1IXMA

Crystal structure of spoob from bacillus subtilis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
168
Chain Sequence
SDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDIMRFEITSHECLIEIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formation of a novel four-helix bundle and molecular recognition sites by dimerization of a response regulator phosphotransferase.
pubmed doi rcsb
molecule keywords PROTEIN (SPORULATION RESPONSE REGULATORY PROTEIN)
molecule tags Transferase
source organism Bacillus subtilis
total genus 56
structure length 168
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
A PF14689 SPOB_a Sensor_kinase_SpoOB-type, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ixmA01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 1ixmA02
4JASA 4BIZA 5B1NA 3ZRVA 5B1OA 3P32A 2LFRA 4JYBA 4LC1A 2LFSA 5C93A 3MD0A 4FPPA 3ZRWB 1IXMA 3A0RA 4QPJA 4MTXA 3DGEA 1F51A 3ZCCA 5IDJA 3ZRXA 3ZRWA 4Q20A 3NXSA 4JYCA 4GT1A 4JAVA 4KP4A 2QM8A 3TK1A 4FMTA 3D36A 4BIUA 4U7NA 2QM7A 2C2AA 2FTKA 4MT8A 2P67A 4QPKA 4ZKIA 4GCZA 1JOYA 2WWWA 4I5SA 4U7OA 4JAUA
chains in the Genus database with same CATH superfamily
3CJHA 5GW7A 4LF4O 1AJNA 2DQ3A 1LUVA 4GX5A 2NN4A 3TZ4A 2YEVB 3HPLC 1BL8A 4D7TA 2YEFA 1N4CA 1UYIA 3OPDA 2CTQA 2Y4TA 4XD8A 4EKWA 4PD4F 4GQTA 3UKMA 1SQXH 3MDSA 1S5JA 1NH2D 1GAXA 5JENA 3K58A 1IX9A 3EHGA 1YITV 1JM6A 2AHYA 2QWOB 3FFQA 2B1IA 1DF4A 5KHIA 3CRKA 2BE3A 2UU9B 4XDMA 1S5LZ 1QBZA 1YJNV 1B62A 2B1GA 4J9ZB 1Q86W 4BW9A 4KFGA 1I5AA 4LWEA 2ZM6O 1KIJA 5CTXA 3RYIB 4K3AA 3QVNA 1KQSU 2P4VA 3O2FA 1YTFD 1NTKH 1TUEB 3JAWB 5CB4A 4TV9B 1BYQA 5JCOA 3A0YA 4YJ2A 2BZ5A 4X65B 2UWDA 1GK9A 2GHYA 2WLIA 4NTYA 3J80N 3SJBC 5BXZA 4DV5O 4FJCC 2ZE6A 3WB1A 3N2GB 4LFBO 1XHZA 2IORA 5BOCA 1GN6A 1H8HG 3ETGA 3K5OA 2QM7A 5CF0A 3G4SV 2UUCB 4LFCB 2ZE8A 4JYYA 1Y76B 5IDMA 4NTWA 1TC0A 3K0DA 4XDKA 3C90A 2A3QA 3H80A 2YKIA 1Q43A 3ABKB 2QFOA 1WAZA 3STLC 2YEVA 3GIGA 2Y69B 2M7WA 1ORQC 4I9WA 4XCJA 4OX9O 4CH4A 4Q6GA 2XX2A 4GCZA 1WPXA 2WWWA 3W7TA 1SZTA 5LBQA 4CE2A 1KBHA 4XTJA 2ZQMA 1K9MW 2XDUA 2CTPA 2G38A 4BIZA 5B66Z 5EYPB 2HHHB 4DR1B 4O09A 1PD3A 4Z1MG 4UV8A 3TJTA 3ZXOA 4JPRA 2WEPA 2ZIMA 2CH7A 3OM3B 3QTFA 4EEQA 2UXDO 2QKCA 1MZEA 2Q7GA 1Q5OA 2KSDA 5LYJA 3TGUH 3QTCA 4JTCB 4FLXA 3EXAA 1GM9A 3K99A 1K97A 5KHJA 3T1KA 2WPDG 2YI8A 1NVPB 2QE7G 5LMNB 4DUYB 2ZDIC 3T1HB 2V4DA 3OUSA 2YE8A 4LF9B 5D5QA 1XL6A 2LQTA 4RWUA 5FNVB 3GVMA 2JDIG 4DR5B 3K57A 4I55B 1MZFA 2BTQB 2XDKA 4PI2A 4CWTA 3FV5A 4UCVA 1PNLA 3A0HZ 2BU7A 2QM4A 4GKKO 4EFTA 1ZXMA 4R3AA 1IBKO 1U0ZA 2MK3A 1VQ6V 2LJ2A 2UUBO 3AG2C 1AP6A 4DO2A 2BSMA 1AR4A 2P22C 4YJ3B 5B1AC 4PDMA 4MVRA 3VOUA 3H01A 3ZXQA 3D3IA 1OCRC 4U7NA 4JI2O 4B3SO 3N2KB 4J7KA 3JSLA 5LOVB 2ZKJA 2WAMA 4L87A 4MVQA 4G27B 1P7GA 3EHBB 3W7UA 5EBLC 2A0LA 3ZJZA 1Q8IA 5EYPA 3OD4A 1Z5CA 4TQDA 4HXWA 4PA6A 4B7EA 3CRQA 1PNKA 5BY1A 2EBOA 4PDLA 1UPGA 1BCCH 5D5PA 3CCLV 4FLWA 4EGIA 1QLEB 1T5EA 5A2QN 2FTKA 1ID0A 4LR3A 1DGSA 2H55A 2YGAA 4GEEA 2YEEA 1ZWIC 1BQZA 2XHRA 4PRXA 2VQFB 4UVBA 5CPHA 1V9PA 3L72H 1XMQB 4FFKA 4YHHB 2EINC 4RUFA 2YE7A 2V1DA 1K73W 4EFUA 2K1EA 4X64O 4CWSA 4EB6A 4JI1B 1UYFA 2XABA 2P5OA 1S0VA 4CH3A 4LNUA 4JYCA 1AR1B 1I58A 2E76B 4YXWG 3MNRP 3WQ9A 4YKUA 1NHHA 2ZIOA 4DV0O 2NLJC 1XUQA 1XILA 3KCXA 4NYKA 4TUYB 4WFHA 4ASGA 3RLPA 2YDEA 1US6A 2F43G 3HR0A 4YKTA 2DYSB 1W0KG 2E74B 4ZOLB 1B6QA 2GTAA 3E35A 3P3PA 2BT0A 1I5YA 4DUHA 4LCUC 2BU5A 2YEBA 2ITDC 1YS3A 3GWKC 1PL0A 3K9AA 1JJOA 1VQ7V 5KA6A 3N2KA 3FT5A 1Y4MA 4PA4A 4E72A 1G6UA 3JATA 2VS0A 4MW3A 5EBMC 4X62B 4ZVIA 3F7VC 1YT2A 3ZKBA 1GRJA 2X6CA 5J6AA 3OMAB 2BU8A 1EA6A 4B08A 1BXDA 1Y8NA 4G2KA 3ZKDA 2YEAA 2GFDA 3T0HA 5M4MA 5L3DA 1Y74B 2EIMB 1GN4A 4DV3O 2B9ZA 1KYOF 4JTDB 2JS3A 1VQ8V 4J42A 2WLLB 3UO3A 3CSXA 2OTLV 3RVZA 3W7SA 2IH1C 2CG9A 1MABG 5L3FA 2ZXWC 3AEIA 4OXSA 4DUZO 1WB8A 1M1KW 1M5IA 4X8AA 3ABUA 2JEXA 3TXQA 4WUBA 4R8CA 1MSWD 3M8AA 1JPXA 3T4ZA 4X1YA 1QY8A 4O2AB 1X59A 1PM9A 4BW5A 5J2UB 1V55B 3A0TA 1VF5B 1HNXO 4TOIA 1XNRB 3ZRWB 3EHJA 1GO3F 3CCQV 1F4NA 3R66A 4CC5A 1HDJA 3G80A 4WUCA 1QNMA 3HKEA 3K3WA 4DR6B 1Z5VA 2IOQA 2XAHA 5JVDB 2W6JG 2ZDYA 3QNEA 2FWYA 2Y48A 5LXTA 3KZIZ 4FIPC 4TV8B 5E79Z 4I5SA 3OW6A 1VQ4V 1H2NA 5B3SB 1X4TA 3CPWU 4F6RB 1XNQB 1RSOB 4YKWA 4O4LB 5CA1B 1XOUA 2IH3C 1I5DA 4JYBA 3UT5A 3E8HA 2Q8FA 1BMFG 1WNSA 5KUMA 4ASUG 3JD0A 1I7FA 2FYUH 1WB7A 1NVPD 3INWA 5BMVB 2RDCA 3O6OA 4K4OA 1OJHA 5KUKA 2Q0OC 2CTWA 4B3RO 4U7OA 1OCZB 2IW5A 1NT2B 3HKBB 3D2RA 1Y74A 2XDXA 1WP8A 3T1YO 2C1GA 3IJ4A 4H0LB 2F93B 4YY3B 2OCCC 5LGUA 1UYCA 4KFMA 1K5SA 4PA9A 4K0KO 5IWAO 1AH8A 2YI9A 3A0XA 4CE1A 4GT1A 4X20A 1IBMO 2QDOA 1WP7A 3WHAA 4DV6B 1BQ0A 1AJPA 4PHZA 4JZGA 3X2QC 1S5HC 1FS0G 2L6LA 1BZKA 2PGGA 2PUSA 4NKGB 3FB6C 1H2LA 4FLTA 1WN7A 5IYZA 4L8JA 2HG1A 4MPEA 1Z5BA 4X1KB 5J2UA 4DV7B 1MMMA 2H8MA 4O4IB 3HHUA 2YC0A 3ZRWA 1FD9A 4TQFA 1TVKA 1FXKC 1MOFA 3RT3C 1Y67A 4X88A 2EJ7A 1N32O 1FYJA 4QPKA 3CS5A 5JVDA 2L35A 4L90A 2Q8IA 2ETNA 2YE6A 4MVSA 4TV8A 4FFBB 3QDDA 2OYQA 2DJVA 1Y8PA 2F4VB 4B3TO 3ETDA 3I55V 3EKOA 1I08A 1SQGA 4YIOA 1RP3B 4X66O 1Q82W 1VF6A 5DEDA 2HVJC 1AM1A 4R6ZA 4ZI7B 1S14A 2W6IG 2XUMA 2H3OA 3B77A 3H1JH 4XCLA 2YIAA 1WLEA 4WF9V 2ZD9A 4NXNB 1B3QA 1OHHG 3SPCA 2XHXA 4HY6A 3K0GA 1VIBA 5LHIA 4J9YB 1ZW9A 4LF7B 3K97A 4DW0A 4ASFA 2YI7A 1I0HA 3HKCB 3OT7A 1BHAA 5LHHA 3H1KH 5JH7A 4DR4B 3JARB 2WI2A 4DXWA 3L71H 1KD1W 4XE2A 5DECA 3HYZA 1AR5A 3CJHB 4WCEV 5LP6C 4GKJB 3I56V 1RM1B 2GDSA 2ZBKB 2N05A 2HFEC 2QKAA 1YSCA 3K06A 4WFBV 1NQTA 2FKXA 3CWVA 1R3IC 2NNUA 4BQJA 2JGUA 1L0NH 1QQCA 4ZHQA 2O57A 4QPJA 4UCTA 2XNDG 4FCPA 4L94A 3SYPA 4X1KA 4WFEA 2CTRA 4YKYA 4J10A 1YSZA 3CMEV 3AG1B 4BAEA 3S3XA 4U93A 2YK9A 3BA8A 2GTSA 4JI0B 5CA3A 4AILC 4GLXA 3B8MA 4H33A 5J71A 1FJGO 1THZA 1U97A 1QLNA 4LWGA 4X65O 4UUJC 1QVGU 2QF6A 3JCZA 2PYJA 1FAFA 1IVSA 3JASB 2ESAA 4X1IB 4ZI7A 3FB5C 2PI4A 4DV4B 1JOYA 1HWYA 2AKPA 2RMKB 3ZS8C 1ZSPA 1NU1H 2WLIB 2IU0A 1BKNA 5M4PA 3SJAC 2QG2A 2UUCO 4NB5A 3Q4HA 1YESA 4O05A 1RFYA 2IJIA 4XDJA 3ASNC 1M57B 1SERA 2HKJA 4XC0A 1ZUQA 4AI8A 2EJRA 1H38A 1UYKA 3U10A 2FMLA 5F2VO 4JI5O 5LA6B 4NXMO 3JARA 3K08A 1VEWA 3W7WA 3LDEA 4LP8A 5KAFZ 2EILB 1IURA 3K59A 3GIGB 4JI7B 4FLYA 1QHTA 4RQEA 1CEZA 2CGOA 2GUZA 2IM9A 4E01A 4MTFA 2PY5A 3D36A 5IYDO 3Q5KA 1AI5A 2F1MA 1PPJH 3SJCC 2YICA 1Y4SA 2X0LA 4BXIA 2DYRC 1VQMV 2YI6A 1OCOC 2XAJA 3OMNB 2YEHA 1YERA 1R3LC 2HR3A 