 2WSBA 3C19A 5IJ9B 1LWOA 3VGUA 2C7GA 1RWKA 2YJ6A 3D7RA 3SSOA 4GR4A 1M6EX 5I7WA 1JLQB 3FMVA 4O6VA 3DFMA 2QRKA 5IJ9A 1L7RA 4N7JA 2HQDA 3MWBA 2ZJ7A 4RJKA 2DM6A 2AYBA 2QA1A 1J5XA 1G41A 3OZDA 2PSHA 5JNUA 4LYGA 4FFNA 2YOGA 4D4JA 1HDZA 4PAOA 4JI0B 5KG5A 1K5DA 2I3ZA 3G2LA 3QYAA 3EDQB 3RAEC 4YMWA 3LCRA 2XDAA 2X0DA 3FMBA 5DLDA 3JWPA 4RO0A 2OD4A 4QPTA 1E20A 4ALNA 1R8BA 3GPBA 2AT1A 1COZA 5ER6A 3J81j 1TCAA 2A1IA 3M2UA 1I13A 2XZOA 2C4NA 3TZLA 3WLHA 1NP3A 1V7QA 2C42A 3RC3A 3FXAA 4EY4A 4KXVA 5SYMA 3EDYA 3R0XA 4RBVA 4L9RA 1OUMA 1G4HA 1KP6A 2YMQA 4PO9A 5JWHA 5FUQA 2XMQA 4DXAA 3ZE9A 5FAXA 1FDNA 3UNYA 2C54A 4E88A 3HCWA 1V3ZA 1FQJA 3VO9A 1DCTA 2VJYA 4I67A 5KWIA 1SIOA 3NB0A 1R4NA 3M6IA 3RH0A 1XERA 1EA5A 1IKVB 1UBHS 1E1CA 2ZJ0A 1U7PA 4BNMA 1I5RA 1KGDA 3KPVA 1PZXA 1VQMS 5CA1B 4RPIA 1U9IC 3C1AA 4NU8X 3JQ6A 3UN5A 4JT8A 3WLTA 3C16A 1U7LA 1IBLF 4WZBE 3IYLW 2GVNA 4GX5A 1FYVA 1RAHB 5KT3A 3VUFA 4O2AF 1IY9A 4I0WA 4NE7A 1YQHA 4LF9B 3HUEA 3ZHOA 1DADA 5E2AA 5LA6B 1M6VA 4GRAA 1NF9A 5LQCA 4KWTA 1CUGA 2CL6X 3EMTA 2AFHA 2CYAA 3U4CA 3CV3A 2HA4A 4QFBA 4TLDA 1SWVA 1UMBA 5A0FA 3EISA 4RQUA 4L2IB 4C6AA 4XIGS 2Q9AA 4E70A 1O08A 5THQA 2EARA 4UDYX 3IMQJ 2YWKA 4D80A 2OPSA 1F17A 3FCCA 1U5AA 1AZTA 1VPTA 4ZAGA 1IR1A 2NO9A 7MDHA 1Z74A 1TTHA 4I4CA 3R20A 4MK7A 2YFHA 3AQPA 1S1VA 3WKDA 2ZBPA 3HBLA 4NZZA 4IGKA 1CQXA 4A2QA 3QUQA 1M54A 4EHJA 1X2BA 5HROA 1XD9A 1XN4A 5C37A 2R2RA 1XTRA 3JS9A 2QUJA 4ZN3A 3K92A 4QDUA 1U0HB 2IRUA 2ZK7A 1U2PA 5LXRA 1NW9B 3DKVA 4U9RA 2VL1A 2ZRDA 2YIVX 2CLOB 3CDEA 3EPKA 4U8VA 2P35A 1W0JD 3DI6A 4OQMA 1YRXA 1CLFA 3RYIB 1YR6A 2GQCA 3O8CA 2YWRA 2OCKA 4NYIQ 4I68A 1J0XO 1G291 2HNBA 5CIYA 2AZTA 1NW6A 3CJKB 3OTQA 3QPVA 4QZVA 4DPYA 2GWHA 5FX2A 1FT8A 1SCDA 3HBNA 4W6QA 3Q8UA 3WXBA 4AMVA 2K7KA 1QFMA 3PNOA 2CRLA 3H25A 1J39A 1E2JA 1M7HA 4F9FA 3ZY5A 4YB1P 4JJ4A 3EGWA 2ZUVA 3DOLB 3RU7A 1MFZA 3V00A 4P98A 1M1YB 2Q4TA 2M4MA 1Q77A 2GYWA 3ADDA 3M8PB 3Q11A 1W1UA 3AEQA 1EEHA 4ENVA 6Q21A 3DM9B 2A3JA 2ICAA 5DDOC 5FPQA 3UMCA 5C5IA 2XUHA 1AGNA 2G88A 1V7PC 1IJFB 3BFXA 1W1IA 2OKGA 3LPDA 1UDWA 5REQA 2HSWA 3M2RB 2OBBA 2QMUA 3L8FA 3UMBA 4PZPA 4BLVA 2O2GA 3U48A 4OXNA 1KJZA 1T94A 4QR1A 3FOAA 4WPGA 3HABA 1ZUIA 2JGDB 3FB4A 3C2PA 3V1NA 3RRYA 4WE1A 2J4DA 1WJ9A 1HF3A 3ELDA 2FETA 4EATA 4DUPA 5ERGB 2J7PD 2RQMA 2B43A 3PG5A 4FDUA 5LZ7A 1EJ7L 2D5CA 4LJ9A 4OBWA 2INGX 1SBZA 1XL0A 2R7NA 2JC3A 3OEEA 2JFVA 1QJHA 4PUOB 1CUUA 1HDGO 1ODSA 3BAFA 5TIIA 5CFRA 3U3KA 5ETMA 5D84A 2EFJA 3EQ2A 3TA2A 4YFUA 5JE8A 1E2BA 5LXTA 4P71A 1EXDA 4KR0B 2I9PA 1N2JA 1V7ZA 4FYYB 1KXJA 1RYRA 2VZEA 2J5KA 2RHTA 4J9QA 1XMOF 1VL0A 3TZ6A 8RUCA 4TTSA 1FQWA 2OEJA 3EZ9A 4KUGA 4OAOA 3S99A 1PJRA 4JOQA 3ESAA 3B3QA 1ZINA 2DNYA 3AZOA 2C83A 2TYSB 4ZMMA 2ERXA 3PCTA 4MKXA 4JIGA 3UCFA 1KLMB 2QQFA 1K8QA 2GK3A 3HYCA 1RKUA 1Z0AA 2HBQA 4QEDA 4ZCKA 3D6HB 4RJJA 1TD9A 2EKPA 1D4FA 5IYZB 4L9SA 4G5QA 1YI1A 1CUIA 4BO8A 5BNWA 1U3FA 3LALA 4FFWA 4GM0A 5C8XA 2DISA 2GHWA 5JH7B 3S7ZA 2H92A 2WM8A 2DB1A 4E5YA 