1IXMA

Crystal structure of spoob from bacillus subtilis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
168
Chain Sequence
SDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDIMRFEITSHECLIEIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formation of a novel four-helix bundle and molecular recognition sites by dimerization of a response regulator phosphotransferase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords PROTEIN (SPORULATION RESPONSE REGULATORY PROTEIN)
total genus 56
structure length 168
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
A PF14689 SPOB_a Sensor_kinase_SpoOB-type, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ixmA01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 1ixmA02
4JAUA 4JAVA 3A0RA 4MTXA 4FMTA 5B1OA 5IDJA 3P32A 2QM7A 4QPJA 4JASA 4JYCA 5C93A 3ZRWB 4U7OA 1F51A 3TK1A 2LFSA 4QPKA 2QM8A 4GT1A 1IXMA 4ZKIA 3NXSA 4BIZA 3DGEA 3D36A 4Q20A 5B1NA 3MD0A 3ZRVA 4I5SA 4KP4A 4FPPA 4U7NA 3ZRXA 1JOYA 2FTKA 4LC1A 3ZCCA 4JYBA 3ZRWA 2WWWA 2C2AA 4GCZA 4MT8A 2P67A 2LFRA 4BIUA
chains in the Genus database with same CATH superfamily
5C8YA 4WUBA 1AP5A 2QR4A 3OUFA 1S5LZ 1YT2A 5DN6G 1RSOA 2YI6A 1QVGU 4I55A 1FAFA 4JI6O 2WLHA 3JYCA 4XCJA 3FX7A 1I5DA 4DK1A 1I7FA 4K35A 2ODMA 4MW8A 3EKOA 3HYZA 4PL9A 1F7YA 2YI7A 1HW7A 2IW5A 4UCSA 2ZINA 2CTRA 1QYEA 4YJ3A 1UYEA 2HFEC 3O0IA 3G7BA 1UY6A 2YIDA 3F7VC 3O65A 1KD1W 5C93A 1OJHA 3WHAA 1Q3EA 4P9OA 4QPKA 1QU7A 2JDIG 5K1PA 2YEFA 2A3QA 5BXZA 1VEWA 5BZBA 2EIJC 1TC6A 4CWPA 2LP7A 2QKSA 1SKVA 3K0DA 4MPCA 3SPJA 1YVWA 4I55B 5JJNB 4NXNB 3G75A 4JI0B 4EM7A 3SYAA 4YXWG 3ZBHA 3H1IH 1IX9A 4HZ5A 3GIEA 1ZUQA 5CBGA 4QE9A 2KG7B 2LFSA 4I4TA 1BE3H 4GX5A 2DE0X 2XX4A 4GKJB 5LHHA 2LW1A 4E4EA 4EB6B 4O4IA 2AXTZ 2Y48A 5JJJB 5LHIA 1D2DA 2JIZG 1ZAUA 5LBQA 1BXDA 2LW7A 1ZWHA 4XITA 3K5MA 5CBHA 1I5CA 1GM7A 3CCMV 1EZVH 4FLTA 4HNAB 1HP8A 2ZDXA 2EXLA 4LH6A 1GJVA 3B8MA 5IDMA 5EC2C 1MSDA 4I0XB 4JZGA 2Q8GA 3R91A 3A0TA 1KP2A 2Q73A 3CC2V 1BKNA 4EGIA 1I0HA 3QG5A 1Q6IA 2BTQB 4RQFA 3B09A 3ZMZA 1I5YA 2WLJA 1Q90D 2VWJA 5B1AC 2YKBA 2OIGA 2H8MA 4JZ2A 1E1QG 2YKEA 2UXBO 5M4KA 2WEQA 4R3AA 3JAMN 4UCUA 1FJGB 3APOA 4FLWA 4RWUA 5CB4B 1BCCH 2Y69B 2HKJA 2HLDG 3EHFA 3JD3A 2JGDA 5LHGA 3E8GA 2W6JG 2YS8A 5CTWA 2Q6AA 1XUQA 2IJKA 5HFLA 2P90A 3SPHA 4UB8Z 3GWOA 5L3EA 2A9HA 1UPGA 1H7UA 4I50A 2PNRA 1VF6A 1S77D 4W4LA 3R92A 5IN9A 4PA9A 2PYJA 3UCSC 4WFAV 5FNCA 1V54B 1TUBB 4X9QA 2Q5ZA 3FFQA 5JQGA 3K5LA 1US7A 5KHIA 5FNDA 1Y74B 4NXNO 2VWKA 4EFUA 1TILA 4EEQA 3RN4A 1Y6XA 5M4EA 2Q8FA 3OT7A 1PNMA 4O4HB 4O4HA 4CS2A 1R1BA 2F95B 1Q43A 1UYMA 3FV5A 3CCEV 1V9PA 2IOPA 4LF8O 4TV9B 1BQZA 4NVPA 3Q5KA 2UXCB 2DMXA 2K1EA 2Q2EB 1JR9A 4HXWA 5KX5B 1M57C 4TV8A 3K59A 4NXMB 4I50B 4PI2A 4WBNA 2BCCH 4JI8B 4DV4B 1AR1B 2P5OA 1H38A 5J9PC 2F4VO 2XDSA 4MB9A 3K97A 2QDOA 5KUKA 5FNVB 4H13B 3RYHB 1SRYA 1GO3F 1SQGA 3CRMA 1Y76B 3CYGA 4LP8A 3U67A 4JTAB 1R3LC 5CB4A 4W4KA 2G38A 4B3TB 1Z5AA 3M7MX 1BMFG 4URLA 1AB3A 2WLIB 2YIBD 3WU2Z 3K58A 1GN4A 5EZYB 2XDUA 1OZ0A 4DV5B 4LR3A 2XAGA 3UT5A 1KQSU 1WPBA 2UUCB 2YEGA 4JYYA 1NTZH 4DR1B 1VQ7V 1G4YB 1K9MW 4HZ3A 2RDCA 1JPXA 1Z5CA 1R73A 4TQDA 2JJ2G 3E8BA 1NH2D 2YKJA 1N34B 2XDKA 1AP6A 2AGAA 4JAVA 3HKCA 2IWUA 2VW5A 1WP8A 2Z3YA 1XMOB 3AG4B 4MOTA 4KUMA 3G67A 4E2LA 5C8YB 3C3TA 4EKWA 3QO5A 4CS4A 1DLBA 1K7DA 3LDEA 4DR2O 1NZ6A 2YXLA 3EXAA 4K0KB 2Q7GA 1VQOV 1UJWB 3INXA 3F7YC 3CRCA 2WLKA 5DM6V 2QTOA 1RPOA 4YKXA 2N74A 5IJ0B 3BPZA 2QG0A 4R1FA 2VQEO 3IEDA 4CWTA 1R6KA 4AI8A 5ITZA 2V4DA 3SPIA 1HNZO 4AQYB 3AK2A 1ORQC 1WPXA 3RW0A 3RLRA 4YKYA 1FFXA 2JGUA 3JAKB 1MA1A 4XDJA 3ZRWA 1RM1C 3CWBH 3TXQA 2HP8A 3P3PA 1XQ8A 2WI6A 1B06A 3B27A 4O09A 1ZL8A 3CXCU 2HJFC 3CHXA 1GKXA 4U7OA 3CP1A 3JCUZ 5TISZ 4P8OA 2YGAA 4AHCA 3RVYA 4UXNA 3IC7A 4FM0A 1YI2V 2XDLA 2B9ZA 2XASA 4LWIA 2WI2A 2JJ1G 2IJIA 3B40A 2F4VB 2BRCA 1JA8A 2EILC 2YI5A 1AJQA 3ZMUA 2CCSA 3TETA 3A0RA 2Q8HA 5DECA 1F23A 3RFRA 3ZRSA 1XL6A 4IIJA 1U97A 3WG7B 1B04A 2V1DA 5LGUA 1LUWA 2CGFA 4H44B 1SQXH 3R4NA 4BQGA 3LDCA 1L0NH 4DR6B 1XI1A 4L90A 1Y74A 2UXXA 1JOYA 4EGHA 2Q69A 2A06H 2O1UA 4P9PA 2W6IG 3CC4V 4GCZA 3AG4C 2UUAB 4CWRA 1MMMA 5JH7A 1M90W 1N36B 1QR8A 1UYHA 4LF4O 4UCVA 4OX9B 4DUHA 1SERA 1K4DC 1YHQV 3FT5A 1IBKO 3BCCH 4FPPA 3CX5F 3JARB 5KAFZ 5IY5B 4B3MO 5A2QN 4CWOA 3UM7A 1YC1A 4TOIA 3QTFA 1LUVA 4HAMA 1MOFA 5IYDO 1NQTA 2CCTA 4TV9A 2LJ2A 3MDSA 5LA6A 2JJCA 1LR1A 2YE6A 3FT8A 1G6UA 5B66Z 3W7TA 4DXWA 3GB7C 3JALB 3VBBA 2XOKG 4L94A 3CE2A 2IBZH 1HNXO 2BOBC 4FFKA 4KFMA 4DV1O 1HNWO 4FVMA 2C2AA 1M56C 2LFRA 4OXSA 2WI7A 1KU9A 3IFXA 5E1AC 4BW5A 3BY6A 3JATA 3AG3C 1F51A 1CP9A 1AJ6A 1VQKV 3N27A 4NXMO 2VS0A 2YICA 1PNKA 3SL2A 4Q6GA 2EIMC 3CJHA 4MTOA 4NYKA 1PD3A 2EILB 5KA5A 3CRAA 4MS2A 1Y66A 2ETNA 2EINC 2D2CB 4O4IB 4UB6Z 2CH4A 3DXRA 1KUQA 3E2EA 2BREA 1H2GA 1EN4A 1F4NA 5KA6A 5BR8O 2YECA 1KIJA 3WG7C 2YEAA 5D7CA 4WFBV 1SA0A 1NHJA 1K4CC 3NMQA 3J81N 4CC5A 1S0VA 4TUYB 4UCTA 4DR2B 3H1HH 1SQFA 3ZM7A 5IJ9A 3ETEA 1Q82W 3R65A 4GQTA 1WLEA 2YC0A 1OV9A 1AM1A 3VHDA 3AEIA 3ZHQA 4YKUA 3CRQA 3QO8A 3X2QB 4MPEA 4P7AA 1L0LH 2QM4A 3B24A 1RM1B 2ZE6A 4JI3O 4LH7A 5EIBC 3K3WA 1D5AA 2F93B 1YESA 1J5EB 1N0JA 4O4JA 2XABA 4TSFG 4H81A 4B3SB 1XNQO 4GKKB 1W0JG 4BAEA 1R6NA 1P49A 2RN9A 4GX2A 1PP9H 1Y8NA 3K99A 5CA1B 1B6QA 4LC1A 1UYDA 2UUAO 2UXBB 3PEHA 1M4UA 3K98A 4CWQA 3STLC 1N36O 5JH7B 4DV2B 2MW2B 3ZMVA 3T4DA 1N32B 4JV5B 3CD6V 5LP6B 1UFIA 4NTYA 3NXSA 1DF4A 2Z5UA 3B77A 2AW9A 4V25A 2XUMA 3BRCA 1SQVH 3MAQA 4YKTA 1H2LA 2CH7A 3HR0A 1GM9A 5JCOA 5LMNB 1FXKB 1THNA 4PD4F 1OSFA 3MHSC 1THZA 3ZMSA 1NR7A 1Z5VA 4R8CA 3SJQC 1Q6UA 2UXDB 1R3JC 2YEDA 3L75H 1MG1A 2WLLA 3W7WA 4CE1A 3CS5A 3B8NA 1YS3A 3FB6C 3ZN0A 1S76D 1OCOB 4BW9A 2K5BA 2XNDG 3BABA 2VQFO 5GGZA 3N2KB 4O2AA 3M99B 3EHHA 4FM2A 4FIPC 2JS5A 2P67A 2ZDIA 2F23A 3QNEA 2W0XA 5EIBD 3ZHUA 5IDJA 4QIWF 1N8RW 1ROPA 1GM8A 3RYCA 3C11A 2XAFA 3CCVV 3L72H 4OPHA 2AZ2A 4RAIA 4YJ2A 4D7SA 3OTOB 2PTMA 4DR5B 1P4RA 1Y4SA 5CPHA 1O9HA 2EZPA 1QBZA 4ASGA 3U2KA 2QKAA 4FLVA 3I55V 5D6QA 4IIJB 2FKXA 1YSRA 4FLXA 3TTZA 1M56B 4CWFA 1P7GA 1J5EO 4GT8A 2BU8A 1KC8W 4JTDB 5L3DA 4JI5B 1Z5WA 1YC4A 2BZ5A 1LNQA 4LNUB 1TUBA 5HFMA 2EIKB 4J7ZA 4XDMA 2FWYA 3OGIB 4X20B 2EIMB 3ASNC 3OUSA 4FCQA 2CUGA 4KQVA 2AZ0A 1ENVA 3K79A 3E8HA 5M4HA 1NKDA 4NH7A 3DC6A 1FXVA 2L6LA 4GEEA 2YEIA 2CGNA 2JGDB 3OAAG 5LGTA 4DR7O 1JQ0A 1GK9A 1COWG 3T1HB 4GT1A 