1IXMA

Crystal structure of spoob from bacillus subtilis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
168
Chain Sequence
SDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDIMRFEITSHECLIEIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SPORULATION RESPONSE REGULATORY PROTEIN)
publication title Formation of a novel four-helix bundle and molecular recognition sites by dimerization of a response regulator phosphotransferase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 56
structure length 168
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
A PF14689 SPOB_a Sensor_kinase_SpoOB-type, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ixmA01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 1ixmA02
5B1NA 2WWWA 5IDJA 3A0RA 2C2AA 3TK1A 3MD0A 2LFSA 3ZRVA 1IXMA 4ZKIA 4GT1A 4GCZA 4QPJA 4BIUA 4MT8A 4MTXA 2LFRA 3ZCCA 3ZRWA 4JASA 3DGEA 4JYBA 3ZRWB 2FTKA 4JYCA 4LC1A 3ZRXA 3NXSA 4QPKA 4FMTA 5C93A 1JOYA 3P32A 1F51A 2QM7A 4KP4A 3D36A 4U7OA 4JAUA 4FPPA 5B1OA 2P67A 2QM8A 4JAVA 4I5SA 4Q20A 4BIZA 4U7NA
chains in the Genus database with same CATH superfamily
4EEQA 4YJ3B 2YXYA 2VQEO 2QKAA 1M9NA 5LBQA 1BSMA 3JAWA 1VQNV 1KU9A 2P06A 4CH4A 3ETEA 1MX0A 4CE2A 3K04A 1FPOA 3OEHG 1URFA 4YKWA 4ASAA 1Y8OA 3C3SA 4IGGA 4R3MA 2YE7A 3RVYA 5JJNB 2ZNIA 4X89A 1N8RW 2VWJA 4DR3O 4LFAB 4W7TA 2Q8FA 3JZ3A 4DR5B 2UXXA 4PJ0Z 1NH2D 2MK3A 1G4YB 3TCUA 2M6YA 3PEJA 4HY6A 2XDUA 2YEIA 2B9ZA 5CBFA 3NXSA 4UCTA 1YS3A 5LP6C 1EN5A 4LFBO 1MMMA 5EZYA 1KIJA 3E22A 2ZDIA 4XIPA 2EZOA 2IORA 2V4DA 1IDSA 1SERA 2GUZA 2ZD9A 4RAIA 3BFRA 1LUWA 2Y0IA 4PI2A 2XAGA 5A9GA 1NI8A 4CE3A 4I7ZB 4WF9V 1M57B 4ZVIA 2KSDA 1K73W 1YERA 2FXSA 4BXIA 1XHXA 1MOFA 2BSKA 3B77A 2IOQA 2DQ0A 1R3LC 4ASGA 2X6CA 2FYPA 4FM1A 2W0XA 2YEDA 2PYLA 4LFCB 3T4ZA 4HAMA 5FL7G 2VW5A 4LNUB 4EFBA 2QKCA 4PV1B 3LPSA 5LOVA 4O0BA 1FAFA 3G6EV 1YTFB 1S72V 1IXMA 1OCRB 4YKTA 1Z5CA 1AJ6A 2C1GA 1Q3EA 4DV4O 1Z5BA 2H8PC 2ZM6B 1DF5A 4H7QA 1VQ7V 3QO7A 3JD3A 4XITA 1AR5A 2EIJB 1AM1A 2ZKOA 1YSRA 3U2KA 2YIBD 4AWQA 3INWA 5FNDA 1IBLB 3CRLA 4GKJO 5LMUB 3QG5A 4TUYB 2PY5A 4PA7A 4CS3A 2R9RB 2V1DA 4DV1O 1U97A 2ZKJA 1HDJA 3R91A 1MSWD 1YJWV 2XHRA 4G27B 1Y76A 1UY6A 4DR4B 4JI3B 3CRAA 2IOPA 2YIAA 1JX9A 