1IXMA

Crystal structure of spoob from bacillus subtilis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
168
Chain Sequence
SDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDIMRFEITSHECLIEIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formation of a novel four-helix bundle and molecular recognition sites by dimerization of a response regulator phosphotransferase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords PROTEIN (SPORULATION RESPONSE REGULATORY PROTEIN)
total genus 56
structure length 168
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
A PF14689 SPOB_a Sensor_kinase_SpoOB-type, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ixmA01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 1ixmA02
4MTXA 5B1OA 3ZRXA 4GT1A 5C93A 2WWWA 2LFRA 4JAVA 3ZRWA 3ZCCA 4ZKIA 2C2AA 4FMTA 4BIZA 1F51A 2FTKA 4QPKA 3NXSA 4LC1A 4I5SA 5IDJA 3D36A 3ZRVA 3A0RA 2LFSA 4JAUA 2P67A 4QPJA 4MT8A 3ZRWB 3P32A 4BIUA 4U7OA 5B1NA 4GCZA 1JOYA 4FPPA 4Q20A 4JYCA 2QM7A 3MD0A 2QM8A 3TK1A 4JYBA 3DGEA 4U7NA 1IXMA 4JASA 4KP4A
chains in the Genus database with same CATH superfamily
1WB8A 3JALB 2ZM6O 5M4PA 3OEEG 3W7TA 2VCJA 4QGPA 3AK1A 4MVOA 1GN4A 4F6RB 2R70A 4DV6O 2KQXA 4NXNO 4EFUA 1NQTA 1YDXA 4PJ0Z 5EBMC 4EGKA 4NXNB 3T10A 1FFTB 1KKDA 3ASNC 2QG0A 1VIBA 3N2KB 4AWOA 1S76D 1M4UA 1HNWO 1NKDA 3ZMUA 1SESA 1Q86W 1N0JA 4FM0A 3WB1A 4J42A 5CA3A 4X65B 3T2SA 5LOVA 1TAEA 2CTRA 3FD9A 2LP7A 4UV9A 2JDIG 3TXSA 3WB2A 5JVDA 2EULA 1HNXO 1SS3A 2UU9O 4AQYB 3E22B 2VWKA 1US7A 4AHCA 3SPCA 4MTFA 1I5DA 3GIGA 3B09A 1VQ4V 2YE6A 3C3SA 2CH7B 1XMQO 3IAYA 3ZM7A 4IYIA 3FFQA 2XAFA 1HDJA 3ZHTA 2YEIA 3HZ5A 2XUMA 2DQ3A 4JYYA 1PV0A 5EZYB 5GONA 3HKEB 1FPOA 4NXMO 3CS5A 4OX9B 2R9AA 4DV7B 4XC0A 1K7DA 1NS1A 4DW1A 2XJXA 4TQDA 3ASOC 4P9OA 3CC7V 3DTUB 2E5LB 1IBLO 2PGGA 3J80N 5H2FZ 2F95B 1IBMB 1K4DC 2DYRC 2GTAA 1A32A 1K4CC 1YT0A 2YGEA 1EZVH 3K5MA 4KP4A 1ZXNA 3E89A 3E35A 3E2EA 4GX0A 4BIOA 2YXLA 4HZ0A 3ZXOA 4B3TB 3SYQA 1YF2A 4D7TA 2IOPA 3JCZA 3EHGA 2Q2EB 2AGAA 4B3RO 2DWDC 2OTJV 2ZE5A 4PHZA 4XCLA 4RAIA 4KFMA 2M6YA 2X6BA 3SJAC 3CRCA 3K5LA 1YITV 3CCVV 1Q3EA 2IWXA 2N04A 5CTXA 4JI7O 3BRCA 5KHGA 4P7AA 2OCCC 3RW0A 3OW6A 3SPJA 3D2RA 5LYJB 1YC1A 4DR4B 1QQCA 3STLC 1S0VA 1AI7A 1YEWA 3L72H 1S14A 3JD4A 2PYLA 2BYIA 1K3EA 1VF6A 1F4NA 4Q20A 3T4ZA 3ETQA 1JX9A 4PRVA 1FS0G 1JJ2U 4LF4B 2VRZA 1UYDA 1QLEB 1VQLV 2YKEA 3KE6A 3OWDA 2WLKA 1DK1A 3B8NA 3B28A 2EZPA 2QFOA 2GV9A 1KU9A 2P6JA 2P67A 5LOVB 1VEWA 2K1EA 4GX5A 1SQQH 3FB6C 1THZA 5FPRA 1H2LA 3C90A 4J7KA 5IY5B 1N4CA 2YUAA 2F23A 4JI1O 2ZKJA 5CA1A 2QA4V 5CBGA 2BTOA 5LMNO 1ZAUA 5D5QA 4ASGA 2YECA 2D3OW 2ZIMA 3SYCA 2IJJA 2VWJA 1R6TA 2YKJA 4KTNA 1QHTA 4DV7O 5DEDA 1Z5BA 4KQVA 2YSUB 4B3TO 5H5NA 4I9WA 1H8HG 3C3TA 5FNVB 2HVJC 1ZX3A 4WFGA 1MOFA 2FYUH 2QM7A 3ABMB 1Y67A 1BHAA 2IORA 1GO3F 5F5RA 1J95A 1GH6A 3CC4V 2LFRA 2ETNA 4GKJB 4P30A 2YICA 2GDSA 4DR4O 2EXLA 2FWYA 4JI8O 3R4PA 3H1JH 1BYQA 2L35A 1YTFD 4YIOA 1LUWA 4I4TA 5J9PC 2ZT9B 3E8HA 3Q4HB 3ABMC 4JPRA 2DOSA 1ROPA 4NH8A 2PY5A 4IHJA 4P2ZA 1M57C 3LUTB 4UB6Z 3AG3C 1XHXA 3ZEDA 1R62A 4O0BA 2WI7A 1KIJA 2YIBD 1IZ3A 3ZRVA 4PU9A 2ZM6B 2XDKA 3O0IA 2AHZA 3QTCA 5KX5A 2UUAB 2YEFA 4FLWA 1H7UA 4H44B 1NHIA 1YT1A 2HEPA 5LA6A 4UFZA 2N74A 3WHAA 3JATA 1COWG 2BOCC 4MVUA 3AG1B 2YXHA 2ZE6A 1QLNA 1B6QA 4FLYA 5C8YA 3IGAC 3CD6V 4IGGA 1BE3H 1HWYA 1OCCC 2XDUA 4FLXA 2H94A 3TTZA 3H9VA 3RYCB 3JSNA 3K58A 4J7JA 2ZE8A 3UQ8A 2W6IG 4GT1A 4FM2A 1IBMO 4CWOA 1GM8A 1WA8B 3AG1C 4GYCB 4JI3O 3H1KH 4CH6A 4UB8Z 5L3BA 1BGQA 4CH3A 2G38A 4L90A 2DWEC 1XMOO 5H6QA 3VBBA 5BR8O 3RGBA 2ADQB 3B77A 1K33A 3OFNG 3JD2A 1XQ8A 3QO5A 4GCZA 1F4MA 1P7GA 1AVMA 1D5AA 4CS2A 3SPIA 1B62A 2YEVA 3VQWA 2DE0X 1VQ8V 2YEJA 3RBZA 1VQ6V 4DR5O 3DC6A 3NR7A 5IWAO 3CJHA 4X64O 2HG1A 4CWSA 3E8GA 3L74H 3BA9A 2A9HA 4J9ZB 4I0XB 5JJJB 2WAMA 2VQEB 4L8ZA 1NVPD 1GN2A 1TUBA 1QCEA 5CN0A 2P06A 2UUAO 1PL4A 5FNFA 4RUFA 2AHYA 1MABG 4MPNA 4LF7B 4LWSA 1R73A 2ARHA 4PDMA 1HR0B 3B26A 4CWRA 2CUGA 4LFBO 5IN9A 4LF4O 1VQNV 5K1PA 4IHJB 2JGDB 4DV6B 2DJVA 1YJWV 5J71A 4MP7A 4ZVIA 2ZKOA 3AG2C 3T1HO 1CPYA 4TQFA 2OIEA 4B3MO 1K5QA 1H2MA 1Y4MA 3ZHRA 2Q8GA 4X20A 5GW7A 1FXKC 2WI1A 2PTMA 2EIKC 4X88A 3T1CA 3ZMTA 2QTSA 4F4LA 3TZ2A 1YI2V 2XDSA 1B04A 3CCMV 3CWBH 4FCPA 2YKCA 4LF9O 1R6NA 1XNRB 4XDKA 3A0TA 2IH1C 4FJCC 3ABLB 3E22A 4BAYA 2OT5A 4WF9V 4K8ZA 1RPOA 1TVKA 1P49A 3BHPA 3BVOA 1Z2GA 4DR1B 3C0EA 4DV5B 1AP5A 2Y69C 3SDLA 1GKXA 1LNQA 3HYYA 5LXTB 3DGEA 3CCSV 2X6CA 1KMIZ 1OJHA 4HBNA 4LP8A 2QJ1A 4F6RA 2DW4A 3RYCA 4DUYO 4QPKA 3ETDA 5IYDO 3CCLV 4PDLA 1Y8OA 4B7EA 2YGFA 1K92A 3EKOA 3LNMB 1J5EO 3FB8C 2DYSC 3KZIZ 1EM1A 1I94B 1O9HA 4ZHQA 1YIJV 2A7WA 2ZXWB 4YJ3A 2QM8A 3CRAA 3SR2C 4LF6B 4U7NA 1UYHA 1V55B 2H3OA 5KAIZ 1H7SA 4OX9O 3CGZA 1GRJA 4ASAA 4DR7O 4LWEA 4NTWA 4ZI7B 2IJIA 4DV3B 3A0ZA 3OWBA 2UUCO 2WI3A 2Z3YA 3GWKC 5KHKA 3VHCA 2BOBC 4LFCB 2ZQMA 1N33B 2RCVA 5DECA 5L3JA 2NN4A 2LW7A 1Y4UA 2B5UA 2ZCEA 3T0ZA 4LFBB 4MPEA 2EILB 3CE2A 2EZOA 4GX1A 2WLIA 2WPDG 4PA6A 1Z5WA 3X2QC 2HJDA 2QWQB 2YKBA 4B3RB 2ZNIA 3ZKDA 2HFEC 5M4EA 5M4HA 1I5AA 3M99B 3DXRA 4CWTA 2HJFC 4X64B 1YHQV 1OCRC 1NT2B 4PA4A 2FYPA 1JA8A 1UFIA 2CTWA 4DR2B 2PI4A 2LQTA 2ZDIC 3JASB 4R3MA 1JQ0A 4JI6B 4XD8A 5CMUA 1B06A 3JYCA 3SPHA 4ZI7A 4O05A 3KG2A 2OWOA 5IDMA 2GQPA 4NH9A 5BMVB 5M4MA 3QDDA 4RQFA 2BZ5A 1Q6HA 2WI5A 3G6EV 3ZHVA 5IYCO 2QKCA 1XDCA 2JVDA 4TSFG 5FL7G 1N34B 3K0DA 1CP9A 4XIQA 5KUKA 2XD6A 2YI7A 2QDOA 3LNNA 2UXDB 2UXDO 3B24A 5LP6C 1S16A 1Z59A 4WFHA 4EEQA 3K5OA 1UYGA 4I50A 4JI7B 2WLLB 1IXBA 4BWAA 3CGYA 1G4YB 4XIPA 3CWVA 3JZ3A 4OXSA 4BW5A 5L3EA 1NHHA 5BODA 2UU9B 3OR6C 3OMNB 3ZRXA 4LFAO 2O1VA 5EIBD 2R9IA 3G71V 3MAQA 3INWA 5EK0A 3JAKB 5CTYA 1H8EG 1SQBH 4UCSA 5IDJA 3ASOB 1VF7A 3ZS8C 1DF4A 1RP3B 2CGOA 2YIBA 5JWPA 1V54C 3OTOO 4O4IA 4J41A 4GUNA 5KMGA 2IBZH 4EFEA 2BSKA 4JI5B 4X9QA 5EC1C 5H9CA 4R1FA 3FAVB 2VQEO 2XDLA 3CCRV 2FWZA 3CC2V 2AW9A 2IH3C 4JTAB 3NMQA 3DC5A 4BQGA 1IX9A 4XDMA 4XCJA 1YESA 3FB5C 4X1YA 3LSSA 4Z2WA 1S3JA 2CGNA 2CTPA 1SA0B 5LHHA 1KUQA 1XEQA 2UUBO 4J9YB 3ZJZA 2Z0AA 1Q43A 1SC5B 1AR1B 2QGNA 1OHHG 5D6QA 3VQYA 2O57A 2Q7GA 1Y4SA 4X1IA 1F7YA 4W4LA 2XOKG 4ZKIA 1YJ9V 2IWUA 1PNMA 1ENVA 3RYIA 2AZ0A 4DUYB 4JI6O 3JAKA 4EFTA 5D5PA 4KHPB 4UUJC 3X2QB 3U10A 3N27A 1HP8A 5IJ0B 3RVYA 5IYBO 4MW3A 1SZXA 5J2UA 2QKSA 5FLXN 4L93A 1BQZA 5D6PA 1ZTEA 1YZBA 2RNBA 3M8AA 3K79A 