2QJ1A 3B8NA 2UUAB 3Q5JA 2LW1A 2CH7B 2QWNB 2N74A 4DUYO 3B2EE 1D5NA 1R6NA 3T1HO 4TSFG 4CE3A 5LYJB 1AJQA 4AQYB 4DR7B 3ZIAG 4JI8O 4LF9O 1UYDA 5JJJB 2JVDA 3C11A 4I50A 1FXHA 5KA5A 1EI1A 5L3BA 3H9VA 2Z5UA 3RYCA 1HR0B 4EEHA 1B06A 2EIJC 3A0BZ 3ABLC 3JASA 4X1IA 4LBEC 1XL4A 3A2FA 3JALA 1I5CA 4PRVA 2YIBD 3LNMB 1CPYA 5JJNB 1HNZB 1SA0B 4NH9A 4IGGA 1R3JC 2JK5C 2LFSA 5B1BB 4PA3A 3CCVV 2CH4A 2Y0IA 1GMGA 2AW9A 4Q20A 2VWKA 2ATKC 2QM8A 4HYOA 2HCHA 1CXZB 4ABMA 4DK1A 4FM0A 4NVPA 2CUGA 2WA4A 3BPZA 4FVMA 1QCEA 4UCSA 3B25A 2EIKC 3RVYA 4IHJB 4CH5A 1AJ6A 2BTOA 5LA6A 2IJHA 4E02A 4UROA 5M4NA 4ZIBA 3OTOO 4B7PA 3R92A 3R4MA 1Q90D 4AWOA 2VQEB 2YECA 2P7TC 2QWPB 4IYIA 2BTZA 1AILA 3OMIB 1VQKV 1TC6A 5BR8B 1GN3A 1TA8A 2AHZA 3ZX6A 3FAVA 2F95B 4MB9A 3WB0A 1XMOB 1JQ0A 5LMUB 2D3OW 3WG7B 4LWFA 5KX5A 1AP5A 1GM8A 2VQFO 2E5LB 2HHIA 1XMQO 4DV2B 3OR6C 4RUEA 2YIDA 3DGEA 4YHHO 3OWBA 1HNWB 5H9CA 2Z3YA 4H13B 5GONB 2YE5A 2XX4A 1YHQV 2QTOA 4LF4B 4JI1O 1L0OA 4PDVA 1H2MA 3EVKA 1EN5A 4ZKIA 3RLRA 4U3JA 2XHTA 4IIJB 4LF8B 2Q5ZA 3ZN1A 4OPAA 4YKRA 2BYIA 1LNQA 4EB6B 3EFFK 1H7UA 3CXCU 2HKOA 2YEJA 4GZRB 4LNUB 1OCRB 1SA0A 1VMGA 2AZ2A 3CRLA 3KE6A 1Q7YW 4CWRA 3CCRV 1YI2V 1I94B 5IE9A 2Y69C 2PI5A 2LW7A 5IT9N 1GTOA 4D7SA 1AI6A 2IOPA 2CDYA 3CB2A 4IHJA 3N27A 4KUMA 3OEEG 4WBNA 2YEIA 4FPPA 2JIZG 2HLDG 3CHXA 2KG7A 1YC4A 5H2FZ 2HJDA 4X62O 2XDSA 3D0BA 4JV5O 1N36B 4BQGA 3SGIA 2GV9A 4QE7A 4BAYA 3R4OA 2ZT9B 1Z5AA 2WA3A 2YUAA 2Q8GA 2EINB 3JATB 2ZDIA 2LO1A 3IFXA 1N33B 1H2KA 1R1BA 2EULA 3OEHG 3BEHA 3H1LH 1W0JG 3JYCA 4CS2A 4UCUA 4Z1VA 3SPIA 3STZC 5GTIZ 2WI6A 4B7KA 5IDJA 4NH7A 3RYHA 3ZMSA 3CRMA 4PL9A 3AG4B 4KP4A 2YE4A 4O04A 3OWDA 2XX5A 2Q7HA 5GONA 3OTFA 4I4TB 2WERA 3LNNA 1KKDA 3TUHA 2RQ6A 4ZBMA 1I5XA 3LSQA 4NTXA 1OCCC 1N34B 1BHBA 4XKAA 1YJWV 4IIJA 4URMA 3UCSC 3FB7C 4OX9B 3J7AU 1NR1A 3EKRA 1US7A 3AG3B 4KHPB 3EHHA 4KQVA 1NI8A 2Z0AA 3KCYA 3VHCA 2BOBC 1Z2GA 4X1YB 4I3HA 2MW2B 2CCSA 1GJVA 3BFRA 2PF4E 5LHGA 2BU2A 3F7YC 3ZM7A 2DN9A 1I59A 1TAEA 1YEWA 2DQ0A 2UXDB 1BGQA 3E22A 3UO2A 3VQWA 4D6TH 1H2SB 1WJZA 3ZN0A 3K04A 4H7QA 3WU2Z 3HKEB 1XNQO 1QVFU 3VHAA 2AXTZ 2WI5A 5LXTB 1K8AW 1VQ9V 4L93A 3THOA 3OUFA 3UM7A 2IWSA 4GFNA 1ZL8A 1H8EG 1LR1A 1QLEC 2EX3A 3UT5B 3L73H 4JGSA 2ODMA 4HYMA 4EFBA 5D6QA 3SPJA 2K5BA 3T2MA 1XBLA 1IXMA 4MP7A 5B5EZ 2YXLA 1QYEA 1EM1A 2XT9A 5J2TB 3DC5A 2W0FC 4I0XA 4V25A 2YS8A 3P3NA 1R6TA 4ASAA 4GKKB 1IBKB 3F5WC 3FYIB 4H85A 3HZ1A 4JF3A 4DV6O 3H1HH 1YZBA 3W7XA 3TZ2A 1SQBH 4I4TA 4DV1B 4IT5A 2OIEA 1L8DA 4EFEA 2GBOA 4DR3B 2DYSC 4R3MA 2FWZA 1NZ6A 3CYOA 4X20B 4B3SB 1R62A 3R4PA 3NXSA 4O4HB 2YEDA 4LWIA 4GUNA 2KKWA 1JR9A 3BRCA 3BM9A 5L3JA 3E2EA 2JKIA 2ADPA 2P90A 4PELA 3S5TA 3ABTA 4LPBA 2YJXA 5L3GA 1PVGA 3C3TA 2XJGA 5IYZB 4MPCA 3SPHA 1VQOV 4K35A 5B1NA 1IBLB 2QWQB 3RYFA 2YK2A 1SETA 2UXCB 5M4EA 2JEUA 4LP0A 1NTMH 2ITCC 2QKSA 3TTZA 3JAKB 3KKYA 1QR8A 1TVKB 2GSMB 2F4VO 1Q6UA 4GGLA 5IJ0A 2UXXA 4JI3B 1MG1A 1JFFA 1Y8OA 1MNGA 3TZ5A 1SESA 2HJFC 3IC9A 1AI4A 1F23A 3QO7A 1J5EO 4X64B 4X9QA 3SYQA 2C1IA 4P2ZA 2VCJA 1VP7A 2EIMC 5KAIZ 2YGEA 3APQA 3OE7G 2QR4A 1XQ8A 3G7BA 4O0BA 4J7JA 2XASA 4DR2B 1BGYH 3RW0A 4EGKA 2HP8A 5J2TA 2BOCC 1UY6A 4DR4O 4YKQA 5CTUA 5ITZB 4R1FA 1SS3A 5D7CA 3H4LA 4LWSB 1UY9A 4LF6B 5AG2A 2Q67A 5JH7B 3K9SA 5F3KA 3K5MA 4JAVA 1K4DC 4HZ5A 4JI6B 1JA8A 2Q8VA 1HNWO 1L1FA 1TIDA 4O4HA 2YKJA 3J81N 1Q3EA 1QU7A 2YEGA 3L70H 3SDLA 4ZHQB 5B3SC 2RCVA 4PJ0Z 1ZWHA 2WI7A 4HNAA 3CMAV 3LDDA 5JQGA 2OTJV 3BVOA 1E1RG 1LUWA 3TZ0A 1MSDA 3OMUA 4J11A 3JAKA 5D6PA 5IY5C 3BHPA 1UYHA 3DTUB 2UXNA 3RN4A 3G75A 1YSRA 4N23A 3ZBHA 4AWPA 1OZ0A 4JAAA 4CWPA 3R91A 1XDCA 1PL4A 3PJSK 3JAMN 1N0JA 4E4EA 3VQYA 3IEDA 3CE2A 1FFXA 4URLA 3Q5LA 4YKXA 2CK3G 4JYAO 4O4JA 2CGFA 2XCMA 4AWQA 5CMUA 1Q81W 4FCRA 3OFNG 3Q4HB 1AROP 4QNHB 4JI4O 5H6RA 1DF5A 5ITZA 3T0ZA 3FD9A 1SQPH 4LWSA 1M56C 4FZ1A 3JD4A 4FLUA 3O0IA 3T10A 3CWBH 3ASOB 1R6KA 3O65A 2XHBA 1FXKA 4GX0A 3E89A 1YETA 5JWPA 4H37A 3AK2A 1M4UA 1TUBB 4MP2A 1M93A 4UVCA 1AI7A 2FXSA 3P30A 3DXRB 2N04A 2QWRB 2QG0A 5IYBO 4CWNA 2XDLA 3CGZA 4AHCA 5KHHA 2GUZB 5L3CA 3VHDA 5EIBD 3A0WA 3SJQC 2YE2A 2UU9O 3KG2A 3LDCA 5LL6Y 5C8YB 1EZVH 1MA1A 4F4LA 2VW5A 1A4HA 4FMTA 1V54B 4P8OA 1MU5A 1WA8B 4AQYO 4DR7O 3FT8A 4W7TA 3CCJV 3EHFA 4UB8Z 4AS9A 2ZKOA 3TETA 1HR0O 1ROPA 3LNUA 1A32A 1PKXA 1MX0A 1SQFA 3FYEB 5J9PC 1XEQA 2YKEA 5HFMA 4LFAB 3ABMB 4I50B 3ZHUA 4WFGA 4MTOA 3K5NA 1Z59A 2D2CB 5GTHZ 2FL4A 5KLVH 3RYCB 2XOKG 1W59A 3K98A 3NR7A 1P4RA 1IZ3A 4PDRA 2Q7EA 3JALB 2O1UA 5LP6A 3SYCA 3SL2A 3D3QA 4TT3G 1AH6A 4E2LA 1JCHA 3ZRVA 1RM1C 5KHGA 4RO2A 5H6QA 1YT1A 2Q4PA 1GM7A 4LFCO 2Q6AA 2WI4A 4CS3A 2YXHA 4DW1A 2UXBB 2Q68A 4R7CA 1NR7A 4O07A 1S76D 4TWKA 3JD2A 3G6EV 4LF5B 3CRCA 4X89A 1GKFA 4X66B 1KMIZ 5BR8O 4ICGA 4FM2A 1TUBA 5TISZ 3G7EA 4UV9A 3AG1C 5B1OA 1GN2A 3DXRA 2XAQA 3CEIA 2HHHO 2ZE5A 2XJXA 4DR1O 3K5LA 1L0LH 5LMUO 3VBBA 3I5DA 1S3JA 1E79G 2EIJB 3FX7A 4XIPA 2E5LO 3CCEV 3FAVB 3JD3A 3B28A 3OGCC 4GX1A 4OGQB 5C8YA 3INXA 5D7RA 4PA7A 2Q8HA 4GT8A 4RQFA 5JCOC 5CBHA 1YC3A 5FNCA 1F7YA 1WA8A 1KUQA 5KX5B 3HEKA 3PN1A 4MSWC 1R73A 4PV1B 1YT0A 3T4DA 5LMNO 4LF8O 1BSMA 3A0RA 1Q6IA 3GWOA 5KMGA 2VWCA 1HW7A 2VWJA 1M57C 3LMMA 4U3JB 2EIKB 1PNMA 1NHIA 2WLKA 4PU9A 1ENVA 3QF7A 4FM1A 4DR5O 2OWOA 1TBWA 4FLVA 1ZTEA 4MBCA 5EC2C 3AK3A 1I94O 5FPOA 1BS3A 4J80A 5E1AC 4CWFA 2DW4A 5BZBA 1KU9A 2JGDA 3QO8A 1SC5B 2EILC 3JCUZ 4JQLA 4XIQA 1DTOA 2DMXA 4KSGA 1U96A 2CAZC 1N36O 1JMKC 2CGNA 1HP8A 1S16A 2IJKA 1FJGB 2WEQA 4DK0A 4WBNB 1N0NA 4UVAA 2OT5A 2KG7B 4XIRA 3ICXA 3CCMV 3A8TA 1N33O 4I9QA 1NJIW 4UFZA 3ZCCA 3ZHTA 4B3MB 3MAQA 1Q6HA 3CD6V 2EZOA 4B6CA 2ILMA 2X6BA 3WB2A 3LSSA 1FFTB 4O2BA 3SYAA 5M4KA 1O9GA 2O1VA 3MD0A 2OIGA 3RYHB 1N34O 3E8BA 4Z2WA 1F4MA 4JI5B 4NXMB 2BU6A 4UCOA 5B1BC 4J7ZA 3HB3B 2Q2EB 1XHXA 1FKAO 4KHPO 4CWQA 1KP3A 1AB3A 5DN6G 2BREA 1SKVA 1AMWA 1IXBA 3AG2B 1R3KC 5B1AB 1S77D 2A9HA 2FYPA 2P4KA 4EMVA 3ABKC 3G67A 2DWEC 4HYPA 1Z5WA 2RN9A 3DC6A 4MOTA 3RYIA 4CBCA 4GYCB 1EN6A 3CP1A 3MHSC 4MT8A 3JAWA 3E22B 3GIEA 1G8MA 4TV9A 4JASA 3D8CA 5KHKA 2WLNA 3OW2U 1ZX3A 2ZM6B 3GIFA 5A9GA 5FL7G 4JI8B 5CBFA 1VQ5V 4YKZA 2YJWA 4WFFA 2JJ2G 5IN9A 2ZINA 3WG7C 2YKCA 1IDSA 4MVOA 5FLXN 1THNA 2RJZA 3MHHC 1ZL8B 4DZYA 3N2GA 1JX9A 4KXRA 2BSKB 1OCCB 4L91A 2YGFA 3ETEA 3CX5F 2ARHA 4DV5B 2YI0A 3ZHQA 1Y76A 3L75H 1WPBA 3PEHA 4L8ZA 4LFBB 1YVWA 3M99B 3E83A 1OV9A 2IJJA 4I0XB 3APOA 3SYOA 4LH7A 4DV1O 4DR3O 5EC1C 2R9AA 