1E1RG 3A0YA 5KHGA 1CEZA 4LCUC 4LWSA 2YEVA 1QR9A 1W0KG 2ZNIA 2ESAA 2HVKC 4G28B 3L9DA 2QF6A 5CN0A 4X66O 2WLLB 2FXSA 4X1IB 1AI6A 3TZ2A 1I94O 4UVCA 1KYOF 1MABG 1FPOA 3CYOA 3CCLV 4MVRA 3P32A 5FNVA 3T0ZA 4JI2O 1IBMB 3AK1A 3K9AA 3KCYA 1NJIW 5J2UA 3M8AA 3RYFA 1XL4A 2E3CA 3ZRXA 2YK2A 2Q8IA 4IYIA 4DV0B 5D7RA 1PM9A 2BTZA 4QNHB 4JI2B 4MVMA 1QVFU 2GTAA 4YHHO 4JI0O 1R62A 4JYCA 4JGSA 4NTXA 2C1IA 3GWKC 4F6EA 4CH6A 3E8FA 5EBWC 4I9WA 2E74B 1XNRO 3G6BA 4GLXA 1PL0A 1AH8A 1YZBA 1HNWB 4I7ZB 3R4OA 4O4JB 3HKDA 4UUJC 4XC0A 4O4LB 4KXRA 2CAZC 4Z2WA 2BTOA 4JYAB 2WLMA 1FXKC 1VQ5V 2UUBB 3UQ8A 4LFCO 4HBNA 3ASNB 4J7KA 3B4SA 2QEXV 1KB9F 4JI4O 2ZT9B 1UYLA 2Q67A 2FYUH 4ZI7B 5D5PA 3SGIA 4XDLA 2BU2A 4PDVA 2WI5A 4LF7O 1X59A 3T2SA 5BY1A 4K4OA 3IAYA 2CCUA 3VHCA 4DRXA 4J10A 2PF4E 3ABMC 3ZKBA 5LOVA 3B28A 4B3RO 1JJOA 3CCJV 4JI3B 2LQTA 2XX5A 4X66B 1HWYA 1I08A 1XMQB 4J9ZB 2OT5A 3EVKA 1HR0O 1Z59A 5H2FZ 2IJJA 4JYBA 4HNAA 5LMNO 4BAYA 3DTUB 3ZN1A 1A4HA 5KAIZ 4L91A 3P3NA 1OCZB 3JAWB 3N2GB 3H4LA 4DR6O 1I59A 5LMUB 1SZXA 3TZ4A 4JV5O 1HR0B 4K3AA 1TBWA 3D0BA 2XAJA 4FCPA 4DR4O 3ETGA 5AG2A 3G7EA 1GTOA 1KBHA 2M6YA 1JFFB 1K8AW 3D3IA 1AR4A 4MVOA 2QSAA 1K5QA 2GUZB 3L73H 3ABTA 2Q8VA 1XOUA 2EBOA 2GV9A 1I58A 2IH3C 2IH1C 4JI5O 3S3WA 3K57A 1YSCA 1G8MA 1US6A 1Q81W 2K9PA 2CG9A 2CTWA 3ZHVA 4KTNA 1H7SA 3T0HA 2VWCA 4MPNA 5EZYA 2YEJA 4E72A 2E75B 1YIJV 1RPRA 4LFBB 1FKAO 1ZL8B 4OX9O 2ZKJA 3N2KA 2YUAA 5LA6B 2UUBO 4TUYA 4ZIBA 2IU0A 3L71H 3K08A 5DEDA 2RMKB 3Q4HA 5GONA 4R50A 2PI4A 1XHZA 2PI5A 1G1XB 5IT9N 3ASOC 5FNFA 1AR5A 4B3RB 2JKIA 1GN6A 4P30A 4LF8B 3HEKA 1TH8A 5M4PA 2ZIMA 2EIKC 3RKZA 2YXHA 1ZTEA 3H1JH 4LF7B 2WWWA 3ZHRA 5J6AA 4XDKA 1P7BA 3THOA 4BQJA 5KX5A 4Z1MG 3R4MA 3PEJA 4B08A 3E22B 1PNLA 3H9VA 4CE3A 5B1NA 5JVDB 5CA0A 4R7CA 3T4ZA 2BSMA 1S5JA 4XKAA 3ZXQA 1XBLA 3APQA 1NVPD 2BU7A 2GFDA 2HG5C 5L3FA 1I5AA 1CPYA 1OCZC 1K5SA 3QO7A 2X6CA 4KFGA 3S3XA 4H33A 1EFRG 2LO1A 4J9YB 3H1LH 4LFAO 4URMA 2ZM6O 3GIGA 4PA4A 3EFFK 1YEWA 4ZOLB 3JAKA 5EK0A 4X1IA 3ABLB 4IT5A 1K92A 1XMQO 2ZBKB 3BM9A 4HY6A 2DW4A 1Q86W 4DV6O 5B5EZ 5IY5C 4G2KA 1SS3A 2BU5A 1NTKH 1JX9A 5CMUA 1M1KW 4UROA 1NT2B 2YKIA 4H7QA 4X1KA 2BYIA 4J11A 4UVBA 4CE2A 3OMUA 1H2SB 1URFA 2VRZA 3ZX6A 1NHHA 1IBMO 2OIEA 1NR1A 3Q5JA 4LF4B 2ZR2A 3ZMTA 3A0ZA 1VQLV 2YEVB 2JEXA 2F66C 1VQMV 4C7UA 3VADA 2BSKB 1QLEB 2GBOA 3JD0A 4FFBB 1WJZA 3GIFA 3LPSA 4PV1B 3BVOA 3OM3B 1SC5B 1OHHG 3JZ3A 1ZXMA 3MNRP 3JATB 3R66A 2O1WA 1SQBH 3TJTA 4O4LA 4JAAA 2E5LO 1N32O 2YEEA 2YGFA 1W59A 2QWNB 4MTFA 1W2BU 2EINB 4RUEA 4D7TA 2QJ1A 2YE3A 3CMAV 3RVZA 1K73W 1VQ8V 1PVGA 3KZIZ 1IVSA 3CEIA 4O2AB 4XIRA 4MW3A 5JQGB 2LGWA 3KG2A 2JS3A 3H01A 4CWNA 3CCSV 3OPDA 1EA6A 4IHJA 3O2FA 1WAZA 1JJ2U 2UUCO 1Y76A 4MVUA 4CWSA 3ETQA 3T1YO 5GTIZ 3X2QC 5H6RA 2KKWA 4IYHA 4WBNB 2H55A 1EN6A 1KZNA 5IJ9B 4ZVIA 1JVMA 2P7TC 3AG2C 4WFHA 4MVQA 5IYBO 1SA0B 2B1IA 1K33A 3FB7C 1AILA 4KHPB 5LP6A 2P6JA 4K0KO 5D7DA 1IBLO 2FMLA 4PDRA 4DV3B 4MT8A 2HHIA 1IXMA 3A0HZ 4H0LB 2P4KA 4ABMA 1QQCA 4XCLA 2UU9O 3TGUH 1B62A 1UYKA 4QPJA 4DW0A 3CGZA 5JENA 1N33O 2YE5A 1IZ3A 1ZW9A 4URNA 3FYIB 1DK1A 4JI7B 5LP6C 4TV8B 3BHPA 4X1YA 1TC0A 1QNMA 2QKCA 1I5XA 1TAEA 4X64O 4K8XA 2VQEB 4DR1O 4GUNA 2GUZA 1GN3A 4LWFA 2X6AA 4FK5C 3LSQA 1VMGA 2F1MA 1AI7A 5CA1A 5IYCO 1M93A 3K0GA 3UKMA 2EJRA 5KHJA 2YXYA 3JSNA 4YIPA 4U3FH 5LYJB 2FB5A 4EGKA 3VQYA 3ZIAG 1SQPH 1XEQA 2Y0PA 2ZDYA 3C90A 3INWA 2Y4TA 1N4CA 1OCOC 5FLXN 3ASOB 3K9SA 5CA3A 3EKRA 4YJ2B 4O0BA 2UU9B 2HHHB 3W7SA 2DWDC 4U3JB 2GDSA 2X0LA 1XNRB 1PKXA 1SQQH 2KB1A 3KCXA 4GX0A 4YKRA 4I5SA 2HEPA 5B1BC 2A79B 3F5TA 4MVSA 3T1YB 1PPJH 4NKGB 1BGQA 2V7QG 3FAVA 2YEBA 1DTOA 3ZKDA 1XHXA 5EYPB 1XDCA 5KUMA 3CRLA 3AG1B 2LGQA 2OWOA 1FD9A 1NI8A 5LMUO 2BU6A 1EM1A 3AG2B 3IJ4A 2BTQA 2NLJC 3U0ZA 4YKWA 1E79G 4D6TH 2QM8A 5LGNA 2IU3A 4EMVA 3QTCA 1S14A 3O6OA 1YC3A 2IORA 3QDDA 2F43G 2QA4V 3HKCB 2YI9A 4LF5B 1IBLB 1RSOB 2KSDA 2UXNA 3ABLC 2FTKA 4CZZA 4O2BB 1EZJA 5IYZB 2XJGA 3MHHC 5B3SB 4ASAA 4L87A 5EC1C 3A0XA 3W7XA 2NR5A 3RYIA 1XMOO 2YIBA 1S16A 1UYFA 4V26A 1YDXA 2XAQA 1JM6A 2ZE7A 1YTFD 4E01A 2DN9A 5BODA 2Y0IA 3D36A 2FYPA 4Q20A 4DUYB 4X89A 3G71V 1YT0A 4MP2A 1KKCA 3ZJZA 4GKJO 5LXTA 3P30A 4DV1B 3OTOO 1WP7A 4XKKA 1YJ9V 4HYPA 1QLNA 1TGOA 1NS1A 2N04A 2VCIA 1QLEC 1HNXB 4IHJB 1FJGO 1YTFB 1BQ0A 1KKDA 2XT9A 3RYHA 2QWPB 2ARHA 1HDJA 4LP0A 1Z2GA 1YCIA 4ZHQA 3MD0A 3H1KH 1Y4UA 4F6RB 3CCQV 4F6RA 1WB8A 4N21A 4Z1VA 2YE4A 2PGGA 3D3QA 2DJVA 4LBEC 3J80N 3SR2C 1A32A 1IDSA 4LWSB 1L0OA 5IE9A 1RFYA 5B1BB 3HHUA 4W7TA 2M7WA 3CSXA 1YJWV 4BIZA 3KE6A 3I56V 1I94B 3FB5C 3RYFB 1UY9A 4H37A 2JRIA 2ZXWB 4B7KA 2ATKC 3WB1A 3ETDA 2A7WA 3ABUA 1PL4A 5L3BA 2B5UA 2MK3A 4ZBMA 5KLVH 2FL4A 2JEUA 4ZHQB 2VQFB 3CCRV 2AKPA 1UYGA 4HXZA 4PA3A 3G6EV 5JWPA 1EN5A 1WA8A 1MNGA 3JAWA 3N2GA 4FLUA 4NH9A 2GQPA 4DV2O 4LF9O 2HR3A 2EJ7A 2ZR3A 4R6ZA 5M4NA 3HZ1A 4MSWC 4MVZA 1YT1A 4H85A 3OMAB 2PY5A 2XTAA 1VQPV 1U96A 1Y8OA 5D6PA 3C3SA 2WAMA 2XJJA 5BMVB 5IJ0A 3SYQA 1TUEB 1JMKC 2D3OW 3TZ0A 4YKZA 5D5QA 4JAUA 2O1VA 2GSMB 3E86A 1VP7A 4FLYA 1AVMA 3U2DA 1SF9A 4J7JA 2H3OA 2XK2A 2BYHA 4OPAA 2YGEA 4DV7B 1VQ4V 1U0ZA 2XHBA 3ABMB 2YI8A 3SJCC 1H8EG 4UCOA 2CK3G 3FKSG 4L8JA 4JI4B 4LFCB 3EHBB 2NN4A 4FZ1A 3OW2U 4B7EA 2IWXA 2EX3A 4O05A 4JI1B 4QE7A 4FLZA 4R3MA 2Q7HA 3K04A 4FZ0A 5IWAO 3UO3A 4UVAA 2YJXA 2AHYA 4B3SO 1XNQB 4GYCB 1BGYH 3JCZA 4LNUA 1B63A 4PHZA 2ZCEA 5EYPA 1KP3A 2GHYA 3T1HO 4DV7O 3T1KA 1GH6A 3K5NA 4X62B 3OW6A 4WFEA 1Z5BA 2YSUB 3B26A 2CGOA 4B3MB 2OYQA 2YI0A 3B25A 4J42A 2HHHO 1VQNV 1P84F 3RT3C 1VIBA 4WFGA 4MTXA 1BT8A 2DYRB 1BZKA 4JI1O 5J2TB 4JASA 2RNBA 2IJHA 1S3JA 3FD9A 4KL1A 1MX0A 3WQ9A 1H2KA 2ZXWC 4PA6A 4WF9V 3DSQA 2C1GA 4B3TO 5L3CA 5CTYA 4E00A 2NNUA 4ICGA 3B2EE 3BA8A 3BA9A 4X1KB 5GONB 2EZOA 2E76B 4JI6B 2ZIOA 2HG1A 2R9AA 1DF5A 2PZSA 1VF6C 1N34O 4RO2A 2P22C 1X4TA 4DZYA 1AROP 2XHRA 2VCJA 2WPDG 3G80A 2OTJV 4XE2A 1B3QA 4DW1A 3OMIB 3AG1C 1Y67A 2CDYA 5EBLC 4YJ3B 4LWGA 3TXSA 4FCRA 1BHAA 4X62O 3CGYA 1WA8B 5KMGA 2CE4A 4GKKO 4AILC 1O9GA 1GKFA 2WI1A 3JD2A 2QWOB 1FXKA 4PA7A 2QE7G 4MTGA 1OCRB 4PI0A 4WFFA 4LF6O 2E0AA 3D8CA 3LSUA 4AWPA 1F4MA 4LFAB 5B3SC 3ZHTA 2RQ6A 4EFEA 1R3IC 2PUSA 4DO2A 4JQLA 3PJSK 4K8ZA 3O9OA 1VQ6V 2WEPA 4LWEA 1YSZA 3F5WC 1D5NA 4KP4A 4DV4O 1HNZB 1TVKA 3LSSA 1Q7YW 2YJWA 3RLQA 1AMWA 3VOUA 3LUTB 3U10A 4TWKA 1KECA 5F5RA 3KKYA 3CPWU 2YE2A 4X88A 3CMEV 1AH6A 4JPRA 5J2UB 2HCHA 1VF7A 5B1OA 3WFVA 5K1XA 1CXZB 