4TV9A 2YC0A 4XBFA 2YE4A 1AJQA 4RUEA 1N36B 2IM9A 2CG9A 4NH7A 4WFAV 2YEVB 1VQKV 3G6BA 1R3JC 3J7AU 1BKNA 3E83A 1R1BA 4GKJO 1TILA 2WLLA 3CP1A 1XUQA 1M90W 1OCOC 5EYPA 1G6UA 3BFRA 4G27B 2OCHA 2WLNA 4DV2O 2UXCB 1M56B 4IT5A 1YETA 2DYRB 3BM9A 5FWKA 3K5NA 4YHHB 1FYJA 1ZW9A 3ZRWB 2H8PC 1OSFA 1FXKB 1H2KA 4H33A 4HZ3A 1NTMH 2UXNA 2ESAA 4IIJB 4WBNB 1JFFA 5DM6V 2JRIA 3ZHUA 3WB0A 1PNLA 5KMGB 2Q8IA 4ASUG 4I7ZB 1I58A 2PZSA 4E72A 3JAMN 1N0NA 2LGQA 4TV9B 1VQ9V 1ID0A 3BA8A 4JZ2A 4LP0A 4LWIA 4DV1B 2CH7A 1SQFA 4B6CA 1NR1A 4HAMA 2GUZB 1XI1A 2IU0A 4BQJA 4PDRA 2A0LA 2YIAA 4DUHA 5JVDB 3D3IA 4HY1A 2DQ0A 4DR1O 1AJ6A 2ZBKB 2W0FC 1X4TA 5LMUB 4UCUA 1OCZC 1JMKC 3O65A 1MNGA 4EGIA 4B3SB 2UXBO 1KZNA 5L3GA 2LFSA 3R91A 4JI4O 2Q69A 3E86A 3R4NA 1YSRA 1MA1A 3EHBB 5B1NA 2WEQA 3MNRP 1JM6A 3F5WC 4GLXA 3H1LH 4YKRA 3H4LA 1WNSA 4D7SA 3LSQA 2WWWA 1QNMA 3HKEA 4GX2A 3CXHF 3CEIA 3HR0A 1RM1C 3SJQC 1M1KW 3ZXQA 3TGUH 1MG1A 1I94O 5ITZB 2XHRA 5B1BC 4EMVA 4DXWA 1QZRA 2GUZA 1K34A 4DO2A 2CK3G 4URNA 1DLBA 1QYEA 4U7OA 3UO2A 1JOYA 3CXCU 3GVMA 1TC6A 4UROA 4CC6A 1E79G 3CCQV 1QVFU 1P7BA 1VQMV 1VQOV 3PN1A 4I55B 1N36O 2YGAA 1DF5A 4DR2O 1ZUQA 2Q0AA 5GTHZ 4TV8A 2DMXA 5CB4B 4HYMA 4TOIA 1HNWB 4O4HB 2FTKA 1AR4A 1R3IC 2BCCH 5IE9A 3CCEV 3UCSC 1NR7A 4X66O 1NH2B 3OEHG 2XT9A 3U67A 1D2DA 4LH6A 1O9GA 2B1GA 4FIPC 5CA1B 2V1DA 3UT5A 1HNZO 4H13B 1AH8A 3CCJV 1FXKA 2H8MA 5CA0B 4DW0A 3K9AA 4R3AA 2XX5A 3JD0A 2XAHA 3AG7A 3QO7A 4DR6O 4CE1A 3UKMA 1I7FA 1Z5AA 3TJTA 3GWOA 3FYIB 1DGSA 2ZR2A 3F5TA 4YKQA 5E79Z 3BABA 2OYQA 4A5UB 1VARA 1TBWA 4XKAA 2ITCC 4YKTA 1QR8A 1JPXA 4O07A 3IC7A 4YY3O 4PL9A 4QE7A 3D36A 4TWKA 3IFXA 5E1AC 3A2FA 1Y76B 2YE3A 2X6AA 2ATKC 2XASA 3KKYA 1UYCA 5HFLA 1FFXB 4LNUB 3LNUA 1RFYA 2XJGA 4NVPA 1TC0A 3ZRSA 1AI4A 3HKDA 3VHDA 1Q6UA 4ICGA 2BTQA 5AG2A 1FJGB 2QR4A 4CWNA 1PVGA 2HVKC 5EC2C 1XMOB 4YHHO 1VQ5V 1GMGA 4X20B 4H85A 1UY8A 3G7EA 2CCSA 3RKZA 4MVSA 4H81A 3TK1A 4UVBA 1YC3A 2YXYA 3HHUA 1TVKB 4FMTA 4X62O 1KECA 4J7ZA 3RWRD 1JFFB 1US6A 1IVSA 1L1FA 4LWHA 3ML0A 1AM1A 1EN5A 2XCMA 1WP7A 3ETEA 3ZMSA 3CSXA 5IJ9B 1N8RW 3BMYA 2QTOA 3AK2A 5B1AB 2UXCO 2Q5ZA 1YSZA 3L73H 3Q5LA 3L71H 5EZYA 4LNUA 1Y8PA 4I0XA 4JAAA 4RWUA 1BGYH 3CRQA 3D36C 3RYHB 4QE9A 2RJZA 1W0JG 1S5LZ 3GIGB 1SQGA 3HYZA 5CTWA 4FPPA 4JYCA 4PRXA 4JI4B 3G75A 1L0LH 2WERA 5IJ9A 4V26A 2P5OA 4B3SO 2UXBB 1EBOA 1BXDA 2EBOA 5BXZA 3UM7A 2UUCB 3JARA 1Q5OA 3EFFK 3RFRA 4L8JA 3T1KA 2R72A 4CS4A 4LC1A 5IJ0A 2PF4E 2YE7A 4V25A 2JJ2G 3A8TA 3EXAA 4FVMA 4EB6B 1YT2A 5KAFZ 5LP6A 4R6ZA 4K8XA 2CCTA 3U2DA 4BIUA 3K98A 1QBZA 1GJVA 4FZ0A 3LMMA 2EIJC 5CPHA 3WFVA 5CBHA 4LF8B 5BZBA 1V55C 4OPAA 2BSMA 2E0AA 4E01A 4DRXA 2W0XA 2V4DA 4R7CA 4FFBA 5LGUA 1BCCH 2HHHB 3SPGA 3T1HB 2VCIA 3B2EE 1THNA 3ZCCA 5LBQA 2EINB 3OMIB 1E1RG 3OAAG 1UY6A 2BE3A 2FL4A 2PI5A 4I5SA 3HKBA 2YJXA 1MZFA 1MZEA 4PI0A 2KKWA 1Y8NA 4U3FH 2EIJB 1MMMA 2BTZA 3SYAA 5BR8B 3A0YA 2RN9A 2HHIA 4I55A 4PD4F 3OR7C 1J5EB 1B63A 2OIGA 2YS8A 3RVZA 1SZTA 1AP6A 3NXSA 4JYAB 1RPRA 1QY8A 1ZL8B 3FT5A 1Q8IA 2IOQA 5BMVA 3T0HA 4DR5B 3I55V 4L94A 1NJIW 4UCRA 1SQPH 1FKAO 3VHAA 4LWGA 2JS3A 2LJ2A 1OCZB 3LDDA 4MTXA 4O4JA 3ASNB 3HKCA 2Q8HA 3W7WA 2AXTZ 1YXBA 4G28B 3DSQA 2M7WA 3G7BA 4YJ3B 3RT3C 2B1IA 4X66B 3CPWU 4LF9B 3D0BA 4MTOA 3F7YC 4LWFA 2UXXA 3THOA 3CCUV 4PA7A 1M9NA 1TA8A 2XAQA 5B1AC 4U93A 2A79B 3ZIAG 3G80A 2CTQA 4KL1A 3L75H 4C7UA 4MOTA 2JKIA 3EVKA 5KUMA 1EZJA 5B1BB 4YKUA 2WLJA 1ZLZA 2BU2A 1R3KC 3I5DA 1OZ0A 2WLHA 2P4VA 4DUZO 3OD4A 4IIJA 2BSKB 4WBNA 4Z1VA 5JCOA 4X1KB 3R4OA 1SA0A 5L3DA 1MSDA 1Z5VA 2ZIOA 5JH7A 4MB9A 1SQXH 2B9ZA 1HR0O 2JJ1G 4HY6A 4JI0B 3ABTA 2YEHA 4I4TB 4LFAB 3T2MA 4XKKA 3N2GA 4P9PA 1JCHA 4TUYB 4DYLA 3DXRB 3HKBB 5ITZA 4O04A 1NTZH 1SETA 4XE2A 5D7DA 2MK3A 2YI8A 1Q6IA 2HCHA 4R50A 5LGNA 3K99A 5KHIA 3HEKA 1Q90D 3EHHA 1ZXMA 1Y74B 2KSDA 2P90A 4DR7B 3ABKB 1N32O 4CWFA 2UWDA 1KQSU 3JAWA 1SF9A 2EX3A 3S3WA 1H2SB 3R92A 2X7RB 1ZWIC 1WPXA 5J2UB 1JJOA 1BMFG 3BPZA 1WLEA 2OCCB 4MPCA 1BT8A 1D5NA 1YVWA 2N05A 3T4DA 3EHJA 4XIRA 4O2AB 3P30A 2E3CA 1T5EA 1KYOF 1FAFA 3MHHC 4UCTA 2XTAA 4MSWC 3LSUA 5KLVH 4DV0B 4GGLA 1B3QA 2K5BA 1PKXA 2Q6AA 4NKGB 3S3XA 5GTIZ 2ZR3A 3JD3A 4L91A 2YKIA 2XNDG 3S5TA 4CZZA 1M93A 3CMEV 3SJBC 2XHTA 1WB7A 2YDEA 3JD1A 4TUYA 3L9DA 3RLRA 3P32A 3QNEA 2XAGA 1PM9A 2E75B 2GHYA 2HLDG 4DK0A 2IWSA 3FB7C 3JASA 1WP8A 1Y74A 3QG5A 3K08A 1PPJH 1QU7A 1YS3A 4YIPA 1XL4A 4GZRB 3TUHA 5J2TB 5EBLC 1XL6A 2Q7EA 2DYSB 2BREA 2XX4A 3A0RA 2XABA 4JAUA 3APQA 2YI6A 4LFCO 1WJZA 4MT8A 2PNRA 2E5LO 5JH7B 5D7CA 5IYZB 1OCRB 3R4MA 3CRRA 5B5EZ 2Q8FA 1UYLA 4WUDA 1P84F 1ORQC 2E76B 5FPOA 5M4KA 3OW2U 4YKYA 3K60A 4DV0O 1PNKA 3H80A 3OUFA 3AG3B 2Q67A 2HHHO 5D7RA 3OTFA 1M57B 1KD1W 2JGDA 4CWPA 1YTFB 4NTXA 1I0HA 2O1UA 4B08A 3BY6A 5IY5C 1NH2D 1ZL8A 1GAXA 3K57A 1S5HC 3CRKA 4X65O 1AJPA 4MW8A 4ZOLA 2VQFO 1UY9A 1URFA 5HFMA 1K9MW 4HNAA 1HW7A 2K9PA 3FT8A 3A0HZ 2YEBA 2ZXWC 4GEEA 2HP8A 1TH8A 3K9SA 2A3QA 2VWCA 3C11A 3VQXA 4LCUC 1LR1A 4JI3B 1VQPV 1IDSA 4FK5C 1LUVA 5B1OA 4WFEA 4X1IB 4MBCA 3OM3B 1AR5A 2XAJA 3ZN1A 1U2OA 1MU5A 2YIDA 4XDJA 1EA6A 2ZINA 4NYKA 2Q68A 5GGZA 1Z5CA 4UV8A 2LW1A 2Q73A 4X62B 2BYHA 3EHFA 1KKCA 1I5YA 4JI2B 2EIMC 4NXMB 4EEHA 4OPHA 1UYMA 4O09A 5F2VO 2F93B 2FMLA 4K0KB 1BSMA 3KCXA 4O2BB 3ZX6A 2RMKB 4DRXB 3APOA 4DV2B 4Q6GA 2EILC 3SYPA 1SQVH 2NNUA 3JAWB 4K4OA 4FM1A 2Q7HA 2JGUA 4XITA 4EB6A 5LP6B 2ZNJA 5K1XA 2JEXA 1VF5B 4ZHQB 1ZWHA 2ZE7A 1BL8A 2XDXA 5CA0A 4GKKO 3WU2Z 3ZMZA 2GTSA 1BS3A 4W4KA 4DZYA 3H01A 2HG5C 4DR3O 3OPDA 3K0GA 2WSSG 1VQ7V 4DK1A 4JGSA 2AKPA 3OGCC 4JYAO 4H7QA 5FNCA 4HYPA 4UVCA 2YJWA 1IBLB 3QO8A 1KBHA 3H1HH 4BW9A 2CGFA 2F4VB 2QE7G 1VF6C 5A9GA 2HKOA 5JJEB 2BU7A 3CRLA 3RYHA 1U97A 2Q8VA 2HKJA 4FCQA 3CRMA 4YY3B 2Y0PA 3LPSA 1NBMG 2UUBB 2GSMB 1CEZA 2QWOB 3JALA 4LF7O 3OGIB 3J81N 4ABMA 1GM9A 3PJSK 3G67A 2JK5C 1XMQB 3STZC 4FFKA 4WUBA 5LGTA 2YEDA 3ZRWA 4PI2A 4JI5O 5LXTA 3ABUA 2VS0A 4DV3O 2KG7B 4QNHB 3ZBHA 5KA6A 1N32B 4MTGA 5LHGA 1PP9H 4HNAB 2GFDA 2NR5A 3MD0A 2YEGA 1EN6A 5IT9N 4JASA 4UCOA 3G4SV 3ICXA 3HKCB 1UYKA 2VW5A 3B27A 5F3KA 1M56C 2BTQB 1MX0A 4JV5O 3SGIA 4H37A 1NZ6A 2QM4A 3WG7C 1YSCA 3RLQA 4KSHA 2KG7A 3OTOB 2ZDYA 5B3SC 3MDSA 3P3PA 1I5BA 1GM7A 1OCCB 2X0LA 2IW5A 2QWRB 2EJRA 2VQFB 2Y0IA 1F23A 4BAEA 1WPBA 3TETA 1KP3A 4DV1O 3LDEA 1NHJA 2C2AA 5KHJA 4DUZB 3PEHA 4KXRA 2GBOA 2CH4A 1N33O 4F6EA 1G1XB 2XK2A 4YKWA 3CHXA 4PDVA 1AI6A 4X1KA 3HZ1A 1XILA 1YC4A 2BT0A 1UY7A 4LR3A 