4UNSA 2GZSA 2BTQA 1ZM4A 1JDSA 1F1BB 1SQSA 1G64A 2YZ2A 4JUCA 3N86A 4PLFA 4EGJA 2LCQA 3H5SA 2NU7A 3MR7A 2X0NA 2WV7A 1WTBA 1SVKA 3W8FA 2WW8A 2CDAA 1PZGA 1ZI9A 1MHTA 1NCLA 4M87A 4NKRA 3K9BA 2PIDA 3J7TA 2PUEA 3D1VA 2HNDB 4IGEA 5I48A 2FKNA 2IXFA 5LA6A 4ES2A 3NAMA 5HOQA 3NCPA 5KYYA 3P0IA 2BKLA 1JNRB 4RDCA 4MV4A 1DX9A 1VLHA 4DLBA 3T19A 2P62A 4RANA 3VRHA 3K09A 4OH1A 3AEXA 2FUG6 3OR1A 4ZT4A 2BGWA 1TVEA 4O59O 5EEHA 3HA5A 3IKJA 3AF6A 3GA7A 4OL0A 4AZ0A 1Q57A 4D42A 4QXOA 2HNYB 4AF6A 5ALOA 1OXXK 2CMHA 4K7JA 4DMRA 3O73A 5EIOA 1N2HA 4MH8A 3H75A 3MFHA 3E9ZA 4QOEA 1EK5A 3IQDB 2WAXA 3BSSA 4Q9JA 4RW6B 4HP8A 5EPUA 1OYOA 3UMVA 3JSAA 1ZHOA 2BJ3A 2P5VA 4FFDA 1OX4B 4Y2KA 3CCWA 2PK3A 1Y3FE 5B09A 2LDXA 3M70A 4LT6A 4HMOA 1JLAB 2VDNB 5LNK6 3JXOA 4LVCA 1HYQA 2VPZA 2FTKE 4XB2A 3SIPA 4K1XA 4WNAA 3R7NA 2PKWA 3GLFA 1D2HA 1FFXA 5LFAA 2XWSA 1C0KA 4I5DA 3KQQA 3D7LA 2RRBA 3R3UA 2Q4RA 1CJCA 4FTWA 1PFKA 5AKEA 2XVXA 3DV0B 1GG5A 3NWPA 3S2GA 2J6BA 3TLGB 3IO1A 3KQVA 2HAIA 5AXCA 4QR0A 3WI7A 5TPWA 3B1WA 3K17A 3DZFA 3NFRA 1HNZB 5LC1A 4WVFA 5EUQB 1I14A 1N9ZA 3RPEA 5B58T 2AXEA 2GGPB 5IVDA 1GLNA 2XQCA 3FNFA 4I6WA 3C3DA 5E4FA 3JVVA 2C03A 1SIUA 4M88A 3HN7A 3PHCA 4G1FA 4RD0A 3UAXA 2VG6A 4UEQA 1QQ7A 2P90A 4HCJA 3WLLA 2OA0A 3LHKA 1E9FA 2WHQA 2ZUTA 3JSBA 1DQAA 3TX2A 1ZCZA 2JFFA 4MIAA 3CO0S 1V6CA 1OV6A 1KSFX 4EB3A 1AUVA 1DLIA 4YAJA 4EGSA 3NLCA 3G8BA 2ZRQA 1LI7A 1U0HC 1NJWA 1E2NA 4Q9LA 1S6YA 2EDAA 1XHFA 4KQWA 2CFRA 3A4VA 5MN6A 3M1YA 2YW2A 1P6XA 4DX6A 4R8RA 4EWLA 4RZHA 1PJBA 3H19A 4MCHA 2H7YA 3JQCA 4RNFA 4CIYA 1RI1A 2GARA 2GN9A 5A3RA 3LWMA 2YJZA 2HIHA 3CLRC 3KJNA 1PC4A 4J6EA 4IQFA 3Q7TA 1RHJB 3TLXA 3WGJA 4JBWA 5IVHA 4IICA 1HDEA 4XASA 3GFOA 2I4IA 2VEOA 4IMPA 1XU9A 1KORA 1X4BA 1GMVA 4JR1A 4FXPA 5IASA 3ABRB 3IAS9 1T5IA 1FFGB 3UQSA 3G13A 4R0JA 1D1PA 1NK0A 1C4OA 1PG2A 1QHYA 3PS9A 2LFVA 4QBKA 2MLZA 3PQ6A 1U31A 2JD1A 4EHHA 4DLVA 3ZD7A 5JTUA 1G17A 4PTYA 2NO7A 4NV3A 3VGJA 4K6OA 5K6AC 1FKPA 3FJYA 3W2VA 4BPBA 2R2UA 2J9CA 3GRYA 3RVRA 3LQFA 3SEAA 1N2CE 4MYDA 2QDXA 3NT2A 3U44A 5CBPB 5DM1A 1ECCA 3TRFA 3SXJA 3U56A 4AULA 4NHOA 3I8XA 3LW7A 4ROSA 3H5OA 4D9EA 2HJHA 2MTLA 3I32A 3WAJA 5E3RA 1SBHA 5ALXA 1RTIB 2R96A 2GV1A 2IW3A 2D1SA 3MCTA 1XBWA 4KJZA 2GZ1A 4NG5A 1J8MF 4FKBA 2MQQA 4CCAA 2FD2A 2MDAA 2IHBA 3ZCTA 2ZB2A 1S1MA 1E5LA 4BWFB 2EP8A 4HD8A 3CGWA 2BF7A 3E8MA 2C7QA 2VBYA 3THOA 5CVJA 1H1LA 4TY9A 3I05A 1LS6A 4ZT5A 4DV2B 5G0UA 2YWEA 1OB5A 4OPMA 4HQKA 5BR8J 1U6ZA 2P2GA 2J08A 3VNRA 1O2DA 1X5PA 3FE2A 4W8HA 2QX6A 2V5AA 1Y4UA 3EJMA 2ARKA 1XMOB 1E18A 3SFUA 2BJWA 2V2VA 3C6XA 4JL5A 4CFYA 2EZ9A 4ZOLF 4B6RA 1E94E 3ICOA 3G8YA 1QKIA 2IKQA 2YQ4A 4JZYA 5LZ9A 2Q9UA 3C6UA 5BNTA 1PQPA 2CYBA 5KYWB 4I81A 4MGZR 2OFXA 9RUBA 3W5AA 1YZVA 1WCWA 2DUNA 4KGZB 4E2WA 1DBWA 3QSYA 5E3IA 2XUZA 3DU5A 2DC1A 5F5NA 3SV3A 3BJRA 1KNQA 4HFRA 1QK4A 4JV2A 1O4WA 5M2RA 3LOPA 1M1KT 2QR2A 5LMNB 3TNDA 1UT8A 1F7UA 5IOLA 3IALA 3Q8SB 4PLWA 5F33A 1Y1KE 1E32A 1QLJA 3MG9A 3K16A 3PQ7A 3NRBA 2ODQA 1MENA 