3A8TA 4LF6B 4NH8A 2DQ0A 4O04A 3OEHG 4FM1A 2ZE8A 1WN7A 4PRXA 4DUYO 3ML0A 1NTMH 4CH3A 3ZEDA 2YE8A 4JF3A 3HKEB 2DYSC 1FFXB 3T2MA 1YETA 1MZFA 5L3JA 5BOCA 2XAHA 4JTCB 4ZI7A 3OEEG 1VF5B 2BOCC 2CTQA 3RYCB 2DQ3A 4GFNA 3SYCA 3IC9A 5LOVB 4FFBA 3JASB 3LDDA 3SYPA 1VQ9V 2QGNA 2WA3A 3JSLA 4HYMA 1ID0A 3OFNG 4DV3O 1QHTA 4BXIA 2AHZA 2OCCB 3BEHA 4CC6A 3JD1A 4BR6A 4DYLA 2GTSA 1FYJA 2QWQB 3RGBA 1OCCC 5FPOA 4JI7O 3FYEB 3OE7G 1UY8A 3H80A 2ZM6B 2KQXA 4DR5O 3Q5LA 3JALA 4I3HA 4I0XA 4U7NA 2IM9A 2H94A 3HKBA 3OGCC 1IBKB 3CB2A 3HPLC 2ITCC 3U11A 5FL7G 2KG7A 3UO2A 5BR8B 3OWBA 1L1FA 3ABKC 4TQFA 5CBFA 4AS9A 5KHKA 4RUFA 4EB6A 1BS3A 4L8ZA 1R6TA 2WI4A 2O57A 4WUDA 4J80A 3AK3A 4ZKIA 5M4MA 5H9CA 1NVPB 4I4TB 4OGQB 2ZKOA 5J71A 1AJNA 3W7UA 2R72A 3OD4A 1QCEA 3A0BZ 4DUZO 1K3EA 3S5TA 4GZRB 4XD8A 2E5LB 3L70H 3RBZA 1WNSA 2WA4A 1L8DA 4HY1A 2IOQA 4KSHA 2YK9A 4FMTA 1S72V 3Q4HB 2BT0A 4MP7A 1T5EA 1GN2A 1AI4A 3I5DA 5LYJA 3T1CA 4PRVA 2Q9LA 4YIOA 2P06A 4CH5A 3T10A 3ZRVA 1ZSPA 2RJZA 4A5UB 2JVDA 2RCVA 1K34A 3DC5A 2YE7A 4B6CA 1V55B 2ILMA 2YIAA 2Q0OC 4DV0O 3RYIB 3LNNA 3J7AU 5JCOC 2A0LA 3EHJA 2QM7A 1OCRC 3TK1A 5IYZA 2B1GA 2XHTA 4HZ0A 4X65O 1AJPA 1QZRA 4BIOA 2X6BA 4X64B 2DYRC 2Q68A 4X8AA 1XILA 3BAAA 1SETA 2PYLA 2QTSA 3RLPA 1KMIZ 1J95A 4MBCA 4L93A 2UXDO 4B7PA 4BIUA 4DV5O 4EFBA 2QWRB 4X20A 2R9RB 4BWAA 3SJAC 3ICXA 1Q8IA 2QFOA 2IWSA 3ZRWB 1TVKB 1EI1A 4G27B 4DR4B 1FXHA 4P2ZA 4UV8A 2XCMA 5ITZB 1N0NA 4I9QA 3LNMB 3CCUV 4AWQA 3K06A 4QJFB 3FB8C 1H8HG 1BL8A 3HZ5A 3ZHSA 3GVMA 4DR3B 1GAXA 1IXBA 1NU1H 3TCUA 1BYQA 5KMGB 5EBMC 3AG7A 2HJDA 3E83A 5GW7A 3UT5B 3VQXA 3STZC 2JK5C 3DGEA 5LL6Y 1Y4MA 2CTPA 5LXTB 1UYIA 2Q7EA 2EULA 3TZ5A 1FFTB 3JASA 3DXRB 2WLNA 5A9GA 3E89A 4EEHA 5H6QA 4DRXB 5L3GA 1ZX3A 3SDLA 5IWAB 3CXHF 2WERA 1ZWIC 3D2RA 4CH4A 3CJHB 4AWOA 1OCCB 3OR7C 2Z0AA 4PJ0Z 4N23A 3D36C 4AQYO 4DK0A 4WCEV 1S5HC 2OCHA 1ZXNA 4E02A 4QGPA 2W0FC 3HKBB 3SPCA 5FPRA 5J2TA 2XDXA 3OMNB 2CH7B 1H2NA 2HKOA 5CTXA 5H5NA 2Y4UA 3ABKB 1ZLZA 3CRRA 1UYCA 4FJCC 2BSKA 2DYSB 1NH2B 1YERA 2ZE5A 4DV6B 1SESA 4U93A 1BSMA 3SYOA 2FWZA 3VQVA 2ZNJA 1N33B 3QVNA 4X1YB 3ZS8C 1JCHA 2YEHA 4PELA 4LF5O 1YXBA 1FS0G 3TUHA 4JYAO 3C0EA 2Q0AA 2WLIA 1MSWD 2OCCC 4TT3G 2WSSG 4YKQA 2X7RB 4KHPO 4PDLA 1IURA 1I5BA 1AI5A 1XREA 4U3JA 4DR7B 1U2OA 3K60A 2OTLV 1M5IA 2XX2A 2EIJB 4F4LA 1UY7A 4NB5A 1K97A 1EBOA 1NHIA 3JARA 1VARA 4ASUG 5B1AB 1YITV 3A0WA 1DGSA 3EHGA 5CF0A 1TIDA 3NR7A 4YHHB 4LWHA 2ADPA 4XBFA 3A2FA 4DR3O 4GX1A 2UWDA 4UV9A 4PDMA 2Y69C 4XKOA 1QY8A 2R9IA 4PU9A 4YY3B 3BFRA 5GTHZ 3ZXOA 5CA0B 5JVDA 3HKDB 3RWRD 5FWKA 3L74H 5F3KA 4HYOA 4KSGA 2HVJC 3ZCCA 3OTFA 3SPGA 2YKCA 3VHAA 4O2BA 1Q5OA 3BMYA 1Q6HA 1GRJA 1H2MA 4JI8O 2DWEC 3AG3B 3CWVA 3CRKA 4LPBA 1WB7A 2BE3A 1BHBA 5KHHA 4IGGA 1YJNV 4UCRA 3QF7A 2ADQB 4YY3O 4X9LA 2ITDC 3CC7V 2YE9A 4ASFA 1Y8PA 2N05A 3VQWA 2XJXA 4GGLA 3K03A 4DUZB 3FAVB 1GMGA 3PN1A 3OR6C 1MU5A 4J41A 3E35A 3SJBC 4WUCA 4NTWA 2XD6A 1V55C 3R4PA 4XTJA 2YDEA 1MZEA 3IGAC 4IL6Z 4CBCA 4EFTA 2ZQMA 1M57B 3HB3B 1RP3B 2Q4PA 2QG2A 3OWDA 3JD4A 5JJEB 4LF9B 1PV0A 2XHXA 1R3KC 4LFBO 4NR1A 1M9NA 2L35A 4O07A 2ZDIC 2ZD9A 1NBMG 5E79Z 3HKEA 3G4SV 3K5OA 2DOSA 3GIGB 4ZOLA 4XIQA 1JFFA 1SZTA 1V54C 2H8PC 1TA8A 5BMVA 2WI3A 3HYYA 1GKZA 4UFZA 3LMMA 5CTUA 4XIPA 3WB2A 1YF2A 3LNUA 2UXCO 4RQEA 4X65B 2R70A 4CS3A 2P4VA 3WB0A 3E22A 5F2VO 4ASBA
chains in the Genus database with same CATH topology
4PA7A 1JX9A 5KA6A 5CMUA 1M1KW 2QE7G 4MTGA 1OCRB 4WFFA 3OUFA 3WG7C 4WFBV 1F4MA 5DN6G 4UVBA 5B3SC 1QVGU 1K4CC 1S0VA 1R3IC 1NR1A 4DO2A 2ZR2A 3ZMTA 3PJSK 2WLHA 3JYCA 3ETEA 1Q82W 1VQ6V 3R65A 1WLEA 1VQLV 2YEVB 2JEXA 3F5WC 4KP4A 1VQMV 3LSSA 1Q7YW 3VOUA 3LUTB 1QLEB 3AEIA 3JD0A 4MW8A 4TWKA 1KECA 3CPWU 3QO8A 3X2QB 2IW5A 4X88A 3CMEV 1RM1B 3OM3B 4JPRA 2HFEC 3F7VC 5B1OA 1OHHG 1KD1W 3K3WA 3WFVA 5C93A 4P9OA 4QPKA 4TSFG 2DQ0A 2JDIG 3OEHG 5BZBA 2EIJC 1W0JG 3ML0A 2LP7A 1R6NA 2QKSA 4GX2A 4MTFA 1W2BU 1B6QA 3K0DA 4JF3A 4LC1A 3SPJA 2DYSC 3T2MA 2EINB 4RUEA 2XAHA 4JTCB 4YXWG 3SYAA 3CMAV 3RVZA 1K73W 3STLC 1VQ8V 3OEEG 2BOCC 5CBGA 3ZMVA 2DQ3A 4QE9A 3SYCA 3T4DA 3CD6V 2LFSA 3LDDA 3SYPA 1VQ9V 3NXSA 4MW3A 1DF4A 2Z5UA 3B77A 4GX5A 3OFNG 3KG2A 3H01A 3CCSV 5LHHA 3BEHA 2AHZA 2OCCB 3JD1A 1JJ2U 2Y48A 5LHIA 2JIZG 4MVUA 5LBQA 1GM9A 1FXKB 1OCCC 3X2QC 3FYEB 5H6RA 3MHSC 1THZA 3ZMSA 1NR7A 3OE7G 4R8CA 3SJQC 5CBHA 1R3JC 1GM7A 3CCMV 1MG1A 2WLLA 3W7WA 3B8NA 3B8MA 3FB6C 5EC2C 3ZN0A 1JVMA 2P7TC 3AG2C 4WFHA 1S76D 4MVQA 1OCOB 5IYBO 4U7NA 2H94A 2XNDG 3OGCC 3HPLC 2ITCC 2B1IA 1K33A 3FB7C 1KP2A 3CC2V 5FL7G 2P6JA 3M99B 1L1FA 4FIPC 3ABKC 4PDRA 4RQFA 5CBFA 3ZMZA 4MT8A 2ZDIA 2P67A 2WLJA 1I5YA 1IXMA 3QNEA 5B1AC 1E1QG 5IDJA 4QIWF 1N8RW 4RUFA 4QPJA 1ROPA 1GM8A 2XAFA 3CCVV 4RAIA 3FYIB 4ZKIA 5H9CA 1NVPB 2Y69B 1AJNA 1P4RA 3W7UA 2HLDG 2EZPA 1I5XA 1QBZA 1QCEA 3JD3A 1K3EA 5LHGA 3E8GA 2W6JG 3I55V 3RBZA 2X6AA 2Q6AA 4FK5C 3LSQA 2IJKA 5HFLA 2P90A 3SPHA 1M56B 3GWOA 4FMTA 5L3EA 2A9HA 1AI7A 5IYCO 1KC8W 1S72V 1S77D 3K0GA 4JTDB 4PA9A 2EJRA 5L3DA 3UKMA 1LNQA 4WFAV 1AI4A 1V54B 3T1CA 5HFMA 2EIKB 3ZIAG 3ZRVA 2EIMB 3ASNC 3OUSA 1K34A 1OCOC 1V55B 1ENVA 3ASOB 3K79A 1PNMA 3E8HA 5CA3A 1NKDA 1FXVA 3W7SA 2DWDC 2A0LA 3OAAG 5LGTA 2QM7A 1OCRC 2X0LA 1JQ0A 1GK9A 3CCEV 1COWG 1PKXA 3TK1A 2B1GA 1AJPA 4GT1A 1E1RG 2X6BA 1CEZA 2DYRC 2KB1A 2Q68A 2K1EA 4GX0A 4LCUC 2YEVA 1QR9A 1W0KG 4X8AA 2HVKC 1M57C 4I5SA 5B1BC 4G28B 2A79B 1SETA 5CN0A 4MVSA 2WLLB 1J95A 1AI6A 2V7QG 4UVCA 1MABG 3CYOA 1DTOA 3CCLV 1AR1B 4BIUA 1H38A 5J9PC 4MVRA 5KUMA 3AG1B 2R9RB 3P32A 5KUKA 3AG2B 3ZRWB 2NLJC 1SRYA 1GO3F 3K9AA 4G27B 1E79G 4LP8A 1FXHA 2QM8A 4JTAB 1R3LC 2IU3A 4P2ZA 4UV8A 5LGNA 1NJIW 2F43G 2QA4V 1XL4A 3LNMB 2UXNA 3ABLC 3ZRXA 3CCUV 2FTKA 1BMFG 4CZZA 1EZJA 3K06A 4QJFB 3FB8C 3MHHC 1H8HG 1BL8A 5B3SB 4QNHB 2WLIB 4MVMA 4L87A 1QVFU 5EC1C 3W7XA 3TCUA 1OZ0A 2XAQA 4JYCA 4JGSA 5EBMC 1YTFD 2XAGA 3E83A 5GW7A 3STZC 1KQSU 3E8FA 2JK5C 3D36A 3DGEA 4Q20A 5EBWC 4I9WA 4X89A 3G71V 1VQ7V 1G4YB 1K9MW 1Y4MA 4HZ3A 3ZJZA 1PL0A 3P30A 1JPXA 1FFTB 1R73A 2WLNA 3E89A 5H6QA 2JJ2G 4UUJC 3E8BA 5L3GA 1NH2D 1ZWIC 1YJ9V 1QLNA 4JAVA 2WLMA 1FXKC 1QLEC 1VQ5V 2Z3YA 1OCCB 3OR7C 3AG4B 4KUMA 3ASNB 4N23A 1YTFB 1KKDA 4E2LA 4WCEV 1S5HC 4EKWA 3QO5A 2QEXV 3MD0A 1DLBA 3CCQV 4N21A 1K7DA 2W0FC 3SPCA 3LDEA 3OMNB 4LBEC 2Q67A 2HKOA 1VQOV 4XDLA 4PDVA 1UJWB 3ABKB 3F7YC 4FJCC 2DYSB 2WLKA 1NH2B 5DM6V 2QTOA 1SESA 1RPOA 5B1BB 3SYOA 3ABMC 2M7WA 1YJWV 