1E1QG 4TT3G 4B7KA 3K04A 1YJNV 1UJWB 5JCOC 1ZSPA 1L0NH 5LL6Y 1N34O 1NTKH 3K97A 1WAZA 1IURA 5DN6G 4RQEA 4O4IB 3RN4A 1TGOA 2QWNB 2WEPA 2EIKB 3QTFA 4FZ1A 4XTJA 5JENA 2P7TC 2Z5UA 2QEXV 2O1WA 3AEIA 2CDYA 4NB5A 1FJGO 2YI5A 1I5XA 1I59A 3Q5KA 5JQGB 4JF3A 2ZDIA 3E8FA 3OE7G 4ZOLB 3T1YB 4PA3A 2Y4UA 5LYJA 2YK2A 3K59A 2HR3A 4FLVA 3CJHB 4HZ5A 2Y48A 1K5SA 4CE3A 4OGQB 4FFBB 4O4JB 3TZ4A 3TZ5A 2ODMA 4BR6A 4O4HA 4CWQA 1YERA 3FX7A 4DV4O 3UT5B 3AG4B 4AI8A 2YE8A 5L3FA 3OT7A 5IWAB 3OUSA 5BY1A 3U11A 4LBEC 3RYFB 4WFFA 5JQGA 1I08A 2YI0A 3ZKBA 4UVAA 3N2GB 4NR1A 4E00A 2XHBA 2YE5A 4ZIBA 1FD9A 3A0BZ 4UCVA 4YJ2A 2OTLV 4E4EA 1Y6XA 2W6JG 4U3JB 2JEUA 4K35A 4PELA 3AK3A 4DV4B 1KB9F 3JSLA 2XX2A 4KSGA 4FLTA 5C8YB 1W0KG 3FYEB 3INXA 3GIFA 1XREA 3MHSC 3TCUA 1RM1B 3O6OA 4EFBA 2Y69B 4JYBA 3RYFA 1XNQB 3IJ4A 2P4KA 3Q5JA 5JJNB 1GTOA 5BOCA 1AROP 4B7PA 1IBKB 1V9PA 3P3NA 2BU5A 5M4NA 1S72V 4EGHA 3OMUA 3HPLC 1GKZA 1UPGA 2IU3A 4CS3A 4AWPA 1XNRO 4O4LB 1H2GA 3QVNA 4Z1MG 1FFXA 4GT8A 1GKFA 1AJNA 3SJCC 3ZN0A 5KA5A 1TUBB 4JI0O 2PUSA 2CAZC 4CC5A 3A0WA 2FB5A 3B4SA 3HKDB 4W7TA 3Q4HA 4GFNA 1EFRG 4BXIA 1X59A 4B3MB 1UYFA 3L70H 4PV1B 4D6TH 2H55A 4QIWF 2P22C 1G8MA 2ZD9A 5TISZ 4EKWA 4J80A 4O4LA 1QR9A 2EJ7A 5EIBC 3ETGA 3KCYA 3VQVA 1AILA 5C93A 1GN6A 2FXSA 3UO3A 3W7SA 4X9LA 2WA3A 4JTCB 5B66Z 1U96A 1Q81W 3FV5A 4JI8B 2RQ6A 3JATB 5KX5B 4JV5B 4P8OA 2F43G 2YEEA 2BRCA 1WN7A 5LA6B 2IJHA 3BEHA 3W7XA 4X8AA 1JVMA 1L0OA 4UXNA 3U2KA 2QSAA 3K3WA 4LF5B 1R3LC 4CH4A 2WI4A 3PEJA 5LMUO 3JARB 3R65A 4MVQA 2WLMA 3O2FA 4BIZA 4PA9A 2NLJC 4H0LB 1Q7YW 2JJCA 2Y4TA 3VOUA 1GK9A 4LH7A 5J2TA 1S77D 4E2LA 3AG4C 2QWPB 2WI6A 4I9QA 5LMNB 1RSOB 4AS9A 2QG2A 5CF0A 4J11A 4J10A 3EKRA 1NI8A 2LGWA 1SRYA 2Q9LA 4I3HA 3ZMVA 2C1GA 4MVZA 4E02A 2YEAA 3RLPA 1I5CA 4DR3B 4GKKB 1QVGU 4HYOA 4LF8O 1F51A 3D8CA 4N23A 2XHXA 1W59A 3B8MA 3OMAB 5CB4A 2ILMA 4ZBMA 5KHHA 3A0XA 2D2CB 1P4RA 4QPJA 4ASFA 4ASBA 2JS5A 4URLA 5CTUA 4K3AA 1K8AW 1XNQO 3VADA 3M7MX 3ZHSA 1K97A 1OCOB 2EIMB 4EM7A 3WQ9A 3D3QA 3GB7C 4LWSB 4CH5A 5FNDA 4R8CA 4O2BA 2JIZG 1BHBA 3K03A 4JI1B 3H1IH 1FXHA 2CCUA 2RDCA 4JQLA 3LDCA 4U3JA 1BZKA 1PD3A 1QLEC 4MVRA 3CYOA 1SERA 2WI2A 4YKXA 4CBCA 1RSOA 1VMGA 1TIDA 2BU6A 3FKSG 1V54B 4KUMA 1BQ0A 3TZ0A 2ADPA 1EI1A 1HNZB 3FAVA 3U0ZA 4LF6O 5L3CA 4IL6Z 2YI9A 4DV5O 4JZGA 2PYJA 1M5IA 4I50B 1XOUA 5FNVA 1NVPB 4K0KO 1Y66A 3WG7B 4WCEV 1H2NA 2MW2B 3B25A 1OV9A 2E74B 4XKOA 2R9RB 4X1YB 1IBKO 3SYOA 3N2KA 1EN4A 4JTDB 1U0ZA 2YE2A 4NTYA 1Y76A 3K06A 3QF7A 2F1MA 3T1YO 3BAAA 3I56V 4GQTA 4URMA 2Q0OC 1WA8A 2ITDC 5A2QN 4RO2A 2QKAA 1PL0A 2WA4A 1DTOA 3ABLC 4JI2O 2L6LA 2LO1A 2KB1A 1JR9A 3E8BA 2AZ2A 4KHPO 4G2KA 4X89A 2EINC 5EBWC 1VP7A 4TV8B 5CBFA 3F7VC 4FLUA 3SL2A 4IYHA 4WFBV 4LPBA 4JAVA 2BU8A 4AWQA 5LHIA 1NU1H 2YE9A 1S5JA 2C1IA 1H38A 2V7QG 4WUCA 4QJFB 3HB3B 1AI5A 3R66A 3CMAV 3CX5F 1XHZA 1GN3A 2ZDXA 3TXQA 4MS2A 5B3SB 4N21A 5GONB 3JCUZ 5H6RA 5EYPB 1YCIA 4MP2A 1UYEA 2F4VO 3IEDA 3O9OA 1MSWD 3GIEA 1L8DA 2YK9A 4YKZA 5J6AA 1UYIA 1HNXB 2WLIB 4FLZA 2CE4A 4DR6B 1TUEB 1Q82W 3CB2A 1R6KA 4L87A 2FKXA 1K73W 3BCCH 2Q4PA 4MVMA 4AILC 2QF6A 1AMWA 3AG2B 4O2AA 4HXWA 1XBLA 1SKVA 4LF5O 1AB3A 3CYGA 2XJJA 3B40A 2A06H 1KC8W 1A4HA 4HXZA 1AH6A 3IC9A 4YXWG 4XDLA 4CE2A 1FXVA 1CXZB 1W2BU 3ZHQA 4AQYO 5IYZA 3ABKC 2DN9A 1KP2A 4FCRA 4YJ2B 4KFGA 3RYIB 3W7UA 2F66C 1IXMA 2IJKA
chains in the Genus database with same CATH topology
3G4SV 2B5UA 3OEEG 1M56C 3W7TA 2EILB 4MVOA 2EZOA 4H37A 3WG7C 1NQTA 1YSCA 4QE9A 4GX1A 2WLIA 5EBMC 2WPDG 4PA6A 1W0JG 3X2QC 1FFTB 5B3SC 1KKDA 2HFEC 3ASNC 4FPPA 1GM7A 1S76D 4JYCA 1OCCB 2X0LA 2IW5A 2EJRA 1NKDA 3M99B 3ZMUA 1SESA 1Q86W 2HJFC 1EBOA 1YHQV 1F23A 2EBOA 5CA3A 3TETA 1OCRC 3UM7A 4PA4A 1KP3A 3LDEA 2C2AA 2PI4A 2LP7A 3EFFK 2JDIG 4UV9A 2ZDIC 1JQ0A 4LC1A 5CMUA 3SPCA 4MTFA 3JYCA 3SPHA 2JJ2G 1VQ4V 4PDVA 4R6ZA 1AI6A 3KG2A 4BIUA 2XAFA 1QBZA 4RQFA 1E1QG 2EIJC 3WFVA 4TT3G 5CBHA 5BZBA 1V55C 3K04A 1YJNV 1UJWB 2DQ3A 3G6EV 5IYCO 4R7CA 5LGUA 5DN6G 3SPGA 4RQEA 4TSFG 5FL7G 3K0DA 3ZCCA 1CP9A 2EINB 5LBQA 3OMIB 1E1RG 3OAAG 5KUKA 1K7DA 2EIKB 2PI5A 2P7TC 2Z5UA 4I5SA 2QEXV 3AEIA 3ASOC 4P9OA 3CC7V 3DTUB 4WFHA 2EIJB 2WLLB 1I5XA 3SYAA 1K4DC 2DYRC 1G4YB 4JF3A 1K4CC 2ZDIA 3E8FA 4OXSA 3OE7G 4BW5A 5L3EA 4PA3A 4KP4A 3OR6C 3OMNB 2HR3A 3ZRXA 3E89A 2Y48A 1K5SA 3E35A 3E2EA 3OR7C 4GX0A 2R9IA 3G71V 5EK0A 3RVZA 1H8EG 1SZTA 3SYQA 3NXSA 5IDJA 3ASOB 3JCZA 1DF4A 1RPRA 3AG4B 1V54C 2DWDC 2OTJV 5L3FA 3I55V 4RAIA 3OUSA 1NJIW 4KFMA 2X6BA 4LBEC 5EC1C 5H9CA 1YITV 3CCVV 4WFFA 1OCZB 3LDDA 4UVAA 3CCRV 4MTXA 3CC2V 3ASNB 3W7WA 2IH3C 4JTAB 2OCCC 4G28B 3RW0A 2M7WA 3SPJA 3FB5C 2OTLV 2B1IA 2W6JG 3LSSA 2JEUA 3CPWU 3STLC 1S3JA 4MTOA 3F7YC 2UXXA 4PELA 5LHHA 4PA7A 1AI7A 1M9NA 3CCUV 1S0VA 3JD4A 2XAQA 5B1AC 1K3EA 2A79B 1F4NA 1W0KG 4J9YB 3FYEB 3ZIAG 3MHSC 3TCUA 4Q20A 3ZJZA 3T4ZA 1RM1B 2Y69B 1JX9A 4JYBA 1FS0G 5KUMA 1JJ2U 1EZJA 1AR1B 1OHHG 5B1BB 1GTOA 2WLJA 1QLEB 1AROP 1VQLV 2XOKG 4ZKIA 1YJ9V 1R3KC 1PNMA 1ENVA 2WLKA 1OZ0A 2WLHA 1S72V 3B8NA 2EZPA 2P6JA 2P67A 3HPLC 2K1EA 4GX5A 2IU3A 3FB6C 5L3DA 1THZA 4UUJC 3X2QB 5IY5B 1H2GA 4Z1MG 3RVYA 5IYBO 4MW3A 2QA4V 2JJ1G 1GKFA 1AJNA 2QKSA 3ZN0A 5CBGA 3ABTA 5KA5A 2D3OW 3T2MA 3SYCA 2IJJA 4P9PA 1JCHA 2YSUB 1EFRG 1SETA 3K79A 2MK3A 4R50A 5LGNA 4QIWF 4I9WA 4XBFA 1AJQA 1G8MA 1H8HG 2HVJC 4RUEA 4WFGA 2ZD9A 1MOFA 4EKWA 2P90A 4WFAV 2QM7A 2YEVB 1VQKV 3ABMB 1R3JC 3ABKB 1GO3F 1QR9A 1BHAA 3E83A 3ETGA 1J95A 3CC4V 5C93A 2WLLA 3CP1A 2LFRA 1M90W 3W7SA 1KQSU 4P30A 1OCOC 4G27B 4JTCB 2WLNA 2X7RB 1ZWIC 1WPXA 1M56B 1Q81W 1BMFG 2DYRB 1YTFD 1WLEA 2OCCB 3T4DA 2F43G 3ZRWB 2H8PC 5J9PC 1FXKB 3P30A 4H33A 4HZ3A 2IJHA 3BEHA 3W7XA 3MHHC 2UXNA 4X8AA 3E8HA 1JVMA 3ABMC 4MSWC 4JPRA 4UXNA 1ROPA 4P2ZA 1M57C 3LUTB 3K3WA 5DM6V 1R3LC 1PKXA 2Q6AA 3AG3C 1PNLA 2ZR3A 3JD3A 4ASUG 3R65A 4MVQA 2WLMA 2XNDG 4BIZA 4CZZA 4PA9A 2NLJC 3CMEV 1Q7YW 1VQ9V 3VOUA 1GK9A 3ZRVA 3JD1A 1S77D 4E2LA 2AHZA 3AG4C 1NR1A 3P32A 3QNEA 2XAGA 4HAMA 2GHYA 2HLDG 2IU0A 4PDRA 2A0LA 3FB7C 1SRYA 3D3IA 2DQ0A 3ZMVA 4MVZA 3K08A 2W0FC 1QVGU 4HYOA 1XL4A 1OCZC 1F51A 5EBLC 1COWG 2BOCC 1XL6A 4MVUA 3AG1B 2DYSB 4N23A 3B8MA 3OMAB 1QLNA 5L3GA 1B6QA 3CD6V 3IGAC 3A0RA 2LFSA 4ZBMA 4JAUA 4QPJA 1P4RA 2Q69A 4MT8A 3E86A 1K8AW 3EHBB 1HWYA 5B1NA 1OCCC 1K97A 2H94A 1OCOB 2EIMB 3F5WC 3GB7C 4R8CA 1OCRB 2JIZG 2W6IG 1BHBA 3K03A 4GT1A 3LSQA 1FXHA 2WWWA 4GX2A 1GM8A 1ORQC 1RM1C 3LDCA 3AG1C 3SJQC 1PD3A 