3TK1A 4BR6A 3HZ5A 4P9OA 2BCCH 1M90W 3L9DA 3BY6A 4H44B 5K1XA 3JD1A 3B27A 1UFIA 3OTOB 2PTMA 3ZRSA 4DRXB 2DOSA 4CS4A 5DM6V 3E8GA 1KB9F 3RGBA 4URNA 2F66C 3A0ZA 3T1CA 1KECA 1O9HA 1IBLO 3B4SA 2UXCO 2JRIA 3U2KA 2H8PC 2ADQB 4XDLA 4OPHA 1XNRO 1UYMA 4FLZA 1FXVA 5FWKA 1EBOA 2EZPA 2P67A 4JI3O 2XJJA 3CRAA 4DR6O 1OSFA 3RYFB 4P7AA 4HAMA 5GGZA 5FNFA 2YKBA 2WLJA 1KC8W 3U67A 5IJ0B 4UB6Z 1XREA 2WLMA 2BRCA 1JFFB 1XI1A 1K34A 5FNVA 2AZ0A 2QEXV 1EN4A 1TGOA 1COWG 1S72V 3AG4C 5CBGA 4JTAB 3R65A 2HG5C 3T2SA 4DR2O 5EZYB 4I55A 3SPGA 3O9OA 2IWUA 3PEJA 2BTQA 2BSKA 2WLHA 3G71V 2A06H 2CCTA 4LC1A 2ZXWB 1G1XB 5C93A 3C0EA 4QGPA 4EGHA 4P30A 4MPNA 4CC6A 3ZRXA 1VQPV 2WI3A 5IJ9B 4XBFA 3AG3C 2FB5A 1YC1A 4LF6O 4YJ3A 4YY3O 1PV0A 2Q69A 2Y4UA 3RKZA 3BAAA 1SF9A 2XAGA 4JI6O 3OR7C 4DYLA 3ZMTA 1UY7A 2ZR2A 2UUBB 3S3WA 5LOVA 5H5NA 3P32A 4DRXA 3RFRA 4WUDA 4JV5B 3E8FA 2R70A 2LP7A 1UYGA 3C3SA 1VQNV 2ZNJA 4JI2B 3CC2V 5CA0B 5F5RA 1M9NA 5D7DA 3B24A 4DV7O 3BABA 2Q73A 5JJEB 3K60A 1SRYA 4QIWF 5EIBC 3ZHRA 3CCUV 4WFAV 4HNAB 1UYLA 4XKOA 5JQGB 3NMQA 2O1WA 4KL1A 3VADA 1K5QA 3JZ3A 1CP9A 1I5BA 4KSHA 3AG7A 2P6JA 4MVUA 1ZXNA 2QTSA 4BWAA 4ASBA 2XAFA 3G6BA 3IC7A 4NXNO 4TUYA 4LWHA 4V26A 5EZYA 3LUTB 4KTNA 4HXZA 4W4LA 2OCCB 1W2BU 1DLBA 1FFXB 1H7SA 4PI0A 4ZOLA 2OCHA 4LF7O 2K9PA 4IL6Z 1AVMA 1KP2A 2WSSG 2Y0PA 3IGAC 2DE0X 4DV0B 1B04A 3TCUA 4O4JB 2X6AA 3K03A 4RAIA 3X2QB 3CYGA 1RPOA 2C2AA 2X7RB 5IJ9A 4JZ2A 1K4CC 4C7UA 3U2DA 2JJ1G 2R9IA 2V7QG 1NH2B 1URFA 3FKSG 2ZNIA 2IWXA 2LFRA 4GKJO 1UYEA 3E86A 4UCRA 4K8XA 2CE4A 1UY8A 2ZDXA 4E00A 1V55C 1FXKB 3CC7V 5IY5B 5K1PA 2AGAA 4HBNA 4CZZA 2VCIA 3IAYA 3OAAG 4MS2A 5CTYA 4GX2A 3RBZA 2BYHA 5CA0A 1TH8A 3SR2C 1SQVH 2H94A 2HVKC 1P84F 3LSUA 4JAUA 2XTAA 3BMYA 1YTFB 5CTWA 1KZNA 1K92A 2E75B 1ZLZA 2WI1A 3H1IH 4FZ0A 2IBZH 2WLLA 1VF6C 4EM7A 4JI0O 2Q0AA 1SQQH 2KQXA 2QSAA 4IYHA 4QE9A 5FNDA 4DV3B 5L3EA 4LFAO 4CH6A 2F23A 2ZE7A 4CWOA 1K3EA 1BE3H 1UJWB 2VRZA 1JJ2U 5LGNA 4FCQA 4O2AA 4HY1A 2QGNA 2P06A 4U3FH 4DV4O 1M56B 4DUZB 1H2GA 1OCZC 1EFRG 4HZ3A 3L74H 1NKDA 1E1QG 3RLQA 5CN0A 2E3CA 2W0XA 5M4HA 3U11A 1Y6XA 3VQXA 2A79B 5LP6B 3OGIB 2ZR3A 2GQPA 1NS1A 3CGYA 3R4NA 2UXBO 1K33A 1ZAUA 1BT8A 3ZMZA 2YE3A 2JJCA 1HNXB 4G28B 3DSQA 3WFVA 4YIPA 3F5TA 2M6YA 4LF5O 3ZEDA 1VF7A 4FK5C 2JS5A 4F6RA 1RSOA 4A5UB 4O4LA 5CA1A 2YI5A 2LGWA 2ZCEA 4J41A 3FB8C 1F51A 3B40A 4MVZA 1K7DA 3RWRD 4HZ0A 1D2DA 1J5EB 1YCIA 1QZRA 4NH8A 4XKKA 1YIJV 4JI7O 3K79A 5BMVA 1N8RW 1VQLV 3CRRA 1TILA 5BODA 4I7ZB 3QO5A 3HKDB 4QJFB 3U0ZA 1YF2A 2YXYA 3HKBA 1FPOA 2IU3A 3ZMUA 1QR9A 5HFLA 5LGTA 2UUAO 3HYYA 2YIBA 4B3RB 3B26A 1JVMA 4LH6A 4BIUA 3GB7C 3LPSA 3T1YB 4BIOA 4F6EA 3CC4V 4MTGA 1YJ9V 4X9LA 3ASNB 3ETQA 2QA4V 5IWAB 4K0KB 2PZSA 5KMGB 3JSNA 1IBMB 3B09A 2YSUB 2A7WA 2XK2A 2E0AA 1HNZO 3ZHVA 1KKCA 4MW8A 4O4IA 4R50A 3TXSA 3ASOC 2EXLA 3ZMVA 1U2OA 2XD6A 4H81A 1GH6A 1NTZH 2LGQA 3CCSV 2JGDB 1YXBA 4N21A 4FFBA 3BCCH 2YE9A 3CXHF 5CB4B 1N32B 4NR1A 2R72A 5IYCO 2Q9LA 2PYLA 4UXNA 1P7BA 1J95A 2KB1A 3QG5A 1B63A 2DYRB 1DK1A 3D36C 4YJ2B 2PNRA 2VQEO 1OCOB 5FPRA 5EBWC 4MVMA 4B3TB 1VARA 4B3MO 4P9PA 3M7MX 1GKXA 2CCUA 1V54C 2HEPA 3BA9A 1YDXA 3ZHSA 1RPRA 1Y4UA 3ML0A 1EZJA 2R9RB 1SZXA 2RNBA 3UQ8A 1Y66A 4W4KA 3HKDA 1XMOO 1G4YB 4JYAB 4MTXA 4K8ZA 3AK1A 3HKCA 2NR5A 2DWDC 3ABLB 3ABMC 3VQVA 4XITA 1P49A 1NHJA 1GKZA 1NBMG 4DV2O 4JI4B 2B5UA 4O2BB 1PP9H 5EK0A 1D5AA
chains in the Genus database with same CATH topology
3FYIB 4MVSA 4JF3A 4JASA 5GW7A 1AJNA 3W7XA 2DQ3A 2WLNA 3OW2U 4GX5A 5FL7G 3ETDA 3I55V 2YEVB 3HPLC 5CBFA 1BL8A 1VQ5V 1Q82W 2DYSC 4WFFA 2JJ2G 2HVJC 3WG7C 3CYOA 4R6ZA 4MVOA 4EKWA 3MHHC 2W6IG 3NXSA 3B77A 1WLEA 4WF9V 1JX9A 2ZD9A 3UKMA 3E2EA 1NH2D 2P90A 1OCCB 4PELA 1YITV 3ABTA 1OHHG 3SPCA 5L3GA 3K0GA 2AHYA 5LHIA 4J9YB 2B1IA 1DF4A 3ETEA 3SPHA 1VQOV 5B1NA 1SETA 2JEUA 1QBZA 3M99B 1YJNV 2ITCC 3E83A 2B1GA 2IJJA 4J9ZB 1Q86W 2QKSA 1QR8A 2GSMB 3SYOA 1BHAA 5LHHA 2UXXA 1KQSU 5EC1C 1MG1A 3TK1A 1YTFD 4P9OA 1TUEB 4DXWA 1M90W 1KD1W 1SESA 2HJFC 3BY6A 4WCEV 1AI4A 3JD1A 3ZRSA 1F23A 3QO7A 3I56V 1RM1B 3SYQA 2HFEC 5DM6V 3E8GA 4P2ZA 1YSCA 2EIMC 3K06A 4WFBV 1NQTA 1GK9A 2GHYA 1KECA 2WLIA 3T1CA 1R3IC 2NNUA 3OE7G 4QPJA 4FJCC 2XNDG 2XASA 2H8PC 4XDLA 3SYPA 4WFEA 1H8HG 3RW0A 3ETGA 1FXVA 2QM7A 1EBOA 2EZPA 2P67A 3G4SV 3CMEV 2BOCC 3AG1B 3K0DA 4XDKA 4HAMA 5CA3A 3B8MA 4H33A 3ABKB 2WLJA 1KC8W 1THZA 1QLNA 2WLMA 2Q67A 3STLC 4UUJC 1QVGU 2YEVA 3JCZA 2Y69B 1K34A 2M7WA 1ORQC 4I9WA 4JAVA 1K4DC 2QEXV 1S72V 1COWG 3FB5C 2PI4A 1L1FA 3AG4C 5CBGA 4GCZA 1WPXA 1HWYA 2WWWA 1SZTA 3R65A 4JTAB 2HG5C 5LBQA 3W7TA 3SPGA 2ZQMA 2WLIB 1K9MW 4BIZA 2WLHA 2IU0A 3G71V 1PD3A 4Z1MG 5B3SC 4LC1A 2ZXWB 4UV8A 5C93A 4JPRA 2IJIA 4XDJA 3ASNC 3OM3B 3CMAV 1M57B 3LDDA 4P30A 1SERA 2OTJV 1E1RG 3ZRXA 1VQPV 4XBFA 3AG3C 2EJRA 1H38A 4JTCB 5IY5C 1GM9A 2Q69A 1K97A 2WPDG 1NVPB 3K08A 2QE7G 2XAGA 3DTUB 2UXNA 2ZDIC 3OR7C 3W7WA 3LDEA 3ZMTA 4LP8A 4N23A 2ZR2A 1OZ0A 3P32A 2EILB 3OUSA 3E8FA 1XL6A 3PJSK 2LP7A 4RQEA 1CEZA 2JDIG 1VQNV 3CC2V 4MTFA 1M9NA 2CK3G 3D36A 5IYDO 1AI5A 5CMUA 1Q81W 1SRYA 4QIWF 2X0LA 2DYRC 1VQMV 3OFNG 1PNLA 1OCOC 1AROP 2XAJA 3OMNB 1R3LC 2HR3A 3B8NA 4QNHB 3CCUV 4WFAV 5H6RA 1DF5A 2MK3A 1VQ6V 1R6NA 1M56C 3AG2C 4TSFG 3JD4A 4DO2A 1AJQA 1K5QA 5B1AC 4PDMA 4MVRA 3ASOB 1R6KA 3H01A 3VOUA 1CP9A 1FXKA 3ZIAG 3D3IA 4GX0A 1FXHA 5KA5A 1OCRC 5L3BA 3E89A 2Z5UA 4U7NA 4H37A 2P6JA 2EIJC 4MVUA 3ABLC 4UVCA 1AI7A 4LBEC 1XL4A 3P30A 2WAMA 2XAFA 3LNMB 4L87A 4MVQA 3IC7A 4G27B 3EHBB 5IYBO 3W7UA 1CPYA 5EBLC 3LUTB 2OCCB 1W2BU 2A0LA 3ZJZA 1DLBA 1R3JC 2JK5C 2LFSA 5B1BB 5L3CA 4PA3A 3SJQC 4PA6A 2WSSG 1KP2A 3IGAC 3CCVV 1PNKA 3KG2A 2EBOA 3LDCA 1GMGA 4PDLA 4Q20A 3TCUA 2X6AA 3K03A 4HYOA 2ATKC 2QM8A 4RAIA 3X2QB 4F4LA 3CCLV 4FMTA 1QLEB 1V54B 1RPOA 2C2AA 2FTKA 2X7RB 1QCEA 1K4CC 2JJ1G 3CCJV 2EIKC 2R9IA 3RVYA 1ZWIC 2V7QG 4UVBA 3TETA 1NH2B 1ROPA 2IJHA 3FKSG 2LFRA 1PKXA 2EINC 4RUFA 3E86A 3FYEB 5J9PC 2V1DA 1K73W 2K1EA 5HFMA 1V55C 1FXKB 3CC7V 5IY5B 3ABMB 2P7TC 4WFGA 4MTOA 1S0VA 3OMIB 1VQKV 4CZZA 4JYCA 2XOKG 1AR1B 3OAAG 4MS2A 4GX2A 3RBZA 2AHZA 4YXWG 1P4RA 4PDRA 2H94A 2HVKC 3SYCA 2NLJC 4JAUA 4WFHA 1YTFB 4TT3G 2F43G 4E2LA 1JCHA 2DYSB 1W0KG 3ZRVA 1K92A 1JQ0A 1RM1C 3WG7B 1B6QA 4RO2A 5H6QA 2D3OW 1GM7A 2Q6AA 2WLLA 1GM8A 3E35A 1I5YA 3OR6C 4RUEA 3DGEA 2Q68A 4LCUC 4R7CA 4QE9A 1NR7A 2ITDC 5H9CA 2Z3YA 5L3EA 1PL0A 2QTOA 1YHQV 1S76D 4TWKA 1K3EA 3JD2A 3K9AA 4PDVA 3G6EV 4ZKIA 4X89A 