2X7XA 2ACEA 3F41A 1U2GC 3QTBA 1G3MA 3KCQA 4YEAA 1LBIA 1AQJA 1SCJA 4XPCA 2EJTA 3SBDA 1B15A 2MKIA 1T0HB 3HFKA 2YKMB 2X3DA 1JWBB 2ZJFA 3L7CA 1NM2A 4D9IA 5KC8A 3EPHA 1KE1A 4EZBA 4KR6A 3RDPA 2H63A 2AZ4A 1E8DA 3AU9A 5HKLA 4KNVA 3C16B 3FPBA 4HVAA 1YZQA 2X0FA 3FH0A 2FPKA 2JCXA 3F7TA 4JI7F 3G2KA 3KIPA 1FRFS 5ELMA 1ESDA 4TL9A 2XXBA 4J0CA 4QGAA 1LNZA 2VF8A 1WORA 3EDMA 2GA7A 2XUIA 1XDBA 3LHDA 5FO1A 4DLZA 3GUZA 5H9VA 2FQQB 1CX9B 3IRUA 1EAYC 1JFFA 4QYRA 1LQTA 2GD0A 1EZZB 1ZSVA 3CISA 2P3QA 3T5LA 3DM2B 3QH4A 4Z4EA 5LD2C 3NT5A 4Q8FA 2HXYA 2BKUA 1P9QC 4QL3A 4GYKA 4BLTA 6LDHA 1SKYE 3EG9B 3AFGA 1Q0PA 5JROA 4KFBA 4GSYA 1RM3A 4DLNA 2LPMA 5DQGA 5LMNF 2HNAA 2M6KA 1WAMA 4QXMA 3KXKA 2C04A 2GDJA 4ED2A 1DQZA 4DARA 1NMEA 3GH1A 3WFJA 4D25A 3E05A 2JDIA 1RHUA 5K0EA 4KQGA 3DXBA 3NO4A 1BXRB 5JWRA 3NOGA 1YJCA 1VMIA 4DQUA 3C8YA 1SG9A 2JIMA 2F3JA 2PRJA 4LF9J 1BTOA 3C5CA 4QWCA 1UZDA 3MT0A 1DBIA 5IKMA 5AOAA 4UQTA 2C1EB 4GC9A 3ZD8A 4F3RA 1Z88A 1UOEA 3KJZA 1JDNA 2ONKA 1IWOA 4ZJUA 3E7XA 1NF3A 4KXYA 1FQKA 4DR6F 2GVZA 1DAPA 4ZT6A 1YQTA 2Q46A 3NM4A 4Q4HB 4MVJH 3DZCA 3FZGA 4H7PA 4RKFA 2RE8A 3HXMA 2BKOA 3VISA 2FEKA 5BYBA 4B4UA 1EETB 3HV2A 4QBHA 2ZBEA 2JI6A 3PM9A 1M83A 5FIUA 4X54A 3QVXA 1SOVA 1QOPB 1MIHA 2KZMA 3IPRA 3GBVA 4FWBA 3OZWA 4L6IA 3VTFA 4B3RB 3OLVA 5FTWA 2GIQA 2AD1A 4PTLA 4PQUA 4MR9A 2PWAA 4KQ2A 3ORFA 4MV8A 2OLWA 2LQJA 4TMKA 4YMHA 3H20A 2MXYA 3MS2A 3C14C 2RGCA 1FVSA 4P75A 1MN6A 2ADOA 2FW8A 2WAQD 2Z04A 3A1EA 1EKXA 4OA8A 4TLBA 2WKPA 3TA0A 3EVBA 4ZEXA 3S6EA 4FYHA 3WBKA 4BWJA 1GXSB 1KE2A 1V8PA 3MD0A 5I7SA 2VXBA 2XUKA 1XLTC 3OCUA 2G5CA 4ZRDA 3KOOA 4RKYA 3N7AA 1AKNA 5BVGB 3W3AD 2XNQA 1B8OA 3MEGB 1GXSA 1IKWB 2FSVA 1LDNA 3QP9A 1MEJA 3VJRA 4J7XA 2CFOA 3P2OA 3WK4A 3OWOA 5JV5A 1V7CA 3QOXA 4RMHA 4HFNA 2DRIA 5FNVF 1SPBP 3WLRA 2WFLA 1DRKA 2JVRA 3OZEA 2XMKA 3A27A 4AY3A 3DUFB 3BH6A 2R47A 1SCKA 2VZ9A 3PD0A 5BWCA 5IT9A 2KVQE 4Y2UA 4Q0BB 2J6TA 3NKLA 4Z49A 5HMWA 2C2BA 1CDEA 3JSMA 3GN1A 4RWZA 4LC9A 1Z06A 1N9GA 1MDBA 4MOWA 2R7LA 1JJVA 2R84A 2RAFA 2Q8QA 4KR9A 3RR2A 2EXXA 2BE9B 1JPNA 5E41A 4DNPA 4Z1MA 3PWZA 4Y2YA 5CXSA 1H1DA 4GQBA 4TVSA 1Z5GA 1Q1QA 1YQQA 1P0CA 5ALZA 3E9CA 2RDMA 1WACA 1KJWA 3GPAA 4QQBA 1CJUB 1UEIA 1IKYA 4KKOB 2GO7A 4EG3A 1A9YA 1LVUA 1W36B 4OKIA 4K7QA 3W6NA 3ET6A 4BQEA 4A27A 2VQSA 5FJJA 5FPYA 1TTTA 4MPJA 1OLXA 2CLLB 3DZIA 1TEVA 3OEHD 1Q5VA 4HTFA 4I36A 2OCAA 2FJBB 1R88A 3NV9A 3G0GA 2CHEA 4CMIA 5ITHA 5GAJA 4YH1A 4DIMA 4C29A 1P5JA 1Y42X 2JLZA 3TBHA 5T6BA 2HPZA 5ETKA 2WD7A 4IQ0A 2IWRA 2XQVA 1Y7PA 1MVLA 5DXAA 4DREA 1W5EA 2D2FA 5CHCB 5AOVA 1N5RA 1EGMB 2J48A 3PL5A 3ZS9A 3T4EA 4DJDC 4FJ2A 3V4MA 3J80Y 3O75A 3FN4A 2HWYA 1ZTTA 1U8CB 2NAFA 2YJNA 2P9ZA 3F3KA 2VH5R 1FPMA 1U3WA 1MD9A 3JQ9A 3C6TA 3KLHB 1ZVQA 1T5BA 4USWA 4MK4A 5U1PA 3PDUA 4HN9A 3RNOA 1Z8DA 4OP3A 4RNOA 2Q3LA 4P7JA 4OHOA 4OJHA 3RJTA 1CBKA 1HMVA 1SPBS 5J1EA 3W5YA 3GLKA 1DRVA 1MVNA 4PYLA 2W2NA 4QU7A 4E2XA 1G2IA 4CIAA 2GAOA 4XVHA 4D6YA 3EXEA 3G8CA 1QF6A 2HWUA 3B6JA 1IMOA 