1M1KW 1QLEC 4MVRA 3CYOA 1SERA 1MG1A 5L3BA 5B1BC 3OW2U 4DXWA 2DWEC 4CBCA 5H6QA 1K34A 3VBBA 1PNKA 4DO2A 2CK3G 3B77A 3FKSG 1K33A 3OUFA 1V54B 1DLBA 3JD2A 3OFNG 3AG3B 3QO5A 4KUMA 2Q67A 4GCZA 1F4MA 4U7OA 1JOYA 3CXCU 3SPIA 1M57B 5L3CA 2YEVA 1KD1W 1E79G 3CCQV 1QVFU 1VQ8V 1P7BA 1VQMV 1VQOV 3RBZA 1YTFB 1VQ6V 3BY6A 5IY5C 1NH2D 1DF5A 1NVPB 1Y66A 1S5HC 3WG7B 4WCEV 1AJPA 3E8GA 4MW8A 2A9HA 2FTKA 2R9RB 1R3IC 4J9ZB 3SYOA 5HFMA 3CCEV 1K9MW 2WAMA 4JTDB 2ZXWC 1NR7A 1NVPD 1NH2B 3OEHG 1QCEA 5CN0A 4RUFA 2AHYA 1MABG 3K06A 2B1GA 4FIPC 1R73A 4PDMA 4LCUC 2V1DA 3I56V 1VQPV 4FK5C 2ITDC 3CCJV 5B1OA 1FXKA 4WFEA 3OM3B 4RO2A 3K9AA 2XAJA 3JD0A 2XAHA 3QO7A 3ZN1A 1VQNV 4XDJA 1PL0A 3UKMA 2Q68A 4UV8A 1YJWV 1I5YA 1DTOA 3AG2C 2EIMC 3FYIB 3GWOA 1CPYA 3ABLC 2ZR2A 1K5QA 1Y4MA 2KB1A 3E8BA 4G2KA 4X89A 2EINC 5GW7A 5EBWC 2EILC 1FXKC 3SYPA 5CBFA 2EIKC 2NNUA 3F7VC 4X88A 3T1CA 4WFBV 3ZMTA 4JAVA 2ITCC 4F4LA 1YI2V 1QR8A 1JPXA 5LHIA 3CCMV 3IC7A 1R6NA 2JEXA 4XDKA 4QE7A 2IH1C 4FJCC 3ABLB 3D36A 4BAYA 4TWKA 2OT5A 1H38A 2V7QG 3IFXA 5E1AC 4WF9V 4QJFB 1BL8A 3HB3B 1AI5A 1RPOA 3ZMZA 2X6AA 3H01A 2HG5C 3CMAV 2ATKC 2WSSG 2XASA 3K0GA 1VQ7V 4JGSA 2Y69C 5HFLA 3OGCC 1LNQA 4MS2A 3DGEA 4UVCA 3CCSV 3QO8A 2X6CA 5B3SB 4N21A 5H6RA 2QE7G 4LP8A 2HKOA 3ZRSA 2DW4A 1AI4A 1MSWD 4QPKA 1NBMG 3ETDA 5IYDO 3CCLV 2GSMB 4PDLA 1CEZA 1K92A 3LNMB 2HVKC 5EC2C 3FB8C 1VQ5V 2DYSC 1GMGA 2WLIB 5B1AB 1YIJV 2ZXWB 1TUEB 1GM9A 4MVSA 3PJSK 2QM8A 3TK1A 1Q82W 1R6KA 2JK5C 4L87A 4U7NA 1V55B 4UVBA 3STZC 1K73W 4MVMA 5LGTA 3AG2B 3ZRWA 4FMTA 2IJIA 1KECA 3ABUA 4QNHB 2Z3YA 1L1FA 1KC8W 3ML0A 5KA6A 4YXWG 4XDLA 2BOBC 1FXVA 2ZQMA 1W2BU 4MTGA 3ETEA 3ABKC 3ZMSA 5LHGA 1N8RW 1KP2A 2QTOA 3MD0A 3W7UA 1IXMA 4JASA 2IJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTX A;  5B1O A;  3ZRX A;  4GT1 A;  5C93 A;  2WWW A;  2LFR A;  4JAV A;  3ZRW A;  3ZCC A;  4ZKI A;  2C2A A;  4FMT A;  4BIZ A;  1F51 A;  2FTK A;  4QPK A;  3NXS A;  4LC1 A;  4I5S A;  5IDJ A;  3D36 A;  3ZRV A;  3A0R A;  2LFS A;  4JAU A;  2P67 A;  4QPJ A;  4MT8 A;  3ZRW B;  3P32 A;  4BIU A;  4U7O A;  5B1N A;  4GCZ A;  1JOY A;  4FPP A;  4Q20 A;  4JYC A;  2QM7 A;  3MD0 A;  2QM8 A;  3TK1 A;  4JYB A;  3DGE A;  4U7N A;  1IXM A;  4JAS A;  4KP4 A; 
#chains in the Genus database with same CATH topology
 1WB8 A;  3JAL B;  2ZM6 O;  5M4P A;  3OEE G;  3W7T A;  2VCJ A;  4QGP A;  3AK1 A;  4MVO A;  1GN4 A;  4F6R B;  2R70 A;  4DV6 O;  2KQX A;  4NXN O;  4EFU A;  1NQT A;  1YDX A;  4PJ0 Z;  5EBM C;  4EGK A;  4NXN B;  3T10 A;  1FFT B;  1KKD A;  3ASN C;  2QG0 A;  1VIB A;  3N2K B;  4AWO A;  1S76 D;  1M4U A;  1HNW O;  1NKD A;  3ZMU A;  1SES A;  1Q86 W;  1N0J A;  4FM0 A;  3WB1 A;  4J42 A;  5CA3 A;  4X65 B;  3T2S A;  5LOV A;  1TAE A;  2CTR A;  3FD9 A;  2LP7 A;  4UV9 A;  2JDI G;  3TXS A;  3WB2 A;  5JVD A;  2EUL A;  1HNX O;  1SS3 A;  2UU9 O;  4AQY B;  3E22 B;  2VWK A;  1US7 A;  4AHC A;  3SPC A;  4MTF A;  1I5D A;  3GIG A;  3B09 A;  1VQ4 V;  2YE6 A;  3C3S A;  2CH7 B;  1XMQ O;  3IAY A;  3ZM7 A;  4IYI A;  3FFQ A;  2XAF A;  1HDJ A;  3ZHT A;  2YEI A;  3HZ5 A;  2XUM A;  2DQ3 A;  4JYY A;  1PV0 A;  5EZY B;  5GON A;  3HKE B;  1FPO A;  4NXM O;  3CS5 A;  4OX9 B;  2R9A A;  4DV7 B;  4XC0 A;  1K7D A;  1NS1 A;  4DW1 A;  2XJX A;  4TQD A;  3ASO C;  4P9O A;  3CC7 V;  3DTU B;  2E5L B;  1IBL O;  2PGG A;  3J80 N;  5H2F Z;  2F95 B;  1IBM B;  1K4D C;  2DYR C;  2GTA A;  1A32 A;  1K4C C;  1YT0 A;  2YGE A;  1EZV H;  3K5M A;  4KP4 A;  1ZXN A;  3E89 A;  3E35 A;  3E2E A;  4GX0 A;  4BIO A;  2YXL A;  4HZ0 A;  3ZXO A;  4B3T B;  3SYQ A;  1YF2 A;  4D7T A;  2IOP A;  3JCZ A;  3EHG A;  2Q2E B;  2AGA A;  4B3R O;  2DWD C;  2OTJ V;  2ZE5 A;  4PHZ A;  4XCL A;  4RAI A;  4KFM A;  2M6Y A;  2X6B A;  3SJA C;  3CRC A;  3K5L A;  1YIT V;  3CCV V;  1Q3E A;  2IWX A;  2N04 A;  5CTX A;  4JI7 O;  3BRC A;  5KHG A;  4P7A A;  2OCC C;  3RW0 A;  3OW6 A;  3SPJ A;  3D2R A;  5LYJ B;  1YC1 A;  4DR4 B;  1QQC A;  3STL C;  1S0V A;  1AI7 A;  1YEW A;  3L72 H;  1S14 A;  3JD4 A;  2PYL A;  2BYI A;  1K3E A;  1VF6 A;  1F4N A;  4Q20 A;  3T4Z A;  3ETQ A;  1JX9 A;  4PRV A;  1FS0 G;  1JJ2 U;  4LF4 B;  2VRZ A;  1UYD A;  1QLE B;  1VQL V;  2YKE A;  3KE6 A;  3OWD A;  2WLK A;  1DK1 A;  3B8N A;  3B28 A;  2EZP A;  2QFO A;  2GV9 A;  1KU9 A;  2P6J A;  2P67 A;  5LOV B;  1VEW A;  2K1E A;  4GX5 A;  1SQQ H;  3FB6 C;  1THZ A;  5FPR A;  1H2L A;  3C90 A;  4J7K A;  5IY5 B;  1N4C A;  2YUA A;  2F23 A;  4JI1 O;  2ZKJ A;  5CA1 A;  2QA4 V;  5CBG A;  2BTO A;  5LMN O;  1ZAU A;  5D5Q A;  4ASG A;  2YEC A;  2D3O W;  2ZIM A;  3SYC A;  2IJJ A;  2VWJ A;  1R6T A;  2YKJ A;  4KTN A;  1QHT A;  4DV7 O;  5DED A;  1Z5B A;  4KQV A;  2YSU B;  4B3T O;  5H5N A;  4I9W A;  1H8H G;  3C3T A;  5FNV B;  2HVJ C;  1ZX3 A;  4WFG A;  1MOF A;  2FYU H;  2QM7 A;  3ABM B;  1Y67 A;  1BHA A;  2IOR A;  1GO3 F;  5F5R A;  1J95 A;  1GH6 A;  3CC4 V;  2LFR A;  2ETN A;  4GKJ B;  4P30 A;  2YIC A;  2GDS A;  4DR4 O;  2EXL A;  2FWY A;  4JI8 O;  3R4P A;  3H1J H;  1BYQ A;  2L35 A;  1YTF D;  4YIO A;  1LUW A;  4I4T A;  5J9P C;  2ZT9 B;  3E8H A;  3Q4H B;  3ABM C;  4JPR A;  2DOS A;  1ROP A;  4NH8 A;  2PY5 A;  4IHJ A;  4P2Z A;  1M57 C;  3LUT B;  4UB6 Z;  3AG3 C;  1XHX A;  3ZED A;  1R62 A;  4O0B A;  2WI7 A;  1KIJ A;  2YIB D;  1IZ3 A;  3ZRV A;  4PU9 A;  2ZM6 B;  2XDK A;  3O0I A;  2AHZ A;  3QTC A;  5KX5 A;  2UUA B;  2YEF A;  4FLW A;  1H7U A;  4H44 B;  1NHI A;  1YT1 A;  2HEP A;  5LA6 A;  4UFZ A;  2N74 A;  3WHA A;  3JAT A;  1COW G;  2BOC C;  4MVU A;  3AG1 B;  2YXH A;  2ZE6 A;  1QLN A;  1B6Q A;  4FLY A;  5C8Y A;  3IGA C;  3CD6 V;  4IGG A;  1BE3 H;  1HWY A;  1OCC C;  2XDU A;  4FLX A;  2H94 A;  3TTZ A;  3H9V A;  3RYC B;  3JSN A;  3K58 A;  4J7J A;  2ZE8 A;  3UQ8 A;  2W6I G;  4GT1 A;  4FM2 A;  1IBM O;  4CWO A;  1GM8 A;  1WA8 B;  3AG1 C;  4GYC B;  4JI3 O;  3H1K H;  4CH6 A;  4UB8 Z;  5L3B A;  1BGQ A;  4CH3 A;  2G38 A;  4L90 A;  2DWE C;  1XMO O;  5H6Q A;  3VBB A;  5BR8 O;  3RGB A;  2ADQ B;  3B77 A;  1K33 A;  3OFN G;  3JD2 A;  1XQ8 A;  3QO5 A;  4GCZ A;  1F4M A;  1P7G A;  1AVM A;  1D5A A;  4CS2 A;  3SPI A;  1B62 A;  2YEV A;  3VQW A;  2DE0 X;  1VQ8 V;  2YEJ A;  3RBZ A;  1VQ6 V;  4DR5 O;  3DC6 A;  3NR7 A;  5IWA O;  3CJH A;  4X64 O;  2HG1 A;  4CWS A;  3E8G A;  3L74 H;  3BA9 A;  2A9H A;  4J9Z B;  4I0X B;  5JJJ B;  2WAM A;  2VQE B;  4L8Z A;  1NVP