4BIZA 3CCJV 3I56V 3FB5C 1R6KA 3SPIA 1JCHA 1HWYA 4J9ZB 2OT5A 4H37A 1ORQC 1WPXA 2ZXWB 3RW0A 2ATKC 4PELA 2IJJA 3ETDA 3ABUA 4JYBA 5L3BA 4XDJA 1FS0G 3ZRWA 4BAYA 2B5UA 1RM1C 2MK3A 3DTUB 3ZN1A 2WLIA 1MSWD 2OCCC 4TT3G 4ZBMA 2WSSG 2JEUA 2X7RB 4PDLA 3CCRV 1AI5A 4PA3A 3G6EV 1OCZB 3CXCU 2HJFC 2OTLV 4U7OA 2HR3A 3CP1A 2ZR3A 4R6ZA 2EIJB 4F4LA 4MSWC 4MVZA 3RVYA 4UXNA 2XAJA 3OMAB 1K97A 1EBOA 3IC7A 3ETGA 1YI2V 1GTOA 1VQPV 2XASA 4ASUG 5B1AB 1YITV 1K8AW 3D3IA 2WAMA 2JJ1G 2IJIA 4MVOA 1TUEB 1K5QA 2EILC 3SYQA 4XBFA 3ABTA 2D3OW 4JAUA 1AJQA 4GX1A 3ZMUA 2EBOA 2GSMB 3E86A 3TETA 2IH3C 2IH1C 3A0RA 4UV9A 1YSCA 1G8MA 4PDMA 2Y69C 1Q81W 2R9IA 1F23A 3ZRSA 1XL6A 1VQ4V 3WG7B 3ABMB 2V1DA 5LGUA 1H8EG 3LDCA 4HYOA 1YIJV 1RPRA 2UXXA 1JOYA 2HVJC 2Q69A 3ZCCA 2CK3G 4P9PA 3FKSG 2W6IG 3SPGA 3CC4V 3EHBB 4GCZA 3AG4C 3OW2U 2IU0A 4QE7A 2DWEC 3K08A 3AG3B 1M90W 3K04A 1BHBA 1QR8A 4UVAA 4R50A 2PI4A 1YJNV 2PI5A 2AHYA 1SERA 1K4DC 3JCZA 2ITDC 3ASOC 3CC7V 1YHQV 4P30A 1KP3A 2GHYA 4FPPA 3K03A 5IY5B 4WFEA 2EIKC 2YSUB 3UM7A 1GMGA 2WWWA 3OR6C 1VQNV 3E35A 4HAMA 1MOFA 1P7BA 4XDKA 5IYDO 4WFGA 4MTXA 1V55C 1NQTA 2DYRB 4Z1MG 3IGAC 4CBCA 4JASA 2IJHA 1S3JA 2ZQMA 1M57B 3HB3B 4PA6A 1PNLA 2ZXWC 4WF9V 3JD4A 5L3CA 1R3KC 5B1NA 3T4ZA 4R7CA 1M9NA 3W7TA 2NNUA 4DXWA 2ZDIC 3GB7C 2ZD9A 1NVPD 3VBBA 1NBMG 2XOKG 2HG5C 2EZOA 5L3FA 2BOBC 1CPYA 1OCZC 4KFMA 1K5SA 3QO7A 2X6CA 3G4SV 2C2AA 1M56C 4H33A 2LFRA 1EFRG 4J9YB 4OXSA 1DF5A 5E1AC 3IFXA 4RO2A 4PA4A 1AROP 3EFFK 2WPDG 2OTJV 4BW5A 3BY6A 1V54C 3AG3C 1SZTA 1F51A 1CP9A 2H8PC 5EK0A 1VQKV 3ABLB 3OMIB 3AG1C 1PNKA 1K92A 2EIMC 4MTOA 1PD3A 2EILB 5EBLC 5KA5A 4MS2A 1BHAA 1Y66A 2EINC 2DW4A 4RQEA 1Q86W 1GKFA 3E2EA 3JD2A 5IY5C 4G2KA 1H2GA 1FXKA 1F4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JAU A;  4JAV A;  3A0R A;  4MTX A;  4FMT A;  5B1O A;  5IDJ A;  3P32 A;  2QM7 A;  4QPJ A;  4JAS A;  4JYC A;  5C93 A;  3ZRW B;  4U7O A;  1F51 A;  3TK1 A;  2LFS A;  4QPK A;  2QM8 A;  4GT1 A;  1IXM A;  4ZKI A;  3NXS A;  4BIZ A;  3DGE A;  3D36 A;  4Q20 A;  5B1N A;  3MD0 A;  3ZRV A;  4I5S A;  4KP4 A;  4FPP A;  4U7N A;  3ZRX A;  1JOY A;  2FTK A;  4LC1 A;  3ZCC A;  4JYB A;  3ZRW A;  2WWW A;  2C2A A;  4GCZ A;  4MT8 A;  2P67 A;  2LFR A;  4BIU A; 
#chains in the Genus database with same CATH topology
 5C8Y A;  4WUB A;  1AP5 A;  2QR4 A;  3OUF A;  1S5L Z;  1YT2 A;  5DN6 G;  1RSO A;  2YI6 A;  1QVG U;  4I55 A;  1FAF A;  4JI6 O;  2WLH A;  3JYC A;  4XCJ A;  3FX7 A;  1I5D A;  4DK1 A;  1I7F A;  4K35 A;  2ODM A;  4MW8 A;  3EKO A;  3HYZ A;  4PL9 A;  1F7Y A;  2YI7 A;  1HW7 A;  2IW5 A;  4UCS A;  2ZIN A;  2CTR A;  1QYE A;  4YJ3 A;  1UYE A;  2HFE C;  3O0I A;  3G7B A;  1UY6 A;  2YID A;  3F7V C;  3O65 A;  1KD1 W;  5C93 A;  1OJH A;  3WHA A;  1Q3E A;  4P9O A;  4QPK A;  1QU7 A;  2JDI G;  5K1P A;  2YEF A;  2A3Q A;  5BXZ A;  1VEW A;  5BZB A;  2EIJ C;  1TC6 A;  4CWP A;  2LP7 A;  2QKS A;  1SKV A;  3K0D A;  4MPC A;  3SPJ A;  1YVW A;  4I55 B;  5JJN B;  4NXN B;  3G75 A;  4JI0 B;  4EM7 A;  3SYA A;  4YXW G;  3ZBH A;  3H1I H;  1IX9 A;  4HZ5 A;  3GIE A;  1ZUQ A;  5CBG A;  4QE9 A;  2KG7 B;  2LFS A;  4I4T A;  1BE3 H;  4GX5 A;  2DE0 X;  2XX4 A;  4GKJ B;  5LHH A;  2LW1 A;  4E4E A;  4EB6 B;  4O4I A;  2AXT Z;  2Y48 A;  5JJJ B;  5LHI A;  1D2D A;  2JIZ G;  1ZAU A;  5LBQ A;  1BXD A;  2LW7 A;  1ZWH A;  4XIT A;  3K5M A;  5CBH A;  1I5C A;  1GM7 A;  3CCM V;  1EZV H;  4FLT A;  4HNA B;  1HP8 A;  2ZDX A;  2EXL A;  4LH6 A;  1GJV A;  3B8M A;  5IDM A;  5EC2 C;  1MSD A;  4I0X B;  4JZG A;  2Q8G A;  3R91 A;  3A0T A;  1KP2 A;  2Q73 A;  3CC2 V;  1BKN A;  4EGI A;  1I0H A;  3QG5 A;  1Q6I A;  2BTQ B;  4RQF A;  3B09 A;  3ZMZ A;  1I5Y A;  2WLJ A;  1Q90 D;  2VWJ A;  5B1A C;  2YKB A;  2OIG A;  2H8M A;  4JZ2 A;  1E1Q G;  2YKE A;  2UXB O;  5M4K A;  2WEQ A;  4R3A A;  3JAM N;  4UCU A;  1FJG B;  3APO A;  4FLW A;  4RWU A;  5CB4 B;  1BCC H;  2Y69 B;  2HKJ A;  2HLD G;  3EHF A;  3JD3 A;  2JGD A;  5LHG A;  3E8G A;  2W6J G;  2YS8 A;  5CTW A;  2Q6A A;  1XUQ A;  2IJK A;  5HFL A;  2P90 A;  3SPH A;  4UB8 Z;  3GWO A;  5L3E A;  2A9H A;  1UPG A;  1H7U A;  4I50 A;  2PNR A;  1VF6 A;  1S77 D;  4W4L A;  3R92 A;  5IN9 A;  4PA9 A;  2PYJ A;  3UCS C;  4WFA V;  5FNC A;  1V54 B;  1TUB B;  4X9Q A;  2Q5Z A;  3FFQ A;  5JQG A;  3K5L A;  1US7 A;  5KHI A;  5FND A;  1Y74 B;  4NXN O;  2VWK A;  4EFU A;  1TIL A;  4EEQ A;  3RN4 A;  1Y6X A;  5M4E A;  2Q8F A;  3OT7 A;  1PNM A;  4O4H B;  4O4H A;  4CS2 A;  1R1B A;  2F95 B;  1Q43 A;  1UYM A;  3FV5 A;  3CCE V;  1V9P A;  2IOP A;  4LF8 O;  4TV9 B;  1BQZ A;  4NVP A;  3Q5K A;  2UXC B;  2DMX A;  2K1E A;  2Q2E B;  1JR9 A;  4HXW A;  5KX5 B;  1M57 C;  4TV8 A;  3K59 A;  4NXM B;  4I50 B;  4PI2 A;  4WBN A;  2BCC H;  4JI8 B;  4DV4 B;  1AR1 B;  2P5O A;  1H38 A;  5J9P C;  2F4V O;  2XDS A;  4MB9 A;  3K97 A;  2QDO A;  5KUK A;  5FNV B;  4H13 B;  3RYH B;  1SRY A;  1GO3 F;  1SQG A;  3CRM A;  1Y76 B;  3CYG A;  4LP8 A;  3U67 A;  4JTA B;  1R3L C;  5CB4 A;  4W4K A;  2G38 A;  4B3T B;  1Z5A A;  3M7M X;  1BMF G;  4URL A;  1AB3 A;  2WLI B;  2YIB D;  3WU2 Z;  3K58 A;  1GN4 A;  5EZY B;  2XDU A;  1OZ0 A;  4DV5 B;  4LR3 A;  2XAG A;  3UT5 A;  1KQS U;  1WPB A;  2UUC B;  2YEG A;  4JYY A;  1NTZ H;  4DR1 B;  1VQ7 V;  1G4Y B;  1K9M W;  4HZ3 A;  2RDC A;  1JPX A;  1Z5C A;  1R73 A;  4TQD A;  2JJ2 G;  3E8B A;  1NH2 D;  2YKJ A;  1N34 B;  2XDK A;  1AP6 A;  2AGA A;  4JAV A;  3HKC A;  2IWU A;  2VW5 A;  1WP8 A;  2Z3Y A;  1XMO B;  3AG4 B;  4MOT A;  4KUM A;  3G67 A;  4E2L A;  5C8Y B;  3C3T A;  4EKW A;  3QO5 A;  4CS4 A;  1DLB A;  1K7D A;  3LDE A;  4DR2 O;  1NZ6 A;  2YXL A;  3EXA A;  4K0K B;  2Q7G A;  1VQO V;  1UJW B;  3INX A;  3F7Y C;  3CRC A;  2WLK A;  5DM6 V;  2QTO A;  1RPO A;  4YKX A;  2N74 A;  5IJ0 B;  3BPZ A;  2QG0 A;  4R1F A;  2VQE O;  3IED A;  4CWT A;  1R6K A;  4AI8 A;  5ITZ A;  2V4D A;  3SPI A;  1HNZ O;  4AQY B;  3AK2 A;  1ORQ C;  1WPX A;  3RW0 A;  3RLR A;  4YKY A;  1FFX A;  2JGU A;  3JAK B;  1MA1 A;  4XDJ A;  3ZRW A;  1RM1 C;  3CWB H;  3TXQ A;  2HP8 A;  3P3P A;  1XQ8 A;  2WI6 A;  1B06 A;  3B27 A;  4O09 A;  1ZL8 A;  3CXC U;  2HJF C;  3CHX A;  1GKX A;  4U7O A;  3CP1 A;  3JCU Z;  5TIS Z;  4P8O A;  2YGA A;  4AHC A;  3RVY A;  4UXN A;  3IC7 A;  4FM0 A;  1YI2 V;  2XDL A;  2B9Z A;  2XAS A;  4LWI A;  2WI2 A;  2JJ1 G;  2IJI A;  3B40 A;  2F4V B;  2BRC A;  1JA8 