1OFTA 3IPXA 2BH2A 5EWLB 1MH9A 2KLHA 1FSFA 1UPUA 5H80A 1IYZA 2IEBA 2CJXB 5FLKA 4FFLA 1WG8A 3FSEA 4KIAA 3IDZA 4BEJA 3OIVA 2VUUA 2I03A 5L53A 2UAGA 1UL1X 1P4JA 3GIKA 2PTGA 3BIWA 2Y3YA 1EETA 1M5PC 2H5IA 2DNOA 5CMLA 3EEBA 3L43A 3SBXA 4WEQA 4UTGA 4RVSA 2Z4PA 3ZN2A 5SY6A 2P1RA 3E3AA 1PEKE 7REQA 2QN6B 1K8AT 1MT3A 1CVJA 1T4MA 3GSDA 2XYPB 2RC5A 3E2PA 1TRKA 4ETWA 3P9KA 2MSCB 1L1EA 4OYHA 2QRJA 3GQBA 3QPWA 5GONB 3OTEA 3FIJA 4AJIA 4ZTZB 2BCEA 5AHKA 1PT7A 4IIYA 2BE2B 3LWBA 2HRBA 1E3LA 2DQYA 1B4DA 3F6YA 4ER5A 4KQ9A 1MPXA 5BN4A 2IYLD 3CM0A 1RT6B 4BLWA 3MT8A 3JQQA 1K97A 2JFBA 3TLJA 3JWGA 4IMIB 3F7OA 3OMXA 3WQPA 3FNNA 1GNVA 3KV3O 3F5SA 4GZ3A 3CURA 3HVTA 5C2JB 3MXHP 1DAKA 3LA6A 2C96A 4KBGA 3PQ8A 4C06A 2PCLA 2RHBA 3L4SO 1H2BA 1UJ4A 1RCOB 3US5A 1LTKA 4J9OA 1FA0A 1SURA 3I61A 3L7BA 3T1YJ 3IQGX 3ONQA 5BSUA 1QZUA 2JBWA 1FLDA 4G4SO 2N7YA 1X13A 1XROA 1OFHA 3E6AA 5CM2Z 1PT6A 2OYSA 2Y1CA 1TKAA 1ST3A 3RM3A 1C0UA 3K05A 2IYNA 3I2YX 4JC4A 5E6UA 1ZYUA 3KKKA 3R5KA 4FGKA 4TVAB 1LPMA 3NBZC 3RRXA 1PE0A 3VXKA 2XUGA 4MUXA 1QRDA 2JF0A 1FTGA 4C08A 3G6YA 4ABYA 4B3JA 1U2SA 1OZHA 3GU3A 5MFPA 3M3HA 4EYQA 4BU0A 5CA1A 5JARA 4ZU1X 1AX9A 1NBIA 2XMJA 4LZAA 1N5KA 3QU5A 1F3OA 1U3TA 2WZ1A 3T7DA 4NLSA 5AKYA 3WGLA 4CMHA 1GRRA 1XZ8A 2L08A 2W5UA 2G8LA 4PGHA 3M2VA 3GDWA 4DM4A 1KVSA 4W90B 2OCGA 5EIFA 1UPTA 2QD4A 4UD2A 1CF2O 1VKRA 3WJ2A 4HC4A 1V35A 1RPAA 3W61A 4XJSA 3ORHA 1T6YA 4E5DA 4KUHA 1QHNA 4E21A 2XECA 1VHFA 1J2VA 2XHWA 1G60A 4U7JA 3NXSA 2EP7A 1WI6A 4I3FA 1LLUA 2GMJA 2VYVA 1ZM3A 3IIMA 5J2TF 4IDGA 2ZUCA 3SWWA 4HQFA 2HT6A 4C2TA 2WHOA 1VTKA 1KVIA 1FFEA 2NP6A 1QCCA 2V7EA 2F1JA 3ZJTA 3IB3A 4ALJA 4EK9A 3ICVA 4MRVA 1FRNA 1IAQA 2FMFA 4Q39A 5HK4A 2UXBJ 1O5OA 1SUSA 1L3TA 1ULZA 1R43A 4ZVUB 4YCDA 1OXSC 4EELA 2Y6UA 5GM2A 4ETZA 1O57A 4L1KA 4LRCA 3A8KA 2XJ9A 1ZICA 5AVZA 5GMDA 4HXFB 3KK3B 2VUSA 3I83A 5LBTA 4E22A 1GVHA 4DJTA 3FLAA 2H06A 3CPSA 1FP4B 2MYPA 1WUJS 3TQIA 3IVMA 4HAWA 3TQEA 1E79A 2C9OA 5IWAJ 5BV1A 3MRSA 3QFFA 4NCGA 3THYA 4L76A 1LZLA 4KYUA 3TW4A 4N01A 3V7NA 4DL6A 4EKNB 3T5BA 1KH1A 4Q1BA 1M8JA 1QFYA 2ZRGA 2HZ7A 3GJ4A 3IO3A 2VLBA 4TMTA 4L5BA 4FHEA 5CA0B 4IVNA 3RQIA 1ELOA 1XEWX 1G8MA 5CT6A 4ARUA 4CF7A 2Q49A 2BTQB 5IX8A 3VPXA 2DJIA 1OI4A 3UGJA 4ESHA 4OI3A 3DLCA 1MAHA 4ILRA 5AVSA 1TU4A 1FWLA 2BZ0A 2UXDJ 3JATA 2ZXEA 3B48A 4KI7A 2A1TS 1RDFA 4UHEA 5I4BA 2JIRA 2PX4A 2IDMA 1MH1A 4JT2A 1ZTWA 3GPCA 4HH3C 1WX1A 3AB8A 3AL0C 5L45A 4R8SA 2C57A 3UCEA 4FM9A 3DRXA 2F1OA 5SY9A 1TCVA 1NSFA 3DLGA 4LF8B 4AO7A 4M83A 3HB7A 3KK1B 3RYCA 3DD1A 1XD2A 4YREA 3ED5A 1GKKA 1J8DA 3EJWA 1WWKA 4G5GA 4OP2A 1IKYB 1SKRA 1Q1EA 2G25A 3IV7A 3CE6A 3ID6C 2Q4DA 4YXWA 3HSZA 3OG9A 2O3DA 3I2HA 2W1BA 1VMAA 1WP4A 1Q84A 3SSNA 5KTKA 2ZREA 3AY6A 7YASA 4CEHB 3EA4A 4FW8A 3ZNOA 5GAHI 2BRUA 2N46A 4JGIA 1YJ7A 4AZVA 2REOA 2DYAA 4OZLA 4KXFB 5FULA 1TVRB 1BE1A 2WU0A 4EHNA 3BM7A 3KPUA 3C8MA 3Q10A 3TDMA 3FJOA 5GJBA 1KJ8A 3SBOA 2MQMA 5B6IA 4CIOA 1CWUA 3SSRA 4DA6A 3H2IA 3LPMA 1KU0A 2O8NA 5BVGA 