D;  1GN2 A;  1TUB A;  1QCE A;  5CN0 A;  2P06 A;  2UUA O;  1PL4 A;  5FNF A;  4RUF A;  2AHY A;  1MAB G;  4MPN A;  4LF7 B;  4LWS A;  1R73 A;  2ARH A;  4PDM A;  1HR0 B;  3B26 A;  4CWR A;  2CUG A;  4LFB O;  5IN9 A;  4LF4 O;  1VQN V;  5K1P A;  4IHJ B;  2JGD B;  4DV6 B;  2DJV A;  1YJW V;  5J71 A;  4MP7 A;  4ZVI A;  2ZKO A;  3AG2 C;  3T1H O;  1CPY A;  4TQF A;  2OIE A;  4B3M O;  1K5Q A;  1H2M A;  1Y4M A;  3ZHR A;  2Q8G A;  4X20 A;  5GW7 A;  1FXK C;  2WI1 A;  2PTM A;  2EIK C;  4X88 A;  3T1C A;  3ZMT A;  2QTS A;  4F4L A;  3TZ2 A;  1YI2 V;  2XDS A;  1B04 A;  3CCM V;  3CWB H;  4FCP A;  2YKC A;  4LF9 O;  1R6N A;  1XNR B;  4XDK A;  3A0T A;  2IH1 C;  4FJC C;  3ABL B;  3E22 A;  4BAY A;  2OT5 A;  4WF9 V;  4K8Z A;  1RPO A;  1TVK A;  1P49 A;  3BHP A;  3BVO A;  1Z2G A;  4DR1 B;  3C0E A;  4DV5 B;  1AP5 A;  2Y69 C;  3SDL A;  1GKX A;  1LNQ A;  3HYY A;  5LXT B;  3DGE A;  3CCS V;  2X6C A;  1KMI Z;  1OJH A;  4HBN A;  4LP8 A;  2QJ1 A;  4F6R A;  2DW4 A;  3RYC A;  4DUY O;  4QPK A;  3ETD A;  5IYD O;  3CCL V;  4PDL A;  1Y8O A;  4B7E A;  2YGF A;  1K92 A;  3EKO A;  3LNM B;  1J5E O;  3FB8 C;  2DYS C;  3KZI Z;  1EM1 A;  1I94 B;  1O9H A;  4ZHQ A;  1YIJ V;  2A7W A;  2ZXW B;  4YJ3 A;  2QM8 A;  3CRA A;  3SR2 C;  4LF6 B;  4U7N A;  1UYH A;  1V55 B;  2H3O A;  5KAI Z;  1H7S A;  4OX9 O;  3CGZ A;  1GRJ A;  4ASA A;  4DR7 O;  4LWE A;  4NTW A;  4ZI7 B;  2IJI A;  4DV3 B;  3A0Z A;  3OWB A;  2UUC O;  2WI3 A;  2Z3Y A;  3GWK C;  5KHK A;  3VHC A;  2BOB C;  4LFC B;  2ZQM A;  1N33 B;  2RCV A;  5DEC A;  5L3J A;  2NN4 A;  2LW7 A;  1Y4U A;  2B5U A;  2ZCE A;  3T0Z A;  4LFB B;  4MPE A;  2EIL B;  3CE2 A;  2EZO A;  4GX1 A;  2WLI A;  2WPD G;  4PA6 A;  1Z5W A;  3X2Q C;  2HJD A;  2QWQ B;  2YKB A;  4B3R B;  2ZNI A;  3ZKD A;  2HFE C;  5M4E A;  5M4H A;  1I5A A;  3M99 B;  3DXR A;  4CWT A;  2HJF C;  4X64 B;  1YHQ V;  1OCR C;  1NT2 B;  4PA4 A;  2FYP A;  1JA8 A;  1UFI A;  2CTW A;  4DR2 B;  2PI4 A;  2LQT A;  2ZDI C;  3JAS B;  4R3M A;  1JQ0 A;  4JI6 B;  4XD8 A;  5CMU A;  1B06 A;  3JYC A;  3SPH A;  4ZI7 A;  4O05 A;  3KG2 A;  2OWO A;  5IDM A;  2GQP A;  4NH9 A;  5BMV B;  5M4M A;  3QDD A;  4RQF A;  2BZ5 A;  1Q6H A;  2WI5 A;  3G6E V;  3ZHV A;  5IYC O;  2QKC A;  1XDC A;  2JVD A;  4TSF G;  5FL7 G;  1N34 B;  3K0D A;  1CP9 A;  4XIQ A;  5KUK A;  2XD6 A;  2YI7 A;  2QDO A;  3LNN A;  2UXD B;  2UXD O;  3B24 A;  5LP6 C;  1S16 A;  1Z59 A;  4WFH A;  4EEQ A;  3K5O A;  1UYG A;  4I50 A;  4JI7 B;  2WLL B;  1IXB A;  4BWA A;  3CGY A;  1G4Y B;  4XIP A;  3CWV A;  3JZ3 A;  4OXS A;  4BW5 A;  5L3E A;  1NHH A;  5BOD A;  2UU9 B;  3OR6 C;  3OMN B;  3ZRX A;  4LFA O;  2O1V A;  5EIB D;  2R9I A;  3G71 V;  3MAQ A;  3INW A;  5EK0 A;  3JAK B;  5CTY A;  1H8E G;  1SQB H;  4UCS A;  5IDJ A;  3ASO B;  1VF7 A;  3ZS8 C;  1DF4 A;  1RP3 B;  2CGO A;  2YIB A;  5JWP A;  1V54 C;  3OTO O;  4O4I A;  4J41 A;  4GUN A;  5KMG A;  2IBZ H;  4EFE A;  2BSK A;  4JI5 B;  4X9Q A;  5EC1 C;  5H9C A;  4R1F A;  3FAV B;  2VQE O;  2XDL A;  3CCR V;  2FWZ A;  3CC2 V;  2AW9 A;  2IH3 C;  4JTA B;  3NMQ A;  3DC5 A;  4BQG A;  1IX9 A;  4XDM A;  4XCJ A;  1YES A;  3FB5 C;  4X1Y A;  3LSS A;  4Z2W A;  1S3J A;  2CGN A;  2CTP A;  1SA0 B;  5LHH A;  1KUQ A;  1XEQ A;  2UUB O;  4J9Y B;  3ZJZ A;  2Z0A A;  1Q43 A;  1SC5 B;  1AR1 B;  2QGN A;  1OHH G;  5D6Q A;  3VQY A;  2O57 A;  2Q7G A;  1Y4S A;  4X1I A;  1F7Y A;  4W4L A;  2XOK G;  4ZKI A;  1YJ9 V;  2IWU A;  1PNM A;  1ENV A;  3RYI A;  2AZ0 A;  4DUY B;  4JI6 O;  3JAK A;  4EFT A;  5D5P A;  4KHP B;  4UUJ C;  3X2Q B;  3U10 A;  3N27 A;  1HP8 A;  5IJ0 B;  3RVY A;  5IYB O;  4MW3 A;  1SZX A;  5J2U A;  2QKS A;  5FLX N;  4L93 A;  1BQZ A;  5D6P A;  1ZTE A;  1YZB A;  2RNB A;  3M8A A;  3K79 A;  4TV9 A;  2YC0 A;  4XBF A;  2YE4 A;  1AJQ A;  4RUE A;  1N36 B;  2IM9 A;  2CG9 A;  4NH7 A;  4WFA V;  2YEV B;  1VQK V;  3G6B A;  1R3J C;  3J7A U;  1BKN A;  3E83 A;  1R1B A;  4GKJ O;  1TIL A;  2WLL A;  3CP1 A;  1XUQ A;  1M90 W;  1OCO C;  5EYP A;  1G6U A;  3BFR A;  4G27 B;  2OCH A;  2WLN A;  4DV2 O;  2UXC B;  1M56 B;  4IT5 A;  1YET A;  2DYR B;  3BM9 A;  5FWK A;  3K5N A;  4YHH B;  1FYJ A;  1ZW9 A;  3ZRW B;  2H8P C;  1OSF A;  1FXK B;  1H2K A;  4H33 A;  4HZ3 A;  1NTM H;  2UXN A;  2ESA A;  4IIJ B;  4WBN B;  1JFF A;  5DM6 V;  2JRI A;  3ZHU A;  3WB0 A;  1PNL A;  5KMG B;  2Q8I A;  4ASU G;  4I7Z B;  1I58 A;  2PZS A;  4E72 A;  3JAM N;  1N0N A;  2LGQ A;  4TV9 B;  1VQ9 V;  1ID0 A;  3BA8 A;  4JZ2 A;  4LP0 A;  4LWI A;  4DV1 B;  2CH7 A;  1SQF A;  4B6C A;  1NR1 A;  4HAM A;  2GUZ B;  1XI1 A;  2IU0 A;  4BQJ A;  4PDR A;  2A0L A;  2YIA A;  4DUH A;  5JVD B;  3D3I A;  4HY1 A;  2DQ0 A;  4DR1 O;  1AJ6 A;  2ZBK B;  2W0F C;  1X4T A;  5LMU B;  4UCU A;  1OCZ C;  1JMK C;  3O65 A;  1MNG A;  4EGI A;  4B3S B;  2UXB O;  1KZN A;  5L3G A;  2LFS A;  3R91 A;  4JI4 O;  2Q69 A;  3E86 A;  3R4N A;  1YSR A;  1MA1 A;  3EHB B;  5B1N A;  2WEQ A;  3MNR P;  1JM6 A;  3F5W C;  4GLX A;  3H1L H;  4YKR A;  3H4L A;  1WNS A;  4D7S A;  3LSQ A;  2WWW A;  1QNM A;  3HKE A;  4GX2 A;  3CXH F;  3CEI A;  3HR0 A;  1RM1 C;  3SJQ C;  1M1K W;  3ZXQ A;  3TGU H;  1MG1 A;  1I94 O;  5ITZ B;  2XHR A;  5B1B C;  4EMV A;  4DXW A;  1QZR A;  2GUZ A;  1K34 A;  4DO2 A;  2CK3 G;  4URN A;  1DLB A;  1QYE A;  4U7O A;  3UO2 A;  1JOY A;  3CXC U;  3GVM A;  1TC6 A;  4URO A;  4CC6 A;  1E79 G;  3CCQ V;  1QVF U;  1P7B A;  1VQM V;  1VQO V;  3PN1 A;  4I55 B;  1N36 O;  2YGA A;  1DF5 A;  4DR2 O;  1ZUQ A;  2Q0A A;  5GTH Z;  4TV8 A;  2DMX A;  5CB4 B;  4HYM A;  4TOI A;  1HNW B;  4O4H B;  2FTK A;  1AR4 A;  1R3I C;  2BCC H;  5IE9 A;  3CCE V;  3UCS C;  1NR7 A;  4X66 O;  1NH2 B;  3OEH G;  2XT9 A;  3U67 A;  1D2D A;  4LH6 A;  1O9G A;  2B1G A;  4FIP C;  5CA1 B;  2V1D A;  3UT5 A;  1HNZ O;  4H13 B;  1AH8 A;  3CCJ V;  1FXK A;  2H8M A;  5CA0 B;  4DW0 A;  3K9A A;  4R3A A;  2XX5 A;  3JD0 A;  2XAH A;  3AG7 A;  3QO7 A;  4DR6 O;  4CE1 A;  3UKM A;  1I7F A;  1Z5A A;  3TJT A;  3GWO A;  3FYI B;  1DGS A;  2ZR2 A;  3F5T A;  4YKQ A;  5E79 Z;  3BAB A;  2OYQ A;  4A5U B;  1VAR A;  1TBW A;  4XKA A;  2ITC C;  4YKT A;  1QR8 A;  1JPX A;  4O07 A;  3IC7 A;  4YY3 O;  4PL9 A;  4QE7 A;  3D36 A;  4TWK A;  3IFX A;  5E1A C;  3A2F A;  1Y76 B;  2YE3 A;  2X6A A;  2ATK C;  2XAS A;  3KKY A;  1UYC A;  5HFL A;  1FFX B;  4LNU B;  3LNU A;  1RFY A;  2XJG A;  4NVP A;  1TC0 