1IXMA

Crystal structure of spoob from bacillus subtilis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
168
Chain Sequence
b'SDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDIMRFEITSHECLIEIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SPORULATION RESPONSE REGULATORY PROTEIN)
publication title Formation of a novel four-helix bundle and molecular recognition sites by dimerization of a response regulator phosphotransferase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 56
structure length 168
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
A PF14689 SPOB_a Sensor_kinase_SpoOB-type, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ixmA01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 1ixmA02
4GT1A 2C2AA 4BIZA 4U7OA 2FTKA 3DGEA 3P32A 1F51A 4BIUA 5C93A 4JASA 4I5SA 4ZKIA 4KP4A 3TK1A 5B1NA 4JAUA 4LC1A 4QPJA 3D36A 4JYCA 3ZRWB 4JAVA 3MD0A 1IXMA 2LFSA 4Q20A 4U7NA 4FPPA 4MT8A 3ZRXA 2QM7A 3ZRVA 4QPKA 2WWWA 4FMTA 1JOYA 4MTXA 3NXSA 4JYBA 2P67A 3ZRWA 4GCZA 5IDJA 2LFRA 5B1OA 3ZCCA 3A0RA 2QM8A
chains in the Genus database with same CATH superfamily
1IBLB 3UO3A 4EM7A 5JH7A 2XJXA 2PYLA 5KA6A 1URFA 4LR3A 4JI1B 4URLA 5CF0A 2LGWA 1YHQV 4D6TH 1K5SA 1M4UA 4W7TA 3AG3B 2ZIOA 1QLEB 2G38A 1W0JG 3BEHA 5M4KA 3CRRA 4DYLA 1N34B 1KKDA 1Z5BA 1XQ8A 2R70A 3FB6C 4DV5O 2UUAB 3RLPA 1Z5CA 3PJSK 5H6QA 4GKKB 3T1CA 1GN2A 3FAVA 3ZCCA 2E0AA 2IOQA 3SPGA 5D6PA 3CC7V 1YT0A 1QYEA 2UU9B 1V55B 5B66Z 2N05A 1BKNA 3HKBB 2IJHA 2UWDA 1PP9H 3QO8A 4PDLA 4CS4A 3BRCA 1VF6C 3CX5F 2ZXWB 2YJWA 3DC5A 1B6QA 2DN9A 1Z2GA 4ZVIA 3ETEA 3NXSA 4MVUA 3O9OA 4XTJA 1THNA 2MW2B 2RJZA 3GWOA 1MG1A 4KFGA 2HJFC 3RYHB 5KMGB 5LA6B 3KG2A 1XDCA 2BSMA 2YEHA 4ASUG 1DK1A 1EN5A 5KAFZ 3ZRXA 2FXSA 2A06H 4MPEA 3CCVV 5IYBO 4PELA 3CWBH 5L3EA 1AMWA 3I5DA 5KAIZ 3OW2U 3IFXA 4PDMA 5KA5A 3B26A 5EZYA 3D36C 4BXIA 4I7ZB 3K08A 1COWG 3Q5KA 3EFFK 4P2ZA 1IBLO 2VQEO 1E79G 1SKVA 1Z59A 4IHJA 4JI1O 3RVYA 4X20A 4O4HB 4DV4B 2P22C 4E4EA 4FVMA 2QKAA 5GTIZ 2JGUA 3F7VC 4PA4A 1JA8A 2Y4TA 4LP8A 3O65A 1N34O 3G75A 2WA3A 2BZ5A 3TTZA 3T2MA 3FFQA 2BE3A 1K73W 1ID0A 3ZIAG 4JTAB 2O57A 2JVDA 4GKKO 2B5UA 1WN7A 2Q8HA 3R65A 3U11A 1K4DC 4YKRA 1FD9A 3S3WA 4UROA 2D2CB 1XL4A 2NR5A 3E22B 4KSHA 4WUBA 3FV5A 2QWOB 3K99A 2HP8A 1TUEB 4LP0A 1V54C 3ZHSA 4L93A 4JQLA 2YEEA 4K3AA 4DV1B 4DV6O 4EMVA 4RUEA 1K7DA 2V4DA 3OEEG 4YKXA 5LYJA 1AI6A 1UFIA 1QU7A 3DSQA 5JQGB 3D36A 4I55A 2HHIA 1XOUA 2L6LA 1N32B 4LF6B 1P84F 2QFOA 1NVPB 1B62A 1TVKB 1YC3A 1UY7A 1F7YA 2W0FC 5F2VO 1OV9A 4LWHA 3LSQA 3K97A 3B4SA 4U3FH 4DR6B 3ZMTA 3GIFA 1NHJA 2KSDA 3AG2B 4JI6B 2BTQB 1WP8A 4WCEV 3G7EA 4YJ3A 1GKZA 4DR5B 3JARB 3GIGA 1H2MA 5LXTA 2YE3A 4JI4O 2ZNJA 4TV8A 4RQFA 5LMUO 2EIKB 4Q20A 3BAAA 1BQ0A 2R9AA 5LGTA 5AG2A 4DRXB 1QQCA 4MTGA 2EILB 3U2KA 3ZS8C 4QIWF 2WERA 2C1GA 4W4KA 3JALB 3IJ4A 4HZ5A 2IJJA 2WSSG 2C1IA 4EEQA 3CHXA 4JASA 4DV2B 3ASOC 1TH8A 3VQVA 3HYZA 3K5NA 2JGDB 3KCYA 3AG1B 2VW5A 2DWEC 3SJBC 3ZHVA 3OE7G 3IAYA 3CWVA 1JFFB 4TT3G 1UYEA 1XEQA 2Q67A 2FB5A 3CS5A 1U0ZA 2UUCO 1JM6A 1AI4A 1IZ3A 2ZIMA 3N2KA 2FL4A 5GTHZ 2YXYA 4LF7B 2XCMA 3B2EE 4DR7O 2YE6A 2YEFA 4O0BA 4GYCB 2IH1C 4FPPA 1RPOA 4GX5A 1UYCA 5J2TB 5CA3A 3AK1A 4P30A 1FFXB 4URMA 5CN0A 4CS2A 1Y74B 4L94A 2ESAA 4C7UA 1XILA 2JIZG 4LF6O 2QG0A 4F6EA 2BOCC 5BY1A 4X1IA 1AR1B 1GAXA 3O2FA 4Z1VA 4B08A 5EYPA 3CMAV 4H44B 4R50A 1AP6A 3C90A 2KG7A 2P4VA 3K60A 4H81A 4DR6O 4TV9A 3DXRB 1D5NA 5DECA 2O1VA 4GKJB 3SJQC 2QSAA 1ENVA 2VWKA 2CTQA 4ZOLA 3VHDA 3G6EV 2EJ7A 4FM0A 4JF3A 2UUBB 2FTKA 4E02A 2Q69A 4N23A 2OCHA 4EKWA 4DR2O 3QVNA 2ZM6O 2PY5A 4FZ0A 3H1JH 3VOUA 2IJIA 4CWQA 2XAJA 5CA0A 2WWWA 2R9RB 3CCJV 4BW5A 3BCCH 2ZKOA 2GV9A 1UYDA 2HG5C 4XITA 5H9CA 2WEPA 3OT7A 3K3WA 3T4DA 5FNCA 3T1YB 4UCVA 3TZ0A 3ABMB 1BGYH 3RYIB 2YIAA 4O4JA 4LF4O 3WB1A 1OSFA 1YS3A 4DV0B 3INXA 2H55A 4QPKA 3FB5C 4B3SB 2ILMA 1QLNA 3QF7A 5GONB 2VRZA 1FAFA 1N0NA 3Q5JA 1SQQH 2ZR3A 2DE0X 2OTJV 3ICXA 3R4NA 4G28B 1JX9A 1Y8OA 3H1IH 3K5OA 1U97A 2ZQMA 4G2KA 2QWPB 4FLYA 4P8OA 3HKBA 3A0YA 3B25A 2BSKB 2A79B 2CCUA 5BODA 1P7BA 3APOA 4R8CA 1OCRB 1UYLA 3OUSA 1EN6A 1OCCB 1FXKA 2NN4A 2OIEA 2PF4E 3K03A 4ABMA 2X0LA 4CWTA 1VF7A 5DN6G 5B1BB 4BQJA 1NVPD 4Z1MG 4OX9O 1BSMA 3WQ9A 1E1RG 2JDIG 4KP4A 3GVMA 4MBCA 1DLBA 5KMGA 2WI2A 4U93A 4UXNA 1IURA 3OWBA 4X62B 2ARHA 4XD8A 4EB6A 1YEWA 4AWPA 4GX1A 5B3SC 4JPRA 4XBFA 3WG7C 4CS3A 2F43G 3CC2V 3WB2A 3IGAC 4KTNA 1M57B 2Z3YA 1QBZA 3R66A 4QGPA 2WI1A 2JJCA 4GZRB 3ZMSA 1L0LH 3MHSC 1TILA 5IYDO 3B27A 4KHPO 1R3JC 1Y76B 4BQGA 3JZ3A 4XCJA 3ZMVA 3X2QB 2WI7A 3PN1A 5FNVB 4X1YB 1YDXA 5EIBC 2C2AA 4DV0O 1YSCA 1BS3A 1B3QA 2XT9A 1MA1A 5BZBA 1T5EA 3BY6A 4MPCA 2HR3A 4H13B 2ZDIC 1XMQO 1SETA 4JTCB 3SJCC 3T2SA 3OR6C 1R6NA 2QM8A 3Q4HB 4GT1A 3ZKBA 4PL9A 5CMUA 1BHAA 4AWOA 5IE9A 3LDEA 5KX5B 3H4LA 1NZ6A 1BHBA 4BIUA 4JI8B 5M4NA 2XOKG 3K9SA 1YVWA 2H94A 2WLLB 4IL6Z 2H3OA 3MD0A 3VHCA 3K79A 2YI8A 3T4ZA 5KUKA 2Z5UA 4MOTA 4NB5A 5KHHA 3T1KA 4HYOA 2YKJA 1PNKA 2QE7G 3OTFA 5J2UA 1F23A 2EIJC 5CTWA 4X62O 2VWCA 4GGLA 2QWNB 4O2AA 3SPIA 3T1HO 1MX0A 2YEJA 2BTQA 1VQ7V 4PRXA 1MMMA 4I0XA 4I9QA 5F3KA 2Q7EA 1I5AA 1YETA 2EJRA 3JARA 4DUHA 5EC2C 5IJ0B 4MP7A 1YSZA 3A0TA 1VP7A 2ZDIA 5BR8O 4NXNO 4B7PA 3JAKB 4ZI7B 2UXDB 4DRXA 1HNZB 4KSGA 1XNRB 3OWDA 3OMIB 3G67A 2HHHB 4HBNA 1SQBH 1BQZA 2RQ6A 2YKEA 3JALA 1OCOC 1UYKA 3B24A 1VIBA 1Q7YW 4HXWA 4AS9A 3L72H 2YE7A 2XHTA 2JGDA 1XHXA 4GX0A 3B28A 1OCZC 2OCCB 4DR1O 1NI8A 4LFCO 1ZXMA 3M8AA 1H38A 3B40A 2CTRA 4DXWA 2CH7B 3H1HH 3OFNG 5F5RA 2GUZA 5H6RA 5LHIA 3EKOA 2X6AA 2P90A 1H2SB 1SA0B 2P6JA 1LNQA 4LF5B 1HR0B 2YE5A 2XDLA 3JAMN 1PM9A 2XDKA 1AM1A 1JVMA 2P06A 3FB8C 2EINC 4FLUA 4U7OA 5M4MA 2E3CA 1KP2A 5DM6V 5LGNA 1Y74A 4CWNA 4FM2A 2XX2A 4DO2A 3B77A 2Q7HA 1BXDA 4X65O 1BT8A 3CJHB 3THOA 3RFRA 1Z5AA 1KBHA 3UKMA 3HZ5A 5B1AC 3W7XA 2DWDC 2WLIB 3U10A 4J42A 3EHJA 2EZPA 3DXRA 3RYFA 4B7KA 5CA1B 1YJWV 2Y69C 3JAWB 3R91A 4JYYA 4NTYA 4JI2O 3OAAG 4DR4B 3BPZA 3JD3A 1NR1A 5FNFA 4ASGA 4XIRA 1AVMA 2EBOA 4GQTA 3RW0A 2Y4UA 1VF5B 1GMGA 3KCXA 4CZZA 5CBGA 5TISZ 1HNWB 5ITZA 5L3BA 4MT8A 2HHHO 1I5BA 3RLQA 1W0KG 3C3SA 4WFAV 4QJFB 1GM7A 4MTXA 4DR3B 4O4LB 4R7CA 2M7WA 2PNRA 1S72V 3UT5B 4XKAA 2Q8IA 5D7RA 3RKZA 4PA6A 4EFUA 5IYZB 2N74A 2QWRB 5HFMA 3CSXA 3CRKA 2Q9LA 4R3MA 3RN4A 3CPWU 5LMNO 1Y8NA 2WLJA 2YGAA 3EHHA 2R72A 3HZ1A 1H7UA 4JI7B 3ZN0A 2JK5C 4TWKA 2YIBA 1RM1B 3D3IA 3DTUB 