1UJWB 1VQ7V 1JJ2U 1GKFA 5LGNA 5KA6A 3ZN1A 1Y4MA 4PA4A 1M56B 3AG1C 4UV9A 5B1OA 1H2GA 1LNQA 1OCZC 3EFFK 4MW3A 5EBMC 1EFRG 4HZ3A 3F7VC 1NKDA 2XAQA 1E1QG 2HKOA 3CXCU 2X6CA 5CN0A 1OCRB 3OMAB 3VBBA 1S3JA 1E79G 2EIJB 1Q7YW 4G2KA 2A79B 3CCEV 3CCRV 3JD3A 1YI2V 2ZR3A 3OGCC 2Y69C 2PI5A 4GX1A 1K33A 5L3DA 4PA7A 3ZMZA 2EIMB 4RQFA 4G28B 5CBHA 1GTOA 3WFVA 1AI6A 4JTDB 1VQ8V 2WLLB 4FK5C 1R73A 4MSWC 2OTLV 4KUMA 3T4DA 3RVZA 3OEEG 3W7SA 2IH1C 4FPPA 2JIZG 1MABG 5L3FA 2HLDG 3A0RA 2ZXWC 3AEIA 4OXSA 3GWOA 3FB8C 1F51A 4MVZA 1M1KW 1K7DA 4X8AA 1M57C 3ABUA 2JEXA 2EIKB 1YIJV 1PNMA 2WLKA 4R8CA 1MSWD 1ENVA 3K79A 4QE7A 4BAYA 1JPXA 3T4ZA 1N8RW 1VQLV 2EINB 2ZDIA 5EC2C 3IFXA 3QO5A 4BW5A 4QJFB 5E1AC 1V55B 2DW4A 3OEHG 5BZBA 3BEHA 2IU3A 1W0JG 3JYCA 3ZRWB 3QO8A 3SPIA 2EILC 3STZC 1GO3F 3ZMUA 1QR9A 5HFLA 5LGTA 1F4NA 3CCQV 5IDJA 3ZMSA 3K3WA 1DTOA 3AG4B 2XAHA 4KP4A 1JVMA 2W6JG 3QNEA 4BIUA 2Y48A 3GB7C 4FIPC 4I5SA 1VQ4V 3CC4V 4MTGA 1YJ9V 2IJKA 5B3SB 1KKDA 3CPWU 4ZBMA 1I5XA 3LSQA 1OCCC 1BHBA 1YJWV 3ASNB 2IH3C 4JYBA 3E8HA 2OT5A 4UVAA 2QA4V 1BMFG 3FB7C 3CCMV 5KUMA 4ASUG 1NR1A 3JD0A 3AG3B 2YSUB 1NJIW 3ZCCA 1NVPD 2BOBC 3CD6V 4MW8A 2EZOA 4R50A 3ASOC 2X6BA 3ZMVA 5KUKA 5LHGA 3F7YC 1JOYA 4U7OA 3LSSA 1OCZB 2IW5A 1FFTB 3CCSV 2DQ0A 4N21A 3SYAA 3ZN0A 3K04A 3MD0A 1QVFU 3E8BA 2OCCC 5LGUA 4KFMA 1F4MA 1K5SA 4PA9A 5IYCO 5B1BC 4UXNA 1K8AW 4GT1A 1P7BA 1J95A 3HB3B 2KB1A 1VQ9V 2DYRB 3OUFA 3UM7A 1AJPA 1KP3A 1OCOB 1H8EG 3X2QC 1S5HC 5EBWC 4MVMA 1FS0G 1QLEC 4P9PA 1V54C 1RPRA 5DN6G 4JGSA 3FB6C 3ML0A 1EZJA 2R9RB 3AG2B 1R3KC 1Y66A 3SPJA 5B1AB 1S77D 3T2MA 2A9HA 1G4YB 1IXMA 4MTXA 3ABKC 3ZRWA 2W0FC 2DWDC 1FXKC 1MOFA 2DWEC 3ABLB 3ABMC 4CBCA 4X88A 3CP1A 3MHSC 4MT8A 1NBMG 4QPKA 2B5UA 5EK0A 3F5WC 1G8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JAS A;  4BIZ A;  5B1N A;  3ZRV A;  5B1O A;  3P32 A;  2LFR A;  4JYB A;  4LC1 A;  2LFS A;  5C93 A;  3MD0 A;  4FPP A;  3ZRW B;  1IXM A;  3A0R A;  4QPJ A;  4MTX A;  3DGE A;  1F51 A;  3ZCC A;  5IDJ A;  3ZRX A;  3ZRW A;  4Q20 A;  3NXS A;  4JYC A;  4GT1 A;  4JAV A;  4KP4 A;  2QM8 A;  3TK1 A;  4FMT A;  3D36 A;  4BIU A;  4U7N A;  2QM7 A;  2C2A A;  2FTK A;  4MT8 A;  2P67 A;  4QPK A;  4ZKI A;  4GCZ A;  1JOY A;  2WWW A;  4I5S A;  4U7O A;  4JAU A; 
#chains in the Genus database with same CATH topology
 3CJH A;  5GW7 A;  4LF4 O;  1AJN A;  2DQ3 A;  1LUV A;  4GX5 A;  2NN4 A;  3TZ4 A;  2YEV B;  3HPL C;  1BL8 A;  4D7T A;  2YEF A;  1N4C A;  1UYI A;  3OPD A;  2CTQ A;  2Y4T A;  4XD8 A;  4EKW A;  4PD4 F;  4GQT A;  3UKM A;  1SQX H;  3MDS A;  1S5J A;  1NH2 D;  1GAX A;  5JEN A;  3K58 A;  1IX9 A;  3EHG A;  1YIT V;  1JM6 A;  2AHY A;  2QWO B;  3FFQ A;  2B1I A;  1DF4 A;  5KHI A;  3CRK A;  2BE3 A;  2UU9 B;  4XDM A;  1S5L Z;  1QBZ A;  1YJN V;  1B62 A;  2B1G A;  4J9Z B;  1Q86 W;  4BW9 A;  4KFG A;  1I5A A;  4LWE A;  2ZM6 O;  1KIJ A;  5CTX A;  3RYI B;  4K3A A;  3QVN A;  1KQS U;  2P4V A;  3O2F A;  1YTF D;  1NTK H;  1TUE B;  3JAW B;  5CB4 A;  4TV9 B;  1BYQ A;  5JCO A;  3A0Y A;  4YJ2 A;  2BZ5 A;  4X65 B;  2UWD A;  1GK9 A;  2GHY A;  2WLI A;  4NTY A;  3J80 N;  3SJB C;  5BXZ A;  4DV5 O;  4FJC C;  2ZE6 A;  3WB1 A;  3N2G B;  4LFB O;  1XHZ A;  2IOR A;  5BOC A;  1GN6 A;  1H8H G;  3ETG A;  3K5O A;  2QM7 A;  5CF0 A;  3G4S V;  2UUC B;  4LFC B;  2ZE8 A;  4JYY A;  1Y76 B;  5IDM A;  4NTW A;  1TC0 A;  3K0D A;  4XDK A;  3C90 A;  2A3Q A;  3H80 A;  2YKI A;  1Q43 A;  3ABK B;  2QFO A;  1WAZ A;  3STL C;  2YEV A;  3GIG A;  2Y69 B;  2M7W A;  1ORQ C;  4I9W A;  4XCJ A;  4OX9 O;  4CH4 A;  4Q6G A;  2XX2 A;  4GCZ A;  1WPX A;  2WWW A;  3W7T A;  1SZT A;  5LBQ A;  4CE2 A;  1KBH A;  4XTJ A;  2ZQM A;  1K9M W;  2XDU A;  2CTP A;  2G38 A;  4BIZ A;  5B66 Z;  5EYP B;  2HHH B;  4DR1 B;  4O09 A;  1PD3 A;  4Z1M G;  4UV8 A;  3TJT A;  3ZXO A;  4JPR A;  2WEP A;  2ZIM A;  2CH7 A;  3OM3 B;  3QTF A;  4EEQ A;  2UXD O;  2QKC A;  1MZE A;  2Q7G A;  1Q5O A;  2KSD A;  5LYJ A;  3TGU H;  3QTC A;  4JTC B;  4FLX A;  3EXA A;  1GM9 A;  3K99 A;  1K97 A;  5KHJ A;  3T1K A;  2WPD G;  2YI8 A;  1NVP B;  2QE7 G;  5LMN B;  4DUY B;  2ZDI C;  3T1H B;  2V4D A;  3OUS A;  2YE8 A;  4LF9 B;  5D5Q A;  1XL6 A;  2LQT A;  4RWU A;  5FNV B;  3GVM A;  2JDI G;  4DR5 B;  3K57 A;  4I55 B;  1MZF A;  2BTQ B;  2XDK A;  4PI2 A;  4CWT A;  3FV5 A;  4UCV A;  1PNL A;  3A0H Z;  2BU7 A;  2QM4 A;  4GKK O;  4EFT A;  1ZXM A;  4R3A A;  1IBK O;  1U0Z A;  2MK3 A;  1VQ6 V;  2LJ2 A;  2UUB O;  3AG2 C;  1AP6 A;  4DO2 A;  2BSM A;  1AR4 A;  2P22 C;  4YJ3 B;  5B1A C;  4PDM A;  4MVR A;  3VOU A;  3H01 A;  3ZXQ A;  3D3I A;  1OCR C;  4U7N A;  4JI2 O;  4B3S O;  3N2K B;  4J7K A;  3JSL A;  5LOV B;  2ZKJ A;  2WAM A;  4L87 A;  4MVQ A;  4G27 B;  1P7G A;  3EHB B;  3W7U A;  5EBL C;  2A0L A;  3ZJZ A;  1Q8I A;  5EYP A;  3OD4 A;  1Z5C A;  4TQD A;  4HXW A;  4PA6 A;  4B7E A;  3CRQ A;  1PNK A;  5BY1 A;  2EBO A;  4PDL A;  1UPG A;  1BCC H;  5D5P A;  3CCL V;  4FLW A;  4EGI A;  1QLE B;  1T5E A;  5A2Q N;  2FTK A;  1ID0 A;  4LR3 A;  1DGS A;  2H55 A;  2YGA A;  4GEE A;  2YEE A;  1ZWI C;  1BQZ A;  2XHR A;  4PRX A;  2VQF B;  4UVB A;  5CPH A;  1V9P A;  3L72 H;  1XMQ B;  4FFK A;  4YHH B;  2EIN C;  4RUF A;  2YE7 A;  2V1D A;  1K73 W;  4EFU A;  2K1E A;  4X64 O;  4CWS A;  4EB6 A;  4JI1 B;  1UYF A;  2XAB A;  2P5O A;  1S0V A;  4CH3 A;  4LNU A;  4JYC A;  1AR1 B;  1I58 A;  2E76 B;  4YXW G;  3MNR P;  3WQ9 A;  4YKU A;  1NHH A;  2ZIO A;  4DV0 O;  2NLJ C;  1XUQ A;  1XIL A;  3KCX A;  4NYK A;  4TUY B;  4WFH A;  4ASG A;  3RLP A;  2YDE A;  1US6 A;  2F43 G;  3HR0 A;  4YKT A;  2DYS B;  1W0K G;  2E74 B;  4ZOL B;  1B6Q A;  2GTA A;  3E35 A;  3P3P A;  2BT0 A;  1I5Y A;  4DUH A;  4LCU C;  2BU5 A;  2YEB A;  2ITD C;  1YS3 A;  3GWK C;  1PL0 A;  3K9A A;  1JJO A;  1VQ7 V;  5KA6 A;  3N2K A;  3FT5 A;  1Y4M A;  4PA4 A;  4E72 A;  1G6U A;  3JAT A;  2VS0 A;  4MW3 A;  5EBM C;  4X62 B;  4ZVI A;  3F7V C;  1YT2 A;  3ZKB A;  1GRJ A;  2X6C A;  5J6A A;  3OMA B;  2BU8 A;  1EA6 A;  4B08 A;  1BXD A;  1Y8N A;  4G2K A;  3ZKD A;  2YEA A;  2GFD A;  3T0H A;  5M4M A;  5L3D A;  1Y74 B;  2EIM B;  1GN4 A;  4DV3 O;  2B9Z A;  1KYO F;  4JTD B;  2JS3 A;  1VQ8 V;  4J42 A;  2WLL B;  3UO3 A;  3CSX A;  2OTL V;  3RVZ A;  3W7S A;  2IH1 C;  2CG9 A;  1MAB G;  5L3F A;  2ZXW C;  3AEI A;  4OXS A;  4DUZ O;  1WB8 A;  1M1K W;  1M5I A;  4X8A A;  3ABU A;  2JEX A;  3TXQ A;  4WUB A;  4R8C A;  1MSW D;  3M8A A;  1JPX A;  3T4Z A;  4X1Y A;  1QY8 A;  4O2A B;  1X59 A;  1PM9 A;  4BW5 A;  5J2U B;  1V55 B;  3A0T A;  1VF5 B;  1HNX O;  4TOI A;  1XNR B;  3ZRW B;  3EHJ A;  1GO3 F;  3CCQ V;  1F4N A;  3R66 A;  4CC5 A;  1HDJ A;  3G80 A;  4WUC A;  1QNM A;  3HKE A;  3K3W A;  4DR6 B;  1Z5V A;  2IOQ A;  2XAH A;  5JVD B;  2W6J G;  2ZDY A;  3QNE A;  2FWY A;  2Y48 A;  5LXT A;  3KZI Z;  4FIP C;  4TV8 B;  5E79 Z;  4I5S A;  3OW6 A;  1VQ4 V;  1H2N A;  5B3S B;  1X4T A;  3CPW U;  4F6R B;  1XNQ B;  1RSO B;  4YKW A;  4O4L B;  5CA1 B;  1XOU A;  2IH3 C;  1I5D A;  4JYB A;  3UT5 A;  3E8H A;  2Q8F A;  1BMF G;  1WNS A;  5KUM A;  4ASU G;  3JD0 A;  1I7F A;  2FYU H;  1WB7 A;  1NVP D;  3INW A;  5BMV B;  2RDC A;  3O6O A;  4K4O A;  1OJH A;  5KUK A;  2Q0O C;  2CTW A;  4B3R O;  4U7O A;  1OCZ B;  2IW5 A;  1NT2 B;  3HKB B;  3D2R A;  1Y74 A;  2XDX A;  1WP8 A;  3T1Y O;  2C1G A;  3IJ4 A;  4H0L B;  2F93 B;  4YY3 B;  2OCC C;  5LGU A;  1UYC A;  4KFM A;  1K5S A;  4PA9 A;  4K0K O;  5IWA O;  1AH8 A;  2YI9 A;  3A0X A;  4CE1 A;  4GT1 A;  4X20 A;  1IBM O;  2QDO A;  1WP7 A;  3WHA A;  4DV6 B;  1BQ0 A;  1AJP A;  4PHZ A;  4JZG A;  3X2Q C;  1S5H C;  1FS0 G;  2L6L A;  1BZK A;  2PGG A;  2PUS A;  4NKG B;  3FB6 C;  1H2L A;  4FLT A;  1WN7 A;  5IYZ A;  4L8J A;  2HG1 A;  4MPE A;  1Z5B A;  4X1K B;  5J2U A;  4DV7 B;  1MMM A;  2H8M A;  4O4I B;  3HHU A;  2YC0 A;  3ZRW A;  1FD9 A;  4TQF A;  1TVK A;  1FXK C;  1MOF A;  3RT3 C;  1Y67 A;  4X88 A;  2EJ7 A;  1N32 O;  1FYJ A;  4QPK A;  3CS5 A;  5JVD A;  2L35 A;  4L90 A;  2Q8I A;  2ETN A;  2YE6 A;  4MVS A;  4TV8 A;  4FFB B;  3QDD A;  2OYQ A;  2DJV A;  1Y8P A;  2F4V B;  4B3T O;  3ETD A;  3I55 V;  3EKO A;  1I08 A;  1SQG A;  4YIO A;  1RP3 B;  4X66 O;  1Q82 W;  1VF6 A;  5DED A;  2HVJ C;  1AM1 A;  4R6Z A;  4ZI7 B;  1S14 A;  2W6I G;  2XUM A;  2H3O A;  3B77 A;  3H1J H;  4XCL A;  2YIA A;  1WLE A;  4WF9 V;  2ZD9 A;  4NXN B;  1B3Q A;  1OHH G;  3SPC A;  2XHX A;  4HY6 A;  3K0G A;  1VIB A;  5LHI A;  4J9Y B;  1ZW9 A;  4LF7 B;  3K97 A;  4DW0 A;  4ASF A;  2YI7 A;  1I0H A;  3HKC B;  3OT7 A;  1BHA A;  5LHH A;  3H1K H;  5JH7 A;  4DR4 B;  3JAR B;  2WI2 A;  4DXW A;  3L71 H;  1KD1 W;  4XE2 A;  5DEC A;  3HYZ A;  1AR5 A;  3CJH B;  4WCE V;  5LP6 C;  4GKJ B;  3I56 V;  1RM1 B;  2GDS A;  2ZBK B;  2N05 A;  2HFE C;  2QKA A;  1YSC A;  3K06 A;  4WFB V;  1NQT A;  2FKX A;  3CWV A;  1R3I C;  2NNU A;  4BQJ A;  2JGU A;  1L0N H;  1QQC A;  4ZHQ A;  2O57 A;  4QPJ A;  4UCT A;  2XND G;  4FCP A;  4L94 A;  3SYP A;  4X1K A;  4WFE A;  2CTR A;  4YKY A;  4J10 A;  1YSZ A;  3CME V;  3AG1 B;  4BAE A;  3S3X A;  4U93 A;  2YK9 A;  3BA8 A;  2GTS A;  4JI0 B;  5CA3 A;  4AIL C;  4GLX A;  3B8M A;  4H33 A;  5J71 A;  1FJG O;  1THZ A;  1U97 A;  1QLN A;  4LWG A;  4X65 O;  4UUJ C;  1QVG U;  2QF6 A;  3JCZ A;  2PYJ A;  1FAF A;  1IVS A;  3JAS B;  2ESA A;  4X1I B;  4ZI7 A;  3FB5 C;  2PI4 A;  4DV4 B;  1JOY A;  1HWY A;  2AKP A;  2RMK B;  3ZS8 C;  1ZSP A;  1NU1 H;  2WLI B;  2IU0 A;  1BKN A;  5M4P A;  3SJA C;  2QG2 A;  2UUC O;  4NB5 A;  3Q4H A;  1YES A;  4O05 A;  1RFY A;  2IJI A;  4XDJ A;  3ASN C;  1M57 B;  1SER A;  2HKJ A;  4XC0 A;  1ZUQ A;  4AI8 A;  2EJR A;  1H38 A;  1UYK A;  3U10 A;  2FML A;  5F2V O;  4JI5 O;  5LA6 B;  4NXM O;  3JAR A;  3K08 A;  1VEW A;  3W7W A;  3LDE A;  4LP8 A;  5KAF Z;  2EIL B;  1IUR A;  3K59 A;  3GIG B;  4JI7 B;  4FLY A;  1QHT A;  4RQE A;  1CEZ A;  2CGO A;  2GUZ A;  2IM9 A;  4E01 A;  4MTF A;  2PY5 A;  3D36 A;  5IYD O;  3Q5K A;  1AI5 A;  2F1M A;  1PPJ H;  3SJC C;  2YIC A;  1Y4S A;  2X0L A;  4BXI A;  2DYR C;  1VQM V;  2YI6 A;  1OCO C;  2XAJ A;  3OMN B;  2YEH A;  1YER A;  1R3L C;  2HR3 A;  2QJ1 A;  3B8N A;  2UUA B;  3Q5J A;  2LW1 A;  2CH7 B;  2QWN B;  2N74 A;  4DUY O;  3B2E E;  1D5N A;  1R6N A;  3T1H O;  4TSF G;  4CE3 A;  5LYJ B;  1AJQ A;  4AQY B;  4DR7 B;  3ZIA G;  4JI8 O;  4LF9 O;  1UYD A;  5JJJ B;  2JVD A;  3C11 A;  4I50 A;  1FXH A;  5KA5 A;  1EI1 A;  5L3B A;  3H9V A;  2Z5U A;  3RYC A;  1HR0 B;  4EEH A;  1B06 A;  2EIJ C;  3A0B Z;  3ABL C;  3JAS A;  4X1I A;  4LBE C;  1XL4 A;  3A2F A;  3JAL A;  1I5C A;  4PRV A;  2YIB D;  3LNM B;  1CPY A;  5JJN B;  1HNZ B;  1SA0 B;  4NH9 A;  4IGG A;  1R3J C;  2JK5 C;  2LFS A;  5B1B B;  4PA3 A;  3CCV V;  2CH4 A;  2Y0I A;  1GMG A;  2AW9 A;  4Q20 A;  2VWK A;  2ATK C;  2QM8 A;  4HYO A;  2HCH A;  1CXZ B;  4ABM A;  4DK1 A;  4FM0 A;  4NVP A;  2CUG A;  2WA4 A;  3BPZ A;  4FVM A;  1QCE A;  4UCS A;  3B25 A;  2EIK C;  3RVY A;  4IHJ B;  4CH5 A;  1AJ6 A;  2BTO A;  5LA6 A;  2IJH A;  4E02 A;  4URO A;  5M4N A;  4ZIB A;  3OTO O;  4B7P A;  3R92 A;  3R4M A;  1Q90 D;  4AWO A;  2VQE B;  2YEC A;  2P7T C;  2QWP B;  4IYI A;  2BTZ A;  1AIL A;  3OMI B;  1VQK V;  1TC6 A;  5BR8 B;  1GN3 A;  1TA8 A;  2AHZ A;  3ZX6 A;  3FAV A;  2F95 B;  4MB9 A;  3WB0 A;  1XMO B;  1JQ0 A;  5LMU B;  2D3O W;  3WG7 B;  4LWF A;  5KX5 A;  1AP5 A;  1GM8 A;  2VQF O;  2E5L B;  2HHI A;  1XMQ O;  4DV2 B;  3OR6 C;  4RUE A;  2YID A;  3DGE A;  4YHH O;  3OWB A;  1HNW B;  5H9C A;  2Z3Y A;  4H13 B;  5GON B;  2YE5 A;  2XX4 A;  1YHQ V;  2QTO A;  4LF4 B;  4JI1 O;  1L0O A;  4PDV A;  1H2M A;  3EVK A;  1EN5 A;  4ZKI A;  3RLR A;  4U3J A;  2XHT A;  4IIJ B;  4LF8 B;  2Q5Z A;  3ZN1 A;  4OPA A;  4YKR A;  2BYI A;  1LNQ A;  4EB6 B;  3EFF K;  1H7U A;  3CXC U;  2HKO A;  2YEJ A;  4GZR B;  4LNU B;  1OCR B;  1SA0 A;  1VMG A;  2AZ2 A;  3CRL A;  3KE6 A;  1Q7Y W;  4CWR A;  3CCR V;  1YI2 V;  1I94 B;  5IE9 A;  2Y69 C;  2PI5 A;  2LW7 A;  5IT9 N;  1GTO A;  4D7S A;  1AI6 A;  2IOP A;  2CDY A;  3CB2 A;  4IHJ A;  3N27 A;  4KUM A;  3OEE G;  4WBN A;  2YEI A;  4FPP A;  2JIZ G;  2HLD G;  3CHX A;  2KG7 A;  1YC4 A;  5H2F Z;  2HJD A;  4X62 O;  2XDS A;  3D0B A;  4JV5 O;  1N36 B;  4BQG A;  3SGI A;  2GV9 A;  4QE7 A;  4BAY A;  3R4O A;  2ZT9 B;  1Z5A A;  2WA3 A;  2YUA A;  2Q8G A;  2EIN B;  3JAT B;  2ZDI A;  2LO1 A;  3IFX A;  1N33 B;  1H2K A;  1R1B A;  2EUL A;  3OEH G;  3BEH A;  3H1L H;  1W0J G;  3JYC A;  4CS2 A;  4UCU A;  4Z1V A;  3SPI A;  3STZ C;  5GTI Z;  2WI6 A;  4B7K A;  5IDJ A;  4NH7 A;  3RYH A;  3ZMS A;  3CRM A;  4PL9 A;  3AG4 B;  4KP4 A;  2YE4 A;  4O04 A;  3OWD A;  2XX5 A;  2Q7H A;  5GON A;  3OTF A;  4I4T B;  2WER A;  3LNN A;  1KKD A;  3TUH A;  2RQ6 A;  4ZBM A;  1I5X A;  3LSQ A;  4NTX A;  1OCC C;  1N34 B;  