A;  3ZRS A;  1AI4 A;  3HKD A;  3VHD A;  1Q6U A;  4ICG A;  2BTQ A;  5AG2 A;  1FJG B;  2QR4 A;  4CWN A;  1PVG A;  2HVK C;  5EC2 C;  1XMO B;  4YHH O;  1VQ5 V;  1GMG A;  4X20 B;  4H85 A;  1UY8 A;  3G7E A;  2CCS A;  3RKZ A;  4MVS A;  4H81 A;  3TK1 A;  4UVB A;  1YC3 A;  2YXY A;  3HHU A;  1TVK B;  4FMT A;  4X62 O;  1KEC A;  4J7Z A;  3RWR D;  1JFF B;  1US6 A;  1IVS A;  1L1F A;  4LWH A;  3ML0 A;  1AM1 A;  1EN5 A;  2XCM A;  1WP7 A;  3ETE A;  3ZMS A;  3CSX A;  5IJ9 B;  1N8R W;  3BMY A;  2QTO A;  3AK2 A;  5B1A B;  2UXC O;  2Q5Z A;  1YSZ A;  3L73 H;  3Q5L A;  3L71 H;  5EZY A;  4LNU A;  1Y8P A;  4I0X A;  4JAA A;  4RWU A;  1BGY H;  3CRQ A;  3D36 C;  3RYH B;  4QE9 A;  2RJZ A;  1W0J G;  1S5L Z;  3GIG B;  1SQG A;  3HYZ A;  5CTW A;  4FPP A;  4JYC A;  4PRX A;  4JI4 B;  3G75 A;  1L0L H;  2WER A;  5IJ9 A;  4V26 A;  2P5O A;  4B3S O;  2UXB B;  1EBO A;  1BXD A;  2EBO A;  5BXZ A;  3UM7 A;  2UUC B;  3JAR A;  1Q5O A;  3EFF K;  3RFR A;  4L8J A;  3T1K A;  2R72 A;  4CS4 A;  4LC1 A;  5IJ0 A;  2PF4 E;  2YE7 A;  4V25 A;  2JJ2 G;  3A8T A;  3EXA A;  4FVM A;  4EB6 B;  1YT2 A;  5KAF Z;  5LP6 A;  4R6Z A;  4K8X A;  2CCT A;  3U2D A;  4BIU A;  3K98 A;  1QBZ A;  1GJV A;  4FZ0 A;  3LMM A;  2EIJ C;  5CPH A;  3WFV A;  5CBH A;  4LF8 B;  5BZB A;  1V55 C;  4OPA A;  2BSM A;  2E0A A;  4E01 A;  4DRX A;  2W0X A;  2V4D A;  4R7C A;  4FFB A;  5LGU A;  1BCC H;  2HHH B;  3SPG A;  3T1H B;  2VCI A;  3B2E E;  1THN A;  3ZCC A;  5LBQ A;  2EIN B;  3OMI B;  1E1R G;  3OAA G;  1UY6 A;  2BE3 A;  2FL4 A;  2PI5 A;  4I5S A;  3HKB A;  2YJX A;  1MZF A;  1MZE A;  4PI0 A;  2KKW A;  1Y8N A;  4U3F H;  2EIJ B;  1MMM A;  2BTZ A;  3SYA A;  5BR8 B;  3A0Y A;  2RN9 A;  2HHI A;  4I55 A;  4PD4 F;  3OR7 C;  1J5E B;  1B63 A;  2OIG A;  2YS8 A;  3RVZ A;  1SZT A;  1AP6 A;  3NXS A;  4JYA B;  1RPR A;  1QY8 A;  1ZL8 B;  3FT5 A;  1Q8I A;  2IOQ A;  5BMV A;  3T0H A;  4DR5 B;  3I55 V;  4L94 A;  1NJI W;  4UCR A;  1SQP H;  1FKA O;  3VHA A;  4LWG A;  2JS3 A;  2LJ2 A;  1OCZ B;  3LDD A;  4MTX A;  4O4J A;  3ASN B;  3HKC A;  2Q8H A;  3W7W A;  2AXT Z;  1YXB A;  4G28 B;  3DSQ A;  2M7W A;  3G7B A;  4YJ3 B;  3RT3 C;  2B1I A;  4X66 B;  3CPW U;  4LF9 B;  3D0B A;  4MTO A;  3F7Y C;  4LWF A;  2UXX A;  3THO A;  3CCU V;  4PA7 A;  1M9N A;  1TA8 A;  2XAQ A;  5B1A C;  4U93 A;  2A79 B;  3ZIA G;  3G80 A;  2CTQ A;  4KL1 A;  3L75 H;  4C7U A;  4MOT A;  2JKI A;  3EVK A;  5KUM A;  1EZJ A;  5B1B B;  4YKU A;  2WLJ A;  1ZLZ A;  2BU2 A;  1R3K C;  3I5D A;  1OZ0 A;  2WLH A;  2P4V A;  4DUZ O;  3OD4 A;  4IIJ A;  2BSK B;  4WBN A;  4Z1V A;  5JCO A;  4X1K B;  3R4O A;  1SA0 A;  5L3D A;  1MSD A;  1Z5V A;  2ZIO A;  5JH7 A;  4MB9 A;  1SQX H;  2B9Z A;  1HR0 O;  2JJ1 G;  4HY6 A;  4JI0 B;  3ABT A;  2YEH A;  4I4T B;  4LFA B;  3T2M A;  4XKK A;  3N2G A;  4P9P A;  1JCH A;  4TUY B;  4DYL A;  3DXR B;  3HKB B;  5ITZ A;  4O04 A;  1NTZ H;  1SET A;  4XE2 A;  5D7D A;  2MK3 A;  2YI8 A;  1Q6I A;  2HCH A;  4R50 A;  5LGN A;  3K99 A;  5KHI A;  3HEK A;  1Q90 D;  3EHH A;  1ZXM A;  1Y74 B;  2KSD A;  2P90 A;  4DR7 B;  3ABK B;  1N32 O;  4CWF A;  2UWD A;  1KQS U;  3JAW A;  1SF9 A;  2EX3 A;  3S3W A;  1H2S B;  3R92 A;  2X7R B;  1ZWI C;  1WPX A;  5J2U B;  1JJO A;  1BMF G;  3BPZ A;  1WLE A;  2OCC B;  4MPC A;  1BT8 A;  1D5N A;  1YVW A;  2N05 A;  3T4D A;  3EHJ A;  4XIR A;  4O2A B;  3P30 A;  2E3C A;  1T5E A;  1KYO F;  1FAF A;  3MHH C;  4UCT A;  2XTA A;  4MSW C;  3LSU A;  5KLV H;  4DV0 B;  4GGL A;  1B3Q A;  2K5B A;  1PKX A;  2Q6A A;  4NKG B;  3S3X A;  5GTI Z;  2ZR3 A;  3JD3 A;  4L91 A;  2YKI A;  2XND G;  3S5T A;  4CZZ A;  1M93 A;  3CME V;  3SJB C;  2XHT A;  1WB7 A;  2YDE A;  3JD1 A;  4TUY A;  3L9D A;  3RLR A;  3P32 A;  3QNE A;  2XAG A;  1PM9 A;  2E75 B;  2GHY A;  2HLD G;  4DK0 A;  2IWS A;  3FB7 C;  3JAS A;  1WP8 A;  1Y74 A;  3QG5 A;  3K08 A;  1PPJ H;  1QU7 A;  1YS3 A;  4YIP A;  1XL4 A;  4GZR B;  3TUH A;  5J2T B;  5EBL C;  1XL6 A;  2Q7E A;  2DYS B;  2BRE A;  2XX4 A;  3A0R A;  2XAB A;  4JAU A;  3APQ A;  2YI6 A;  4LFC O;  1WJZ A;  4MT8 A;  2PNR A;  2E5L O;  5JH7 B;  5D7C A;  5IYZ B;  1OCR B;  3R4M A;  3CRR A;  5B5E Z;  2Q8F A;  1UYL A;  4WUD A;  1P84 F;  1ORQ C;  2E76 B;  5FPO A;  5M4K A;  3OW2 U;  4YKY A;  3K60 A;  4DV0 O;  1PNK A;  3H80 A;  3OUF A;  3AG3 B;  2Q67 A;  2HHH O;  5D7R A;  3OTF A;  1M57 B;  1KD1 W;  2JGD A;  4CWP A;  1YTF B;  4NTX A;  1I0H A;  2O1U A;  4B08 A;  3BY6 A;  5IY5 C;  1NH2 D;  1ZL8 A;  1GAX A;  3K57 A;  1S5H C;  3CRK A;  4X65 O;  1AJP A;  4MW8 A;  4ZOL A;  2VQF O;  1UY9 A;  1URF A;  5HFM A;  1K9M W;  4HNA A;  1HW7 A;  2K9P A;  3FT8 A;  3A0H Z;  2YEB A;  2ZXW C;  4GEE A;  2HP8 A;  1TH8 A;  3K9S A;  2A3Q A;  2VWC A;  3C11 A;  3VQX A;  4LCU C;  1LR1 A;  4JI3 B;  1VQP V;  1IDS A;  4FK5 C;  1LUV A;  5B1O A;  4WFE A;  4X1I B;  4MBC A;  3OM3 B;  1AR5 A;  2XAJ A;  3ZN1 A;  1U2O A;  1MU5 A;  2YID A;  4XDJ A;  1EA6 A;  2ZIN A;  4NYK A;  2Q68 A;  5GGZ A;  1Z5C A;  4UV8 A;  2LW1 A;  2Q73 A;  4X62 B;  2BYH A;  3EHF A;  1KKC A;  1I5Y A;  4JI2 B;  2EIM C;  4NXM B;  4EEH A;  4OPH A;  1UYM A;  4O09 A;  5F2V O;  2F93 B;  2FML A;  4K0K B;  1BSM A;  3KCX A;  4O2B B;  3ZX6 A;  2RMK B;  4DRX B;  3APO A;  4DV2 B;  4Q6G A;  2EIL C;  3SYP A;  1SQV H;  2NNU A;  3JAW B;  4K4O A;  4FM1 A;  2Q7H A;  2JGU A;  4XIT A;  4EB6 A;  5LP6 B;  2ZNJ A;  5K1X A;  2JEX A;  1VF5 B;  4ZHQ B;  1ZWH A;  2ZE7 A;  1BL8 A;  2XDX A;  5CA0 A;  4GKK O;  3WU2 Z;  3ZMZ A;  2GTS A;  1BS3 A;  4W4K A;  4DZY A;  3H01 A;  2HG5 C;  4DR3 O;  3OPD A;  3K0G A;  2WSS G;  1VQ7 V;  4DK1 A;  4JGS A;  2AKP A;  3OGC C;  4JYA O;  4H7Q A;  5FNC A;  4HYP A;  4UVC A;  2YJW A;  1IBL B;  3QO8 A;  1KBH A;  3H1H H;  4BW9 A;  2CGF A;  2F4V B;  2QE7 G;  1VF6 C;  5A9G A;  2HKO A;  5JJE B;  2BU7 A;  3CRL A;  3RYH A;  1U97 A;  2Q8V A;  2HKJ A;  4FCQ A;  3CRM A;  4YY3 B;  2Y0P A;  3LPS A;  1NBM G;  2UUB B;  2GSM B;  1CEZ A;  2QWO B;  3JAL A;  4LF7 O;  3OGI B;  3J81 N;  4ABM A;  1GM9 A;  3PJS K;  3G67 A;  2JK5 C;  1XMQ B;  3STZ C;  4FFK A;  4WUB A;  5LGT A;  2YED A;  3ZRW A;  4PI2 A;  4JI5 O;  5LXT A;  3ABU A;  2VS0 A;  4DV3 O;  2KG7 B;  4QNH B;  3ZBH A;  5KA6 A;  1N32 B;  4MTG A;  5LHG A;  1PP9 H;  4HNA B;  2GFD A;  2NR5 A;  3MD0 A;  2YEG A;  1EN6 A;  5IT9 N;  4JAS A;  4UCO A;  3G4S V;  3ICX A;  3HKC B;  1UYK A;  2VW5 