4CH3A 2XX5A 4GLXA 4YKQA 5C8YB 4CWRA 5L3FA 2V7QG 1HR0O 5C93A 3R4PA 2AW9A 4JZ2A 1FXVA 5DEDA 3CRCA 3FT8A 3HKDB 1NS1A 3A2FA 1CXZB 1FFTB 2EIMC 1AB3A 2AXTZ 1M56B 3AK3A 1QZRA 1M90W 4O4IB 3QO5A 3K5LA 2BSKA 2QR4A 2YGEA 1ORQC 2YKCA 3PEHA 3A0XA 3J81N 2RDCA 3E8GA 3J7AU 4J7ZA 2ADPA 4D7SA 2R9IA 1ZTEA 1VQPV 1K8AW 4U7NA 1AR4A 1THZA 3L9DA 1VQMV 4X1KA 1Y4UA 1JJ2U 2Z0AA 3BABA 2AHZA 4GCZA 1TA8A 5LBQA 1HNWO 2XDXA 2CG9A 2UUAO 2VS0A 2BU6A 2XNDG 3TXSA 3SL2A 3HKCB 3STLC 3ABLB 4QPJA 5IY5C 4TUYB 2DMXA 1FYJA 2UU9O 4U3JA 2B1GA 3G80A 2QM7A 5LOVA 2A0LA 4ZHQA 2WLKA 1A4HA 5CBFA 5K1PA 1NH2B 3IEDA 1KMIZ 4FFBA 2A9HA 4J7KA 4YKWA 4YY3B 1R3LC 4RQEA 1B06A 4X1YA 5FNVA 5KUMA 1FJGB 1XNQB 4FIPC 1N8RW 4GEEA 4LCUC 4CH4A 2B9ZA 3CE2A 4TQDA 4OPHA 1PL0A 1Q6UA 5JENA 4YIPA 1HWYA 2HEPA 3AG7A 4LH6A 3WG7B 2XD6A 3CXCU 2GQPA 2CCTA 3G4SV 3ASNB 3OUFA 2ZBKB 1Q43A 5J71A 2RNBA 2O1WA 3HYYA 2EX3A 3Q4HA 2XHBA 1U96A 1HP8A 2BTOA 2BU2A 1HNXB 3D3QA 3RYCB 2PYJA 5L3JA 3ZRSA 2XAFA 4EFTA 2JEXA 1PV0A 1Q8IA 5EBLC 4JAAA 4LWFA 3IC7A 4WBNB 3B09A 2YE9A 5KLVH 4CE3A 3QG5A 4YHHB 4JYAB 2XAGA 1YI2V 1RSOA 2IH3C 1I7FA 1BZKA 5IDMA 2YEVA 4DV4O 1ROPA 4I5SA 2YICA 3S5TA 1EM1A 5A9GA 1EZJA 3ZHRA 2ZD9A 3JCUZ 2NNUA 3OW6A 4UV8A 5J6AA 2DYSB 4HNAA 5LP6B 1MSDA 3A0RA 4LBEC 2VQFB 4B7EA 1PL4A 4WFBV 2E76B 5D7CA 1YITV 5IJ0A 1R62A 1P7GA 1AJQA 4PDVA 1TGOA 1TUBA 1H8EG 2QTOA 1IBMB 2OTLV 4YY3O 1WPXA 1FXHA 4DV1O 3M99B 2WI3A 4UB8Z 1JMKC 4YKYA 3ZRWA 3HKEA 4YXWG 5JVDA 1HW7A 5D7DA 1KU9A 1L1FA 4JI5B 5A2QN 3WHAA 3ABKB 1N32O 1ZUQA 2RMKB 3O0IA 1WA8A 4IIJA 4DV3B 1BMFG 1KZNA 5FNDA 1O9GA 2FWYA 2XABA 3N2GB 1K33A 1G8MA 1NBMG 3AG4B 2YEBA 3AG3C 4EGHA 3TUHA 1SRYA 1Q5OA 3K57A 3NR7A 3B8NA 5J9PC 1BGQA 4JI6O 2NLJC 3JD2A 2QKSA 1ZL8A 3CCQV 3CXHF 2QKCA 4KXRA 3LNUA 2DOSA 1XHZA 1HNXO 4CH5A 2YI9A 5IYCO 4DR5O 3WFVA 4N21A 3SDLA 1PKXA 1AROP 1Z5VA 3WU2Z 1SA0A 3BM9A 2LJ2A 4W4LA 1SQXH 1NQTA 4EGIA 2UXCB 2WEQA 4JYAO 3QTCA 1MZFA 4I4TB 4X89A 1US7A 2XDSA 3JATB 5FPRA 4LWSB 4CC6A 3TETA 4AQYB 3E35A 5CPHA 2L35A 4DV7B 2ZR2A 1IVSA 3CCSV 1S5HC 2K1EA 1B63A 1W2BU 2ZXWC 4BWAA 5KHJA 1FXKC 5JH7B 2IWXA 4DV2O 3C0EA 1BCCH 3K04A 3OMAB 4UCTA 5KHIA 2WI6A 1Q90D 2YEAA 5JJEB 4YJ2A 5CA1A 3JAWA 4DUYB 5M4EA 2YKBA 3E8BA 2E75B 4X9QA 4Q6GA 3KZIZ 2IOPA 3FAVB 5IN9A 2WA4A 4NXMB 3E2EA 1KQSU 4NH8A 2QG2A 1W59A 5KHKA 4LF7O 4PI0A 1GN3A 4YKTA 3N27A 2N04A 3CRMA 4LF8B 2EINB 3KKYA 2XAQA 1YC4A 3AEIA 5CBHA 5CB4B 4ZIBA 2PTMA 3OTOB 1I58A 4CE2A 5IYZA 4QE9A 1NH2D 2K5BA 2ZINA 1DF5A 1P49A 1JPXA 1XI1A 5EK0A 1IBKB 2Y69B 1Q3EA 1VQ5V 2LP7A 3K0DA 4GKJO 2A3QA 3CRQA 2F1MA 4RWUA 4L8JA 4JV5B 3ETDA 5C8YA 2ZKJA 4JTDB 4JI3B 2UUBO 5D5QA 3RYHA 4R3AA 5LA6A 1QY8A 1RP3B 1GN4A 4PRVA 3U2DA 4CH6A 1HDJA 2P4KA 1NT2B 1AJNA 3AK2A 1YERA 2YSUB 1L0OA 4K0KB 1YCIA 2W6JG 4IHJB 1BE3H 4MVQA 4X20B 2VWJA 4KUMA 2AZ0A 3SPHA 4MP2A 1WLEA 2H8PC 5EIBD 3GIEA 4O05A 3ZM7A 3P3PA 1GJVA 1YTFB 3T1YO 4MTOA 3ZMZA 2W0XA 4H85A 3FYEB 1SQGA 5BMVB 4O4HA 4MVMA 3EXAA 2QDOA 3AG2C 2UXNA 4NXMO 2IW5A 4B3SO 4FLVA 2GBOA 2IM9A 4E2LA 4LF9B 4MS2A 1CP9A 4FCQA 3ZMUA 3O6OA 2EIKC 3A0WA 4EEHA 3R4MA 1BYQA 2EIMB 2FKXA 4TUYA 3H1KH 1MU5A 2YECA 4F6RB 4PHZA 2EILC 3E89A 4X66B 3OMUA 3VQXA 3KE6A 3E22A 2HCHA 5LYJB 1Y8PA 2BTZA 2LGQA 5JJJB 1I94B 2AKPA 1O9HA 1ZWHA 3K9AA 4UVBA 4V26A 4O07A 1QHTA 2QGNA 4GUNA 1GM8A 5D5PA 4QNHB 1VARA 4JI0B 4DK0A 3AG1C 4LNUB 3K59A 3UCSC 1GH6A 4LWIA 4ICGA 4NKGB 4FMTA 2QJ1A 5JQGA 1TAEA 2YDEA 4P9PA 1EI1A 4YJ3B 2E5LB 5JWPA 1TVKA 5CTYA 3CCLV 4L90A 2ATKC 3L75H 2OT5A 3QNEA 5LXTB 1VEWA 1SS3A 4TV8B 2YEIA 3K98A 1D2DA 1SZTA 1ZX3A 1I5DA 1TBWA 1R3IC 3LSUA 2XDUA 4DW1A 3D8CA 4MW8A 3A0BZ 1M5IA 2UXBB 1XREA 3CCMV 4BIOA 3TZ2A 4EGKA 3OPDA 3ETQA 1Q6IA 4NTXA 4K8ZA 2FMLA 1V54B 2ZE6A 4CC5A 4QE7A 4OGQB 1XMOB 1H2GA 2VCJA 3ABTA 3MAQA 1MSWD 4WUDA 1QVGU 5EBMC 1YSRA 1OJHA 3GB7C 3UO2A 3F5WC 3TJTA 1WB8A 1SC5B 2MK3A 4I3HA 3N2KB 1KB9F 2XUMA 4ASAA 1YT1A 1KP3A 4IYIA 5LP6A 3FX7A 5BOCA 4DV5B 1JFFA 2ADQB 4X66O 3RT3C 1S5JA 1ZW9A 2CTWA 3TZ4A 5M4HA 1G1XB 4CE1A 1IX9A 2Y0IA 5IJ9B 4JI8O 1M9NA 4X1IB 2WLMA 3H1LH 4D7TA 3HB3B 4UV9A 2Q4PA 1YJ9V 5EYPB 2CCSA 1GRJA 2KG7B 1AH8A 1WB7A 5J2TA 2IU3A 4PU9A 2YGFA 3K5MA 1FFXA 1NHIA 4B3RB 3MDSA 4Z2WA 3ASOB 2LO1A 4XDLA 4I50B 2GTSA 3PEJA 1NKDA 3NMQA 3VQWA 4G27B 4DUZB 2XTAA 4MTFA 1I5XA 4LPBA 1YF2A 2BRCA 2PI4A 4MVSA 1X4TA 3ZXOA 3JCZA 3UQ8A 5LHGA 2UXBO 1CEZA 5K1XA 1QCEA 3L71H 2KB1A 2EXLA 1UPGA 4CBCA 2E74B 3DC6A 1YXBA 1DF4A 4BR6A 4XKOA 2M6YA 4LFBB 4H33A 2XJJA 5CA0B 3K58A 3TK1A 2BYIA 4UB6Z 1S76D 2UXDO 1HNZO 1XNRO 3CYOA 3JATA 5L3GA 1OCRC 1LUVA 2BYHA 3CGYA 1GO3F 4PJ0Z 1OCCC 2VQEB 2YS8A 3P32A 2X7RB 4O4JB 5B1BC 1G4YB 2JS5A 3TGUH 1YTFD 3A0ZA 2CGOA 4CWSA 4HAMA 2CK3G 2JJ2G 4NH9A 1NU1H 3OGIB 2PZSA 4FFKA 1VQKV 3RYIA 1EBOA 4UCSA 1Q82W 1H7SA 4AHCA 1NTZH 3HPLC 1TC6A 1M1KW 1H2NA 1AR5A 5GONA 1JR9A 1L8DA 4LF5O 2Q2EB 1M57C 4IYHA 3TXQA 3CCRV 1OZ0A 1VQ6V 2Y0PA 4R1FA 2WI4A 4LWGA 5CB4A 2YC0A 2HJDA 4B3RO 1FXKB 2YXHA 4RO2A 4FLXA 2A7WA 4DV6B 3LMMA 2BU7A 4TOIA 3OD4A 1WJZA 4J10A 5FL7G 3CD6V 3W7WA 2ZDYA 5CTUA 3X2QC 4DUZO 2XK2A 2YE4A 4UCRA 2ZE7A 3OEHG 2PGGA 5M4PA 3SYPA 2XAHA 3ETGA 2X6CA 3R92A 4NYKA 3FKSG 3BHPA 4TQFA 3CEIA 4FLZA 4X64B 4DR4O 4JZGA 4EB6B 2F93B 1UYHA 2Q8GA 4LFBO 1RPRA 2CUGA 2ZDXA 2IBZH 4KL1A 4FCPA 2F23A 1JCHA 1SF9A 4JI4B 3FD9A 5LMUB 1UY6A 4O2BB 3H9VA 4NVPA 3L74H 2ZE8A 4DR3O 3Q5LA 3U67A 1WP7A 2ZT9B 3H01A 5EBWC 2YE2A 2V1DA 3QDDA 1PD3A 1IXMA 3SYAA 1MOFA 1XUQA 3T0HA 1UYGA 2Q7GA 2H8MA 2YI6A 1VF6A 4MPNA 3EVKA 5KHGA 2FYUH 2CDYA 2ITDC 2QA4V 3EHBB 2GTAA 5H5NA 1AI7A 3SPCA 1Y76A 1JQ0A 1IXBA 3R4OA 4J9ZB 2VCIA 4K4OA 1I08A 5BMVA 4O04A 3BA8A 3INWA 2BOBC 2Q5ZA 3M7MX 3ZHTA 3P3NA 4JI7O 1YT2A 2AGAA 3QTFA 1OHHG 2YEGA 1EA6A 2HLDG 2YE8A 2UUCB 4BAEA 2HKJA 3BMYA 2PI5A 1A32A 2F66C 5B3SB 3H80A 3ZXQA 4DR7B 1DGSA 1RFYA 2YK9A 1NJIW 2YKIA 2K9PA 4F6RA 2CGFA 4O09A 1F51A 2ODMA 3OR7C 4MVRA 2BU8A 5FWKA 2Q73A 1S16A 4UVAA 3J80N 1DTOA 1X59A 4XCLA 4ZKIA 3RBZA 4X9LA 4FK5C 2PUSA 1J5EB 1ZXNA 1GM9A 5KX5A 3TZ5A 4MVOA 1K92A 2JEUA 5J2UB 5HFLA 5H2FZ 2WLLA 3JD4A 1N4CA 3ZHUA 4LNUA 3E83A 4O2AB 4X64O 1I5CA 4YKUA 1Y4MA 1AI5A 2OCCC 5LL6Y 3SPJA 1AJPA 2Q0OC 3EHGA 1K4CC 4WFEA 1KUQA 3K06A 4I0XB 2AZ2A 2BCCH 2LQTA 3JASB 3MHHC 1KC8W 4LC1A 3HHUA 2DW4A 2O1UA 2YUAA 1XL6A 2YJXA 3SGIA 4PD4F 1QNMA 4V25A 2XASA 4UCOA 3E8HA 3D0BA 1JOYA 1AILA 4DR2B 4P9OA 4WFFA 2ZM6B 4MVZA 2IWUA 4H37A 2JJ1G 4FCRA 3HEKA 4J80A 1H8HG 3JAKA 4ZI7A 4H7QA 2WI5A 