1A9QA 1RQNA 1G7SA 4N6GA 2EW1A 4LBHA 3WTCA 3HEBA 3I9V1 3NTLA 4XM0A 5TPWB 3WC4A 3ZI0A 2OP1A 3S8EA 2GX6A 5F8IA 2PTHA 5EC8A 1WOOA 3K20A 3RK0A 2BBSA 2E5JA 4TXMA 2CQ3A 5F41A 3B60A 4DJJA 1SMKA 4M8KA 1GYQA 2PLWA 3A37A 1OH7A 4KE8A 4C0BA 1PFWA 2ODPA 2ZATA 2WF6A 1W2GA 2YV2A 5G0TA 1V1MA 4EG5A 1QAOA 9MHTA 3L7PA 4P83A 4YQEA 1SVWA 5K3BA 4P54A 5KPDA 3L9ZA 1VHQA 3WGTA 3TVTA 4DSIA 2FEMA 3ZIAD 1OU4A 1U7UA 5DZ7A 2VJBA 1KERA 2YYAA 4DQQA 1M34A 2X13A 1P9LA 5BWBA 1ODCA 4WLUA 3TRGA 1SVMA 5A0YA 3GRCA 3E3OA 1QANA 2QQEA 2B6NA 2D7SA 4P74A 1C8VB 1D9DA 4BTVA 5ETSA 1Q5PA 2AFRA 3EGVA 2IHJA 4PN3A 5TQ0A 1Q0QA 1RTIA 3OSNA 3F8WA 2WSSD 4HK4A 1B7YB 2FW0A 4BEBA 3KKOA 4NAHA 2FKAA 5HJXA 2P7HA 4W7SA 1QHEA 4B6SA 1QJCA 1UDAA 3MAHA 4X1IA 3KYJB 2H2GA 2W2NP 1E1CB 3GHYA 1E5QA 4RF3A 3ZHRA 2ZAIA 4OYWA 1G8KA 2VATA 1L7DA 4GEGA 1CV2A 5D3GA 2IPNA 1RQRA 3DP9A 3NNNA 5FL7D 5JLJA 4IOJA 4EJFA 2FHOB 4RESA 1U9CA 2VNKA 1K0TA 2OPQB 4OYOA 2OESA 2Z4RA 2WJPA 1K7CA 1DJQA 4MVWA 3T41A 4IS2A 4JROA 2B25A 4JP3A 4ZPBA 2C2YA 2PAFA 5G0RA 3RQSA 3AHEA 2D0IA 4DDTA 2PT6A 2Z5GA 4K4YA 1VC0A 1A69A 3OESA 2E5GA 4BTEA 4GXNA 4PLTA 3K0FA 3O8OB 1KFCB 4V38A 1WHSA 3AY7A 3P0HA 3GEBA 1NJGA 2OHDA 4LVNA 1LW0B 2NUUG 3V2HA 3K2IA 2M7SA 4FK8A 2PUGA 1NULA 5G4LA 2ZVIA 1FUYB 3LVBA 3MOSA 3HEMA 2OPQA 1R8PA 3ABIA 3LUGA 3RJMA 2CZ9A 1EP9A 1HL6A 4NYJQ 4TTRA 3JQBC 4ES6A 2CMKA 4PIMA 1RAHA 3SZGA 2ZYIA 3EWAA 1ZXLA 2F63A 2FDRA 2XD4A 4H6VA 4WKRA 1DELA 3GZ4A 3H4TA 3D0IE 4TWZA 2PIIA 3BJYA 4G9EA 4R5HA 1IIRA 4DWIA 4BNIA 2BUCA 7ADHA 3GR0A 2O8DB 1AZSC 1VL8A 5K3CA 2VDVE 5JMWA 3CVJA 5DIFA 2GAGC 1C1DA 1Q19A 2RJNA 4CYUA 4ECWA 1BO6A 3U16A 2VOOA 1HC7A 3PGA1 5C8VA 1EG7A 5BJRA 2J07A 1O8BA 3BWBA 1VJRA 4LHSA 3WYEA 1SUBA 1I3OB 2PBRA 2MSDB 5SZHB 3PJ9A 3HULA 3PFWO 1SL2A 3G6WA 3OE7D 1N78A 1YZNA 1IOZA 2DG2A 3RYIA 4PW0A 4QVKA 1O6ZA 5J5CA 2BLLA 3OD5A 4F26A 4FHCA 2DSNA 3I45A 3PGVA 4JJ6A 2MMGA 1SXHA 3E03A 3QVMA 4BQQA 4QTXA 3KHGA 1UK7A 4BZWA 1YLXA 4B6GA 4QULA 5HN0A 4HSEA 8LDHA 3IVAA 4YY3J 2QVGA 2GZMA 1QH8A 3OHMA 2QW8A 2XTZA 2W0MA 3D68A 4ZVPB 5WRFA 5KTRA 2N7CA 3PFCA 3T1TA 1WDKA 2HS3A 1FX2A 4ZKEA 2G80A 3IS9B 4CMEC 3UJ9A 3MRVA 2NVUB 3SHFA 2IQ5A 3U4QA 3UWOA 2HS0A 1YKGA 5AW2A 4WXOA 2ODWA 2ZJ1A 3TVZA 2CLCX 4M3NA 4ITUA 2WJWA 5BQPA 1KTQA 4NNJA 1F6TA 1Y5RA 2ZRJA 1TKTA 5DXFA 4MVXA 2WIBA 3EVEA 3NR2A 1VLJA 4DPWA 3SQDA 4FYJA 3D3BJ 1D2MA 1X4FA 1AA6A 5ALDA 2CNLA 3HRKA 1VRTA 5ES3A 3ROQA 4FZVA 2VH2A 4DCVA 1J9GA 2XAUA 2ZI7A 4RFLA 3HE3A 3KE8A 3OMLA 2OCDA 5KU1A 5JHGB 4UAGA 1ML3A 1YZ3A 1OXKB 3LBFA 1Z35A 2YY5A 3LQ4A 3DD5A 2UXCF 1OWMA 2G9NA 1VL5A 1CKEA 5IT4A 3Q98A 3K2YA 4ZEOA 3TJAA 4PO1A 1T8SA 4IUYA 1M75A 1VSUA 4WKYA 1Z29A 4E1AA 3AO0B 4G24A 3A36A 4MV9A 4ARBA 1W4LA 4L5IA 1VC6A 4WKPA 2ZZNA 3BXZA 2NQPA 3GH3A 3Q15C 3QSYB 3BGSA 1IG0A 3OI7A 2XOKA 2IH5A 1UZHA 1V26A 1K5PA 3WSWA 2HMIA 3KSDO 5AE2A 1XELA 3A8EA 3HSDA 4Y2RA 3ADCA 4J4TA 4FOTA 4LHYA 4E6PA 2WJAA 3ZDFA 2Q0SA 2XE7A 1CFJA 5BNIA 3USES 4U2GA 1J2YA 2J76E 2PL1A 4ND6A 2CV2A 3JQBA 5DTEA 