A;  3B27 A;  5F3K A;  1M56 C;  2BTQ B;  1MX0 A;  4JV5 O;  3SGI A;  4H37 A;  1NZ6 A;  2QM4 A;  3WG7 C;  1YSC A;  3RLQ A;  4KSH A;  2KG7 A;  3OTO B;  2ZDY A;  5B3S C;  3MDS A;  3P3P A;  1I5B A;  1GM7 A;  1OCC B;  2X0L A;  2IW5 A;  2QWR B;  2EJR A;  2VQF B;  2Y0I A;  1F23 A;  4BAE A;  1WPB A;  3TET A;  1KP3 A;  4DV1 O;  3LDE A;  1NHJ A;  2C2A A;  5KHJ A;  4DUZ B;  3PEH A;  4KXR A;  2GBO A;  2CH4 A;  1N33 O;  4F6E A;  1G1X B;  2XK2 A;  4YKW A;  3CHX A;  4PDV A;  1AI6 A;  4X1K A;  3HZ1 A;  1XIL A;  1YC4 A;  2BT0 A;  1UY7 A;  4LR3 A;  1E1Q G;  4TT3 G;  4B7K A;  3K04 A;  1YJN V;  1UJW B;  5JCO C;  1ZSP A;  1L0N H;  5LL6 Y;  1N34 O;  1NTK H;  3K97 A;  1WAZ A;  1IUR A;  5DN6 G;  4RQE A;  4O4I B;  3RN4 A;  1TGO A;  2QWN B;  2WEP A;  2EIK B;  3QTF A;  4FZ1 A;  4XTJ A;  5JEN A;  2P7T C;  2Z5U A;  2QEX V;  2O1W A;  3AEI A;  2CDY A;  4NB5 A;  1FJG O;  2YI5 A;  1I5X A;  1I59 A;  3Q5K A;  5JQG B;  4JF3 A;  2ZDI A;  3E8F A;  3OE7 G;  4ZOL B;  3T1Y B;  4PA3 A;  2Y4U A;  5LYJ A;  2YK2 A;  3K59 A;  2HR3 A;  4FLV A;  3CJH B;  4HZ5 A;  2Y48 A;  1K5S A;  4CE3 A;  4OGQ B;  4FFB B;  4O4J B;  3TZ4 A;  3TZ5 A;  2ODM A;  4BR6 A;  4O4H A;  4CWQ A;  1YER A;  3FX7 A;  4DV4 O;  3UT5 B;  3AG4 B;  4AI8 A;  2YE8 A;  5L3F A;  3OT7 A;  5IWA B;  3OUS A;  5BY1 A;  3U11 A;  4LBE C;  3RYF B;  4WFF A;  5JQG A;  1I08 A;  2YI0 A;  3ZKB A;  4UVA A;  3N2G B;  4NR1 A;  4E00 A;  2XHB A;  2YE5 A;  4ZIB A;  1FD9 A;  3A0B Z;  4UCV A;  4YJ2 A;  2OTL V;  4E4E A;  1Y6X A;  2W6J G;  4U3J B;  2JEU A;  4K35 A;  4PEL A;  3AK3 A;  4DV4 B;  1KB9 F;  3JSL A;  2XX2 A;  4KSG A;  4FLT A;  5C8Y B;  1W0K G;  3FYE B;  3INX A;  3GIF A;  1XRE A;  3MHS C;  3TCU A;  1RM1 B;  3O6O A;  4EFB A;  2Y69 B;  4JYB A;  3RYF A;  1XNQ B;  3IJ4 A;  2P4K A;  3Q5J A;  5JJN B;  1GTO A;  5BOC A;  1ARO P;  4B7P A;  1IBK B;  1V9P A;  3P3N A;  2BU5 A;  5M4N A;  1S72 V;  4EGH A;  3OMU A;  3HPL C;  1GKZ A;  1UPG A;  2IU3 A;  4CS3 A;  4AWP A;  1XNR O;  4O4L B;  1H2G A;  3QVN A;  4Z1M G;  1FFX A;  4GT8 A;  1GKF A;  1AJN A;  3SJC C;  3ZN0 A;  5KA5 A;  1TUB B;  4JI0 O;  2PUS A;  2CAZ C;  4CC5 A;  3A0W A;  2FB5 A;  3B4S A;  3HKD B;  4W7T A;  3Q4H A;  4GFN A;  1EFR G;  4BXI A;  1X59 A;  4B3M B;  1UYF A;  3L70 H;  4PV1 B;  4D6T H;  2H55 A;  4QIW F;  2P22 C;  1G8M A;  2ZD9 A;  5TIS Z;  4EKW A;  4J80 A;  4O4L A;  1QR9 A;  2EJ7 A;  5EIB C;  3ETG A;  3KCY A;  3VQV A;  1AIL A;  5C93 A;  1GN6 A;  2FXS A;  3UO3 A;  3W7S A;  4X9L A;  2WA3 A;  4JTC B;  5B66 Z;  1U96 A;  1Q81 W;  3FV5 A;  4JI8 B;  2RQ6 A;  3JAT B;  5KX5 B;  4JV5 B;  4P8O A;  2F43 G;  2YEE A;  2BRC A;  1WN7 A;  5LA6 B;  2IJH A;  3BEH A;  3W7X A;  4X8A A;  1JVM A;  1L0O A;  4UXN A;  3U2K A;  2QSA A;  3K3W A;  4LF5 B;  1R3L C;  4CH4 A;  2WI4 A;  3PEJ A;  5LMU O;  3JAR B;  3R65 A;  4MVQ A;  2WLM A;  3O2F A;  4BIZ A;  4PA9 A;  2NLJ C;  4H0L B;  1Q7Y W;  2JJC A;  2Y4T A;  3VOU A;  1GK9 A;  4LH7 A;  5J2T A;  1S77 D;  4E2L A;  3AG4 C;  2QWP B;  2WI6 A;  4I9Q A;  5LMN B;  1RSO B;  4AS9 A;  2QG2 A;  5CF0 A;  4J11 A;  4J10 A;  3EKR A;  1NI8 A;  2LGW A;  1SRY A;  2Q9L A;  4I3H A;  3ZMV A;  2C1G A;  4MVZ A;  4E02 A;  2YEA A;  3RLP A;  1I5C A;  4DR3 B;  4GKK B;  1QVG U;  4HYO A;  4LF8 O;  1F51 A;  3D8C A;  4N23 A;  2XHX A;  1W59 A;  3B8M A;  3OMA B;  5CB4 A;  2ILM A;  4ZBM A;  5KHH A;  3A0X A;  2D2C B;  1P4R A;  4QPJ A;  4ASF A;  4ASB A;  2JS5 A;  4URL A;  5CTU A;  4K3A A;  1K8A W;  1XNQ O;  3VAD A;  3M7M X;  3ZHS A;  1K97 A;  1OCO B;  2EIM B;  4EM7 A;  3WQ9 A;  3D3Q A;  3GB7 C;  4LWS B;  4CH5 A;  5FND A;  4R8C A;  4O2B A;  2JIZ G;  1BHB A;  3K03 A;  4JI1 B;  3H1I H;  1FXH A;  2CCU A;  2RDC A;  4JQL A;  3LDC A;  4U3J A;  1BZK A;  1PD3 A;  1QLE C;  4MVR A;  3CYO A;  1SER A;  2WI2 A;  4YKX A;  4CBC A;  1RSO A;  1VMG A;  1TID A;  2BU6 A;  3FKS G;  1V54 B;  4KUM A;  1BQ0 A;  3TZ0 A;  2ADP A;  1EI1 A;  1HNZ B;  3FAV A;  3U0Z A;  4LF6 O;  5L3C A;  4IL6 Z;  2YI9 A;  4DV5 O;  4JZG A;  2PYJ A;  1M5I A;  4I50 B;  1XOU A;  5FNV A;  1NVP B;  4K0K O;  1Y66 A;  3WG7 B;  4WCE V;  1H2N A;  2MW2 B;  3B25 A;  1OV9 A;  2E74 B;  4XKO A;  2R9R B;  4X1Y B;  1IBK O;  3SYO A;  3N2K A;  1EN4 A;  4JTD B;  1U0Z A;  2YE2 A;  4NTY A;  1Y76 A;  3K06 A;  3QF7 A;  2F1M A;  3T1Y O;  3BAA A;  3I56 V;  4GQT A;  4URM A;  2Q0O C;  1WA8 A;  2ITD C;  5A2Q N;  4RO2 A;  2QKA A;  1PL0 A;  2WA4 A;  1DTO A;  3ABL C;  4JI2 O;  2L6L A;  2LO1 A;  2KB1 A;  1JR9 A;  3E8B A;  2AZ2 A;  4KHP O;  4G2K A;  4X89 A;  2EIN C;  5EBW C;  1VP7 A;  4TV8 B;  5CBF A;  3F7V C;  4FLU A;  3SL2 A;  4IYH A;  4WFB V;  4LPB A;  4JAV A;  2BU8 A;  4AWQ A;  5LHI A;  1NU1 H;  2YE9 A;  1S5J A;  2C1I A;  1H38 A;  2V7Q G;  4WUC A;  4QJF B;  3HB3 B;  1AI5 A;  3R66 A;  3CMA V;  3CX5 F;  1XHZ A;  1GN3 A;  2ZDX A;  3TXQ A;  4MS2 A;  5B3S B;  4N21 A;  5GON B;  3JCU Z;  5H6R A;  5EYP B;  1YCI A;  4MP2 A;  1UYE A;  2F4V O;  3IED A;  3O9O A;  1MSW D;  3GIE A;  1L8D A;  2YK9 A;  4YKZ A;  5J6A A;  1UYI A;  1HNX B;  2WLI B;  4FLZ A;  2CE4 A;  4DR6 B;  1TUE B;  1Q82 W;  3CB2 A;  1R6K A;  4L87 A;  2FKX A;  1K73 W;  3BCC H;  2Q4P A;  4MVM A;  4AIL C;  2QF6 A;  1AMW A;  3AG2 B;  4O2A A;  4HXW A;  1XBL A;  1SKV A;  4LF5 O;  1AB3 A;  3CYG A;  2XJJ A;  3B40 A;  2A06 H;  1KC8 W;  1A4H A;  4HXZ A;  1AH6 A;  3IC9 A;  4YXW G;  4XDL A;  4CE2 A;  1FXV A;  1CXZ B;  1W2B U;  3ZHQ A;  4AQY O;  5IYZ A;  3ABK C;  2DN9 A;  1KP2 A;  4FCR A;  4YJ2 B;  4KFG A;  3RYI B;  3W7U A;  2F66 C;  1IXM A;  2IJK A; 
#chains in the Genus database with same CATH homology