3SR2C 4J7JA 1SQVH 2HKOA 1S77D 2DYRC 1FJGO 4WFGA 2JS3A 1XNQO 2XHXA 3SYOA 2DQ3A 3RGBA 1I59A 2KQXA 3C11A 1H2KA 2EIJB 4CWPA 3CP1A 2B1IA 2QTSA 4BIZA 4LF4B 4FM1A 1UY8A 1VQ8V 4XC0A 2GUZB 4JGSA 2QWQB 4B3TB 3CRAA 1UYMA 1WAZA 4OXSA 4FLTA 2FWZA 4MSWC 1PVGA 2YIDA 4JYCA 1KD1W 1QLEC 4K8XA 4P7AA 1KECA 4UVCA 2CH7A 3MNRP 1YESA 1J5EO 4PDRA 1G6UA 5IJ9A 3ZKDA 2HVJC 4BW9A 2WPDG 5LGUA 1NTMH 4YHHO 1N0JA 1V55C 1Y4SA 1MABG 1OCOB 4YIOA 4AI8A 3RYFB 1KIJA 2XJGA 1YJNV 4DW0A 1EFRG 4L8ZA 4I50A 4HY1A 3A0HZ 3K0GA 3CJHA 3G6BA 2DJVA 2HFEC 2P67A 4OX9B 3JYCA 5IDJA 1OCZB 4UCUA 3OMNB 2GDSA 2WLIA 1RM1C 2F95B 1FKAO 3ZN1A 2EZOA 1Y67A 3SYQA 2F4VB 5ITZB 4FLWA 4AWQA 2VQFO 1SQFA 3APQA 1AP5A 2HVKC 4NH7A 2RCVA 1B04A 3F5TA 1L0NH 1FS0G 3QO7A 1UYIA 4HXZA 4MB9A 3L73H 1S5LZ 1MNGA 1M56C 1IBMO 4H0LB 1F4MA 1SESA 3ABUA 3L70H 2WLHA 2IU0A 3JD1A 1XBLA 1GKFA 2DQ0A 4B3MB 4O4LA 3G7BA 4EFBA 2IJKA 4PA9A 4XKKA 3UM7A 4CWOA 3UT5A 4KHPB 1N36B 4JI5O 3P30A 2IWSA 4RUFA 1GKXA 1ZWIC 3IC9A 5B1AB 3RVZA 4AILC 1Q86W 2X6BA 4DV3O 4R6ZA 1VQ9V 4B3TO 5GW7A 1J95A 3W7UA 1CPYA 1JJOA 1N33B 3GWKC 4PV1B 3EKRA 2XX4A 2LW7A 3CGZA 1QR9A 2GFDA 1PNMA 5GGZA 3JD0A 4L87A 5D6QA 4X88A 2ZE5A 3I56V 5FLXN 1XMQB 1SERA 3T10A 4GT8A 4TSFG 1YC1A 4NTWA 5E1AC 3ABLC 1SZXA 3CC4V 1K5QA 4IGGA 1PNLA 2UXCO 3S3XA 2HG1A 4HYPA 1PPJH 3ZRVA 2BREA 2CH4A 3HKDA 5EZYB 2YEDA 1E1QG 4AQYO 4DV7O 3CCUV 1R6TA 4MW3A 4DK1A 1NHHA 3B8MA 3FYIB 4ASFA 3EHFA 4HYMA 4O4IA 2BT0A 4X1KB 2ZNIA 4OPAA 2D3OW 1Y6XA 4E00A 3ZEDA 2GHYA 3E86A 4WUCA 4ASBA 4RAIA 1S3JA 5L3DA 4DUYO 2F4VO 2QF6A 1Z5WA 3LSSA 2AHYA 1R73A 3T1HB 3ASNC 4WFHA 1R6KA 4LFAB 1MZEA 4J9YB 2CE4A 4UFZA 2CTPA 4U3JB 1S14A 3JSLA 4LF8O 1F4NA 5LOVB 4O2BA 4ZHQB 3JSNA 4B3MO 3ZBHA 3ZHQA 1VQLV 5BR8B 4NXNB 1P4RA 5JJNB 2BU5A 2KKWA 4FFBB 3RWRD 2P7TC 1AH6A 2ITCC 3HKCA 3LNMB 1N36O 5IWAB 3FB7C 3OTOO 1LUWA 4HZ3A 4KFMA 3WB0A 1V9PA 3E8FA 2ZCEA 1N33O 1IBKO 4I55B 5BXZA 5JCOC 3W7TA 2GSMB 4FZ1A 1TC0A 4FJCC 4DR1B 4PA3A 4LFCB 2Q68A 3VADA 4JV5O 4CWFA 4YKZA 4E01A 5EC1C 4XDMA 3CYGA 5B5EZ 2DYSC 2WAMA 5LP6C 3STZC 4JI3O 3SYCA 2CGNA 5LHHA 4ZBMA 3VBBA 1BL8A 3CB2A 3GIGB 1UY9A 2RN9A 1GN6A 3CCEV 4XIQA 1H2LA 1K34A 1K3EA 2XHRA 4A5UB 1R1BA 3BFRA 5IY5B 3BA9A 4JAVA 4DZYA 4IT5A 1VMGA 2EULA 4K0KO 4E72A 1RSOB 1GK9A 2CAZC 1Q81W 2YEVB 2LW1A 2Q8FA 3RYCA 4EFEA 4XE2A 4JYBA 2LFRA 1SQPH 4LH7A 3LDCA 4X65B 4WF9V 1FPOA 1YZBA 3ABKC 4WBNA 2YI0A 1GTOA 2QEXV 4NR1A 5CTXA 4BAYA 1ZAUA 3U0ZA 1WPBA 5L3CA 3AG4C 5IT9N 1TIDA 1U2OA 3VHAA 1VQNV 3W7SA 4HNAB 3JASA 4JI2B 4LFAO 1LR1A 5FPOA 2UXXA 1QR8A 1I0HA 5JCOA 3BVOA 1KKCA 3HR0A 4LF9O 1YIJV 1WNSA 5B1OA 1UYFA 2Q0AA 4HZ0A 4PA7A 4URNA 2YI7A 3A8TA 1TUBB 1M93A 2W6IG 3LNNA 1VQ4V 3D2RA 1Q6HA 5IWAO 4GFNA 4J11A 3C3TA 5E79Z 1AJ6A 3LDDA 3ZRWB 3HKEB 4XIPA 1VQOV 2ETNA 5JVDB 4GX2A 1I94O 3LUTB 1R3KC 3ML0A 1D5AA 2WLNA 3LPSA 1Y66A 3TCUA 1WA8B 4IIJB 1K97A 4F4LA 4L91A 2OIGA 2JRIA 4JI0O 4KQVA 2JKIA 5LMNB 1K9MW 4TV9B 2FYPA 3DGEA 3RLRA 1EN4A 1KYOF 1NTKH 2YIBD 1ZL8B 2E5LO 4I9WA 3ZJZA 5B1NA 2OWOA 1I5YA 3ABMC 2LFSA 3OGCC 3G71V 4ZOLB 2Q8VA 3N2GA 2IORA 1QVFU 3SJAC 2YXLA 4LWEA 4XDJA 1ZLZA 4J41A 2Q6AA 2OYQA 1US6A 2QM4A 4UUJC 2YK2A 3F7YC 2Y48A 3CRLA 3VQYA 3FT5A 1ZSPA 1UJWB 2YI5A 3T0ZA 1NR7A 1EZVH 4JAUA 4K35A 2P5OA 4I4TA 3I55V 3CMEV 2DYRB 1XMOO 1S0VA 4B6CA 4LWSA 4YJ2B 4XDKA 1IDSA 4PI2A 4X8AA 4HY6A 3ZX6A 3OM3B
chains in the Genus database with same CATH topology
4GT1A 1NJIW 5KA6A 5CMUA 1BHAA 3LDEA 1F51A 3OR7C 4MVRA 1BHBA 4BIUA 1YHQV 4UVAA 1DTOA 1K5SA 2XOKG 4ZKIA 3RBZA 3AG3B 4FK5C 3E8BA 2H94A 1GM9A 1QLEB 1W0JG 2WLLB 3BEHA 3MD0A 4MVOA 1K92A 1KKDA 3K79A 2JEUA 3FB6C 3E2EA 1KQSU 3PJSK 5HFLA 3T4ZA 5KUKA 2Z5UA 2WLLA 3JD4A 5H6QA 3T1CA 3E83A 3ZCCA 4HYOA 1Y4MA 1PNKA 2EINB 1AI5A 2OCCC 1F23A 2EIJC 2QE7G 3SPJA 1AJPA 3SPGA 2XAQA 3CC7V 1K4CC 4WFEA 3K06A 3AEIA 1V55B 5CBHA 3MHHC 3SPIA 2IJHA 1VQ7V 4QE9A 1NH2D 1KC8W 3QO8A 4LC1A 4PDLA 2DW4A 1XL6A 2ZXWB 1DF5A 2XASA 1B6QA 1JPXA 2EJRA 5EK0A 3E8HA 1JOYA 3ETEA 3NXSA 2Y69B 4MVUA 5EC2C 1VQ5V 2LP7A 4P9OA 4WFFA 3GWOA 2ZDIA 3K0DA 4MVZA 1MG1A 4H37A 2JJ1G 2HJFC 3OMIB 3ETDA 3KG2A 1H8HG 1OCOC 4JTDB 4ASUG 1Q7YW 2HKOA 3ZRXA 1S77D 2DYRC 4WFGA 4GX0A 3SYOA 4PELA 2DQ3A 5IYBO 3CCVV 1OCZC 5L3EA 2OCCB 2EIJB 3CP1A 1AJNA 2B1IA 4BIZA 3OW2U 2YSUB 3IFXA 4PDMA 5KA5A 1VQ8V 1H38A 2W6JG 4JGSA 4MVQA 3K08A 1COWG 3EFFK 4KUMA 3SPHA 4P2ZA 4DXWA 1WLEA 3OFNG 1E79G 2H8PC 4OXSA 4MSWC 4JYCA 1KD1W 1QLEC 3RVYA 5H6RA 5LHIA 2X6AA 1KECA 2P90A 4UVCA 1YTFB 2P6JA 1LNQA 3F7VC 4MTOA 4PA4A 3ZMZA 3FYEB 4PDRA 4LP8A 4MVMA 1JVMA 3FB8C 2EINC 2HVJC 3AG2C 2UXNA 2WPDG 4U7OA 5LGUA 2IW5A 3T2MA 1KP2A 5DM6V 5LGNA 1K73W 3ZIAG 4JTAB 1V55C 2B5UA 4DO2A 3B77A 4E2LA 1MABG 4MS2A 1OCOB 1CP9A 3R65A 3ZMUA 3UKMA 1YJNV 2EIKC 5B1AC 1K4DC 3W7XA 1EFRG 2DWDC 1XL4A 2WLIB 3K0GA 2EZPA 2EIMB 2HFEC 2P67A 2EILC 3JYCA 1YJWV 2Y69C 3E89A 5IDJA 1OCZB 3OMNB 1TUEB 2WLIA 1V54C 1RM1C 3OAAG 3JD3A 1NR1A 3ZN1A 2EZOA 3SYQA 4RUEA 1K7DA 2EBOA 3K9AA 4UVBA 3RW0A 3OEEG 1GMGA 1GM8A 1AI6A 4QNHB 2HVKC 3D36A 4CZZA 5CBGA 3AG1C 5L3BA 3QO7A 1FS0G 4MT8A 3OM3B 1NVPB 1W0KG 4FMTA 4WFAV 2W0FC 1GM7A 4MTXA 4P9PA 4QJFB 1M56C 3LSQA 4R7CA 1F4MA 1SESA 2M7WA 3ABUA 1S72V 2WLHA 2IU0A 3ZMTA 3JD1A 4PA6A 1GKFA 2DQ0A 3AG2B 3CCLV 2ATKC 3QNEA 2OT5A 5HFMA 4WCEV 2IJKA 4PA9A 3UM7A 1SZTA 1R3IC 3P30A 4RUFA 1ZWIC 4RQFA 3CPWU 4MW8A 2EIKB 5B1AB 3RVZA 4Q20A 1Q86W 2X6BA 5LGTA 4R6ZA 3CCMV 1VQ9V 2WLJA 5GW7A 1J95A 3W7UA 4MTGA 1CPYA 2EILB 1QR9A 2JK5C 1PNMA 4QIWF 3JD0A 4TWKA 1V54B 3ZN0A 4L87A 1RM1B 4QE7A 3D3IA 3DTUB 4X88A 3I56V 2IJJA 2WSSG 1H2GA 5L3FA 2V7QG 3ABTA 1SERA 5C93A 1MSWD 4JASA 4TSFG 3ASOC 1QVGU 5EBMC 5E1AC 1FXVA 3ABLC 3GB7C 3F5WC 3CC4V 1K5QA 1PNLA 3AG1B 2DWEC 2MK3A 3ZRVA 3OE7G 1FFTB 2EIMC 1M56B 1M90W 1E1QG 3QO5A 4TT3G 3CCUV 2Q67A 1ORQC 4MW3A 1KP3A 3B8MA 1AI4A 3FYIB 3E8GA 2D3OW 2R9IA 2GHYA 3E86A 1VQPV 1K8AW 4RAIA 2IH1C 1S3JA 4FPPA 1RPOA 1THZA 4U7NA 5L3DA 1VQMV 4GX5A 5CA3A 1M9NA 1JJ2U 4P30A 2WLMA 3LSSA 2AHYA 1R73A 3HB3B 5CN0A 2AHZA 4GCZA 4UV9A 1YJ9V 5LBQA 2JIZG 3ASNC 2BOCC 4WFHA 1AR1B 1R6KA 2IU3A 4J9YB 3CMAV 4R50A 2XNDG 3ASOB 4XDLA 1F4NA 3STLC 3ABLB 1NKDA 4QPJA 5IY5C 1VQLV 4G27B 1P4RA 2B1GA 1I5XA 4MTFA 2P7TC 3SJQC 2ITCC 2QM7A 2A0LA 3LNMB 2PI4A 2WLKA 3FB7C 1ENVA 4HZ3A 4MVSA 5CBFA 1NH2B 3JCZA 4KFMA 5LHGA 3G6EV 4JF3A 2A9HA 1CEZA 2FTKA 3E8FA 1QCEA 2Q69A 2KB1A 4N23A 1R3LC 4CBCA 4RQEA 5KUMA 1DF4A 4EKWA 4H33A 3W7TA 4FIPC 2GSMB 3TK1A 