1T11A 5JDIA 4JBCA 5JI3E 3E3NA 4M8SA 1B0AA 4KFUA 5IXJA 2AU0A 1XMXA 1C1BA 1JHOA 2AGQA 3U81A 2OFPA 2JOQA 4IIEA 4WESB 2YV5A 1NVGA 4TYWA 1JDPA 4KODA 2FPLA 4O3RA 2V54A 2A10A 3QGMA 3VAGA 2C31A 3V4OA 3TK1A 1E6YA 4USMA 2UUBF 1RT9A 4ZO4A 2KJQA 3PR3A 1EX8A 4F02A 1UXOA 3RAFC 2HYIC 2CFIA 3EGIA 3IAFA 4QJ5A 1ZO8A 4YCJA 4MK9A 3DJYA 1MKYA 3M3PA 3H2LA 2CHQA 5AK6A 2R8YA 4ILKA 5AR1A 1DV1A 3R5JA 5K8PA 3W2TA 1WDWB 2VNAA 4K46A 3DE1X 2IBTA 2VTKA 2FRDC 4Z9BA 5E2IA 3PFIA 4DG5A 3DLPX 5TGZA 5I5GA 2COUA 1DTQA 3QGIA 2F2TA 1E9RA 2IGTA 5DGIA 2C2MB 1SC9A 3M8RA 4LCEA 3IQFA 4ETNA 4G85A 1U94A 1EIYB 5KHOC 2FZLA 4NRUA 2AA3A 3QE3A 4IQXA 2CN1A 4BLGA 3L2OB 1PBAA 3VAZA 1MROB 2OG2A 4G1QA 5A1TA 2FSFA 5DQHA 3U1VA 3ZV6A 4PWDA 5F9NA 2XKAA 5A0TA 5CTAA 2D0DA 4CLRB 3RE1A 1HT1E 2F48A 1WSDA 3SF0A 2MY7A 5F3TA 4K4WA 1A8IA 2XEDA 4PSVA 1RFGE 2C59A 3MDFA 2I8EA 4WADA 1AM4D 1TFUA 4FIDA 3E7WA 1ZLXA 5KBYA 4ECRA 3H4IA 4AKHA 2O5RA 3T06B 3W90A 3AXSA 4K6CA 1Z6QA 2HO5A 4Q34A 1ITPA 3KJFB 2OGZA 4X1IB 1WHYA 4X7PA 3VDNB 3P3DA 4YMIA 2QRHA 1UBGA 2P4UA 3NC4A 2WM9B 2IYIA 3BE4A 1OMSA 3KEOA 3VM6A 2GN2A 3O3LA 4L50A 3H2SA 2AOTB 4FDVA 3SXUA 4LX8A 5ALIA 2VASA 4F5YA 4HNRA 3EWSA 4MRMA 2GFIA 4CQLA 2W00A 1LXCA 3F1KA 4W99A 2H9YA 2HUPA 3T95A 1S6QB 1NLYA 3OZ7A 5DLGA 3CIOA 4UBMA 2DWOA 5L6MB 3WX4A 3ZWWA 5DGTA 3G87A 3AMVA 4URUR 3MINA 4F2DA 2W48A 1QE3A 1JIVA 3RUPA 3N0RA 4DLAA 2F8SA 1U0BB 4CV0A 1BLUA 2AP6A 3RFCA 1XZGA 2KJVA 1OXTA 2OEPA 3QVJA 1H2FA 2VPWB 3LWLA 2GW8A 3T7AA 1RQ7A 1J97A 3SYLA 1IN0A 3FD8A 2RCYA 3SJUA 1SKMA 2VLIA 3BT7A 3N6RA 1VGYA 3H90A 2C84A 2XUQA 2C82A 4EYHB 3BGFA 3II6X 1RWUA 4JLNA 4H7JA 3DOHA 4FP9A 4YIHA 3HM9A 2XLKA 1S2OA 1RZMA 2RQ4A 3VR6H 2AD9A 3PDNA 4DQSA 3UJ3X 3GG9A 5CVDA 3EZ5A 3V7YA 4NK4A 2VBWA 4P9SA 3FPCA 3SFGA 3LBYA 4B44A 1UPBA 2QN6A 4BVBA 2C4UA 3LZCA 1HR0B 5C7IO 3IJ5A 2YPYA 1YVRA 4DR6J 2LUOA 1JQGA 4J8PA 1QB8A 4K9KA 4F67A 3T4UA 4Q18A 3UH1A 3A1NA 4DV3J 3PDIA 3H7HB 4MVJD 1KWMA 1SUQA 3O8WA 5L95A 3JPYA 1VBMA 4IG9A 2BMEA 4YR9A 7GPBA 4OYYA 1R0CB 3EPIA 3RVDA 4CEHA 4XM2A 3LOQA 1QSGA 3RVLA 1DAGA 5HS4A 1WSAA 2GSDA 3EFBA 2DRBA 4RPJA 5ENVA 2X3UA 1G9TA 3OQ1A 2PUWA 3EQ6A 2QR5A 1GNSA 1CUAA 4AD8A 1KP3A 1ADGA 5HFJA 4EYGA 1N36B 1R6DA 4LHZA 1IHYA 2JJMA 1H72C 1DOHA 4Q1EA 4I3GA 4D5GA 3A06A 4PAAA 2Z1MA 5DM4A 5D5HA 1FKPB 2A67A 3GZJA 1PILA 5F0WA 2FPXA 1XP5A 1Y8AA 1TP7A 5TMPA 4UTVA 4JX9A 1ULRA 2BGIA 1ILEA 1VIXA 1E2LA 4DCNA 5KFIA 1H69A 4MYCA 4DNXA 2XNHA 3L4BC 1L4MA 3G9CA 1WVMA 1HYEA 4BV2A 3QMQA 1N77A 1WABA 4CT0A 4LYFA 1SKUB 2HGSA 4TSFD 3R7BA 2C4VA 2F64A 4G5FA 1F8UA 4LSZA 4RPCA 2HMVA 3DAFA 3B2QA 2Q1TA 2YIDA 5J1TB 3KHHA 3WGMA 5JZBA 1YAHA 4N7RA 5JJIA 1UEXC 4EHDA 1D2AA 2JIZD 3K5LA 3ZLTA 3OV7A 4POAA 2GKOA 4WDRA 1D03A 3JYOA 4ZP6A 2IBOA 5EUHA 4RX6A 2QWXA 4I4TF 4ESEA 5AQEA 2ZJZA 3C7AA 2M1XA 3DAGA 3K0AA 5B0AA 3PEHA 4NBLA 1TCBA 1E69A 2GZHA 2QGFA 1HQDA 2A88A 2WJ6A 4E46A 3RW7A 3DH0A 1RXOB 1NUSA 1NASA 3AY0A 5JIBA 2RKIB 1ZJ4A 2CUYA 2CQ0A 3CCES 1OMOA 1NZAA 1J42A 4OB8A 3MWEB 4H0CA 2LQBA 4DMFA 3H6KA 4FI3C 3THXA 1SHUX 2B8JA 2XPCA 3L8YA 3DMPA 2BRKA 3BH7B 5MN4A 1BD4A 3PA8A 4G8CA 4PICA 3CG0A 5IKEA 3ZTPA 4GVBB 4NZOA 5EVCA 1E6MA 4DLXA 2MZJA 3R8XA 4D4KA 4R69A 4RTOA 1B8VA 4IDFA 1NPPA 3FZ2A 3WBFA 2ZU6A 4DR1J 3CW8X 1SJ3P 4UQLA 2IOHA 4YMSA 1SVLA 4MGYR 1S9HA 2EDCA 3O1LA 4EVQA 4M86A 1T2NA 2BTOA 3CZPA 4G09A 4WTOB 1TEHA 1S7GA 4J2OA 5AKKA 2JBAB 5EZ6B 4N7TA 2KM8B 3UNGC 1NU8A 3T9EA 1PYDA 4HDOB 2XMSA 2RQKA 5BV2P 2YHSA 2ESRA 1T8YA 4XCXA 5AXDA 4DCGA 3DF7A 2DPLA 3T3GA 3F6SA 3HDJA 3CUVA 5ER9A 3JD0A 3NTXA 1RWQA 1NMXA 4OYBA 1V4NA 1PFVA 1V3RA 3ACDA 1IQUA 3IPCA 1IK4A 4B1FA 5EJ2A 3KJXA 4OM7A 3VVTA 2XBUA 2QSJA 3AUUA 3JAMU 2PYZA 3G5LA 4Q7LA 3DL4A 3IT3A 1NU6A 2QYOA 3VKUA 1FMJA 4UNQA 4IHAA 4LJ4A 4G65A 1UK6A 821PA 3VR6A 2JIBA 4YMLA 1EUDA 1CJTA 1XZNA 4DY4A 2VDMB 3FWHA 5IKXA 1WD6A 4R71A 2G6TA 5A9TA 4NTZA 2FP4B 2OSRA 3KK2B 1QZTA 4KHPF 4XB6B 1NSTA 2NLOA 2O6LA 2ZTLA 4EZEA 2E7VA 4NECA 1JJHA 2XVMA 3FW1A 2DHRA 2ZSHA 1NMSA 1AROP 3VC7A 1Y9ZA 5KFMA 5I3QA 1BXRA 1QC5A 3BFKA 3BICA 4OSPA 4AJ4A 1NVEA 4XDYA 1ZA2A 4JB0A 2OIHA 4KR3A 4IV0A 1DP4A 2CVZA 4N41A 2Y8YA 1BWRA 3K30A 3R1LA 3ILVA 3WLNA 3OOSA 1TMYA 1SOUA 3I1FA 1SVNA 1PJ6A 4OXXA 4WKBA 3K70B 3P4UB 4RH1A 4CF4A 4YUZA 3KQWA 4YLYA 3S0JA 4J4HA 1QV6A 1OHHD 3CMMA 1EFKA 1K44A 2P0EA 5EQDA 3ZE0B 4ZDKA 2PH7A 1Z7EA 1RQPA 1MEEA 1UIMA 1BA2A 4BECA 4F3OA 3H7IA 4E11A 3QELA 4YRFA 3W8RA 5EGSA 1P3DA 1O0PA 4KMOA 2ZQ5A 1GPH1 2WK1A 4IFEA 3NHKA 4KLAA 4J7UA 2R8OA 2ILZA 4OX8A 3WC2A 4I7FB 4RS3A 2NZCA 4JHXA 2DFNA 4DS3A 1J9ZA 1UAGA 3OX3A 1N0WA 8OHMA 3FF1A 3SG0A 4H18A 4QTYA 2CKDA 1QRTA 3IOEA 4OV1A 4QYIB 3FDIA 2A4MA 2OV8A 3RRMA 1SCIA 3M83A 1GQQA 3DYIA 2EWWA 2A2ZA 2RHMA 3CUSA 3ESZA 1E2IA 4NXNF 2X51A 3ASUA 5DYNA 5KWVA 1WC3A 2N3OA 5C2GA 1KWKA 4MUYA 3RAGA 4E2FA 2B3TA 2R7VA 1VRVA 3PRVA 3E1KA 1B6RA 5HLFA 4WBXC 5A1JA 2G1UA 1K0FA 3THTA 5LQRA 2V7TA 4I55A 2K7JA 5IZCC 1N6NA 2Y2VA 4XWYA 4MMYB 4K9OA 4DIUA 3U1NA 1JTFA 3TJ8A 1QSSA 2NYUA 2WZDA 4BAUA 1XYGA 3HQ4O 3ROGA 1N32F 2CF6A 2YCBA 4KL8S 4TTQA 3G96A 3OOEA 4JXXA 4ATNA 1UBOS 3NASA 4HEA6 5DOZA 1TO1E 4P3NA 2V2QA 1ACMB 1MABB 4Q4AA 1Q95A 3SCKE 1UEVA 3VHRA 2SNIE 3KT8A 1U09A 1ZIDA 1X4AA 3X1YA 4EQ6B 4D99A 3FEZA 4KE7A 4J5OA 1AOXA 1H2TZ 2PMBA 3K8ZA 3LGNA 3OWXA 2IDKA 3WHKA 3EQZA 1LVGA 3DF9A 4P7KA 2Q29A 2AKEA 1GDTA 4EWTA 1XTBA 1JJAA 5K0ZA 4YMTA 9ABPA 4YGYA 3DKRA 5LNK1 2WT8A 4RMNA 4M6WB 4DQKA 2KT2A 1E6CA 1MQAA 1FF9A 3K1TA 2ZWIA 1HDOA 10MHA 2VPYB 4HVCA 4GQAA 3UAWA 4A0QA 5IJXA 4B02A 4CCYA 5TF4A 5HBRA 3M30A 2MZ1A 1VGQA 4OFWA 4AM8A 3BK1A 1VQ9S 1ULSA 2ZROA 4K4TA 1XZJA 4MV5A 2RUSA 3OWHA 2BFMA 2NO6A 3QWAA 1R37A 5A4JA 1VSVA 4BKMA 2PJDA 5FBKA 1JLGB 3LP8A 2DHHA 1EUYA 1HQUA 2QRLA 3VI3B 4OZ2A 2IZ5A 4JL8A 3W5XA 3R0JA 4OL9A 1PR6A 5K03A 1U8XX 3T5HA 2BFEA 2JVJA 2RI1A 4QTZA 3KOXA 4H17A 2X0JA 4N18A 4M1OA 2WHRA 1HMPA 1L3SA 2I9SA 3WB0A 3SD7A 2O8CA 3RYHA 3L46A 4KNYA 3VPAA 4MRNA 4ZPAA 1RZRA 2OFOA 1M6NA 3BD6A 3TZZA 1E1QA 2FE4A 2H7XA 1FJGJ 5JAZA 4UUOA 3PQFA 2GK7A 3K6SA 