A;  2EIL C;  2YI5 A;  1AJQ A;  3ZMU A;  2CCS A;  3TET A;  3A0R A;  2Q8H A;  5DEC A;  1F23 A;  3RFR A;  3ZRS A;  1XL6 A;  4IIJ A;  1U97 A;  3WG7 B;  1B04 A;  2V1D A;  5LGU A;  1LUW A;  2CGF A;  4H44 B;  1SQX H;  3R4N A;  4BQG A;  3LDC A;  1L0N H;  4DR6 B;  1XI1 A;  4L90 A;  1Y74 A;  2UXX A;  1JOY A;  4EGH A;  2Q69 A;  2A06 H;  2O1U A;  4P9P A;  2W6I G;  3CC4 V;  4GCZ A;  3AG4 C;  2UUA B;  4CWR A;  1MMM A;  5JH7 A;  1M90 W;  1N36 B;  1QR8 A;  1UYH A;  4LF4 O;  4UCV A;  4OX9 B;  4DUH A;  1SER A;  1K4D C;  1YHQ V;  3FT5 A;  1IBK O;  3BCC H;  4FPP A;  3CX5 F;  3JAR B;  5KAF Z;  5IY5 B;  4B3M O;  5A2Q N;  4CWO A;  3UM7 A;  1YC1 A;  4TOI A;  3QTF A;  1LUV A;  4HAM A;  1MOF A;  5IYD O;  1NQT A;  2CCT A;  4TV9 A;  2LJ2 A;  3MDS A;  5LA6 A;  2JJC A;  1LR1 A;  2YE6 A;  3FT8 A;  1G6U A;  5B66 Z;  3W7T A;  4DXW A;  3GB7 C;  3JAL B;  3VBB A;  2XOK G;  4L94 A;  3CE2 A;  2IBZ H;  1HNX O;  2BOB C;  4FFK A;  4KFM A;  4DV1 O;  1HNW O;  4FVM A;  2C2A A;  1M56 C;  2LFR A;  4OXS A;  2WI7 A;  1KU9 A;  3IFX A;  5E1A C;  4BW5 A;  3BY6 A;  3JAT A;  3AG3 C;  1F51 A;  1CP9 A;  1AJ6 A;  1VQK V;  3N27 A;  4NXM O;  2VS0 A;  2YIC A;  1PNK A;  3SL2 A;  4Q6G A;  2EIM C;  3CJH A;  4MTO A;  4NYK A;  1PD3 A;  2EIL B;  5KA5 A;  3CRA A;  4MS2 A;  1Y66 A;  2ETN A;  2EIN C;  2D2C B;  4O4I B;  4UB6 Z;  2CH4 A;  3DXR A;  1KUQ A;  3E2E A;  2BRE A;  1H2G A;  1EN4 A;  1F4N A;  5KA6 A;  5BR8 O;  2YEC A;  1KIJ A;  3WG7 C;  2YEA A;  5D7C A;  4WFB V;  1SA0 A;  1NHJ A;  1K4C C;  3NMQ A;  3J81 N;  4CC5 A;  1S0V A;  4TUY B;  4UCT A;  4DR2 B;  3H1H H;  1SQF A;  3ZM7 A;  5IJ9 A;  3ETE A;  1Q82 W;  3R65 A;  4GQT A;  1WLE A;  2YC0 A;  1OV9 A;  1AM1 A;  3VHD A;  3AEI A;  3ZHQ A;  4YKU A;  3CRQ A;  3QO8 A;  3X2Q B;  4MPE A;  4P7A A;  1L0L H;  2QM4 A;  3B24 A;  1RM1 B;  2ZE6 A;  4JI3 O;  4LH7 A;  5EIB C;  3K3W A;  1D5A A;  2F93 B;  1YES A;  1J5E B;  1N0J A;  4O4J A;  2XAB A;  4TSF G;  4H81 A;  4B3S B;  1XNQ O;  4GKK B;  1W0J G;  4BAE A;  1R6N A;  1P49 A;  2RN9 A;  4GX2 A;  1PP9 H;  1Y8N A;  3K99 A;  5CA1 B;  1B6Q A;  4LC1 A;  1UYD A;  2UUA O;  2UXB B;  3PEH A;  1M4U A;  3K98 A;  4CWQ A;  3STL C;  1N36 O;  5JH7 B;  4DV2 B;  2MW2 B;  3ZMV A;  3T4D A;  1N32 B;  4JV5 B;  3CD6 V;  5LP6 B;  1UFI A;  4NTY A;  3NXS A;  1DF4 A;  2Z5U A;  3B77 A;  2AW9 A;  4V25 A;  2XUM A;  3BRC A;  1SQV H;  3MAQ A;  4YKT A;  1H2L A;  2CH7 A;  3HR0 A;  1GM9 A;  5JCO A;  5LMN B;  1FXK B;  1THN A;  4PD4 F;  1OSF A;  3MHS C;  1THZ A;  3ZMS A;  1NR7 A;  1Z5V A;  4R8C A;  3SJQ C;  1Q6U A;  2UXD B;  1R3J C;  2YED A;  3L75 H;  1MG1 A;  2WLL A;  3W7W A;  4CE1 A;  3CS5 A;  3B8N A;  1YS3 A;  3FB6 C;  3ZN0 A;  1S76 D;  1OCO B;  4BW9 A;  2K5B A;  2XND G;  3BAB A;  2VQF O;  5GGZ A;  3N2K B;  4O2A A;  3M99 B;  3EHH A;  4FM2 A;  4FIP C;  2JS5 A;  2P67 A;  2ZDI A;  2F23 A;  3QNE A;  2W0X A;  5EIB D;  3ZHU A;  5IDJ A;  4QIW F;  1N8R W;  1ROP A;  1GM8 A;  3RYC A;  3C11 A;  2XAF A;  3CCV V;  3L72 H;  4OPH A;  2AZ2 A;  4RAI A;  4YJ2 A;  4D7S A;  3OTO B;  2PTM A;  4DR5 B;  1P4R A;  1Y4S A;  5CPH A;  1O9H A;  2EZP A;  1QBZ A;  4ASG A;  3U2K A;  2QKA A;  4FLV A;  3I55 V;  5D6Q A;  4IIJ B;  2FKX A;  1YSR A;  4FLX A;  3TTZ A;  1M56 B;  4CWF A;  1P7G A;  1J5E O;  4GT8 A;  2BU8 A;  1KC8 W;  4JTD B;  5L3D A;  4JI5 B;  1Z5W A;  1YC4 A;  2BZ5 A;  1LNQ A;  4LNU B;  1TUB A;  5HFM A;  2EIK B;  4J7Z A;  4XDM A;  2FWY A;  3OGI B;  4X20 B;  2EIM B;  3ASN C;  3OUS A;  4FCQ A;  2CUG A;  4KQV A;  2AZ0 A;  1ENV A;  3K79 A;  3E8H A;  5M4H A;  1NKD A;  4NH7 A;  3DC6 A;  1FXV A;  2L6L A;  4GEE A;  2YEI A;  2CGN A;  2JGD B;  3OAA G;  5LGT A;  4DR7 O;  1JQ0 A;  1GK9 A;  1COW G;  3T1H B;  4GT1 A;  1E1R G;  3A0Y A;  5KHG A;  1CEZ A;  4LCU C;  4LWS A;  2YEV A;  1QR9 A;  1W0K G;  2ZNI A;  2ESA A;  2HVK C;  4G28 B;  3L9D A;  2QF6 A;  5CN0 A;  4X66 O;  2WLL B;  2FXS A;  4X1I B;  1AI6 A;  3TZ2 A;  1I94 O;  4UVC A;  1KYO F;  1MAB G;  1FPO A;  3CYO A;  3CCL V;  4MVR A;  3P32 A;  5FNV A;  3T0Z A;  4JI2 O;  1IBM B;  3AK1 A;  3K9A A;  3KCY A;  1NJI W;  5J2U A;  3M8A A;  3RYF A;  1XL4 A;  2E3C A;  3ZRX A;  2YK2 A;  2Q8I A;  4IYI A;  4DV0 B;  5D7R A;  1PM9 A;  2BTZ A;  4QNH B;  4JI2 B;  4MVM A;  1QVF U;  2GTA A;  4YHH O;  4JI0 O;  1R62 A;  4JYC A;  4JGS A;  4NTX A;  2C1I A;  3GWK C;  4F6E A;  4CH6 A;  3E8F A;  5EBW C;  4I9W A;  2E74 B;  1XNR O;  3G6B A;  4GLX A;  1PL0 A;  1AH8 A;  1YZB A;  1HNW B;  4I7Z B;  3R4O A;  4O4J B;  3HKD A;  4UUJ C;  4XC0 A;  4O4L B;  4KXR A;  2CAZ C;  4Z2W A;  2BTO A;  4JYA B;  2WLM A;  1FXK C;  1VQ5 V;  2UUB B;  3UQ8 A;  4LFC O;  4HBN A;  3ASN B;  4J7K A;  3B4S A;  2QEX V;  1KB9 F;  4JI4 O;  2ZT9 B;  1UYL A;  2Q67 A;  2FYU H;  4ZI7 B;  5D5P A;  3SGI A;  4XDL A;  2BU2 A;  4PDV A;  2WI5 A;  4LF7 O;  1X59 A;  3T2S A;  5BY1 A;  4K4O A;  3IAY A;  2CCU A;  3VHC A;  4DRX A;  4J10 A;  2PF4 E;  3ABM C;  3ZKB A;  5LOV A;  3B28 A;  4B3R O;  1JJO A;  3CCJ V;  4JI3 B;  2LQT A;  2XX5 A;  4X66 B;  1HWY A;  1I08 A;  1XMQ B;  4J9Z B;  2OT5 A;  3EVK A;  1HR0 O;  1Z59 A;  5H2F Z;  2IJJ A;  4JYB A;  4HNA A;  5LMN O;  4BAY A;  3DTU B;  3ZN1 A;  1A4H A;  5KAI Z;  4L91 A;  3P3N A;  1OCZ B;  3JAW B;  3N2G B;  3H4L A;  4DR6 O;  1I59 A;  5LMU B;  1SZX A;  3TZ4 A;  4JV5 O;  1HR0 B;  4K3A A;  1TBW A;  3D0B A;  2XAJ A;  4FCP A;  4DR4 O;  3ETG A;  5AG2 A;  3G7E A;  1GTO A;  1KBH A;  2M6Y A;  1JFF B;  1K8A W;  3D3I A;  1AR4 A;  4MVO A;  2QSA A;  1K5Q A;  2GUZ B;  3L73 H;  3ABT A;  2Q8V A;  1XOU A;  2EBO A;  2GV9 A;  1I58 A;  2IH3 C;  2IH1 C;  4JI5 O;  3S3W A;  3K57 A;  1YSC A;  1G8M A;  1US6 A;  1Q81 W;  2K9P A;  2CG9 A;  2CTW A;  3ZHV A;  4KTN A;  1H7S A;  3T0H A;  2VWC A;  4MPN A;  5EZY A;  2YEJ A;  4E72 A;  2E75 B;  1YIJ V;  1RPR A;  4LFB B;  1FKA O;  1ZL8 B;  4OX9 O;  2ZKJ A;  3N2K A;  2YUA A;  5LA6 B;  2UUB O;  4TUY A;  4ZIB A;  2IU0 A;  3L71 H;  3K08 A;  5DED A;  2RMK B;  3Q4H A;  5GON A;  4R50 A;  2PI4 A;  1XHZ A;  2PI5 A;  1G1X B;  5IT9 N;  3ASO C;  5FNF A;  1AR5 A;  4B3R B;  2JKI A;  1GN6 A;  4P30 A;  4LF8 B;  3HEK A;  1TH8 A;  5M4P A;  2ZIM A;  2EIK C;  3RKZ A;  2YXH A;  1ZTE A;  3H1J H;  4LF7 B;  2WWW A;  3ZHR A;  5J6A A;  4XDK A;  1P7B A;  3THO A;  4BQJ A;  5KX5 A;  4Z1M G;  3R4M A;  3PEJ A;  4B08 A;  3E22 B;  1PNL A;  3H9V