1N8RW 1S76D 4FJCC 4LCUC 4PA3A 2Q68A 3VOUA 2IJIA 3CYOA 2XAJA 1PL0A 2R9RB 1OCRC 2WWWA 5EC1C 5L3GA 1HWYA 2DYSC 1GO3F 2WAMA 3CCJV 3STZC 3WG7B 4BW5A 1OCCC 3SYCA 3CXCU 3G4SV 5LHHA 3ASNB 2HG5C 3OUFA 4ZBMA 5H9CA 3VBBA 1BL8A 3K3WA 3T4DA 3P32A 2X7RB 5B1BC 1G4YB 3CCEV 1YTFD 4HAMA 1K34A 1K3EA 2CK3G 3ABMB 5IY5B 2JJ2G 3ZRSA 2XAFA 4JAVA 2JEXA 5EBLC 1GK9A 1Q81W 3IC7A 2YEVB 1VQKV 4QPKA 3FB5C 4JYBA 2XAGA 1QLNA 1EBOA 1YI2V 2LFRA 4WF9V 3LDCA 1Q82W 3ABKC 2IH3C 2ZR3A 2YEVA 2OTJV 3HPLC 1M1KW 1GTOA 2QEXV 4G28B 1JX9A 4BAYA 1ROPA 4I5SA 1M57C 3CCRV 5L3CA 3AG4C 1OZ0A 2ZQMA 4G2KA 1VQ6V 1EZJA 1VQNV 3W7SA 2ZD9A 1FXKB 2UXXA 1QR8A 4RO2A 2A79B 1P7BA 2NNUA 4R8CA 4UV8A 1OCRB 5FL7G 1YIJV 2DYSB 3CD6V 3W7WA 5B1OA 3A0RA 3OUSA 1OCCB 1FXKA 3K03A 4LBEC 4PA7A 3X2QC 4WFBV 2X0LA 2W6IG 1YITV 3OEHG 1VQ4V 5DN6G 3SYPA 2XAHA 3ETGA 5B1BB 1AJQA 2X6CA 4PDVA 1NVPD 4Z1MG 1E1RG 2JDIG 1H8EG 2QTOA 3FKSG 4KP4A 3LDDA 2OTLV 1DLBA 3ZRWB 1WPXA 1VQOV 1FXHA 4GX2A 4UXNA 3LUTB 3M99B 1R3KC 3ML0A 2WLNA 1RPRA 1Y66A 3TCUA 3ZRWA 1K97A 4GX1A 4YXWG 4F4LA 5B3SC 1L1FA 3ABKB 1JCHA 4JPRA 4XBFA 3WG7C 2F43G 1K9MW 3CC2V 3IGAC 3DGEA 1BMFG 1M57B 2Z3YA 1K33A 1QBZA 1G8MA 1NBMG 3AG4B 3AG3C 3H01A 1SRYA 4I9WA 5EBWC 5B1NA 3ZJZA 2V1DA 3B8NA 5J9PC 1I5YA 3ABMC 1PD3A 2NLJC 3JD2A 1IXMA 2QKSA 2LFSA 3SYAA 1MOFA 3CCQV 3OGCC 3ZMSA 3G71V 3MHSC 1QVFU 5IYDO 1R3JC 5IYCO 3WFVA 4N21A 3ZMVA 1PKXA 3X2QB 1AROP 2ITDC 4XDJA 2QA4V 3EHBB 2C2AA 1NQTA 1YSCA 1AI7A 2Q6AA 3SPCA 1JQ0A 4UUJC 4J9ZB 3F7YC 2Y48A 2BOBC 5BZBA 4X89A 1UJWB 1NR7A 3TETA 1OHHG 3E35A 3BY6A 4JAUA 2ZR2A 3CCSV 1S5HC 2K1EA 1W2BU 2HR3A 2HLDG 2ZXWC 3I55V 3CMEV 2DYRB 2ZDIC 1FXKC 1S0VA 1SETA 4JTCB 4XDKA 2PI5A 4X8AA 3K04A 3OR6C 5B3SB 3OMAB 1R6NA 2QM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GT1 A;  2C2A A;  4BIZ A;  4U7O A;  2FTK A;  3DGE A;  3P32 A;  1F51 A;  4BIU A;  5C93 A;  4JAS A;  4I5S A;  4ZKI A;  4KP4 A;  3TK1 A;  5B1N A;  4JAU A;  4LC1 A;  4QPJ A;  3D36 A;  4JYC A;  3ZRW B;  4JAV A;  3MD0 A;  1IXM A;  2LFS A;  4Q20 A;  4U7N A;  4FPP A;  4MT8 A;  3ZRX A;  2QM7 A;  3ZRV A;  4QPK A;  2WWW A;  4FMT A;  1JOY A;  4MTX A;  3NXS A;  4JYB A;  2P67 A;  3ZRW A;  4GCZ A;  5IDJ A;  2LFR A;  5B1O A;  3ZCC A;  3A0R A;  2QM8 A; 
#chains in the Genus database with same CATH topology
 1IBL B;  3UO3 A;  4EM7 A;  5JH7 A;  2XJX A;  2PYL A;  5KA6 A;  1URF A;  4LR3 A;  4JI1 B;  4URL A;  5CF0 A;  2LGW A;  1YHQ V;  4D6T H;  1K5S A;  1M4U A;  4W7T A;  3AG3 B;  2ZIO A;  1QLE B;  2G38 A;  1W0J G;  3BEH A;  5M4K A;  3CRR A;  4DYL A;  1N34 B;  1KKD A;  1Z5B A;  1XQ8 A;  2R70 A;  3FB6 C;  4DV5 O;  2UUA B;  3RLP A;  1Z5C A;  3PJS K;  5H6Q A;  4GKK B;  3T1C A;  1GN2 A;  3FAV A;  3ZCC A;  2E0A A;  2IOQ A;  3SPG A;  5D6P A;  3CC7 V;  1YT0 A;  1QYE A;  2UU9 B;  1V55 B;  5B66 Z;  2N05 A;  1BKN A;  3HKB B;  2IJH A;  2UWD A;  1PP9 H;  3QO8 A;  4PDL A;  4CS4 A;  3BRC A;  1VF6 C;  3CX5 F;  2ZXW B;  2YJW A;  3DC5 A;  1B6Q A;  2DN9 A;  1Z2G A;  4ZVI A;  3ETE A;  3NXS A;  4MVU A;  3O9O A;  4XTJ A;  1THN A;  2MW2 B;  2RJZ A;  3GWO A;  1MG1 A;  4KFG A;  2HJF C;  3RYH B;  5KMG B;  5LA6 B;  3KG2 A;  1XDC A;  2BSM A;  2YEH A;  4ASU G;  1DK1 A;  1EN5 A;  5KAF Z;  3ZRX A;  2FXS A;  2A06 H;  4MPE A;  3CCV V;  5IYB O;  4PEL A;  3CWB H;  5L3E A;  1AMW A;  3I5D A;  5KAI Z;  3OW2 U;  3IFX A;  4PDM A;  5KA5 A;  3B26 A;  5EZY A;  3D36 C;  4BXI A;  4I7Z B;  3K08 A;  1COW G;  3Q5K A;  3EFF K;  4P2Z A;  1IBL O;  2VQE O;  1E79 G;  1SKV A;  1Z59 A;  4IHJ A;  4JI1 O;  3RVY A;  4X20 A;  4O4H B;  4DV4 B;  2P22 C;  4E4E A;  4FVM A;  2QKA A;  5GTI Z;  2JGU A;  3F7V C;  4PA4 A;  1JA8 A;  2Y4T A;  4LP8 A;  3O65 A;  1N34 O;  3G75 A;  2WA3 A;  2BZ5 A;  3TTZ A;  3T2M A;  3FFQ A;  2BE3 A;  1K73 W;  1ID0 A;  3ZIA G;  4JTA B;  2O57 A;  2JVD A;  4GKK O;  2B5U A;  1WN7 A;  2Q8H A;  3R65 A;  3U11 A;  1K4D C;  4YKR A;  1FD9 A;  3S3W A;  4URO A;  2D2C B;  1XL4 A;  2NR5 A;  3E22 B;  4KSH A;  4WUB A;  3FV5 A;  2QWO B;  3K99 A;  2HP8 A;  1TUE B;  4LP0 A;  1V54 C;  3ZHS A;  4L93 A;  4JQL A;  2YEE A;  4K3A A;  4DV1 B;  4DV6 O;  4EMV A;  4RUE A;  1K7D A;  2V4D A;  3OEE G;  4YKX A;  5LYJ A;  1AI6 A;  1UFI A;  1QU7 A;  3DSQ A;  5JQG B;  3D36 A;  4I55 A;  2HHI A;  1XOU A;  2L6L A;  1N32 B;  4LF6 B;  1P84 F;  2QFO A;  1NVP B;  1B62 A;  1TVK B;  1YC3 A;  1UY7 A;  1F7Y A;  2W0F C;  5F2V O;  1OV9 A;  4LWH A;  3LSQ A;  3K97 A;  3B4S A;  4U3F H;  4DR6 B;  3ZMT A;  3GIF A;  1NHJ A;  2KSD A;  3AG2 B;  4JI6 B;  2BTQ B;  1WP8 A;  4WCE V;  3G7E A;  4YJ3 A;  1GKZ A;  4DR5 B;  3JAR B;  3GIG A;  1H2M A;  5LXT A;  2YE3 A;  4JI4 O;  2ZNJ A;  4TV8 A;  4RQF A;  5LMU O;  2EIK B;  4Q20 A;  3BAA A;  1BQ0 A;  2R9A A;  5LGT A;  5AG2 A;  4DRX B;  1QQC A;  4MTG A;  2EIL B;  3U2K A;  3ZS8 C;  4QIW F;  2WER A;  2C1G A;  4W4K A;  3JAL B;  3IJ4 A;  4HZ5 A;  2IJJ A;  2WSS G;  2C1I A;  4EEQ A;  3CHX A;  4JAS A;  4DV2 B;  3ASO C;  1TH8 A;  3VQV A;  3HYZ A;  3K5N A;  2JGD B;  3KCY A;  3AG1 B;  2VW5 A;  2DWE C;  3SJB C;  3ZHV A;  3OE7 G;  3IAY A;  3CWV A;  1JFF B;  4TT3 G;  1UYE A;  1XEQ A;  2Q67 A;  2FB5 A;  3CS5 A;  1U0Z A;  2UUC O;  1JM6 A;  1AI4 A;  1IZ3 A;  2ZIM A;  3N2K A;  2FL4 A;  5GTH Z;  2YXY A;  4LF7 B;  2XCM A;  3B2E E;  4DR7 O;  2YE6 A;  2YEF A;  4O0B A;  4GYC B;  2IH1 C;  4FPP A;  1RPO A;  4GX5 A;  1UYC A;  5J2T B;  5CA3 A;  3AK1 A;  4P30 A;  1FFX B;  4URM A;  5CN0 A;  4CS2 A;  1Y74 B;  4L94 A;  2ESA A;  4C7U A;  1XIL A;  2JIZ G;  4LF6 O;  2QG0 A;  4F6E A;  2BOC C;  5BY1 A;  4X1I A;  1AR1 B;  1GAX A;  3O2F A;  4Z1V A;  4B08 A;  5EYP A;  3CMA V;  4H44 B;  4R50 A;  1AP6 A;  3C90 A;  2KG7 A;  2P4V A;  3K60 A;  4H81 A;  4DR6 O;  4TV9 A;  3DXR B;  1D5N A;  5DEC A;  2O1V A;  4GKJ B;  3SJQ C;  2QSA A;  1ENV A;  2VWK A;  2CTQ A;  4ZOL A;  3VHD A;  3G6E V;  2EJ7 A;  4FM0 A;  4JF3 A;  2UUB B;  2FTK A;  4E02 A;  2Q69 A;  4N23 A;  2OCH A;  4EKW A;  4DR2 O;  3QVN A;  2ZM6 O;  2PY5 A;  4FZ0 A;  3H1J H;  3VOU A;  2IJI A;  4CWQ A;  2XAJ A;  5CA0 A;  2WWW A;  2R9R B;  3CCJ V;  4BW5 A;  3BCC H;  2ZKO A;  2GV9 A;  1UYD A;  2HG5 C;  4XIT A;  5H9C A;  2WEP A;  3OT7 A;  3K3W A;  3T4D A;  5FNC A;  3T1Y B;  4UCV A;  3TZ0 A;  3ABM B;  1BGY H;  3RYI B;  2YIA A;  4O4J A;  4LF4 O;  3WB1 A;  1OSF A;  1YS3 A;  4DV0 B;  3INX A;  2H55 A;  4QPK A;  3FB5 C;  4B3S B;  