1BHB A;  4XKA A;  1YJW V;  4IIJ A;  4URM A;  3UCS C;  3FB7 C;  4OX9 B;  3J7A U;  1NR1 A;  3EKR A;  1US7 A;  3AG3 B;  4KHP B;  3EHH A;  4KQV A;  1NI8 A;  2Z0A A;  3KCY A;  3VHC A;  2BOB C;  1Z2G A;  4X1Y B;  4I3H A;  2MW2 B;  2CCS A;  1GJV A;  3BFR A;  2PF4 E;  5LHG A;  2BU2 A;  3F7Y C;  3ZM7 A;  2DN9 A;  1I59 A;  1TAE A;  1YEW A;  2DQ0 A;  2UXD B;  1BGQ A;  3E22 A;  3UO2 A;  3VQW A;  4D6T H;  1H2S B;  1WJZ A;  3ZN0 A;  3K04 A;  4H7Q A;  3WU2 Z;  3HKE B;  1XNQ O;  1QVF U;  3VHA A;  2AXT Z;  2WI5 A;  5LXT B;  1K8A W;  1VQ9 V;  4L93 A;  3THO A;  3OUF A;  3UM7 A;  2IWS A;  4GFN A;  1ZL8 A;  1H8E G;  1LR1 A;  1QLE C;  2EX3 A;  3UT5 B;  3L73 H;  4JGS A;  2ODM A;  4HYM A;  4EFB A;  5D6Q A;  3SPJ A;  2K5B A;  3T2M A;  1XBL A;  1IXM A;  4MP7 A;  5B5E Z;  2YXL A;  1QYE A;  1EM1 A;  2XT9 A;  5J2T B;  3DC5 A;  2W0F C;  4I0X A;  4V25 A;  2YS8 A;  3P3N A;  1R6T A;  4ASA A;  4GKK B;  1IBK B;  3F5W C;  3FYI B;  4H85 A;  3HZ1 A;  4JF3 A;  4DV6 O;  3H1H H;  1YZB A;  3W7X A;  3TZ2 A;  1SQB H;  4I4T A;  4DV1 B;  4IT5 A;  2OIE A;  1L8D A;  4EFE A;  2GBO A;  4DR3 B;  2DYS C;  4R3M A;  2FWZ A;  1NZ6 A;  3CYO A;  4X20 B;  4B3S B;  1R62 A;  3R4P A;  3NXS A;  4O4H B;  2YED A;  4LWI A;  4GUN A;  2KKW A;  1JR9 A;  3BRC A;  3BM9 A;  5L3J A;  3E2E A;  2JKI A;  2ADP A;  2P90 A;  4PEL A;  3S5T A;  3ABT A;  4LPB A;  2YJX A;  5L3G A;  1PVG A;  3C3T A;  2XJG A;  5IYZ B;  4MPC A;  3SPH A;  1VQO V;  4K35 A;  5B1N A;  1IBL B;  2QWQ B;  3RYF A;  2YK2 A;  1SET A;  2UXC B;  5M4E A;  2JEU A;  4LP0 A;  1NTM H;  2ITC C;  2QKS A;  3TTZ A;  3JAK B;  3KKY A;  1QR8 A;  1TVK B;  2GSM B;  2F4V O;  1Q6U A;  4GGL A;  5IJ0 A;  2UXX A;  4JI3 B;  1MG1 A;  1JFF A;  1Y8O A;  1MNG A;  3TZ5 A;  1SES A;  2HJF C;  3IC9 A;  1AI4 A;  1F23 A;  3QO7 A;  1J5E O;  4X64 B;  4X9Q A;  3SYQ A;  2C1I A;  4P2Z A;  2VCJ A;  1VP7 A;  2EIM C;  5KAI Z;  2YGE A;  3APQ A;  3OE7 G;  2QR4 A;  1XQ8 A;  3G7B A;  4O0B A;  4J7J A;  2XAS A;  4DR2 B;  1BGY H;  3RW0 A;  4EGK A;  2HP8 A;  5J2T A;  2BOC C;  1UY6 A;  4DR4 O;  4YKQ A;  5CTU A;  5ITZ B;  4R1F A;  1SS3 A;  5D7C A;  3H4L A;  4LWS B;  1UY9 A;  4LF6 B;  5AG2 A;  2Q67 A;  5JH7 B;  3K9S A;  5F3K A;  3K5M A;  4JAV A;  1K4D C;  4HZ5 A;  4JI6 B;  1JA8 A;  2Q8V A;  1HNW O;  1L1F A;  1TID A;  4O4H A;  2YKJ A;  3J81 N;  1Q3E A;  1QU7 A;  2YEG A;  3L70 H;  3SDL A;  4ZHQ B;  5B3S C;  2RCV A;  4PJ0 Z;  1ZWH A;  2WI7 A;  4HNA A;  3CMA V;  3LDD A;  5JQG A;  2OTJ V;  3BVO A;  1E1R G;  1LUW A;  3TZ0 A;  1MSD A;  3OMU A;  4J11 A;  3JAK A;  5D6P A;  5IY5 C;  3BHP A;  1UYH A;  3DTU B;  2UXN A;  3RN4 A;  3G75 A;  1YSR A;  4N23 A;  3ZBH A;  4AWP A;  1OZ0 A;  4JAA A;  4CWP A;  3R91 A;  1XDC A;  1PL4 A;  3PJS K;  3JAM N;  1N0J A;  4E4E A;  3VQY A;  3IED A;  3CE2 A;  1FFX A;  4URL A;  3Q5L A;  4YKX A;  2CK3 G;  4JYA O;  4O4J A;  2CGF A;  2XCM A;  4AWQ A;  5CMU A;  1Q81 W;  4FCR A;  3OFN G;  3Q4H B;  1ARO P;  4QNH B;  4JI4 O;  5H6R A;  1DF5 A;  5ITZ A;  3T0Z A;  3FD9 A;  1SQP H;  4LWS A;  1M56 C;  4FZ1 A;  3JD4 A;  4FLU A;  3O0I A;  3T10 A;  3CWB H;  3ASO B;  1R6K A;  3O65 A;  2XHB A;  1FXK A;  4GX0 A;  3E89 A;  1YET A;  5JWP A;  4H37 A;  3AK2 A;  1M4U A;  1TUB B;  4MP2 A;  1M93 A;  4UVC A;  1AI7 A;  2FXS A;  3P30 A;  3DXR B;  2N04 A;  2QWR B;  2QG0 A;  5IYB O;  4CWN A;  2XDL A;  3CGZ A;  4AHC A;  5KHH A;  2GUZ B;  5L3C A;  3VHD A;  5EIB D;  3A0W A;  3SJQ C;  2YE2 A;  2UU9 O;  3KG2 A;  3LDC A;  5LL6 Y;  5C8Y B;  1EZV H;  1MA1 A;  4F4L A;  2VW5 A;  1A4H A;  4FMT A;  1V54 B;  4P8O A;  1MU5 A;  1WA8 B;  4AQY O;  4DR7 O;  3FT8 A;  4W7T A;  3CCJ V;  3EHF A;  4UB8 Z;  4AS9 A;  2ZKO A;  3TET A;  1HR0 O;  1ROP A;  3LNU A;  1A32 A;  1PKX A;  1MX0 A;  1SQF A;  3FYE B;  5J9P C;  1XEQ A;  2YKE A;  5HFM A;  4LFA B;  3ABM B;  4I50 B;  3ZHU A;  4WFG A;  4MTO A;  3K5N A;  1Z59 A;  2D2C B;  5GTH Z;  2FL4 A;  5KLV H;  3RYC B;  2XOK G;  1W59 A;  3K98 A;  3NR7 A;  1P4R A;  1IZ3 A;  4PDR A;  2Q7E A;  3JAL B;  2O1U A;  5LP6 A;  3SYC A;  3SL2 A;  3D3Q A;  4TT3 G;  1AH6 A;  4E2L A;  1JCH A;  3ZRV A;  1RM1 C;  5KHG A;  4RO2 A;  5H6Q A;  1YT1 A;  2Q4P A;  1GM7 A;  4LFC O;  2Q6A A;  2WI4 A;  4CS3 A;  2YXH A;  4DW1 A;  2UXB B;  2Q68 A;  4R7C A;  1NR7 A;  4O07 A;  1S76 D;  4TWK A;  3JD2 A;  3G6E V;  4LF5 B;  3CRC A;  4X89 A;  1GKF A;  4X66 B;  1KMI Z;  5BR8 O;  4ICG A;  4FM2 A;  1TUB A;  5TIS Z;  3G7E A;  4UV9 A;  3AG1 C;  5B1O A;  1GN2 A;  3DXR A;  2XAQ A;  3CEI A;  2HHH O;  2ZE5 A;  2XJX A;  4DR1 O;  3K5L A;  1L0L H;  5LMU O;  3VBB A;  3I5D A;  1S3J A;  1E79 G;  2EIJ B;  3FX7 A;  4XIP A;  2E5L O;  3CCE V;  3FAV B;  3JD3 A;  3B28 A;  3OGC C;  4GX1 A;  4OGQ B;  5C8Y A;  3INX A;  5D7R A;  4PA7 A;  2Q8H A;  4GT8 A;  4RQF A;  5JCO C;  5CBH A;  1YC3 A;  5FNC A;  1F7Y A;  1WA8 A;  1KUQ A;  5KX5 B;  3HEK A;  3PN1 A;  4MSW C;  1R73 A;  4PV1 B;  1YT0 A;  3T4D A;  5LMN O;  4LF8 O;  1BSM A;  3A0R A;  1Q6I A;  3GWO A;  5KMG A;  2VWC A;  1HW7 A;  2VWJ A;  1M57 C;  3LMM A;  4U3J B;  2EIK B;  1PNM A;  1NHI A;  2WLK A;  4PU9 A;  1ENV A;  3QF7 A;  4FM1 A;  4DR5 O;  2OWO A;  1TBW A;  4FLV A;  1ZTE A;  4MBC A;  5EC2 C;  3AK3 A;  1I94 O;  5FPO A;  1BS3 A;  4J80 A;  5E1A C;  4CWF A;  2DW4 A;  5BZB A;  1KU9 A;  2JGD A;  3QO8 A;  1SC5 B;  2EIL C;  3JCU Z;  4JQL A;  4XIQ A;  1DTO A;  2DMX A;  4KSG A;  1U96 A;  2CAZ C;  1N36 O;  1JMK C;  2CGN A;  1HP8 A;  1S16 A;  2IJK A;  1FJG B;  2WEQ A;  4DK0 A;  4WBN B;  1N0N A;  4UVA A;  2OT5 A;  2KG7 B;  4XIR A;  3ICX A;  3CCM V;  3A8T A;  1N33 O;  4I9Q A;  1NJI W;  4UFZ A;  3ZCC A;  3ZHT A;  4B3M B;  3MAQ A;  1Q6H A;  3CD6 V;  2EZO A;  4B6C A;  2ILM A;  2X6B A;  3WB2 A;  3LSS A;  1FFT B;  4O2B A;  3SYA A;  5M4K A;  1O9G A;  2O1V A;  3MD0 A;  2OIG A;  3RYH B;  1N34 O;  3E8B A;  4Z2W A;  1F4M A;  4JI5 B;  4NXM B;  2BU6 A;  4UCO A;  5B1B C;  4J7Z A;  3HB3 B;  2Q2E B;  1XHX A;  1FKA O;  4KHP O;  4CWQ A;  1KP3 A;  1AB3 A;  5DN6 G;  2BRE A;  1SKV A;  1AMW A;  1IXB A;  3AG2 B;  1R3K C;  5B1A B;  1S77 D;  2A9H A;  2FYP A;  2P4K A;  4EMV A;  3ABK C;  3G67 A;  2DWE C;  4HYP A;  1Z5W A;  2RN9 A;  3DC6 A;  4MOT A;  3RYI A;  4CBC A;  4GYC B;  1EN6 A;  3CP1 A;  3MHS C;  4MT8 A;  3JAW A;  3E22 B;  3GIE A;  1G8M A;  4TV9 A;  4JAS A;  3D8C A;  5KHK A;  2WLN A;  3OW2 U;  1ZX3 