A;  4CE3 A;  5B1N A;  5JVD B;  5CA0 A;  4R7C A;  3T4Z A;  2BSM A;  1S5J A;  4XKA A;  3ZXQ A;  1XBL A;  3APQ A;  1NVP D;  2BU7 A;  2GFD A;  2HG5 C;  5L3F A;  1I5A A;  1CPY A;  1OCZ C;  1K5S A;  3QO7 A;  2X6C A;  4KFG A;  3S3X A;  4H33 A;  1EFR G;  2LO1 A;  4J9Y B;  3H1L H;  4LFA O;  4URM A;  2ZM6 O;  3GIG A;  4PA4 A;  3EFF K;  1YEW A;  4ZOL B;  3JAK A;  5EK0 A;  4X1I A;  3ABL B;  4IT5 A;  1K92 A;  1XMQ O;  2ZBK B;  3BM9 A;  4HY6 A;  2DW4 A;  1Q86 W;  4DV6 O;  5B5E Z;  5IY5 C;  4G2K A;  1SS3 A;  2BU5 A;  1NTK H;  1JX9 A;  5CMU A;  1M1K W;  4URO A;  1NT2 B;  2YKI A;  4H7Q A;  4X1K A;  2BYI A;  4J11 A;  4UVB A;  4CE2 A;  3OMU A;  1H2S B;  1URF A;  2VRZ A;  3ZX6 A;  1NHH A;  1IBM O;  2OIE A;  1NR1 A;  3Q5J A;  4LF4 B;  2ZR2 A;  3ZMT A;  3A0Z A;  1VQL V;  2YEV B;  2JEX A;  2F66 C;  1VQM V;  4C7U A;  3VAD A;  2BSK B;  1QLE B;  2GBO A;  3JD0 A;  4FFB B;  1WJZ A;  3GIF A;  3LPS A;  4PV1 B;  3BVO A;  3OM3 B;  1SC5 B;  1OHH G;  3JZ3 A;  1ZXM A;  3MNR P;  3JAT B;  3R66 A;  2O1W A;  1SQB H;  3TJT A;  4O4L A;  4JAA A;  2E5L O;  1N32 O;  2YEE A;  2YGF A;  1W59 A;  2QWN B;  4MTF A;  1W2B U;  2EIN B;  4RUE A;  4D7T A;  2QJ1 A;  2YE3 A;  3CMA V;  3RVZ A;  1K73 W;  1VQ8 V;  1PVG A;  3KZI Z;  1IVS A;  3CEI A;  4O2A B;  4XIR A;  4MW3 A;  5JQG B;  2LGW A;  3KG2 A;  2JS3 A;  3H01 A;  4CWN A;  3CCS V;  3OPD A;  1EA6 A;  4IHJ A;  3O2F A;  1WAZ A;  1JJ2 U;  2UUC O;  1Y76 A;  4MVU A;  4CWS A;  3ETQ A;  3T1Y O;  5GTI Z;  3X2Q C;  5H6R A;  2KKW A;  4IYH A;  4WBN B;  2H55 A;  1EN6 A;  1KZN A;  5IJ9 B;  4ZVI A;  1JVM A;  2P7T C;  3AG2 C;  4WFH A;  4MVQ A;  5IYB O;  1SA0 B;  2B1I A;  1K33 A;  3FB7 C;  1AIL A;  4KHP B;  5LP6 A;  2P6J A;  4K0K O;  5D7D A;  1IBL O;  2FML A;  4PDR A;  4DV3 B;  4MT8 A;  2HHI A;  1IXM A;  3A0H Z;  4H0L B;  2P4K A;  4ABM A;  1QQC A;  4XCL A;  2UU9 O;  3TGU H;  1B62 A;  1UYK A;  4QPJ A;  4DW0 A;  3CGZ A;  5JEN A;  1N33 O;  2YE5 A;  1IZ3 A;  1ZW9 A;  4URN A;  3FYI B;  1DK1 A;  4JI7 B;  5LP6 C;  4TV8 B;  3BHP A;  4X1Y A;  1TC0 A;  1QNM A;  2QKC A;  1I5X A;  1TAE A;  4X64 O;  4K8X A;  2VQE B;  4DR1 O;  4GUN A;  2GUZ A;  1GN3 A;  4LWF A;  2X6A A;  4FK5 C;  3LSQ A;  1VMG A;  2F1M A;  1AI7 A;  5CA1 A;  5IYC O;  1M93 A;  3K0G A;  3UKM A;  2EJR A;  5KHJ A;  2YXY A;  3JSN A;  4YIP A;  4U3F H;  5LYJ B;  2FB5 A;  4EGK A;  3VQY A;  3ZIA G;  1SQP H;  1XEQ A;  2Y0P A;  2ZDY A;  3C90 A;  3INW A;  2Y4T A;  1N4C A;  1OCO C;  5FLX N;  3ASO B;  3K9S A;  5CA3 A;  3EKR A;  4YJ2 B;  4O0B A;  2UU9 B;  2HHH B;  3W7S A;  2DWD C;  4U3J B;  2GDS A;  2X0L A;  1XNR B;  1PKX A;  1SQQ H;  2KB1 A;  3KCX A;  4GX0 A;  4YKR A;  4I5S A;  2HEP A;  5B1B C;  2A79 B;  3F5T A;  4MVS A;  3T1Y B;  1PPJ H;  4NKG B;  1BGQ A;  2V7Q G;  3FAV A;  2YEB A;  1DTO A;  3ZKD A;  1XHX A;  5EYP B;  1XDC A;  5KUM A;  3CRL A;  3AG1 B;  2LGQ A;  2OWO A;  1FD9 A;  1NI8 A;  5LMU O;  2BU6 A;  1EM1 A;  3AG2 B;  3IJ4 A;  2BTQ A;  2NLJ C;  3U0Z A;  4YKW A;  1E79 G;  4D6T H;  2QM8 A;  5LGN A;  2IU3 A;  4EMV A;  3QTC A;  1S14 A;  3O6O A;  1YC3 A;  2IOR A;  3QDD A;  2F43 G;  2QA4 V;  3HKC B;  2YI9 A;  4LF5 B;  1IBL B;  1RSO B;  2KSD A;  2UXN A;  3ABL C;  2FTK A;  4CZZ A;  4O2B B;  1EZJ A;  5IYZ B;  2XJG A;  3MHH C;  5B3S B;  4ASA A;  4L87 A;  5EC1 C;  3A0X A;  3W7X A;  2NR5 A;  3RYI A;  1XMO O;  2YIB A;  1S16 A;  1UYF A;  4V26 A;  1YDX A;  2XAQ A;  1JM6 A;  2ZE7 A;  1YTF D;  4E01 A;  2DN9 A;  5BOD A;  2Y0I A;  3D36 A;  2FYP A;  4Q20 A;  4DUY B;  4X89 A;  3G71 V;  1YT0 A;  4MP2 A;  1KKC A;  3ZJZ A;  4GKJ O;  5LXT A;  3P30 A;  4DV1 B;  3OTO O;  1WP7 A;  4XKK A;  1YJ9 V;  4HYP A;  1QLN A;  1TGO A;  1NS1 A;  2N04 A;  2VCI A;  1QLE C;  1HNX B;  4IHJ B;  1FJG O;  1YTF B;  1BQ0 A;  1KKD A;  2XT9 A;  3RYH A;  2QWP B;  2ARH A;  1HDJ A;  4LP0 A;  1Z2G A;  1YCI A;  4ZHQ A;  3MD0 A;  3H1K H;  1Y4U A;  4F6R B;  3CCQ V;  4F6R A;  1WB8 A;  4N21 A;  4Z1V A;  2YE4 A;  2PGG A;  3D3Q A;  2DJV A;  4LBE C;  3J80 N;  3SR2 C;  1A32 A;  1IDS A;  4LWS B;  1L0O A;  5IE9 A;  1RFY A;  5B1B B;  3HHU A;  4W7T A;  2M7W A;  3CSX A;  1YJW V;  4BIZ A;  3KE6 A;  3I56 V;  1I94 B;  3FB5 C;  3RYF B;  1UY9 A;  4H37 A;  2JRI A;  2ZXW B;  4B7K A;  2ATK C;  3WB1 A;  3ETD A;  2A7W A;  3ABU A;  1PL4 A;  5L3B A;  2B5U A;  2MK3 A;  4ZBM A;  5KLV H;  2FL4 A;  2JEU A;  4ZHQ B;  2VQF B;  3CCR V;  2AKP A;  1UYG A;  4HXZ A;  4PA3 A;  3G6E V;  5JWP A;  1EN5 A;  1WA8 A;  1MNG A;  3JAW A;  3N2G A;  4FLU A;  4NH9 A;  2GQP A;  4DV2 O;  4LF9 O;  2HR3 A;  2EJ7 A;  2ZR3 A;  4R6Z A;  5M4N A;  3HZ1 A;  4MSW C;  4MVZ A;  1YT1 A;  4H85 A;  3OMA B;  2PY5 A;  2XTA A;  1VQP V;  1U96 A;  1Y8O A;  5D6P A;  3C3S A;  2WAM A;  2XJJ A;  5BMV B;  5IJ0 A;  3SYQ A;  1TUE B;  1JMK C;  2D3O W;  3TZ0 A;  4YKZ A;  5D5Q A;  4JAU A;  2O1V A;  2GSM B;  3E86 A;  1VP7 A;  4FLY A;  1AVM A;  3U2D A;  1SF9 A;  4J7J A;  2H3O A;  2XK2 A;  2BYH A;  4OPA A;  2YGE A;  4DV7 B;  1VQ4 V;  1U0Z A;  2XHB A;  3ABM B;  2YI8 A;  3SJC C;  1H8E G;  4UCO A;  2CK3 G;  3FKS G;  4L8J A;  4JI4 B;  4LFC B;  3EHB B;  2NN4 A;  4FZ1 A;  3OW2 U;  4B7E A;  2IWX A;  2EX3 A;  4O05 A;  4JI1 B;  4QE7 A;  4FLZ A;  4R3M A;  2Q7H A;  3K04 A;  4FZ0 A;  5IWA O;  3UO3 A;  4UVA A;  2YJX A;  2AHY A;  4B3S O;  1XNQ B;  4GYC B;  1BGY H;  3JCZ A;  4LNU A;  1B63 A;  4PHZ A;  2ZCE A;  5EYP A;  1KP3 A;  2GHY A;  3T1H O;  4DV7 O;  3T1K A;  1GH6 A;  3K5N A;  4X62 B;  3OW6 A;  4WFE A;  1Z5B A;  2YSU B;  3B26 A;  2CGO A;  4B3M B;  2OYQ A;  2YI0 A;  3B25 A;  4J42 A;  2HHH O;  1VQN V;  1P84 F;  3RT3 C;  1VIB A;  4WFG A;  4MTX A;  1BT8 A;  2DYR B;  1BZK A;  4JI1 O;  5J2T B;  4JAS A;  2RNB A;  2IJH A;  1S3J A;  3FD9 A;  4KL1 A;  1MX0 A;  3WQ9 A;  1H2K A;  2ZXW C;  4PA6 A;  4WF9 V;  3DSQ A;  2C1G A;  4B3T O;  5L3C A;  5CTY A;  4E00 A;  2NNU A;  4ICG A;  3B2E E;  3BA8 A;  3BA9 A;  4X1K B;  5GON B;  2EZO A;  2E76 B;  4JI6 B;  2ZIO A;  2HG1 A;  2R9A A;  1DF5 A;  2PZS A;  1VF6 C;  1N34 O;  4RO2 A;  2P22 C;  1X4T A;  4DZY A;  1ARO P;  2XHR A;  2VCJ A;  2WPD G;  3G80 A;  2OTJ V;  4XE2 A;  1B3Q A;  4DW1 A;  3OMI B;  3AG1 C;  1Y67 A;  2CDY A;  5EBL C;  4YJ3 B;  4LWG A;  3TXS A;  4FCR A;  1BHA A;  4X62 O;  3CGY A;  1WA8 B;  5KMG A;  2CE4 A;  4GKK O;  4AIL C;  1O9G A;  1GKF A;  2WI1 A;  3JD2 A;  2QWO B;  1FXK