2ILM A;  1QLN A;  3QF7 A;  5GON B;  2VRZ A;  1FAF A;  1N0N A;  3Q5J A;  1SQQ H;  2ZR3 A;  2DE0 X;  2OTJ V;  3ICX A;  3R4N A;  4G28 B;  1JX9 A;  1Y8O A;  3H1I H;  3K5O A;  1U97 A;  2ZQM A;  4G2K A;  2QWP B;  4FLY A;  4P8O A;  3HKB A;  3A0Y A;  3B25 A;  2BSK B;  2A79 B;  2CCU A;  5BOD A;  1P7B A;  3APO A;  4R8C A;  1OCR B;  1UYL A;  3OUS A;  1EN6 A;  1OCC B;  1FXK A;  2NN4 A;  2OIE A;  2PF4 E;  3K03 A;  4ABM A;  2X0L A;  4CWT A;  1VF7 A;  5DN6 G;  5B1B B;  4BQJ A;  1NVP D;  4Z1M G;  4OX9 O;  1BSM A;  3WQ9 A;  1E1R G;  2JDI G;  4KP4 A;  3GVM A;  4MBC A;  1DLB A;  5KMG A;  2WI2 A;  4U93 A;  4UXN A;  1IUR A;  3OWB A;  4X62 B;  2ARH A;  4XD8 A;  4EB6 A;  1YEW A;  4AWP A;  4GX1 A;  5B3S C;  4JPR A;  4XBF A;  3WG7 C;  4CS3 A;  2F43 G;  3CC2 V;  3WB2 A;  3IGA C;  4KTN A;  1M57 B;  2Z3Y A;  1QBZ A;  3R66 A;  4QGP A;  2WI1 A;  2JJC A;  4GZR B;  3ZMS A;  1L0L H;  3MHS C;  1TIL A;  5IYD O;  3B27 A;  4KHP O;  1R3J C;  1Y76 B;  4BQG A;  3JZ3 A;  4XCJ A;  3ZMV A;  3X2Q B;  2WI7 A;  3PN1 A;  5FNV B;  4X1Y B;  1YDX A;  5EIB C;  2C2A A;  4DV0 O;  1YSC A;  1BS3 A;  1B3Q A;  2XT9 A;  1MA1 A;  5BZB A;  1T5E A;  3BY6 A;  4MPC A;  2HR3 A;  4H13 B;  2ZDI C;  1XMQ O;  1SET A;  4JTC B;  3SJC C;  3T2S A;  3OR6 C;  1R6N A;  2QM8 A;  3Q4H B;  4GT1 A;  3ZKB A;  4PL9 A;  5CMU A;  1BHA A;  4AWO A;  5IE9 A;  3LDE A;  5KX5 B;  3H4L A;  1NZ6 A;  1BHB A;  4BIU A;  4JI8 B;  5M4N A;  2XOK G;  3K9S A;  1YVW A;  2H94 A;  2WLL B;  4IL6 Z;  2H3O A;  3MD0 A;  3VHC A;  3K79 A;  2YI8 A;  3T4Z A;  5KUK A;  2Z5U A;  4MOT A;  4NB5 A;  5KHH A;  3T1K A;  4HYO A;  2YKJ A;  1PNK A;  2QE7 G;  3OTF A;  5J2U A;  1F23 A;  2EIJ C;  5CTW A;  4X62 O;  2VWC A;  4GGL A;  2QWN B;  4O2A A;  3SPI A;  3T1H O;  1MX0 A;  2YEJ A;  2BTQ A;  1VQ7 V;  4PRX A;  1MMM A;  4I0X A;  4I9Q A;  5F3K A;  2Q7E A;  1I5A A;  1YET A;  2EJR A;  3JAR A;  4DUH A;  5EC2 C;  5IJ0 B;  4MP7 A;  1YSZ A;  3A0T A;  1VP7 A;  2ZDI A;  5BR8 O;  4NXN O;  4B7P A;  3JAK B;  4ZI7 B;  2UXD B;  4DRX A;  1HNZ B;  4KSG A;  1XNR B;  3OWD A;  3OMI B;  3G67 A;  2HHH B;  4HBN A;  1SQB H;  1BQZ A;  2RQ6 A;  2YKE A;  3JAL A;  1OCO C;  1UYK A;  3B24 A;  1VIB A;  1Q7Y W;  4HXW A;  4AS9 A;  3L72 H;  2YE7 A;  2XHT A;  2JGD A;  1XHX A;  4GX0 A;  3B28 A;  1OCZ C;  2OCC B;  4DR1 O;  1NI8 A;  4LFC O;  1ZXM A;  3M8A A;  1H38 A;  3B40 A;  2CTR A;  4DXW A;  2CH7 B;  3H1H H;  3OFN G;  5F5R A;  2GUZ A;  5H6R A;  5LHI A;  3EKO A;  2X6A A;  2P90 A;  1H2S B;  1SA0 B;  2P6J A;  1LNQ A;  4LF5 B;  1HR0 B;  2YE5 A;  2XDL A;  3JAM N;  1PM9 A;  2XDK A;  1AM1 A;  1JVM A;  2P06 A;  3FB8 C;  2EIN C;  4FLU A;  4U7O A;  5M4M A;  2E3C A;  1KP2 A;  5DM6 V;  5LGN A;  1Y74 A;  4CWN A;  4FM2 A;  2XX2 A;  4DO2 A;  3B77 A;  2Q7H A;  1BXD A;  4X65 O;  1BT8 A;  3CJH B;  3THO A;  3RFR A;  1Z5A A;  1KBH A;  3UKM A;  3HZ5 A;  5B1A C;  3W7X A;  2DWD C;  2WLI B;  3U10 A;  4J42 A;  3EHJ A;  2EZP A;  3DXR A;  3RYF A;  4B7K A;  5CA1 B;  1YJW V;  2Y69 C;  3JAW B;  3R91 A;  4JYY A;  4NTY A;  4JI2 O;  3OAA G;  4DR4 B;  3BPZ A;  3JD3 A;  1NR1 A;  5FNF A;  4ASG A;  4XIR A;  1AVM A;  2EBO A;  4GQT A;  3RW0 A;  2Y4U A;  1VF5 B;  1GMG A;  3KCX A;  4CZZ A;  5CBG A;  5TIS Z;  1HNW B;  5ITZ A;  5L3B A;  4MT8 A;  2HHH O;  1I5B A;  3RLQ A;  1W0K G;  3C3S A;  4WFA V;  4QJF B;  1GM7 A;  4MTX A;  4DR3 B;  4O4L B;  4R7C A;  2M7W A;  2PNR A;  1S72 V;  3UT5 B;  4XKA A;  2Q8I A;  5D7R A;  3RKZ A;  4PA6 A;  4EFU A;  5IYZ B;  2N74 A;  2QWR B;  5HFM A;  3CSX A;  3CRK A;  2Q9L A;  4R3M A;  3RN4 A;  3CPW U;  5LMN O;  1Y8N A;  2WLJ A;  2YGA A;  3EHH A;  2R72 A;  3HZ1 A;  1H7U A;  4JI7 B;  3ZN0 A;  2JK5 C;  4TWK A;  2YIB A;  1RM1 B;  3D3I A;  3DTU B;  4CH3 A;  2XX5 A;  4GLX A;  4YKQ A;  5C8Y B;  4CWR A;  5L3F A;  2V7Q G;  1HR0 O;  5C93 A;  3R4P A;  2AW9 A;  4JZ2 A;  1FXV A;  5DED A;  3CRC A;  3FT8 A;  3HKD B;  1NS1 A;  3A2F A;  1CXZ B;  1FFT B;  2EIM C;  1AB3 A;  2AXT Z;  1M56 B;  3AK3 A;  1QZR A;  1M90 W;  4O4I B;  3QO5 A;  3K5L A;  2BSK A;  2QR4 A;  2YGE A;  1ORQ C;  2YKC A;  3PEH A;  3A0X A;  3J81 N;  2RDC A;  3E8G A;  3J7A U;  4J7Z A;  2ADP A;  4D7S A;  2R9I A;  1ZTE A;  1VQP V;  1K8A W;  4U7N A;  1AR4 A;  1THZ A;  3L9D A;  1VQM V;  4X1K A;  1Y4U A;  1JJ2 U;  2Z0A A;  3BAB A;  2AHZ A;  4GCZ A;  1TA8 A;  5LBQ A;  1HNW O;  2XDX A;  2CG9 A;  2UUA O;  2VS0 A;  2BU6 A;  2XND G;  3TXS A;  3SL2 A;  3HKC B;  3STL C;  3ABL B;  4QPJ A;  5IY5 C;  4TUY B;  2DMX A;  1FYJ A;  2UU9 O;  4U3J A;  2B1G A;  3G80 A;  2QM7 A;  5LOV A;  2A0L A;  4ZHQ A;  2WLK A;  1A4H A;  5CBF A;  5K1P A;  1NH2 B;  3IED A;  1KMI Z;  4FFB A;  2A9H A;  4J7K A;  4YKW A;  4YY3 B;  1R3L C;  4RQE A;  1B06 A;  4X1Y A;  5FNV A;  5KUM A;  1FJG B;  1XNQ B;  4FIP C;  1N8R W;  4GEE A;  4LCU C;  4CH4 A;  2B9Z A;  3CE2 A;  4TQD A;  4OPH A;  1PL0 A;  1Q6U A;  5JEN A;  4YIP A;  1HWY A;  2HEP A;  3AG7 A;  4LH6 A;  3WG7 B;  2XD6 A;  3CXC U;  2GQP A;  2CCT A;  3G4S V;  3ASN B;  3OUF A;  2ZBK B;  1Q43 A;  5J71 A;  2RNB A;  2O1W A;  3HYY A;  2EX3 A;  3Q4H A;  2XHB A;  1U96 A;  1HP8 A;  2BTO A;  2BU2 A;  1HNX B;  3D3Q A;  3RYC B;  2PYJ A;  5L3J A;  3ZRS A;  2XAF A;  4EFT A;  2JEX A;  1PV0 A;  1Q8I A;  5EBL C;  4JAA A;  4LWF A;  3IC7 A;  4WBN B;  3B09 A;  2YE9 A;  5KLV H;  4CE3 A;  3QG5 A;  4YHH B;  4JYA B;  2XAG A;  1YI2 V;  1RSO A;  2IH3 C;  1I7F A;  1BZK A;  5IDM A;  2YEV A;  4DV4 O;  1ROP A;  4I5S A;  2YIC A;  3S5T A;  1EM1 A;  5A9G A;  1EZJ A;  3ZHR A;  2ZD9 A;  3JCU Z;  2NNU A;  3OW6 A;  4UV8 A;  5J6A A;  2DYS B;  4HNA A;  5LP6 B;  1MSD A;  3A0R A;  4LBE C;  2VQF B;  4B7E A;  1PL4 A;  4WFB V;  2E76 B;  5D7C A;  1YIT V;  5IJ0 A;  1R62 A;  1P7G A;  1AJQ A;  4PDV A;  1TGO A;  1TUB A;  1H8E G;  2QTO A;  1IBM B;  2OTL V;  4YY3 O;  1WPX A;  1FXH A;  4DV1 O;  3M99 B;  2WI3 A;  4UB8 Z;  1JMK C;  4YKY A;  3ZRW A;  3HKE A;  4YXW G;  5JVD A;  1HW7 A;  5D7D A;  1KU9 A;  1L1F A;  4JI5 B;  5A2Q N;  3WHA A;  3ABK B;  1N32 O;  1ZUQ A;  2RMK B;  3O0I A;  1WA8 A;  4IIJ A;  4DV3 B;  1BMF G;  1KZN A;  5FND A;  1O9G A;  2FWY A;  2XAB A;  3N2G B;  1K33 A;  1G8M A;  1NBM G;  3AG4 B;  2YEB A;  3AG3 C;  4EGH A;  3TUH A;  1SRY A;  1Q5O A;  3K57 A;  3NR7 A;  3B8N A;  5J9P C;  1BGQ A;  4JI6 O;  2NLJ C;  3JD2 A;  2QKS A;  1ZL8 A;  3CCQ V;  3CXH F;  