 3G4S V;  2B5U A;  3OEE G;  1M56 C;  3W7T A;  2EIL B;  4MVO A;  2EZO A;  4H37 A;  3WG7 C;  1NQT A;  1YSC A;  4QE9 A;  4GX1 A;  2WLI A;  5EBM C;  2WPD G;  4PA6 A;  1W0J G;  3X2Q C;  1FFT B;  5B3S C;  1KKD A;  2HFE C;  3ASN C;  4FPP A;  1GM7 A;  1S76 D;  4JYC A;  1OCC B;  2X0L A;  2IW5 A;  2EJR A;  1NKD A;  3M99 B;  3ZMU A;  1SES A;  1Q86 W;  2HJF C;  1EBO A;  1YHQ V;  1F23 A;  2EBO A;  5CA3 A;  3TET A;  1OCR C;  3UM7 A;  4PA4 A;  1KP3 A;  3LDE A;  2C2A A;  2PI4 A;  2LP7 A;  3EFF K;  2JDI G;  4UV9 A;  2ZDI C;  1JQ0 A;  4LC1 A;  5CMU A;  3SPC A;  4MTF A;  3JYC A;  3SPH A;  2JJ2 G;  1VQ4 V;  4PDV A;  4R6Z A;  1AI6 A;  3KG2 A;  4BIU A;  2XAF A;  1QBZ A;  4RQF A;  1E1Q G;  2EIJ C;  3WFV A;  4TT3 G;  5CBH A;  5BZB A;  1V55 C;  3K04 A;  1YJN V;  1UJW B;  2DQ3 A;  3G6E V;  5IYC O;  4R7C A;  5LGU A;  5DN6 G;  3SPG A;  4RQE A;  4TSF G;  5FL7 G;  3K0D A;  3ZCC A;  1CP9 A;  2EIN B;  5LBQ A;  3OMI B;  1E1R G;  3OAA G;  5KUK A;  1K7D A;  2EIK B;  2PI5 A;  2P7T C;  2Z5U A;  4I5S A;  2QEX V;  3AEI A;  3ASO C;  4P9O A;  3CC7 V;  3DTU B;  4WFH A;  2EIJ B;  2WLL B;  1I5X A;  3SYA A;  1K4D C;  2DYR C;  1G4Y B;  4JF3 A;  1K4C C;  2ZDI A;  3E8F A;  4OXS A;  3OE7 G;  4BW5 A;  5L3E A;  4PA3 A;  4KP4 A;  3OR6 C;  3OMN B;  2HR3 A;  3ZRX A;  3E89 A;  2Y48 A;  1K5S A;  3E35 A;  3E2E A;  3OR7 C;  4GX0 A;  2R9I A;  3G71 V;  5EK0 A;  3RVZ A;  1H8E G;  1SZT A;  3SYQ A;  3NXS A;  5IDJ A;  3ASO B;  3JCZ A;  1DF4 A;  1RPR A;  3AG4 B;  1V54 C;  2DWD C;  2OTJ V;  5L3F A;  3I55 V;  4RAI A;  3OUS A;  1NJI W;  4KFM A;  2X6B A;  4LBE C;  5EC1 C;  5H9C A;  1YIT V;  3CCV V;  4WFF A;  1OCZ B;  3LDD A;  4UVA A;  3CCR V;  4MTX A;  3CC2 V;  3ASN B;  3W7W A;  2IH3 C;  4JTA B;  2OCC C;  4G28 B;  3RW0 A;  2M7W A;  3SPJ A;  3FB5 C;  2OTL V;  2B1I A;  2W6J G;  3LSS A;  2JEU A;  3CPW U;  3STL C;  1S3J A;  4MTO A;  3F7Y C;  2UXX A;  4PEL A;  5LHH A;  4PA7 A;  1AI7 A;  1M9N A;  3CCU V;  1S0V A;  3JD4 A;  2XAQ A;  5B1A C;  1K3E A;  2A79 B;  1F4N A;  1W0K G;  4J9Y B;  3FYE B;  3ZIA G;  3MHS C;  3TCU A;  4Q20 A;  3ZJZ A;  3T4Z A;  1RM1 B;  2Y69 B;  1JX9 A;  4JYB A;  1FS0 G;  5KUM A;  1JJ2 U;  1EZJ A;  1AR1 B;  1OHH G;  5B1B B;  1GTO A;  2WLJ A;  1QLE B;  1ARO P;  1VQL V;  2XOK G;  4ZKI A;  1YJ9 V;  1R3K C;  1PNM A;  1ENV A;  2WLK A;  1OZ0 A;  2WLH A;  1S72 V;  3B8N A;  2EZP A;  2P6J A;  2P67 A;  3HPL C;  2K1E A;  4GX5 A;  2IU3 A;  3FB6 C;  5L3D A;  1THZ A;  4UUJ C;  3X2Q B;  5IY5 B;  1H2G A;  4Z1M G;  3RVY A;  5IYB O;  4MW3 A;  2QA4 V;  2JJ1 G;  1GKF A;  1AJN A;  2QKS A;  3ZN0 A;  5CBG A;  3ABT A;  5KA5 A;  2D3O W;  3T2M A;  3SYC A;  2IJJ A;  4P9P A;  1JCH A;  2YSU B;  1EFR G;  1SET A;  3K79 A;  2MK3 A;  4R50 A;  5LGN A;  4QIW F;  4I9W A;  4XBF A;  1AJQ A;  1G8M A;  1H8H G;  2HVJ C;  4RUE A;  4WFG A;  2ZD9 A;  1MOF A;  4EKW A;  2P90 A;  4WFA V;  2QM7 A;  2YEV B;  1VQK V;  3ABM B;  1R3J C;  3ABK B;  1GO3 F;  1QR9 A;  1BHA A;  3E83 A;  3ETG A;  1J95 A;  3CC4 V;  5C93 A;  2WLL A;  3CP1 A;  2LFR A;  1M90 W;  3W7S A;  1KQS U;  4P30 A;  1OCO C;  4G27 B;  4JTC B;  2WLN A;  2X7R B;  1ZWI C;  1WPX A;  1M56 B;  1Q81 W;  1BMF G;  2DYR B;  1YTF D;  1WLE A;  2OCC B;  3T4D A;  2F43 G;  3ZRW B;  2H8P C;  5J9P C;  1FXK B;  3P30 A;  4H33 A;  4HZ3 A;  2IJH A;  3BEH A;  3W7X A;  3MHH C;  2UXN A;  4X8A A;  3E8H A;  1JVM A;  3ABM C;  4MSW C;  4JPR A;  4UXN A;  1ROP A;  4P2Z A;  1M57 C;  3LUT B;  3K3W A;  5DM6 V;  1R3L C;  1PKX A;  2Q6A A;  3AG3 C;  1PNL A;  2ZR3 A;  3JD3 A;  4ASU G;  3R65 A;  4MVQ A;  2WLM A;  2XND G;  4BIZ A;  4CZZ A;  4PA9 A;  2NLJ C;  3CME V;  1Q7Y W;  1VQ9 V;  3VOU A;  1GK9 A;  3ZRV A;  3JD1 A;  1S77 D;  4E2L A;  2AHZ A;  3AG4 C;  1NR1 A;  3P32 A;  3QNE A;  2XAG A;  4HAM A;  2GHY A;  2HLD G;  2IU0 A;  4PDR A;  2A0L A;  3FB7 C;  1SRY A;  3D3I A;  2DQ0 A;  3ZMV A;  4MVZ A;  3K08 A;  2W0F C;  1QVG U;  4HYO A;  1XL4 A;  1OCZ C;  1F51 A;  5EBL C;  1COW G;  2BOC C;  1XL6 A;  4MVU A;  3AG1 B;  2DYS B;  4N23 A;  3B8M A;  3OMA B;  1QLN A;  5L3G A;  1B6Q A;  3CD6 V;  3IGA C;  3A0R A;  2LFS A;  4ZBM A;  4JAU A;  4QPJ A;  1P4R A;  2Q69 A;  4MT8 A;  3E86 A;  1K8A W;  3EHB B;  1HWY A;  5B1N A;  1OCC C;  1K97 A;  2H94 A;  1OCO B;  2EIM B;  3F5W C;  3GB7 C;  4R8C A;  1OCR B;  2JIZ G;  2W6I G;  1BHB A;  3K03 A;  4GT1 A;  3LSQ A;  1FXH A;  2WWW A;  4GX2 A;  1GM8 A;  1ORQ C;  1RM1 C;  3LDC A;  3AG1 C;  3SJQ C;  1PD3 A;  1M1K W;  1QLE C;  4MVR A;  3CYO A;  1SER A;  1MG1 A;  5L3B A;  5B1B C;  3OW2 U;  4DXW A;  2DWE C;  4CBC A;  5H6Q A;  1K34 A;  3VBB A;  1PNK A;  4DO2 A;  2CK3 G;  3B77 A;  3FKS G;  1K33 A;  3OUF A;  1V54 B;  1DLB A;  3JD2 A;  3OFN G;  3AG3 B;  3QO5 A;  4KUM A;  2Q67 A;  4GCZ A;  1F4M A;  4U7O A;  1JOY A;  3CXC U;  3SPI A;  1M57 B;  5L3C A;  2YEV A;  1KD1 W;  1E79 G;  3CCQ V;  1QVF U;  1VQ8 V;  1P7B A;  1VQM V;  1VQO V;  3RBZ A;  1YTF B;  1VQ6 V;  3BY6 A;  5IY5 C;  1NH2 D;  1DF5 A;  1NVP B;  1Y66 A;  1S5H C;  3WG7 B;  4WCE V;  1AJP A;  3E8G A;  4MW8 A;  2A9H A;  2FTK A;  2R9R B;  1R3I C;  4J9Z B;  3SYO A;  5HFM A;  3CCE V;  1K9M W;  2WAM A;  4JTD B;  2ZXW C;  1NR7 A;  1NVP D;  1NH2 B;  3OEH G;  1QCE A;  5CN0 A;  4RUF A;  2AHY A;  1MAB G;  3K06 A;  2B1G A;  4FIP C;  1R73 A;  4PDM A;  4LCU C;  2V1D A;  3I56 V;  1VQP V;  4FK5 C;  2ITD C;  3CCJ V;  5B1O A;  1FXK A;  4WFE A;  3OM3 B;  4RO2 A;  3K9A A;  2XAJ A;  3JD0 A;  2XAH A;  3QO7 A;  3ZN1 A;  1VQN V;  4XDJ A;  1PL0 A;  3UKM A;  2Q68 A;  4UV8 A;  1YJW V;  1I5Y A;  1DTO A;  3AG2 C;  2EIM C;  3FYI B;  3GWO A;  1CPY A;  3ABL C;  2ZR2 A;  1K5Q A;  1Y4M A;  2KB1 A;  3E8B A;  4G2K A;  4X89 A;  2EIN C;  5GW7 A;  5EBW C;  2EIL C;  1FXK C;  3SYP A;  5CBF A;  2EIK C;  2NNU A;  3F7V C;  4X88 A;  3T1C A;  4WFB V;  3ZMT A;  4JAV A;  2ITC C;  4F4L A;  1YI2 V;  1QR8 A;  1JPX A;  5LHI A;  3CCM V;  3IC7 A;  1R6N A;  2JEX A;  4XDK A;  4QE7 A;  2IH1 C;  4FJC C;  3ABL B;  3D36 A;  4BAY A;  4TWK A;  2OT5 A;  1H38 A;  2V7Q G;  3IFX A;  5E1A C;  4WF9 V;  4QJF B;  1BL8 A;  3HB3 B;  1AI5 A;  1RPO A;  3ZMZ A;  2X6A A;  3H01 A;  2HG5 C;  3CMA V;  2ATK C;  2WSS G;  2XAS A;  3K0G A;  1VQ7 V;  4JGS A;  2Y69 C;  5HFL A;  3OGC C;  1LNQ A;  4MS2 A;  3DGE A;  4UVC A;  3CCS V;  3QO8 A;  2X6C A;  5B3S B;  4N21 A;  5H6R A;  2QE7 G;  4LP8 A;  2HKO A;  3ZRS A;  2DW4 A;  1AI4 A;  1MSW D;  4QPK A;  1NBM G;  3ETD A;  5IYD O;  3CCL V;  2GSM B;  4PDL A;  1CEZ A;  1K92 A;  3LNM B;  2HVK C;  5EC2 C;  3FB8 C;  1VQ5 V;  2DYS C;  1GMG A;  2WLI B;  5B1A B;  1YIJ V;  2ZXW B;  1TUE B;  1GM9 A;  4MVS A;  3PJS K;  2QM8 A;  3TK1 A;  1Q82 W;  1R6K A;  2JK5 C;  4L87 A;  4U7N A;  1V55 B;  4UVB A;  3STZ C;  1K73 W;  4MVM A;  5LGT A;  3AG2 B;  3ZRW A;  4FMT A;  2IJI A;  1KEC A;  3ABU A;  4QNH B;  2Z3Y A;  1L1F A;  1KC8 W;  3ML0 A;  5KA6 A;  4YXW G;  4XDL A;  2BOB C;  1FXV A;  2ZQM A;  1W2B U;  4MTG A;  3ETE A;  3ABK C;  3ZMS A;  5LHG A;  1N8R W;  1KP2 A;  2QTO A;  3MD0 A;  3W7U A;  1IXM A;  4JAS A;  2IJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...