A;  4PA7 A;  2QE7 G;  4MTG A;  1OCR B;  4PI0 A;  4WFF A;  4LF6 O;  2E0A A;  3D8C A;  3LSU A;  4AWP A;  1F4M A;  4LFA B;  5B3S C;  3ZHT A;  2RQ6 A;  4EFE A;  1R3I C;  2PUS A;  4DO2 A;  4JQL A;  3PJS K;  4K8Z A;  3O9O A;  1VQ6 V;  2WEP A;  4LWE A;  1YSZ A;  3F5W C;  1D5N A;  4KP4 A;  4DV4 O;  1HNZ B;  1TVK A;  3LSS A;  1Q7Y W;  2YJW A;  3RLQ A;  1AMW A;  3VOU A;  3LUT B;  3U10 A;  4TWK A;  1KEC A;  5F5R A;  3KKY A;  3CPW U;  2YE2 A;  4X88 A;  3CME V;  1AH6 A;  4JPR A;  5J2U B;  2HCH A;  1VF7 A;  5B1O A;  3WFV A;  5K1X A;  1CXZ B;  3A8T A;  4LF6 B;  4NH8 A;  2DQ0 A;  4O04 A;  3OEH G;  4FM1 A;  2ZE8 A;  1WN7 A;  4PRX A;  4DUY O;  3ML0 A;  1NTM H;  4CH3 A;  3ZED A;  2YE8 A;  4JF3 A;  3HKE B;  2DYS C;  1FFX B;  3T2M A;  1YET A;  1MZF A;  5L3J A;  5BOC A;  2XAH A;  4JTC B;  4ZI7 A;  3OEE G;  1VF5 B;  2BOC C;  2CTQ A;  3RYC B;  2DQ3 A;  4GFN A;  3SYC A;  3IC9 A;  5LOV B;  4FFB A;  3JAS B;  3LDD A;  3SYP A;  1VQ9 V;  2QGN A;  2WA3 A;  3JSL A;  4HYM A;  1ID0 A;  3OFN G;  4DV3 O;  1QHT A;  4BXI A;  2AHZ A;  2OCC B;  3BEH A;  4CC6 A;  3JD1 A;  4BR6 A;  4DYL A;  2GTS A;  1FYJ A;  2QWQ B;  3RGB A;  1OCC C;  5FPO A;  4JI7 O;  3FYE B;  3OE7 G;  1UY8 A;  3H80 A;  2ZM6 B;  2KQX A;  4DR5 O;  3Q5L A;  3JAL A;  4I3H A;  4I0X A;  4U7N A;  2IM9 A;  2H94 A;  3HKB A;  3OGC C;  1IBK B;  3CB2 A;  3HPL C;  2ITC C;  3U11 A;  5FL7 G;  2KG7 A;  3UO2 A;  5BR8 B;  3OWB A;  1L1F A;  3ABK C;  4TQF A;  5CBF A;  4AS9 A;  5KHK A;  4RUF A;  4EB6 A;  1BS3 A;  4L8Z A;  1R6T A;  2WI4 A;  2O57 A;  4WUD A;  4J80 A;  3AK3 A;  4ZKI A;  5M4M A;  5H9C A;  1NVP B;  4I4T B;  4OGQ B;  2ZKO A;  5J71 A;  1AJN A;  3W7U A;  2R72 A;  3OD4 A;  1QCE A;  3A0B Z;  4DUZ O;  1K3E A;  3S5T A;  4GZR B;  4XD8 A;  2E5L B;  3L70 H;  3RBZ A;  1WNS A;  2WA4 A;  1L8D A;  4HY1 A;  2IOQ A;  4KSH A;  2YK9 A;  4FMT A;  1S72 V;  3Q4H B;  2BT0 A;  4MP7 A;  1T5E A;  1GN2 A;  1AI4 A;  3I5D A;  5LYJ A;  3T1C A;  4PRV A;  2Q9L A;  4YIO A;  2P06 A;  4CH5 A;  3T10 A;  3ZRV A;  1ZSP A;  2RJZ A;  4A5U B;  2JVD A;  2RCV A;  1K34 A;  3DC5 A;  2YE7 A;  4B6C A;  1V55 B;  2ILM A;  2YIA A;  2Q0O C;  4DV0 O;  3RYI B;  3LNN A;  3J7A U;  5JCO C;  2A0L A;  3EHJ A;  2QM7 A;  1OCR C;  3TK1 A;  5IYZ A;  2B1G A;  2XHT A;  4HZ0 A;  4X65 O;  1AJP A;  1QZR A;  4BIO A;  2X6B A;  4X64 B;  2DYR C;  2Q68 A;  4X8A A;  1XIL A;  3BAA A;  1SET A;  2PYL A;  2QTS A;  3RLP A;  1KMI Z;  1J95 A;  4MBC A;  4L93 A;  2UXD O;  4B7P A;  4BIU A;  4DV5 O;  4EFB A;  2QWR B;  4X20 A;  2R9R B;  4BWA A;  3SJA C;  3ICX A;  1Q8I A;  2QFO A;  2IWS A;  3ZRW B;  1TVK B;  1EI1 A;  4G27 B;  4DR4 B;  1FXH A;  4P2Z A;  4UV8 A;  2XCM A;  5ITZ B;  1N0N A;  4I9Q A;  3LNM B;  3CCU V;  4AWQ A;  3K06 A;  4QJF B;  3FB8 C;  1H8H G;  1BL8 A;  3HZ5 A;  3ZHS A;  3GVM A;  4DR3 B;  1GAX A;  1IXB A;  1NU1 H;  3TCU A;  1BYQ A;  5KMG B;  5EBM C;  3AG7 A;  2HJD A;  3E83 A;  5GW7 A;  3UT5 B;  3VQX A;  3STZ C;  2JK5 C;  3DGE A;  5LL6 Y;  1Y4M A;  2CTP A;  5LXT B;  1UYI A;  2Q7E A;  2EUL A;  3TZ5 A;  1FFT B;  3JAS A;  3DXR B;  2WLN A;  5A9G A;  3E89 A;  4EEH A;  5H6Q A;  4DRX B;  5L3G A;  1ZX3 A;  3SDL A;  5IWA B;  3CXH F;  2WER A;  1ZWI C;  3D2R A;  4CH4 A;  3CJH B;  4AWO A;  1OCC B;  3OR7 C;  2Z0A A;  4PJ0 Z;  4N23 A;  3D36 C;  4AQY O;  4DK0 A;  4WCE V;  1S5H C;  2OCH A;  1ZXN A;  4E02 A;  4QGP A;  2W0F C;  3HKB B;  3SPC A;  5FPR A;  5J2T A;  2XDX A;  3OMN B;  2CH7 B;  1H2N A;  2HKO A;  5CTX A;  5H5N A;  2Y4U A;  3ABK B;  1ZLZ A;  3CRR A;  1UYC A;  4FJC C;  2BSK A;  2DYS B;  1NH2 B;  1YER A;  2ZE5 A;  4DV6 B;  1SES A;  4U93 A;  1BSM A;  3SYO A;  2FWZ A;  3VQV A;  2ZNJ A;  1N33 B;  3QVN A;  4X1Y B;  3ZS8 C;  1JCH A;  2YEH A;  4PEL A;  4LF5 O;  1YXB A;  1FS0 G;  3TUH A;  4JYA O;  3C0E A;  2Q0A A;  2WLI A;  1MSW D;  2OCC C;  4TT3 G;  2WSS G;  4YKQ A;  2X7R B;  4KHP O;  4PDL A;  1IUR A;  1I5B A;  1AI5 A;  1XRE A;  4U3J A;  4DR7 B;  1U2O A;  3K60 A;  2OTL V;  1M5I A;  2XX2 A;  2EIJ B;  4F4L A;  1UY7 A;  4NB5 A;  1K97 A;  1EBO A;  1NHI A;  3JAR A;  1VAR A;  4ASU G;  5B1A B;  1YIT V;  3A0W A;  1DGS A;  3EHG A;  5CF0 A;  1TID A;  3NR7 A;  4YHH B;  4LWH A;  2ADP A;  4XBF A;  3A2F A;  4DR3 O;  4GX1 A;  2UWD A;  4UV9 A;  4PDM A;  2Y69 C;  4XKO A;  1QY8 A;  2R9I A;  4PU9 A;  4YY3 B;  3BFR A;  5GTH Z;  3ZXO A;  5CA0 B;  5JVD A;  3HKD B;  3RWR D;  5FWK A;  3L74 H;  5F3K A;  4HYO A;  4KSG A;  2HVJ C;  3ZCC A;  3OTF A;  3SPG A;  2YKC A;  3VHA A;  4O2B A;  1Q5O A;  3BMY A;  1Q6H A;  1GRJ A;  1H2M A;  4JI8 O;  2DWE C;  3AG3 B;  3CWV A;  3CRK A;  4LPB A;  1WB7 A;  2BE3 A;  1BHB A;  5KHH A;  4IGG A;  1YJN V;  4UCR A;  3QF7 A;  2ADQ B;  4YY3 O;  4X9L A;  2ITD C;  3CC7 V;  2YE9 A;  4ASF A;  1Y8P A;  2N05 A;  3VQW A;  2XJX A;  4GGL A;  3K03 A;  4DUZ B;  3FAV B;  1GMG A;  3PN1 A;  3OR6 C;  1MU5 A;  4J41 A;  3E35 A;  3SJB C;  4WUC A;  4NTW A;  2XD6 A;  1V55 C;  3R4P A;  4XTJ A;  2YDE A;  1MZE A;  3IGA C;  4IL6 Z;  4CBC A;  4EFT A;  2ZQM A;  1M57 B;  3HB3 B;  1RP3 B;  2Q4P A;  2QG2 A;  3OWD A;  3JD4 A;  5JJE B;  4LF9 B;  1PV0 A;  2XHX A;  1R3K C;  4LFB O;  4NR1 A;  1M9N A;  2L35 A;  4O07 A;  2ZDI C;  2ZD9 A;  1NBM G;  5E79 Z;  3HKE A;  3G4S V;  3K5O A;  2DOS A;  3GIG B;  4ZOL A;  4XIQ A;  1JFF A;  1SZT A;  1V54 C;  2H8P C;  1TA8 A;  5BMV A;  2WI3 A;  3HYY A;  1GKZ A;  4UFZ A;  3LMM A;  5CTU A;  4XIP A;  3WB2 A;  1YF2 A;  3LNU A;  2UXC O;  4RQE A;  4X65 B;  2R70 A;  4CS3 A;  2P4V A;  3WB0 A;  3E22 A;  5F2V O;  4ASB A; 
#chains in the Genus database with same CATH homology