2QKC A;  4KXR A;  3LNU A;  2DOS A;  1XHZ A;  1HNX O;  4CH5 A;  2YI9 A;  5IYC O;  4DR5 O;  3WFV A;  4N21 A;  3SDL A;  1PKX A;  1ARO P;  1Z5V A;  3WU2 Z;  1SA0 A;  3BM9 A;  2LJ2 A;  4W4L A;  1SQX H;  1NQT A;  4EGI A;  2UXC B;  2WEQ A;  4JYA O;  3QTC A;  1MZF A;  4I4T B;  4X89 A;  1US7 A;  2XDS A;  3JAT B;  5FPR A;  4LWS B;  4CC6 A;  3TET A;  4AQY B;  3E35 A;  5CPH A;  2L35 A;  4DV7 B;  2ZR2 A;  1IVS A;  3CCS V;  1S5H C;  2K1E A;  1B63 A;  1W2B U;  2ZXW C;  4BWA A;  5KHJ A;  1FXK C;  5JH7 B;  2IWX A;  4DV2 O;  3C0E A;  1BCC H;  3K04 A;  3OMA B;  4UCT A;  5KHI A;  2WI6 A;  1Q90 D;  2YEA A;  5JJE B;  4YJ2 A;  5CA1 A;  3JAW A;  4DUY B;  5M4E A;  2YKB A;  3E8B A;  2E75 B;  4X9Q A;  4Q6G A;  3KZI Z;  2IOP A;  3FAV B;  5IN9 A;  2WA4 A;  4NXM B;  3E2E A;  1KQS U;  4NH8 A;  2QG2 A;  1W59 A;  5KHK A;  4LF7 O;  4PI0 A;  1GN3 A;  4YKT A;  3N27 A;  2N04 A;  3CRM A;  4LF8 B;  2EIN B;  3KKY A;  2XAQ A;  1YC4 A;  3AEI A;  5CBH A;  5CB4 B;  4ZIB A;  2PTM A;  3OTO B;  1I58 A;  4CE2 A;  5IYZ A;  4QE9 A;  1NH2 D;  2K5B A;  2ZIN A;  1DF5 A;  1P49 A;  1JPX A;  1XI1 A;  5EK0 A;  1IBK B;  2Y69 B;  1Q3E A;  1VQ5 V;  2LP7 A;  3K0D A;  4GKJ O;  2A3Q A;  3CRQ A;  2F1M A;  4RWU A;  4L8J A;  4JV5 B;  3ETD A;  5C8Y A;  2ZKJ A;  4JTD B;  4JI3 B;  2UUB O;  5D5Q A;  3RYH A;  4R3A A;  5LA6 A;  1QY8 A;  1RP3 B;  1GN4 A;  4PRV A;  3U2D A;  4CH6 A;  1HDJ A;  2P4K A;  1NT2 B;  1AJN A;  3AK2 A;  1YER A;  2YSU B;  1L0O A;  4K0K B;  1YCI A;  2W6J G;  4IHJ B;  1BE3 H;  4MVQ A;  4X20 B;  2VWJ A;  4KUM A;  2AZ0 A;  3SPH A;  4MP2 A;  1WLE A;  2H8P C;  5EIB D;  3GIE A;  4O05 A;  3ZM7 A;  3P3P A;  1GJV A;  1YTF B;  3T1Y O;  4MTO A;  3ZMZ A;  2W0X A;  4H85 A;  3FYE B;  1SQG A;  5BMV B;  4O4H A;  4MVM A;  3EXA A;  2QDO A;  3AG2 C;  2UXN A;  4NXM O;  2IW5 A;  4B3S O;  4FLV A;  2GBO A;  2IM9 A;  4E2L A;  4LF9 B;  4MS2 A;  1CP9 A;  4FCQ A;  3ZMU A;  3O6O A;  2EIK C;  3A0W A;  4EEH A;  3R4M A;  1BYQ A;  2EIM B;  2FKX A;  4TUY A;  3H1K H;  1MU5 A;  2YEC A;  4F6R B;  4PHZ A;  2EIL C;  3E89 A;  4X66 B;  3OMU A;  3VQX A;  3KE6 A;  3E22 A;  2HCH A;  5LYJ B;  1Y8P A;  2BTZ A;  2LGQ A;  5JJJ B;  1I94 B;  2AKP A;  1O9H A;  1ZWH A;  3K9A A;  4UVB A;  4V26 A;  4O07 A;  1QHT A;  2QGN A;  4GUN A;  1GM8 A;  5D5P A;  4QNH B;  1VAR A;  4JI0 B;  4DK0 A;  3AG1 C;  4LNU B;  3K59 A;  3UCS C;  1GH6 A;  4LWI A;  4ICG A;  4NKG B;  4FMT A;  2QJ1 A;  5JQG A;  1TAE A;  2YDE A;  4P9P A;  1EI1 A;  4YJ3 B;  2E5L B;  5JWP A;  1TVK A;  5CTY A;  3CCL V;  4L90 A;  2ATK C;  3L75 H;  2OT5 A;  3QNE A;  5LXT B;  1VEW A;  1SS3 A;  4TV8 B;  2YEI A;  3K98 A;  1D2D A;  1SZT A;  1ZX3 A;  1I5D A;  1TBW A;  1R3I C;  3LSU A;  2XDU A;  4DW1 A;  3D8C A;  4MW8 A;  3A0B Z;  1M5I A;  2UXB B;  1XRE A;  3CCM V;  4BIO A;  3TZ2 A;  4EGK A;  3OPD A;  3ETQ A;  1Q6I A;  4NTX A;  4K8Z A;  2FML A;  1V54 B;  2ZE6 A;  4CC5 A;  4QE7 A;  4OGQ B;  1XMO B;  1H2G A;  2VCJ A;  3ABT A;  3MAQ A;  1MSW D;  4WUD A;  1QVG U;  5EBM C;  1YSR A;  1OJH A;  3GB7 C;  3UO2 A;  3F5W C;  3TJT A;  1WB8 A;  1SC5 B;  2MK3 A;  4I3H A;  3N2K B;  1KB9 F;  2XUM A;  4ASA A;  1YT1 A;  1KP3 A;  4IYI A;  5LP6 A;  3FX7 A;  5BOC A;  4DV5 B;  1JFF A;  2ADQ B;  4X66 O;  3RT3 C;  1S5J A;  1ZW9 A;  2CTW A;  3TZ4 A;  5M4H A;  1G1X B;  4CE1 A;  1IX9 A;  2Y0I A;  5IJ9 B;  4JI8 O;  1M9N A;  4X1I B;  2WLM A;  3H1L H;  4D7T A;  3HB3 B;  4UV9 A;  2Q4P A;  1YJ9 V;  5EYP B;  2CCS A;  1GRJ A;  2KG7 B;  1AH8 A;  1WB7 A;  5J2T A;  2IU3 A;  4PU9 A;  2YGF A;  3K5M A;  1FFX A;  1NHI A;  4B3R B;  3MDS A;  4Z2W A;  3ASO B;  2LO1 A;  4XDL A;  4I50 B;  2GTS A;  3PEJ A;  1NKD A;  3NMQ A;  3VQW A;  4G27 B;  4DUZ B;  2XTA A;  4MTF A;  1I5X A;  4LPB A;  1YF2 A;  2BRC A;  2PI4 A;  4MVS A;  1X4T A;  3ZXO A;  3JCZ A;  3UQ8 A;  5LHG A;  2UXB O;  1CEZ A;  5K1X A;  1QCE A;  3L71 H;  2KB1 A;  2EXL A;  1UPG A;  4CBC A;  2E74 B;  3DC6 A;  1YXB A;  1DF4 A;  4BR6 A;  4XKO A;  2M6Y A;  4LFB B;  4H33 A;  2XJJ A;  5CA0 B;  3K58 A;  3TK1 A;  2BYI A;  4UB6 Z;  1S76 D;  2UXD O;  1HNZ O;  1XNR O;  3CYO A;  3JAT A;  5L3G A;  1OCR C;  1LUV A;  2BYH A;  3CGY A;  1GO3 F;  4PJ0 Z;  1OCC C;  2VQE B;  2YS8 A;  3P32 A;  2X7R B;  4O4J B;  5B1B C;  1G4Y B;  2JS5 A;  3TGU H;  1YTF D;  3A0Z A;  2CGO A;  4CWS A;  4HAM A;  2CK3 G;  2JJ2 G;  4NH9 A;  1NU1 H;  3OGI B;  2PZS A;  4FFK A;  1VQK V;  3RYI A;  1EBO A;  4UCS A;  1Q82 W;  1H7S A;  4AHC A;  1NTZ H;  3HPL C;  1TC6 A;  1M1K W;  1H2N A;  1AR5 A;  5GON A;  1JR9 A;  1L8D A;  4LF5 O;  2Q2E B;  1M57 C;  4IYH A;  3TXQ A;  3CCR V;  1OZ0 A;  1VQ6 V;  2Y0P A;  4R1F A;  2WI4 A;  4LWG A;  5CB4 A;  2YC0 A;  2HJD A;  4B3R O;  1FXK B;  2YXH A;  4RO2 A;  4FLX A;  2A7W A;  4DV6 B;  3LMM A;  2BU7 A;  4TOI A;  3OD4 A;  1WJZ A;  4J10 A;  5FL7 G;  3CD6 V;  3W7W A;  2ZDY A;  5CTU A;  3X2Q C;  4DUZ O;  2XK2 A;  2YE4 A;  4UCR A;  2ZE7 A;  3OEH G;  2PGG A;  5M4P A;  3SYP A;  2XAH A;  3ETG A;  2X6C A;  3R92 A;  4NYK A;  3FKS G;  3BHP A;  4TQF A;  3CEI A;  4FLZ A;  4X64 B;  4DR4 O;  4JZG A;  4EB6 B;  2F93 B;  1UYH A;  2Q8G A;  4LFB O;  1RPR A;  2CUG A;  2ZDX A;  2IBZ H;  4KL1 A;  4FCP A;  2F23 A;  1JCH A;  1SF9 A;  4JI4 B;  3FD9 A;  5LMU B;  1UY6 A;  4O2B B;  3H9V A;  4NVP A;  3L74 H;  2ZE8 A;  4DR3 O;  3Q5L A;  3U67 A;  1WP7 A;  2ZT9 B;  3H01 A;  5EBW C;  2YE2 A;  2V1D A;  3QDD A;  1PD3 A;  1IXM A;  3SYA A;  1MOF A;  1XUQ A;  3T0H A;  1UYG A;  2Q7G A;  2H8M A;  2YI6 A;  1VF6 A;  4MPN A;  3EVK A;  5KHG A;  2FYU H;  2CDY A;  2ITD C;  2QA4 V;  3EHB B;  2GTA A;  5H5N A;  1AI7 A;  3SPC A;  1Y76 A;  1JQ0 A;  1IXB A;  3R4O A;  4J9Z B;  2VCI A;  4K4O A;  1I08 A;  5BMV A;  4O04 A;  3BA8 A;  3INW A;  2BOB C;  2Q5Z A;  3M7M X;  3ZHT A;  3P3N A;  4JI7 O;  1YT2 A;  2AGA A;  3QTF A;  1OHH G;  2YEG A;  1EA6 A;  2HLD G;  2YE8 A;  2UUC B;  4BAE A;  2HKJ A;  3BMY A;  2PI5 A;  1A32 A;  2F66 C;  5B3S B;  3H80 A;  3ZXQ A;  4DR7 B;  1DGS A;  1RFY A;  2YK9 A;  1NJI W;  2YKI A;  2K9P A;  4F6R A;  2CGF A;  4O09 A;  1F51 A;  2ODM A;  3OR7 C;  4MVR A;  2BU8 A;  5FWK A;  2Q73 A;  1S16 A;  4UVA A;  3J80 N;  1DTO A;  1X59 A;  4XCL A;  4ZKI A;  3RBZ A;  4X9L A;  4FK5 C;  2PUS A;  1J5E B;  1ZXN A;  1GM9 A;  5KX5 A;  3TZ5 A;  4MVO A;  1K92 A;  2JEU A;  5J2U B;  5HFL A;  5H2F Z;  2WLL A;  3JD4 