A;  2ZM6 B;  3GIF A;  5A9G A;  5FL7 G;  4JI8 B;  5CBF A;  1VQ5 V;  4YKZ A;  2YJW A;  4WFF A;  2JJ2 G;  5IN9 A;  2ZIN A;  3WG7 C;  2YKC A;  1IDS A;  4MVO A;  5FLX N;  1THN A;  2RJZ A;  3MHH C;  1ZL8 B;  4DZY A;  3N2G A;  1JX9 A;  4KXR A;  2BSK B;  1OCC B;  4L91 A;  2YGF A;  3ETE A;  3CX5 F;  2ARH A;  4DV5 B;  2YI0 A;  3ZHQ A;  1Y76 A;  3L75 H;  1WPB A;  3PEH A;  4L8Z A;  4LFB B;  1YVW A;  3M99 B;  3E83 A;  1OV9 A;  2IJJ A;  4I0X B;  3APO A;  3SYO A;  4LH7 A;  4DV1 O;  4DR3 O;  5EC1 C;  2R9A A;  3TK1 A;  4BR6 A;  3HZ5 A;  4P9O A;  2BCC H;  1M90 W;  3L9D A;  3BY6 A;  4H44 B;  5K1X A;  3JD1 A;  3B27 A;  1UFI A;  3OTO B;  2PTM A;  3ZRS A;  4DRX B;  2DOS A;  4CS4 A;  5DM6 V;  3E8G A;  1KB9 F;  3RGB A;  4URN A;  2F66 C;  3A0Z A;  3T1C A;  1KEC A;  1O9H A;  1IBL O;  3B4S A;  2UXC O;  2JRI A;  3U2K A;  2H8P C;  2ADQ B;  4XDL A;  4OPH A;  1XNR O;  1UYM A;  4FLZ A;  1FXV A;  5FWK A;  1EBO A;  2EZP A;  2P67 A;  4JI3 O;  2XJJ A;  3CRA A;  4DR6 O;  1OSF A;  3RYF B;  4P7A A;  4HAM A;  5GGZ A;  5FNF A;  2YKB A;  2WLJ A;  1KC8 W;  3U67 A;  5IJ0 B;  4UB6 Z;  1XRE A;  2WLM A;  2BRC A;  1JFF B;  1XI1 A;  1K34 A;  5FNV A;  2AZ0 A;  2QEX V;  1EN4 A;  1TGO A;  1COW G;  1S72 V;  3AG4 C;  5CBG A;  4JTA B;  3R65 A;  2HG5 C;  3T2S A;  4DR2 O;  5EZY B;  4I55 A;  3SPG A;  3O9O A;  2IWU A;  3PEJ A;  2BTQ A;  2BSK A;  2WLH A;  3G71 V;  2A06 H;  2CCT A;  4LC1 A;  2ZXW B;  1G1X B;  5C93 A;  3C0E A;  4QGP A;  4EGH A;  4P30 A;  4MPN A;  4CC6 A;  3ZRX A;  1VQP V;  2WI3 A;  5IJ9 B;  4XBF A;  3AG3 C;  2FB5 A;  1YC1 A;  4LF6 O;  4YJ3 A;  4YY3 O;  1PV0 A;  2Q69 A;  2Y4U A;  3RKZ A;  3BAA A;  1SF9 A;  2XAG A;  4JI6 O;  3OR7 C;  4DYL A;  3ZMT A;  1UY7 A;  2ZR2 A;  2UUB B;  3S3W A;  5LOV A;  5H5N A;  3P32 A;  4DRX A;  3RFR A;  4WUD A;  4JV5 B;  3E8F A;  2R70 A;  2LP7 A;  1UYG A;  3C3S A;  1VQN V;  2ZNJ A;  4JI2 B;  3CC2 V;  5CA0 B;  5F5R A;  1M9N A;  5D7D A;  3B24 A;  4DV7 O;  3BAB A;  2Q73 A;  5JJE B;  3K60 A;  1SRY A;  4QIW F;  5EIB C;  3ZHR A;  3CCU V;  4WFA V;  4HNA B;  1UYL A;  4XKO A;  5JQG B;  3NMQ A;  2O1W A;  4KL1 A;  3VAD A;  1K5Q A;  3JZ3 A;  1CP9 A;  1I5B A;  4KSH A;  3AG7 A;  2P6J A;  4MVU A;  1ZXN A;  2QTS A;  4BWA A;  4ASB A;  2XAF A;  3G6B A;  3IC7 A;  4NXN O;  4TUY A;  4LWH A;  4V26 A;  5EZY A;  3LUT B;  4KTN A;  4HXZ A;  4W4L A;  2OCC B;  1W2B U;  1DLB A;  1FFX B;  1H7S A;  4PI0 A;  4ZOL A;  2OCH A;  4LF7 O;  2K9P A;  4IL6 Z;  1AVM A;  1KP2 A;  2WSS G;  2Y0P A;  3IGA C;  2DE0 X;  4DV0 B;  1B04 A;  3TCU A;  4O4J B;  2X6A A;  3K03 A;  4RAI A;  3X2Q B;  3CYG A;  1RPO A;  2C2A A;  2X7R B;  5IJ9 A;  4JZ2 A;  1K4C C;  4C7U A;  3U2D A;  2JJ1 G;  2R9I A;  2V7Q G;  1NH2 B;  1URF A;  3FKS G;  2ZNI A;  2IWX A;  2LFR A;  4GKJ O;  1UYE A;  3E86 A;  4UCR A;  4K8X A;  2CE4 A;  1UY8 A;  2ZDX A;  4E00 A;  1V55 C;  1FXK B;  3CC7 V;  5IY5 B;  5K1P A;  2AGA A;  4HBN A;  4CZZ A;  2VCI A;  3IAY A;  3OAA G;  4MS2 A;  5CTY A;  4GX2 A;  3RBZ A;  2BYH A;  5CA0 A;  1TH8 A;  3SR2 C;  1SQV H;  2H94 A;  2HVK C;  1P84 F;  3LSU A;  4JAU A;  2XTA A;  3BMY A;  1YTF B;  5CTW A;  1KZN A;  1K92 A;  2E75 B;  1ZLZ A;  2WI1 A;  3H1I H;  4FZ0 A;  2IBZ H;  2WLL A;  1VF6 C;  4EM7 A;  4JI0 O;  2Q0A A;  1SQQ H;  2KQX A;  2QSA A;  4IYH A;  4QE9 A;  5FND A;  4DV3 B;  5L3E A;  4LFA O;  4CH6 A;  2F23 A;  2ZE7 A;  4CWO A;  1K3E A;  1BE3 H;  1UJW B;  2VRZ A;  1JJ2 U;  5LGN A;  4FCQ A;  4O2A A;  4HY1 A;  2QGN A;  2P06 A;  4U3F H;  4DV4 O;  1M56 B;  4DUZ B;  1H2G A;  1OCZ C;  1EFR G;  4HZ3 A;  3L74 H;  1NKD A;  1E1Q G;  3RLQ A;  5CN0 A;  2E3C A;  2W0X A;  5M4H A;  3U11 A;  1Y6X A;  3VQX A;  2A79 B;  5LP6 B;  3OGI B;  2ZR3 A;  2GQP A;  1NS1 A;  3CGY A;  3R4N A;  2UXB O;  1K33 A;  1ZAU A;  1BT8 A;  3ZMZ A;  2YE3 A;  2JJC A;  1HNX B;  4G28 B;  3DSQ A;  3WFV A;  4YIP A;  3F5T A;  2M6Y A;  4LF5 O;  3ZED A;  1VF7 A;  4FK5 C;  2JS5 A;  4F6R A;  1RSO A;  4A5U B;  4O4L A;  5CA1 A;  2YI5 A;  2LGW A;  2ZCE A;  4J41 A;  3FB8 C;  1F51 A;  3B40 A;  4MVZ A;  1K7D A;  3RWR D;  4HZ0 A;  1D2D A;  1J5E B;  1YCI A;  1QZR A;  4NH8 A;  4XKK A;  1YIJ V;  4JI7 O;  3K79 A;  5BMV A;  1N8R W;  1VQL V;  3CRR A;  1TIL A;  5BOD A;  4I7Z B;  3QO5 A;  3HKD B;  4QJF B;  3U0Z A;  1YF2 A;  2YXY A;  3HKB A;  1FPO A;  2IU3 A;  3ZMU A;  1QR9 A;  5HFL A;  5LGT A;  2UUA O;  3HYY A;  2YIB A;  4B3R B;  3B26 A;  1JVM A;  4LH6 A;  4BIU A;  3GB7 C;  3LPS A;  3T1Y B;  4BIO A;  4F6E A;  3CC4 V;  4MTG A;  1YJ9 V;  4X9L A;  3ASN B;  3ETQ A;  2QA4 V;  5IWA B;  4K0K B;  2PZS A;  5KMG B;  3JSN A;  1IBM B;  3B09 A;  2YSU B;  2A7W A;  2XK2 A;  2E0A A;  1HNZ O;  3ZHV A;  1KKC A;  4MW8 A;  4O4I A;  4R50 A;  3TXS A;  3ASO C;  2EXL A;  3ZMV A;  1U2O A;  2XD6 A;  4H81 A;  1GH6 A;  1NTZ H;  2LGQ A;  3CCS V;  2JGD B;  1YXB A;  4N21 A;  4FFB A;  3BCC H;  2YE9 A;  3CXH F;  5CB4 B;  1N32 B;  4NR1 A;  2R72 A;  5IYC O;  2Q9L A;  2PYL A;  4UXN A;  1P7B A;  1J95 A;  2KB1 A;  3QG5 A;  1B63 A;  2DYR B;  1DK1 A;  3D36 C;  4YJ2 B;  2PNR A;  2VQE O;  1OCO B;  5FPR A;  5EBW C;  4MVM A;  4B3T B;  1VAR A;  4B3M O;  4P9P A;  3M7M X;  1GKX A;  2CCU A;  1V54 C;  2HEP A;  3BA9 A;  1YDX A;  3ZHS A;  1RPR A;  1Y4U A;  3ML0 A;  1EZJ A;  2R9R B;  1SZX A;  2RNB A;  3UQ8 A;  1Y66 A;  4W4K A;  3HKD A;  1XMO O;  1G4Y B;  4JYA B;  4MTX A;  4K8Z A;  3AK1 A;  3HKC A;  2NR5 A;  2DWD C;  3ABL B;  3ABM C;  3VQV A;  4XIT A;  1P49 A;  1NHJ A;  1GKZ A;  1NBM G;  4DV2 O;  4JI4 B;  2B5U A;  4O2B B;  1PP9 H;  5EK0 A;  1D5A A; 
#chains in the Genus database with same CATH homology