 4PA7 A;  1JX9 A;  5KA6 A;  5CMU A;  1M1K W;  2QE7 G;  4MTG A;  1OCR B;  4WFF A;  3OUF A;  3WG7 C;  4WFB V;  1F4M A;  5DN6 G;  4UVB A;  5B3S C;  1QVG U;  1K4C C;  1S0V A;  1R3I C;  1NR1 A;  4DO2 A;  2ZR2 A;  3ZMT A;  3PJS K;  2WLH A;  3JYC A;  3ETE A;  1Q82 W;  1VQ6 V;  3R65 A;  1WLE A;  1VQL V;  2YEV B;  2JEX A;  3F5W C;  4KP4 A;  1VQM V;  3LSS A;  1Q7Y W;  3VOU A;  3LUT B;  1QLE B;  3AEI A;  3JD0 A;  4MW8 A;  4TWK A;  1KEC A;  3CPW U;  3QO8 A;  3X2Q B;  2IW5 A;  4X88 A;  3CME V;  1RM1 B;  3OM3 B;  4JPR A;  2HFE C;  3F7V C;  5B1O A;  1OHH G;  1KD1 W;  3K3W A;  3WFV A;  5C93 A;  4P9O A;  4QPK A;  4TSF G;  2DQ0 A;  2JDI G;  3OEH G;  5BZB A;  2EIJ C;  1W0J G;  3ML0 A;  2LP7 A;  1R6N A;  2QKS A;  4GX2 A;  4MTF A;  1W2B U;  1B6Q A;  3K0D A;  4JF3 A;  4LC1 A;  3SPJ A;  2DYS C;  3T2M A;  2EIN B;  4RUE A;  2XAH A;  4JTC B;  4YXW G;  3SYA A;  3CMA V;  3RVZ A;  1K73 W;  3STL C;  1VQ8 V;  3OEE G;  2BOC C;  5CBG A;  3ZMV A;  2DQ3 A;  4QE9 A;  3SYC A;  3T4D A;  3CD6 V;  2LFS A;  3LDD A;  3SYP A;  1VQ9 V;  3NXS A;  4MW3 A;  1DF4 A;  2Z5U A;  3B77 A;  4GX5 A;  3OFN G;  3KG2 A;  3H01 A;  3CCS V;  5LHH A;  3BEH A;  2AHZ A;  2OCC B;  3JD1 A;  1JJ2 U;  2Y48 A;  5LHI A;  2JIZ G;  4MVU A;  5LBQ A;  1GM9 A;  1FXK B;  1OCC C;  3X2Q C;  3FYE B;  5H6R A;  3MHS C;  1THZ A;  3ZMS A;  1NR7 A;  3OE7 G;  4R8C A;  3SJQ C;  5CBH A;  1R3J C;  1GM7 A;  3CCM V;  1MG1 A;  2WLL A;  3W7W A;  3B8N A;  3B8M A;  3FB6 C;  5EC2 C;  3ZN0 A;  1JVM A;  2P7T C;  3AG2 C;  4WFH A;  1S76 D;  4MVQ A;  1OCO B;  5IYB O;  4U7N A;  2H94 A;  2XND G;  3OGC C;  3HPL C;  2ITC C;  2B1I A;  1K33 A;  3FB7 C;  1KP2 A;  3CC2 V;  5FL7 G;  2P6J A;  3M99 B;  1L1F A;  4FIP C;  3ABK C;  4PDR A;  4RQF A;  5CBF A;  3ZMZ A;  4MT8 A;  2ZDI A;  2P67 A;  2WLJ A;  1I5Y A;  1IXM A;  3QNE A;  5B1A C;  1E1Q G;  5IDJ A;  4QIW F;  1N8R W;  4RUF A;  4QPJ A;  1ROP A;  1GM8 A;  2XAF A;  3CCV V;  4RAI A;  3FYI B;  4ZKI A;  5H9C A;  1NVP B;  2Y69 B;  1AJN A;  1P4R A;  3W7U A;  2HLD G;  2EZP A;  1I5X A;  1QBZ A;  1QCE A;  3JD3 A;  1K3E A;  5LHG A;  3E8G A;  2W6J G;  3I55 V;  3RBZ A;  2X6A A;  2Q6A A;  4FK5 C;  3LSQ A;  2IJK A;  5HFL A;  2P90 A;  3SPH A;  1M56 B;  3GWO A;  4FMT A;  5L3E A;  2A9H A;  1AI7 A;  5IYC O;  1KC8 W;  1S72 V;  1S77 D;  3K0G A;  4JTD B;  4PA9 A;  2EJR A;  5L3D A;  3UKM A;  1LNQ A;  4WFA V;  1AI4 A;  1V54 B;  3T1C A;  5HFM A;  2EIK B;  3ZIA G;  3ZRV A;  2EIM B;  3ASN C;  3OUS A;  1K34 A;  1OCO C;  1V55 B;  1ENV A;  3ASO B;  3K79 A;  1PNM A;  3E8H A;  5CA3 A;  1NKD A;  1FXV A;  3W7S A;  2DWD C;  2A0L A;  3OAA G;  5LGT A;  2QM7 A;  1OCR C;  2X0L A;  1JQ0 A;  1GK9 A;  3CCE V;  1COW G;  1PKX A;  3TK1 A;  2B1G A;  1AJP A;  4GT1 A;  1E1R G;  2X6B A;  1CEZ A;  2DYR C;  2KB1 A;  2Q68 A;  2K1E A;  4GX0 A;  4LCU C;  2YEV A;  1QR9 A;  1W0K G;  4X8A A;  2HVK C;  1M57 C;  4I5S A;  5B1B C;  4G28 B;  2A79 B;  1SET A;  5CN0 A;  4MVS A;  2WLL B;  1J95 A;  1AI6 A;  2V7Q G;  4UVC A;  1MAB G;  3CYO A;  1DTO A;  3CCL V;  1AR1 B;  4BIU A;  1H38 A;  5J9P C;  4MVR A;  5KUM A;  3AG1 B;  2R9R B;  3P32 A;  5KUK A;  3AG2 B;  3ZRW B;  2NLJ C;  1SRY A;  1GO3 F;  3K9A A;  4G27 B;  1E79 G;  4LP8 A;  1FXH A;  2QM8 A;  4JTA B;  1R3L C;  2IU3 A;  4P2Z A;  4UV8 A;  5LGN A;  1NJI W;  2F43 G;  2QA4 V;  1XL4 A;  3LNM B;  2UXN A;  3ABL C;  3ZRX A;  3CCU V;  2FTK A;  1BMF G;  4CZZ A;  1EZJ A;  3K06 A;  4QJF B;  3FB8 C;  3MHH C;  1H8H G;  1BL8 A;  5B3S B;  4QNH B;  2WLI B;  4MVM A;  4L87 A;  1QVF U;  5EC1 C;  3W7X A;  3TCU A;  1OZ0 A;  2XAQ A;  4JYC A;  4JGS A;  5EBM C;  1YTF D;  2XAG A;  3E83 A;  5GW7 A;  3STZ C;  1KQS U;  3E8F A;  2JK5 C;  3D36 A;  3DGE A;  4Q20 A;  5EBW C;  4I9W A;  4X89 A;  3G71 V;  1VQ7 V;  1G4Y B;  1K9M W;  1Y4M A;  4HZ3 A;  3ZJZ A;  1PL0 A;  3P30 A;  1JPX A;  1FFT B;  1R73 A;  2WLN A;  3E89 A;  5H6Q A;  2JJ2 G;  4UUJ C;  3E8B A;  5L3G A;  1NH2 D;  1ZWI C;  1YJ9 V;  1QLN A;  4JAV A;  2WLM A;  1FXK C;  1QLE C;  1VQ5 V;  2Z3Y A;  1OCC B;  3OR7 C;  3AG4 B;  4KUM A;  3ASN B;  4N23 A;  1YTF B;  1KKD A;  4E2L A;  4WCE V;  1S5H C;  4EKW A;  3QO5 A;  2QEX V;  3MD0 A;  1DLB A;  3CCQ V;  4N21 A;  1K7D A;  2W0F C;  3SPC A;  3LDE A;  3OMN B;  4LBE C;  2Q67 A;  2HKO A;  1VQO V;  4XDL A;  4PDV A;  1UJW B;  3ABK B;  3F7Y C;  4FJC C;  2DYS B;  2WLK A;  1NH2 B;  5DM6 V;  2QTO A;  1SES A;  1RPO A;  5B1B B;  3SYO A;  3ABM C;  2M7W A;  1YJW V;  4BIZ A;  3CCJ V;  3I56 V;  3FB5 C;  1R6K A;  3SPI A;  1JCH A;  1HWY A;  4J9Z B;  2OT5 A;  4H37 A;  1ORQ C;  1WPX A;  2ZXW B;  3RW0 A;  2ATK C;  4PEL A;  2IJJ A;  3ETD A;  3ABU A;  4JYB A;  5L3B A;  4XDJ A;  1FS0 G;  3ZRW A;  4BAY A;  2B5U A;  1RM1 C;  2MK3 A;  3DTU B;  3ZN1 A;  2WLI A;  1MSW D;  2OCC C;  4TT3 G;  4ZBM A;  2WSS G;  2JEU A;  2X7R B;  4PDL A;  3CCR V;  1AI5 A;  4PA3 A;  3G6E V;  1OCZ B;  3CXC U;  2HJF C;  2OTL V;  4U7O A;  2HR3 A;  3CP1 A;  2ZR3 A;  4R6Z A;  2EIJ B;  4F4L A;  4MSW C;  4MVZ A;  3RVY A;  4UXN A;  2XAJ A;  3OMA B;  1K97 A;  1EBO A;  3IC7 A;  3ETG A;  1YI2 V;  1GTO A;  1VQP V;  2XAS A;  4ASU G;  5B1A B;  1YIT V;  1K8A W;  3D3I A;  2WAM A;  2JJ1 G;  2IJI A;  4MVO A;  1TUE B;  1K5Q A;  2EIL C;  3SYQ A;  4XBF A;  3ABT A;  2D3O W;  4JAU A;  1AJQ A;  4GX1 A;  3ZMU A;  2EBO A;  2GSM B;  3E86 A;  3TET A;  2IH3 C;  2IH1 C;  3A0R A;  4UV9 A;  1YSC A;  1G8M A;  4PDM A;  2Y69 C;  1Q81 W;  2R9I A;  1F23 A;  3ZRS A;  1XL6 A;  1VQ4 V;  3WG7 B;  3ABM B;  2V1D A;  5LGU A;  1H8E G;  3LDC A;  4HYO A;  1YIJ V;  1RPR A;  2UXX A;  1JOY A;  2HVJ C;  2Q69 A;  3ZCC A;  2CK3 G;  4P9P A;  3FKS G;  2W6I G;  3SPG A;  3CC4 V;  3EHB B;  4GCZ A;  3AG4 C;  3OW2 U;  2IU0 A;  4QE7 A;  2DWE C;  3K08 A;  3AG3 B;  1M90 W;  3K04 A;  1BHB A;  1QR8 A;  4UVA A;  4R50 A;  2PI4 A;  1YJN V;  2PI5 A;  2AHY A;  1SER A;  1K4D C;  3JCZ A;  2ITD C;  3ASO C;  3CC7 V;  1YHQ V;  4P30 A;  1KP3 A;  2GHY A;  4FPP A;  3K03 A;  5IY5 B;  4WFE A;  2EIK C;  2YSU B;  3UM7 A;  1GMG A;  2WWW A;  3OR6 C;  1VQN V;  3E35 A;  4HAM A;  1MOF A;  1P7B A;  4XDK A;  5IYD O;  4WFG A;  4MTX A;  1V55 C;  1NQT A;  2DYR B;  4Z1M G;  3IGA C;  4CBC A;  4JAS A;  2IJH A;  1S3J A;  2ZQM A;  1M57 B;  3HB3 B;  4PA6 A;  1PNL A;  2ZXW C;  4WF9 V;  3JD4 A;  5L3C A;  1R3K C;  5B1N A;  3T4Z A;  4R7C A;  1M9N A;  3W7T A;  2NNU A;  4DXW A;  2ZDI C;  3GB7 C;  2ZD9 A;  1NVP D;  3VBB A;  1NBM G;  2XOK G;  2HG5 C;  2EZO A;  5L3F A;  2BOB C;  1CPY A;  1OCZ C;  4KFM A;  1K5S A;  3QO7 A;  2X6C A;  3G4S V;  2C2A A;  1M56 C;  4H33 A;  2LFR A;  1EFR G;  4J9Y B;  4OXS A;  1DF5 A;  5E1A C;  3IFX A;  4RO2 A;  4PA4 A;  1ARO P;  3EFF K;  2WPD G;  2OTJ V;  4BW5 A;  3BY6 A;  1V54 C;  3AG3 C;  1SZT A;  1F51 A;  1CP9 A;  2H8P C;  5EK0 A;  1VQK V;  3ABL B;  3OMI B;  3AG1 C;  1PNK A;  1K92 A;  2EIM C;  4MTO A;  1PD3 A;  2EIL B;  5EBL C;  5KA5 A;  4MS2 A;  1BHA A;  1Y66 A;  2EIN C;  2DW4 A;  4RQE A;  1Q86 W;  1GKF A;  3E2E A;  3JD2 A;  5IY5 C;  4G2K A;  1H2G A;  1FXK A;  1F4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...