4PDMA 3TZ0A 5LP6B 3WFVA 3AK3A 4KP4A 4G28B 3PEHA 1PPJH 3FT5A 2Y69C 2XK2A 4GQTA 4PRXA 2UXBB 4HYMA 3J81N 1JFFB 2DYRC 2ARHA 5LMNB 1TC0A 1XMOO 2BYHA 1YZBA 5J2TB 4B7EA 3RYHB 1X4TA 2JDIG 5KHKA 1NHIA 1FFXB 4JI8B 2UXCB 5L3GA 2CCUA 5A2QN 2LJ2A 3EXAA 1J5EB 1K8AW 4R6ZA 3ZMZA 2QWOB 3KG2A 3O65A 1PL0A 4MBCA 2GSMB 3RYCA 2IWXA 3HR0A 3BPZA 2WLLB 4HXZA 2YKBA 1BL8A 3BA8A 5IYZA 5BZBA 1TILA 3E35A 3B4SA 3GVMA 2FWZA 4YHHO 1KBHA 4P7AA 1EZJA 3R92A 1X59A 2CH7A 4K4OA 4LF7B 4ZI7B 1UYIA 3W7WA 5CA0B 1WJZA 4LWEA 4NXMO 4MVRA 1K9MW 1XOUA 4UROA 1SRYA 2YK2A 1N4CA 4K3AA 4QE7A 1H8HG 3T4DA 2Y69B 3H1IH 5L3DA 5KMGA 3B8MA 5LGTA 5EIBD 1NS1A 2Q5ZA 4LH7A 4FFBA 2BT0A 3R4OA 1AVMA 2KKWA 2DYRB 3HKEA 4WFBV 1K4DC 4J41A 1N0NA 3CCLV 2QKSA 1MA1A 5LGNA 1EBOA 2VQFO 4CH5A 4UCVA 2YI5A 3F5WC 3T0ZA 4X64O 4CWTA 4E01A 1R3JC 2HJDA 1AP5A 1MZFA 2YKJA 3OFNG 1TUEB 3E8FA 5IJ9B 1K97A 1YF2A 2QM8A 3OE7G 3OW2U 2IWSA 4CWSA 1S0VA 1ID0A 3ABKC 2XASA 5L3FA 2ILMA 4PDRA 3DGEA 2KB1A 4LC1A 1SQXH 3OTOO 3FV5A 1YT0A 4DV7O 3RKZA 2YECA 4QPKA 3OD4A 3ZXQA 3EVKA 5BY1A 3CCUV 5KHHA 1N34B 5JCOC 2UUAB 1MG1A 3MAQA 3HB3B 1VQ5V 4GKKO 1TUBB 4LBEC 2XHTA 5CBHA 4RQEA 4O4IA 4DO2A 2ZDYA 4MVMA 3N27A 1NH2B 1YSCA 1US6A 2O1VA 1XBLA 1Q90D 4TT3G 2KG7B 4X65B 3G71V 4JI7B 1Y74A 4TV9B 4X66O 4YJ3A 2AZ2A 4MW8A 1QLNA 4JI4B 3K5MA 2ZR2A 3E86A 5CMUA 2FMLA 4NKGB 5IYDO 3ETDA 3N2KB 1MABG 3ZCCA 1S14A 2YI9A 2GFDA 1ZL8B 2FYUH 1H2NA 2HR3A 3SPHA 1T5EA 1JOYA 2Q0OC 1UYMA 4MPNA 4B3TO 2KQXA 4RO2A 3CXCU 3JATB 3SYCA 3K98A 2GTSA 3BY6A 3RFRA 2RQ6A 3ABMC 4WFFA 5CA1B 3SDLA 5AG2A 3TXQA 2X0LA 2ZR3A 4XCLA 4LFAO 3GIGB 4DR5O 2Y4UA 1V55B 5IJ0B 3DC5A 5CTWA 4LP8A 4FLTA 1QYEA 4AI8A 4DYLA 1AH8A 5LXTB 1HW7A 4J9ZB 3GWOA 2NNUA 4LF5B 3BA9A 3SPCA 4OX9B 1I58A 1GN4A 4K0KO 4DK1A 2HJFC 4R50A 2IU0A 2IJHA 4R8CA 2WI5A 5LYJB 2HCHA 1HR0B 2P5OA 2LO1A 2HVKC 1YC1A 5KX5B 4UCSA 3SPJA 3WB2A 1FJGB 2AKPA 4O09A 3IFXA 5EIBC 3WHAA 2Q7GA 4YXWG 1E1QG 1Z5WA 4JI6B 1ORQC 2CTWA 2EJ7A 1XQ8A 1I59A 1YEWA 3SYQA 2WLIB 3UO3A 2DE0X 4MPCA 4CWRA 2GDSA 3M99B 3SPIA 3ZMTA 1UYLA 4TUYA 3CCVV 1O9GA 2QDOA 2ZM6O 3K60A 4UV8A 3ABMB 2HKJA 3H01A 2B1GA 4I9QA 3C3TA 4GT8A 3ZN1A 1IBLO 4YKZA 1BMFG 3ZHTA 4HNAB 5LMUO 3DXRB 1BT8A 1KZNA 4EM7A 2IW5A 1WA8B 4LF6B 3I5DA 5LP6A 4NXNB 2IM9A 2BOBC 2DWEC 1IBMB 