 3FYI B;  4MVS A;  4JF3 A;  4JAS A;  5GW7 A;  1AJN A;  3W7X A;  2DQ3 A;  2WLN A;  3OW2 U;  4GX5 A;  5FL7 G;  3ETD A;  3I55 V;  2YEV B;  3HPL C;  5CBF A;  1BL8 A;  1VQ5 V;  1Q82 W;  2DYS C;  4WFF A;  2JJ2 G;  2HVJ C;  3WG7 C;  3CYO A;  4R6Z A;  4MVO A;  4EKW A;  3MHH C;  2W6I G;  3NXS A;  3B77 A;  1WLE A;  4WF9 V;  1JX9 A;  2ZD9 A;  3UKM A;  3E2E A;  1NH2 D;  2P90 A;  1OCC B;  4PEL A;  1YIT V;  3ABT A;  1OHH G;  3SPC A;  5L3G A;  3K0G A;  2AHY A;  5LHI A;  4J9Y B;  2B1I A;  1DF4 A;  3ETE A;  3SPH A;  1VQO V;  5B1N A;  1SET A;  2JEU A;  1QBZ A;  3M99 B;  1YJN V;  2ITC C;  3E83 A;  2B1G A;  2IJJ A;  4J9Z B;  1Q86 W;  2QKS A;  1QR8 A;  2GSM B;  3SYO A;  1BHA A;  5LHH A;  2UXX A;  1KQS U;  5EC1 C;  1MG1 A;  3TK1 A;  1YTF D;  4P9O A;  1TUE B;  4DXW A;  1M90 W;  1KD1 W;  1SES A;  2HJF C;  3BY6 A;  4WCE V;  1AI4 A;  3JD1 A;  3ZRS A;  1F23 A;  3QO7 A;  3I56 V;  1RM1 B;  3SYQ A;  2HFE C;  5DM6 V;  3E8G A;  4P2Z A;  1YSC A;  2EIM C;  3K06 A;  4WFB V;  1NQT A;  1GK9 A;  2GHY A;  1KEC A;  2WLI A;  3T1C A;  1R3I C;  2NNU A;  3OE7 G;  4QPJ A;  4FJC C;  2XND G;  2XAS A;  2H8P C;  4XDL A;  3SYP A;  4WFE A;  1H8H G;  3RW0 A;  3ETG A;  1FXV A;  2QM7 A;  1EBO A;  2EZP A;  2P67 A;  3G4S V;  3CME V;  2BOC C;  3AG1 B;  3K0D A;  4XDK A;  4HAM A;  5CA3 A;  3B8M A;  4H33 A;  3ABK B;  2WLJ A;  1KC8 W;  1THZ A;  1QLN A;  2WLM A;  2Q67 A;  3STL C;  4UUJ C;  1QVG U;  2YEV A;  3JCZ A;  2Y69 B;  1K34 A;  2M7W A;  1ORQ C;  4I9W A;  4JAV A;  1K4D C;  2QEX V;  1S72 V;  1COW G;  3FB5 C;  2PI4 A;  1L1F A;  3AG4 C;  5CBG A;  4GCZ A;  1WPX A;  1HWY A;  2WWW A;  1SZT A;  3R65 A;  4JTA B;  2HG5 C;  5LBQ A;  3W7T A;  3SPG A;  2ZQM A;  2WLI B;  1K9M W;  4BIZ A;  2WLH A;  2IU0 A;  3G71 V;  1PD3 A;  4Z1M G;  5B3S C;  4LC1 A;  2ZXW B;  4UV8 A;  5C93 A;  4JPR A;  2IJI A;  4XDJ A;  3ASN C;  3OM3 B;  3CMA V;  1M57 B;  3LDD A;  4P30 A;  1SER A;  2OTJ V;  1E1R G;  3ZRX A;  1VQP V;  4XBF A;  3AG3 C;  2EJR A;  1H38 A;  4JTC B;  5IY5 C;  1GM9 A;  2Q69 A;  1K97 A;  2WPD G;  1NVP B;  3K08 A;  2QE7 G;  2XAG A;  3DTU B;  2UXN A;  2ZDI C;  3OR7 C;  3W7W A;  3LDE A;  3ZMT A;  4LP8 A;  4N23 A;  2ZR2 A;  1OZ0 A;  3P32 A;  2EIL B;  3OUS A;  3E8F A;  1XL6 A;  3PJS K;  2LP7 A;  4RQE A;  1CEZ A;  2JDI G;  1VQN V;  3CC2 V;  4MTF A;  1M9N A;  2CK3 G;  3D36 A;  5IYD O;  1AI5 A;  5CMU A;  1Q81 W;  1SRY A;  4QIW F;  2X0L A;  2DYR C;  1VQM V;  3OFN G;  1PNL A;  1OCO C;  1ARO P;  2XAJ A;  3OMN B;  1R3L C;  2HR3 A;  3B8N A;  4QNH B;  3CCU V;  4WFA V;  5H6R A;  1DF5 A;  2MK3 A;  1VQ6 V;  1R6N A;  1M56 C;  3AG2 C;  4TSF G;  3JD4 A;  4DO2 A;  1AJQ A;  1K5Q A;  5B1A C;  4PDM A;  4MVR A;  3ASO B;  1R6K A;  3H01 A;  3VOU A;  1CP9 A;  1FXK A;  3ZIA G;  3D3I A;  4GX0 A;  1FXH A;  5KA5 A;  1OCR C;  5L3B A;  3E89 A;  2Z5U A;  4U7N A;  4H37 A;  2P6J A;  2EIJ C;  4MVU A;  3ABL C;  4UVC A;  1AI7 A;  4LBE C;  1XL4 A;  3P30 A;  2WAM A;  2XAF A;  3LNM B;  4L87 A;  4MVQ A;  3IC7 A;  4G27 B;  3EHB B;  5IYB O;  3W7U A;  1CPY A;  5EBL C;  3LUT B;  2OCC B;  1W2B U;  2A0L A;  3ZJZ A;  1DLB A;  1R3J C;  2JK5 C;  2LFS A;  5B1B B;  5L3C A;  4PA3 A;  3SJQ C;  4PA6 A;  2WSS G;  1KP2 A;  3IGA C;  3CCV V;  1PNK A;  3KG2 A;  2EBO A;  3LDC A;  1GMG A;  4PDL A;  4Q20 A;  3TCU A;  2X6A A;  3K03 A;  4HYO A;  2ATK C;  2QM8 A;  4RAI A;  3X2Q B;  4F4L A;  3CCL V;  4FMT A;  1QLE B;  1V54 B;  1RPO A;  2C2A A;  2FTK A;  2X7R B;  1QCE A;  1K4C C;  2JJ1 G;  3CCJ V;  2EIK C;  2R9I A;  3RVY A;  1ZWI C;  2V7Q G;  4UVB A;  3TET A;  1NH2 B;  1ROP A;  2IJH A;  3FKS G;  2LFR A;  1PKX A;  2EIN C;  4RUF A;  3E86 A;  3FYE B;  5J9P C;  2V1D A;  1K73 W;  2K1E A;  5HFM A;  1V55 C;  1FXK B;  3CC7 V;  5IY5 B;  3ABM B;  2P7T C;  4WFG A;  4MTO A;  1S0V A;  3OMI B;  1VQK V;  4CZZ A;  4JYC A;  2XOK G;  1AR1 B;  3OAA G;  4MS2 A;  4GX2 A;  3RBZ A;  2AHZ A;  4YXW G;  1P4R A;  4PDR A;  2H94 A;  2HVK C;  3SYC A;  2NLJ C;  4JAU A;  4WFH A;  1YTF B;  4TT3 G;  2F43 G;  4E2L A;  1JCH A;  2DYS B;  1W0K G;  3ZRV A;  1K92 A;  1JQ0 A;  1RM1 C;  3WG7 B;  1B6Q A;  4RO2 A;  5H6Q A;  2D3O W;  1GM7 A;  2Q6A A;  2WLL A;  1GM8 A;  3E35 A;  1I5Y A;  3OR6 C;  4RUE A;  3DGE A;  2Q68 A;  4LCU C;  4R7C A;  4QE9 A;  1NR7 A;  2ITD C;  5H9C A;  2Z3Y A;  5L3E A;  1PL0 A;  2QTO A;  1YHQ V;  1S76 D;  4TWK A;  1K3E A;  3JD2 A;  3K9A A;  4PDV A;  3G6E V;  4ZKI A;  4X89 A;  1UJW B;  1VQ7 V;  1JJ2 U;  1GKF A;  5LGN A;  5KA6 A;  3ZN1 A;  1Y4M A;  4PA4 A;  1M56 B;  3AG1 C;  4UV9 A;  5B1O A;  1H2G A;  1LNQ A;  1OCZ C;  3EFF K;  4MW3 A;  5EBM C;  1EFR G;  4HZ3 A;  3F7V C;  1NKD A;  2XAQ A;  1E1Q G;  2HKO A;  3CXC U;  2X6C A;  5CN0 A;  1OCR B;  3OMA B;  3VBB A;  1S3J A;  1E79 G;  2EIJ B;  1Q7Y W;  4G2K A;  2A79 B;  3CCE V;  3CCR V;  3JD3 A;  1YI2 V;  2ZR3 A;  3OGC C;  2Y69 C;  2PI5 A;  4GX1 A;  1K33 A;  5L3D A;  4PA7 A;  3ZMZ A;  2EIM B;  4RQF A;  4G28 B;  5CBH A;  1GTO A;  3WFV A;  1AI6 A;  4JTD B;  1VQ8 V;  2WLL B;  4FK5 C;  1R73 A;  4MSW C;  2OTL V;  4KUM A;  3T4D A;  3RVZ A;  3OEE G;  3W7S A;  2IH1 C;  4FPP A;  2JIZ G;  1MAB G;  5L3F A;  2HLD G;  3A0R A;  2ZXW C;  3AEI A;  4OXS A;  3GWO A;  3FB8 C;  1F51 A;  4MVZ A;  1M1K W;  1K7D A;  4X8A A;  1M57 C;  3ABU A;  2JEX A;  2EIK B;  1YIJ V;  1PNM A;  2WLK A;  4R8C A;  1MSW D;  1ENV A;  3K79 A;  4QE7 A;  4BAY A;  1JPX A;  3T4Z A;  1N8R W;  1VQL V;  2EIN B;  2ZDI A;  5EC2 C;  3IFX A;  3QO5 A;  4BW5 A;  4QJF B;  5E1A C;  1V55 B;  2DW4 A;  3OEH G;  5BZB A;  3BEH A;  2IU3 A;  1W0J G;  3JYC A;  3ZRW B;  3QO8 A;  3SPI A;  2EIL C;  3STZ C;  1GO3 F;  3ZMU A;  1QR9 A;  5HFL A;  5LGT A;  1F4N A;  3CCQ V;  5IDJ A;  3ZMS A;  3K3W A;  1DTO A;  3AG4 B;  2XAH A;  4KP4 A;  1JVM A;  2W6J G;  3QNE A;  4BIU A;  2Y48 A;  3GB7 C;  4FIP C;  4I5S A;  1VQ4 V;  3CC4 V;  4MTG A;  1YJ9 V;  2IJK A;  5B3S B;  1KKD A;  3CPW U;  4ZBM A;  1I5X A;  3LSQ A;  1OCC C;  1BHB A;  1YJW V;  3ASN B;  2IH3 C;  4JYB A;  3E8H A;  2OT5 A;  4UVA A;  2QA4 V;  1BMF G;  3FB7 C;  3CCM V;  5KUM A;  4ASU G;  1NR1 A;  3JD0 A;  3AG3 B;  2YSU B;  1NJI W;  3ZCC A;  1NVP D;  2BOB C;  3CD6 V;  4MW8 A;  2EZO A;  4R50 A;  3ASO C;  2X6B A;  3ZMV A;  5KUK A;  5LHG A;  3F7Y C;  1JOY A;  4U7O A;  3LSS A;  1OCZ B;  2IW5 A;  1FFT B;  3CCS V;  2DQ0 A;  4N21 A;  3SYA A;  3ZN0 A;  3K04 A;  3MD0 A;  1QVF U;  3E8B A;  2OCC C;  5LGU A;  4KFM A;  1F4M A;  1K5S A;  4PA9 A;  5IYC O;  5B1B C;  4UXN A;  1K8A W;  4GT1 A;  1P7B A;  1J95 A;  3HB3 B;  2KB1 A;  1VQ9 V;  2DYR B;  3OUF A;  3UM7 A;  1AJP A;  1KP3 A;  1OCO B;  1H8E G;  3X2Q C;  1S5H C;  5EBW C;  4MVM A;  1FS0 G;  1QLE C;  4P9P A;  1V54 C;  1RPR A;  5DN6 G;  4JGS A;  3FB6 C;  3ML0 A;  1EZJ A;  2R9R B;  3AG2 B;  1R3K C;  1Y66 A;  3SPJ A;  5B1A B;  1S77 D;  3T2M A;  2A9H A;  1G4Y B;  1IXM A;  4MTX A;  3ABK C;  3ZRW A;  2W0F C;  2DWD C;  1FXK C;  1MOF A;  2DWE C;  3ABL B;  3ABM C;  4CBC A;  4X88 A;  3CP1 A;  3MHS C;  4MT8 A;  1NBM G;  4QPK A;  2B5U A;  5EK0 A;  3F5W C;  1G8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...