A;  1N4C A;  3ZHU A;  4LNU A;  3E83 A;  4O2A B;  4X64 O;  1I5C A;  4YKU A;  1Y4M A;  1AI5 A;  2OCC C;  5LL6 Y;  3SPJ A;  1AJP A;  2Q0O C;  3EHG A;  1K4C C;  4WFE A;  1KUQ A;  3K06 A;  4I0X B;  2AZ2 A;  2BCC H;  2LQT A;  3JAS B;  3MHH C;  1KC8 W;  4LC1 A;  3HHU A;  2DW4 A;  2O1U A;  2YUA A;  1XL6 A;  2YJX A;  3SGI A;  4PD4 F;  1QNM A;  4V25 A;  2XAS A;  4UCO A;  3E8H A;  3D0B A;  1JOY A;  1AIL A;  4DR2 B;  4P9O A;  4WFF A;  2ZM6 B;  4MVZ A;  2IWU A;  4H37 A;  2JJ1 G;  4FCR A;  3HEK A;  4J80 A;  1H8H G;  3JAK A;  4ZI7 A;  4H7Q A;  2WI5 A;  3SR2 C;  4J7J A;  1SQV H;  2HKO A;  1S77 D;  2DYR C;  1FJG O;  4WFG A;  2JS3 A;  1XNQ O;  2XHX A;  3SYO A;  2DQ3 A;  3RGB A;  1I59 A;  2KQX A;  3C11 A;  1H2K A;  2EIJ B;  4CWP A;  3CP1 A;  2B1I A;  2QTS A;  4BIZ A;  4LF4 B;  4FM1 A;  1UY8 A;  1VQ8 V;  4XC0 A;  2GUZ B;  4JGS A;  2QWQ B;  4B3T B;  3CRA A;  1UYM A;  1WAZ A;  4OXS A;  4FLT A;  2FWZ A;  4MSW C;  1PVG A;  2YID A;  4JYC A;  1KD1 W;  1QLE C;  4K8X A;  4P7A A;  1KEC A;  4UVC A;  2CH7 A;  3MNR P;  1YES A;  1J5E O;  4PDR A;  1G6U A;  5IJ9 A;  3ZKD A;  2HVJ C;  4BW9 A;  2WPD G;  5LGU A;  1NTM H;  4YHH O;  1N0J A;  1V55 C;  1Y4S A;  1MAB G;  1OCO B;  4YIO A;  4AI8 A;  3RYF B;  1KIJ A;  2XJG A;  1YJN V;  4DW0 A;  1EFR G;  4L8Z A;  4I50 A;  4HY1 A;  3A0H Z;  3K0G A;  3CJH A;  3G6B A;  2DJV A;  2HFE C;  2P67 A;  4OX9 B;  3JYC A;  5IDJ A;  1OCZ B;  4UCU A;  3OMN B;  2GDS A;  2WLI A;  1RM1 C;  2F95 B;  1FKA O;  3ZN1 A;  2EZO A;  1Y67 A;  3SYQ A;  2F4V B;  5ITZ B;  4FLW A;  4AWQ A;  2VQF O;  1SQF A;  3APQ A;  1AP5 A;  2HVK C;  4NH7 A;  2RCV A;  1B04 A;  3F5T A;  1L0N H;  1FS0 G;  3QO7 A;  1UYI A;  4HXZ A;  4MB9 A;  3L73 H;  1S5L Z;  1MNG A;  1M56 C;  1IBM O;  4H0L B;  1F4M A;  1SES A;  3ABU A;  3L70 H;  2WLH A;  2IU0 A;  3JD1 A;  1XBL A;  1GKF A;  2DQ0 A;  4B3M B;  4O4L A;  3G7B A;  4EFB A;  2IJK A;  4PA9 A;  4XKK A;  3UM7 A;  4CWO A;  3UT5 A;  4KHP B;  1N36 B;  4JI5 O;  3P30 A;  2IWS A;  4RUF A;  1GKX A;  1ZWI C;  3IC9 A;  5B1A B;  3RVZ A;  4AIL C;  1Q86 W;  2X6B A;  4DV3 O;  4R6Z A;  1VQ9 V;  4B3T O;  5GW7 A;  1J95 A;  3W7U A;  1CPY A;  1JJO A;  1N33 B;  3GWK C;  4PV1 B;  3EKR A;  2XX4 A;  2LW7 A;  3CGZ A;  1QR9 A;  2GFD A;  1PNM A;  5GGZ A;  3JD0 A;  4L87 A;  5D6Q A;  4X88 A;  2ZE5 A;  3I56 V;  5FLX N;  1XMQ B;  1SER A;  3T10 A;  4GT8 A;  4TSF G;  1YC1 A;  4NTW A;  5E1A C;  3ABL C;  1SZX A;  3CC4 V;  1K5Q A;  4IGG A;  1PNL A;  2UXC O;  3S3X A;  2HG1 A;  4HYP A;  1PPJ H;  3ZRV A;  2BRE A;  2CH4 A;  3HKD A;  5EZY B;  2YED A;  1E1Q G;  4AQY O;  4DV7 O;  3CCU V;  1R6T A;  4MW3 A;  4DK1 A;  1NHH A;  3B8M A;  3FYI B;  4ASF A;  3EHF A;  4HYM A;  4O4I A;  2BT0 A;  4X1K B;  2ZNI A;  4OPA A;  2D3O W;  1Y6X A;  4E00 A;  3ZED A;  2GHY A;  3E86 A;  4WUC A;  4ASB A;  4RAI A;  1S3J A;  5L3D A;  4DUY O;  2F4V O;  2QF6 A;  1Z5W A;  3LSS A;  2AHY A;  1R73 A;  3T1H B;  3ASN C;  4WFH A;  1R6K A;  4LFA B;  1MZE A;  4J9Y B;  2CE4 A;  4UFZ A;  2CTP A;  4U3J B;  1S14 A;  3JSL A;  4LF8 O;  1F4N A;  5LOV B;  4O2B A;  4ZHQ B;  3JSN A;  4B3M O;  3ZBH A;  3ZHQ A;  1VQL V;  5BR8 B;  4NXN B;  1P4R A;  5JJN B;  2BU5 A;  2KKW A;  4FFB B;  3RWR D;  2P7T C;  1AH6 A;  2ITC C;  3HKC A;  3LNM B;  1N36 O;  5IWA B;  3FB7 C;  3OTO O;  1LUW A;  4HZ3 A;  4KFM A;  3WB0 A;  1V9P A;  3E8F A;  2ZCE A;  1N33 O;  1IBK O;  4I55 B;  5BXZ A;  5JCO C;  3W7T A;  2GSM B;  4FZ1 A;  1TC0 A;  4FJC C;  4DR1 B;  4PA3 A;  4LFC B;  2Q68 A;  3VAD A;  4JV5 O;  4CWF A;  4YKZ A;  4E01 A;  5EC1 C;  4XDM A;  3CYG A;  5B5E Z;  2DYS C;  2WAM A;  5LP6 C;  3STZ C;  4JI3 O;  3SYC A;  2CGN A;  5LHH A;  4ZBM A;  3VBB A;  1BL8 A;  3CB2 A;  3GIG B;  1UY9 A;  2RN9 A;  1GN6 A;  3CCE V;  4XIQ A;  1H2L A;  1K34 A;  1K3E A;  2XHR A;  4A5U B;  1R1B A;  3BFR A;  5IY5 B;  3BA9 A;  4JAV A;  4DZY A;  4IT5 A;  1VMG A;  2EUL A;  4K0K O;  4E72 A;  1RSO B;  1GK9 A;  2CAZ C;  1Q81 W;  2YEV B;  2LW1 A;  2Q8F A;  3RYC A;  4EFE A;  4XE2 A;  4JYB A;  2LFR A;  1SQP H;  4LH7 A;  3LDC A;  4X65 B;  4WF9 V;  1FPO A;  1YZB A;  3ABK C;  4WBN A;  2YI0 A;  1GTO A;  2QEX V;  4NR1 A;  5CTX A;  4BAY A;  1ZAU A;  3U0Z A;  1WPB A;  5L3C A;  3AG4 C;  5IT9 N;  1TID A;  1U2O A;  3VHA A;  1VQN V;  3W7S A;  4HNA B;  3JAS A;  4JI2 B;  4LFA O;  1LR1 A;  5FPO A;  2UXX A;  1QR8 A;  1I0H A;  5JCO A;  3BVO A;  1KKC A;  3HR0 A;  4LF9 O;  1YIJ V;  1WNS A;  5B1O A;  1UYF A;  2Q0A A;  4HZ0 A;  4PA7 A;  4URN A;  2YI7 A;  3A8T A;  1TUB B;  1M93 A;  2W6I G;  3LNN A;  1VQ4 V;  3D2R A;  1Q6H A;  5IWA O;  4GFN A;  4J11 A;  3C3T A;  5E79 Z;  1AJ6 A;  3LDD A;  3ZRW B;  3HKE B;  4XIP A;  1VQO V;  2ETN A;  5JVD B;  4GX2 A;  1I94 O;  3LUT B;  1R3K C;  3ML0 A;  1D5A A;  2WLN A;  3LPS A;  1Y66 A;  3TCU A;  1WA8 B;  4IIJ B;  1K97 A;  4F4L A;  4L91 A;  2OIG A;  2JRI A;  4JI0 O;  4KQV A;  2JKI A;  5LMN B;  1K9M W;  4TV9 B;  2FYP A;  3DGE A;  3RLR A;  1EN4 A;  1KYO F;  1NTK H;  2YIB D;  1ZL8 B;  2E5L O;  4I9W A;  3ZJZ A;  5B1N A;  2OWO A;  1I5Y A;  3ABM C;  2LFS A;  3OGC C;  3G71 V;  4ZOL B;  2Q8V A;  3N2G A;  2IOR A;  1QVF U;  3SJA C;  2YXL A;  4LWE A;  4XDJ A;  1ZLZ A;  4J41 A;  2Q6A A;  2OYQ A;  1US6 A;  2QM4 A;  4UUJ C;  2YK2 A;  3F7Y C;  2Y48 A;  3CRL A;  3VQY A;  3FT5 A;  1ZSP A;  1UJW B;  2YI5 A;  3T0Z A;  1NR7 A;  1EZV H;  4JAU A;  4K35 A;  2P5O A;  4I4T A;  3I55 V;  3CME V;  2DYR B;  1XMO O;  1S0V A;  4B6C A;  4LWS A;  4YJ2 B;  4XDK A;  1IDS A;  4PI2 A;  4X8A A;  4HY6 A;  3ZX6 A;  3OM3 B; 
#chains in the Genus database with same CATH homology