3I0SB 1WHWA 3LFHA 4BVHA 4PRFA 3RUCA 3KQNA 2DRDA 4LSZB 2FVCA 2XOKD 4ECTA 1G8SA 2O4UX 4RJ2A 2VTEA 3LUKA 2AV6A 3TQCA 3FBCA 4A8PA 2RGEA 5B64A 4A8XA 4PTZA 4EG6A 1X15A 4FYVB 3DSRA 4DQPA 1NX9A 1EDDA 2M70A 1E6EA 5K4HA 3NYIA 3UA4A 2G2ZA 3CFYA 3P1JA 5CYPA 1WUYA 4G4SP 1VRCA 4Z7JA 1LK5A 3K0CC 3KLEB 2YH1A 4Z4QA 1J5EF 2BW2A 2V74B 3A25A 4XDZA 1GCIA 3OP1A 5L4LA 4AJLA 3ANMA 2I62A 4EBFA 1WHTA 1YV9A 3BCHA 4O4IF 2IYRA 4UULA 5B0GA 2DUMA 3JQ9C 4D81A 5HZGA 2O4CA 3CLRD 2I2XB 2WJYA 3LK7A 1IUKA 4QSMA 4QT4A 4BP3A 5DBGA 2D0OB 1NSAA 5F9MA 2YWWA 3CC8A 2DCMA 2O2YA 2UDPA 2ZVQX 3MUMP 1MBZA 4FNIA 3H9JA 4NENA 2REQB 5CNIA 3HXPA 3MEEA 3OY2A 1OYEA 1GG9A 3H84A 2D3WA 4J4BA 5IK2A 2VAMA 3GDGA 4OH7A 2VDLB 3C6KA 1NJ2A 3D3NA 2EW9A 1P1TA 3GJTB 4ZI2A 4EFDA 4XQGA 2B1IA 4LDJA 2B30A 1TIPA 4BGVA 1QUVA 2ROEA 5D78A 5CEFA 5FYQA 2FN4A 1GPUA 2A7XA 5AXAA 3W9JA 1PR0A 2YKAA 4UVEA 4IRXA 5AUQA 1UBJS 2NXJA 4C4PA 1QGYA 1H0RA 1JJ7A 4BXOA 3TJMA 3F8SA 3LUHA 4PKDB 2PRZA 3IDQA 3JTEA 4Q16A 2I2AA 4ROTA 1RJWA 3EZFA 2PL5A 2L0XA 1P17A 3NHPA 2LEPA 5AT1A 3R7WB 1RBAA 4EA7A 3ETJA 4X3OA 3RARA 3S44A 2I3GA 3MTEA 4DR3J 2VT3A 4TQ9A 1Z0UA 2HHQA 3MIIA 2EFDB 1MAAA 3NBQA 1F5AA 3OW2R 3FVQA 4LE1A 4R40A 5KVCA 3P2EA 4H7KA 2E82A 4EUFA 3O3NB 4AXBA 1CJTB 2HU5A 1VOTA 3CE9A 5I9NA 1PK9A 4N5HX 1JA1A 4YAFA 2NW6A 4RY8A 1OSNA 1GH8A 5B1HA 1YR3A 1PV2A 3DOMB 2VJPA 1UEUA 5J2PB 2OQIA 4E08A 4OJGA 2Q2NA 3N1UA 2XGJA 2Y27A 3LG2A 4J2HA 3BWYA 3UHFA 4N48A 5ETLA 4ZHRA 2O23A 4RW4B 4A10A 4KB5A 3BBLA 3ZHTA 5AW0A 1RKQA 3E82A 3GUYA 2ZH5A 1LNQA 5BSRA 4MW1A 2XYHB 2HN9A 1DMSA 4JYAF 1OA1A 5K5EA 4QFDA 2JLBA 4F4UA 5EHIA 3N8DA 5C8ZA 2K7FA 1P45A 3S55A 3KKNA 1S2GA 2WSYB 1X9WA 3CIFA 1UJMA 3RU0A 3FSIA 2ZYVX 1F0XA 1JDBC 5GV7A 1H9AA 1K89A 4BZPA 1NI5A 4TUYB 4K0KJ 3TB6A 5AJ3F 5GOZA 2WU8A 1OE0A 1X2EA 2RHCA 1KK0A 1RYNA 3FA2A 4DU7A 2F3SA 2FTRA 2AQIA 4OJ1A 4TQUS 3T54A 5K6RA 1QC5B 4ECAA 4J3FA 2UV8A 3D4PA 1JKXA 4M1KA 4NFHA 3RBZA 1WG5A 1YFLA 1ZBDA 1ZH8A 1PTJC 1SZJG 2W71A 3I28A 2CNNA 4HAUA 2FHPA 1X5OA 5KYNA 2BGMA 1M0EA 2O8EB 4JI3F 3RS8A 2MQ8A 2A9PA 3IP0A 3CSSA 1KAMA 2WUFA 3TVKA 3TRHA 3A26A 2G6BA 1XKLA 3AXTA 2OZEA 3LV8A 4RZ3A 1AJEA 2GS9A 5AJZA 5JH7A 1PT8A 4EG1A 4BQFA 5AVTA 2N4CA 3BRWD 1BZYA 3BGRA 1J8QA 4CRWB 1F1JA 1H9BA 3ZCRA 1NP7A 4QQRA 3M0EA 4RMJA 1RBMA 3EVCA 4DMGA 5ALLA 2QU8A 2PJZA 3GUUA 5EIBC 4WESA 1EPUA 4ZJYA 3IE2A 3OURA 1SZDA 2VC2B 4EB8A 1N36F 5E2QA 2AC2A 2SKDA 3DE3X 3QMMA 3R3YA 1RLJA 2H9IA 3TVDA 4N56A 2XCLA 2JAUA 1HWJA 2LVWA 2EQAA 1M6YA 2PWYA 1WXWA 2BM9A 2V34A 2PRIA 5CH8A 1S76D 1YB7A 3OQ6A 2BRUC 1FFSA 3QVUA 4Z0HO 2ZDOA 3D6UA 3AG5A 1XJWB 1TA4A 4BDPA 3LLUA 7ABPA 2ZBCA 1S7CA 1K6EA 1FU8A 2OKQA 1HARA 4YV0A 3M6MD 3J7Z5 2P9JA 4G0PA 3M82A 2HMIB 2IXDA 4L6CA 3KNGA 4DJBA 3HJGA 1CVIA 4OV6B 3CE8A 3C14A 3LQQA 5JSKA 4HB3A 3RAJA 4Z7CA 3H42B 2DHSA 4BWMA 1PYTA 2EBGA 1S3GA 2G0CA 1JIKA 1BHQ1 3VSAA 4DG8A 1NVFA 3GROA 4II3A 2UZ1A 5ARCA 2JL1A 4J43A 1G3OA 1P29A 3CPEA 1WG1A 1M2JA 1C2YA 3TD2A 3V6JA 1U6JA 4DC0A 3ADBA 3T1HF 3QE2A