 4GT1 A;  1NJI W;  5KA6 A;  5CMU A;  1BHA A;  3LDE A;  1F51 A;  3OR7 C;  4MVR A;  1BHB A;  4BIU A;  1YHQ V;  4UVA A;  1DTO A;  1K5S A;  2XOK G;  4ZKI A;  3RBZ A;  3AG3 B;  4FK5 C;  3E8B A;  2H94 A;  1GM9 A;  1QLE B;  1W0J G;  2WLL B;  3BEH A;  3MD0 A;  4MVO A;  1K92 A;  1KKD A;  3K79 A;  2JEU A;  3FB6 C;  3E2E A;  1KQS U;  3PJS K;  5HFL A;  3T4Z A;  5KUK A;  2Z5U A;  2WLL A;  3JD4 A;  5H6Q A;  3T1C A;  3E83 A;  3ZCC A;  4HYO A;  1Y4M A;  1PNK A;  2EIN B;  1AI5 A;  2OCC C;  1F23 A;  2EIJ C;  2QE7 G;  3SPJ A;  1AJP A;  3SPG A;  2XAQ A;  3CC7 V;  1K4C C;  4WFE A;  3K06 A;  3AEI A;  1V55 B;  5CBH A;  3MHH C;  3SPI A;  2IJH A;  1VQ7 V;  4QE9 A;  1NH2 D;  1KC8 W;  3QO8 A;  4LC1 A;  4PDL A;  2DW4 A;  1XL6 A;  2ZXW B;  1DF5 A;  2XAS A;  1B6Q A;  1JPX A;  2EJR A;  5EK0 A;  3E8H A;  1JOY A;  3ETE A;  3NXS A;  2Y69 B;  4MVU A;  5EC2 C;  1VQ5 V;  2LP7 A;  4P9O A;  4WFF A;  3GWO A;  2ZDI A;  3K0D A;  4MVZ A;  1MG1 A;  4H37 A;  2JJ1 G;  2HJF C;  3OMI B;  3ETD A;  3KG2 A;  1H8H G;  1OCO C;  4JTD B;  4ASU G;  1Q7Y W;  2HKO A;  3ZRX A;  1S77 D;  2DYR C;  4WFG A;  4GX0 A;  3SYO A;  4PEL A;  2DQ3 A;  5IYB O;  3CCV V;  1OCZ C;  5L3E A;  2OCC B;  2EIJ B;  3CP1 A;  1AJN A;  2B1I A;  4BIZ A;  3OW2 U;  2YSU B;  3IFX A;  4PDM A;  5KA5 A;  1VQ8 V;  1H38 A;  2W6J G;  4JGS A;  4MVQ A;  3K08 A;  1COW G;  3EFF K;  4KUM A;  3SPH A;  4P2Z A;  4DXW A;  1WLE A;  3OFN G;  1E79 G;  2H8P C;  4OXS A;  4MSW C;  4JYC A;  1KD1 W;  1QLE C;  3RVY A;  5H6R A;  5LHI A;  2X6A A;  1KEC A;  2P90 A;  4UVC A;  1YTF B;  2P6J A;  1LNQ A;  3F7V C;  4MTO A;  4PA4 A;  3ZMZ A;  3FYE B;  4PDR A;  4LP8 A;  4MVM A;  1JVM A;  3FB8 C;  2EIN C;  2HVJ C;  3AG2 C;  2UXN A;  2WPD G;  4U7O A;  5LGU A;  2IW5 A;  3T2M A;  1KP2 A;  5DM6 V;  5LGN A;  1K73 W;  3ZIA G;  4JTA B;  1V55 C;  2B5U A;  4DO2 A;  3B77 A;  4E2L A;  1MAB G;  4MS2 A;  1OCO B;  1CP9 A;  3R65 A;  3ZMU A;  3UKM A;  1YJN V;  2EIK C;  5B1A C;  1K4D C;  3W7X A;  1EFR G;  2DWD C;  1XL4 A;  2WLI B;  3K0G A;  2EZP A;  2EIM B;  2HFE C;  2P67 A;  2EIL C;  3JYC A;  1YJW V;  2Y69 C;  3E89 A;  5IDJ A;  1OCZ B;  3OMN B;  1TUE B;  2WLI A;  1V54 C;  1RM1 C;  3OAA G;  3JD3 A;  1NR1 A;  3ZN1 A;  2EZO A;  3SYQ A;  4RUE A;  1K7D A;  2EBO A;  3K9A A;  4UVB A;  3RW0 A;  3OEE G;  1GMG A;  1GM8 A;  1AI6 A;  4QNH B;  2HVK C;  3D36 A;  4CZZ A;  5CBG A;  3AG1 C;  5L3B A;  3QO7 A;  1FS0 G;  4MT8 A;  3OM3 B;  1NVP B;  1W0K G;  4FMT A;  4WFA V;  2W0F C;  1GM7 A;  4MTX A;  4P9P A;  4QJF B;  1M56 C;  3LSQ A;  4R7C A;  1F4M A;  1SES A;  2M7W A;  3ABU A;  1S72 V;  2WLH A;  2IU0 A;  3ZMT A;  3JD1 A;  4PA6 A;  1GKF A;  2DQ0 A;  3AG2 B;  3CCL V;  2ATK C;  3QNE A;  2OT5 A;  5HFM A;  4WCE V;  2IJK A;  4PA9 A;  3UM7 A;  1SZT A;  1R3I C;  3P30 A;  4RUF A;  1ZWI C;  4RQF A;  3CPW U;  4MW8 A;  2EIK B;  5B1A B;  3RVZ A;  4Q20 A;  1Q86 W;  2X6B A;  5LGT A;  4R6Z A;  3CCM V;  1VQ9 V;  2WLJ A;  5GW7 A;  1J95 A;  3W7U A;  4MTG A;  1CPY A;  2EIL B;  1QR9 A;  2JK5 C;  1PNM A;  4QIW F;  3JD0 A;  4TWK A;  1V54 B;  3ZN0 A;  4L87 A;  1RM1 B;  4QE7 A;  3D3I A;  3DTU B;  4X88 A;  3I56 V;  2IJJ A;  2WSS G;  1H2G A;  5L3F A;  2V7Q G;  3ABT A;  1SER A;  5C93 A;  1MSW D;  4JAS A;  4TSF G;  3ASO C;  1QVG U;  5EBM C;  5E1A C;  1FXV A;  3ABL C;  3GB7 C;  3F5W C;  3CC4 V;  1K5Q A;  1PNL A;  3AG1 B;  2DWE C;  2MK3 A;  3ZRV A;  3OE7 G;  1FFT B;  2EIM C;  1M56 B;  1M90 W;  1E1Q G;  3QO5 A;  4TT3 G;  3CCU V;  2Q67 A;  1ORQ C;  4MW3 A;  1KP3 A;  3B8M A;  1AI4 A;  3FYI B;  3E8G A;  2D3O W;  2R9I A;  2GHY A;  3E86 A;  1VQP V;  1K8A W;  4RAI A;  2IH1 C;  1S3J A;  4FPP A;  1RPO A;  1THZ A;  4U7N A;  5L3D A;  1VQM V;  4GX5 A;  5CA3 A;  1M9N A;  1JJ2 U;  4P30 A;  2WLM A;  3LSS A;  2AHY A;  1R73 A;  3HB3 B;  5CN0 A;  2AHZ A;  4GCZ A;  4UV9 A;  1YJ9 V;  5LBQ A;  2JIZ G;  3ASN C;  2BOC C;  4WFH A;  1AR1 B;  1R6K A;  2IU3 A;  4J9Y B;  3CMA V;  4R50 A;  2XND G;  3ASO B;  4XDL A;  1F4N A;  3STL C;  3ABL B;  1NKD A;  4QPJ A;  5IY5 C;  1VQL V;  4G27 B;  1P4R A;  2B1G A;  1I5X A;  4MTF A;  2P7T C;  3SJQ C;  2ITC C;  2QM7 A;  2A0L A;  3LNM B;  2PI4 A;  2WLK A;  3FB7 C;  1ENV A;  4HZ3 A;  4MVS A;  5CBF A;  1NH2 B;  3JCZ A;  4KFM A;  5LHG A;  3G6E V;  4JF3 A;  2A9H A;  1CEZ A;  2FTK A;  3E8F A;  1QCE A;  2Q69 A;  2KB1 A;  4N23 A;  1R3L C;  4CBC A;  4RQE A;  5KUM A;  1DF4 A;  4EKW A;  4H33 A;  3W7T A;  4FIP C;  2GSM B;  3TK1 A;  1N8R W;  1S76 D;  4FJC C;  4LCU C;  4PA3 A;  2Q68 A;  3VOU A;  2IJI A;  3CYO A;  2XAJ A;  1PL0 A;  2R9R B;  1OCR C;  2WWW A;  5EC1 C;  5L3G A;  1HWY A;  2DYS C;  1GO3 F;  2WAM A;  3CCJ V;  3STZ C;  3WG7 B;  4BW5 A;  1OCC C;  3SYC A;  3CXC U;  3G4S V;  5LHH A;  3ASN B;  2HG5 C;  3OUF A;  4ZBM A;  5H9C A;  3VBB A;  1BL8 A;  3K3W A;  3T4D A;  3P32 A;  2X7R B;  5B1B C;  1G4Y B;  3CCE V;  1YTF D;  4HAM A;  1K34 A;  1K3E A;  2CK3 G;  3ABM B;  5IY5 B;  2JJ2 G;  3ZRS A;  2XAF A;  4JAV A;  2JEX A;  5EBL C;  1GK9 A;  1Q81 W;  3IC7 A;  2YEV B;  1VQK V;  4QPK A;  3FB5 C;  4JYB A;  2XAG A;  1QLN A;  1EBO A;  1YI2 V;  2LFR A;  4WF9 V;  3LDC A;  1Q82 W;  3ABK C;  2IH3 C;  2ZR3 A;  2YEV A;  2OTJ V;  3HPL C;  1M1K W;  1GTO A;  2QEX V;  4G28 B;  1JX9 A;  4BAY A;  1ROP A;  4I5S A;  1M57 C;  3CCR V;  5L3C A;  3AG4 C;  1OZ0 A;  2ZQM A;  4G2K A;  1VQ6 V;  1EZJ A;  1VQN V;  3W7S A;  2ZD9 A;  1FXK B;  2UXX A;  1QR8 A;  4RO2 A;  2A79 B;  1P7B A;  2NNU A;  4R8C A;  4UV8 A;  1OCR B;  5FL7 G;  1YIJ V;  2DYS B;  3CD6 V;  3W7W A;  5B1O A;  3A0R A;  3OUS A;  1OCC B;  1FXK A;  3K03 A;  4LBE C;  4PA7 A;  3X2Q C;  4WFB V;  2X0L A;  2W6I G;  1YIT V;  3OEH G;  1VQ4 V;  5DN6 G;  3SYP A;  2XAH A;  3ETG A;  5B1B B;  1AJQ A;  2X6C A;  4PDV A;  1NVP D;  4Z1M G;  1E1R G;  2JDI G;  1H8E G;  2QTO A;  3FKS G;  4KP4 A;  3LDD A;  2OTL V;  1DLB A;  3ZRW B;  1WPX A;  1VQO V;  1FXH A;  4GX2 A;  4UXN A;  3LUT B;  3M99 B;  1R3K C;  3ML0 A;  2WLN A;  1RPR A;  1Y66 A;  3TCU A;  3ZRW A;  1K97 A;  4GX1 A;  4YXW G;  4F4L A;  5B3S C;  1L1F A;  3ABK B;  1JCH A;  4JPR A;  4XBF A;  3WG7 C;  2F43 G;  1K9M W;  3CC2 V;  3IGA C;  3DGE A;  1BMF G;  1M57 B;  2Z3Y A;  1K33 A;  1QBZ A;  1G8M A;  1NBM G;  3AG4 B;  3AG3 C;  3H01 A;  1SRY A;  4I9W A;  5EBW C;  5B1N A;  3ZJZ A;  2V1D A;  3B8N A;  5J9P C;  1I5Y A;  3ABM C;  1PD3 A;  2NLJ C;  3JD2 A;  1IXM A;  2QKS A;  2LFS A;  3SYA A;  1MOF A;  3CCQ V;  3OGC C;  3ZMS A;  3G71 V;  3MHS C;  1QVF U;  5IYD O;  1R3J C;  5IYC O;  3WFV A;  4N21 A;  3ZMV A;  1PKX A;  3X2Q B;  1ARO P;  2ITD C;  4XDJ A;  2QA4 V;  3EHB B;  2C2A A;  1NQT A;  1YSC A;  1AI7 A;  2Q6A A;  3SPC A;  1JQ0 A;  4UUJ C;  4J9Z B;  3F7Y C;  2Y48 A;  2BOB C;  5BZB A;  4X89 A;  1UJW B;  1NR7 A;  3TET A;  1OHH G;  3E35 A;  3BY6 A;  4JAU A;  2ZR2 A;  3CCS V;  1S5H C;  2K1E A;  1W2B U;  2HR3 A;  2HLD G;  2ZXW C;  3I55 V;  3CME V;  2DYR B;  2ZDI C;  1FXK C;  1S0V A;  1SET A;  4JTC B;  4XDK A;  2PI5 A;  4X8A A;  3K04 A;  3OR6 C;  5B3S B;  3OMA B;  1R6N A;  2QM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...