1SQBH 1YSZA 4O04A 1K92A 1VF7A 4Q20A 4YKXA 2E3CA 4DR4O 4JI3O 2NN4A 4J10A 4DV6B 3W7TA 1JFFA 5IY5C 5J2TA 3M7MX 1NVPD 4EGHA 1HP8A 2Q8VA 3RYHA 1BE3H 1P7BA 3FYIB 2UUCO 4XKKA 3AG4C 1WB7A 4CS2A 1BS3A 1S5JA 2UXBO 4L91A 4X1YA 1YDXA 3FB5C 5LMNO 4FPPA 4RQFA 5D7DA 4B08A 2H8MA 5FWKA 2K1EA 3RW0A 2BTZA 1B3QA 4JI8O 3AG3B 3K97A 1K5SA 1QQCA 5KA5A 2WLLA 3UM7A 4YKUA 2CDYA 4I55B 4QNHB 5IYCO 2Q9LA 2ZE5A 4LWGA 4DK0A 2XUMA 1I94B 1GAXA 4TQFA 2ITCC 4H81A 2XAHA 3UT5B 4HY1A 1K33A 3THOA 2WA4A 2YI0A 1NKDA 1QVGU 4DV3O 3U67A 1PVGA 3LNNA 3I56V 1BXDA 4CE1A 1QR8A 3CP1A 1Q86W 1ZWHA 3LNMB 1ROPA 4IT5A 4ZI7A 3OGCC 1EN6A 4F4LA 1Z5VA 4X1KB 1TVKA 3K9AA 4UVAA 1QR9A 2G38A 1GKFA 3EFFK 2Q69A 1D2DA 3A8TA 2WAMA 1VQOV 2XX5A 2Q7EA 2ZNJA 2JJ2G 1R3IC 4PD4F 1TC6A 4LF7O 3UO2A 3GIFA 1BHAA 2PTMA 1PD3A 4ASUG 1KUQA 1NTZH 4N23A 2P4KA 3G80A 2XCMA 4MTFA 2DYSC 5FLXN 4AWPA 1SZXA 5CTXA 2BYIA 1AJQA 1R6TA 3IC7A 2A9HA 1N36B 3U0ZA 4JZGA 3W7XA 2UU9O 3AG4B 3T1HB 3JYCA 5LHIA 4HZ5A 4XTJA 2XHBA 2H55A 3A0YA 2IH1C 4CC6A 4UB6Z 5IJ9A 3H1JH 1JVMA 2F1MA 4NVPA 4EGKA 2XOKG 5CA3A 5IWAB 2YE4A 4I50B 3UKMA 1XL6A 2PF4E 1LUVA 1V9PA 2WEPA 3BRCA 2XX2A 4X88A 1W0JG 3ZRWB 1KC8W 1SF9A 3HKDA 3HKCB 2YSUB 1L1FA 2RJZA 4FM0A 3CRMA 2PZSA 4JI0B 3KKYA 2HG5C 3LUTB 2HVJC 1S5HC 3B25A 4U7OA 1Q6HA 3STLC 1I5XA 3U11A 3ZS8C 4YY3B 2JGUA 1P4RA 4AILC 3T0HA 1TUBA 4JI5O 2E5LB 1AH6A 2UUBB 3R4MA 2A7WA 2YI7A 4JQLA 1M90W 5GTHZ 4FCQA 2H3OA 1OCRC 3ZN0A 1N34O 5LL6Y 4X9LA 1ZXNA 4GYCB 3W7UA 3SJBC 1GM8A 2IJKA 4PELA 4I4TB 2EIJC 2KG7A 4DV5B 3RLRA 1NR1A 4XDLA 2QG0A 2EXLA 4XC0A 4F6EA 1GM7A 4TV9A 2GTAA 2FWYA 4P8OA 2DYSB 2IH3C 2C2AA 1H2MA 1NZ6A 5JH7B 4GX0A 3N2KA 1YJ9V 3CGYA 3ZMSA 4X65O 3ZM7A 2Q8GA 4JI7O 2A06H 5JVDA 3VQWA 4JI4O 1XNRB 3CD6V 1S5LZ 1ZTEA 4DUZB 3JATA 4NH7A 3CCSV 2CGNA 5ITZB 4LF8B 4F6RB 4UVCA 2AXTZ 2E0AA 3CRCA 5CA1A 4P9OA 3MNRP 3OR6C 2WI3A 1DTOA 1PNMA 5EC2C 2BU2A 4DW0A 1COWG 4JTDB 3EKRA 3OW6A 4UCUA 3JAKA 3H1LH 5IJ0A 5JCOA 3G4SV 4U3FH 2Q2EB 1QLEB 3RT3C 1S3JA 2QWNB 2YIBA 1I5YA 3L74H 4U7NA 5LXTA 5FNVB 3EHBB 1NJIW 1QNMA 3CXHF 1BGQA 4XIQA 4BWAA 2UWDA 3K99A 5B1BC 3JALB 4CWOA 2GBOA 4LWIA 3BMYA 3AG1B 2YK9A 3CMAV 1QHTA 2YEHA 1NTKH 1THZA 4PRVA 1JQ0A 1QU7A 1HNWB 4DUYO 4LF5O 1TIDA 1AMWA 4CWQA 1YVWA 2CG9A 5KX5A 1SQFA 4U3JA 3SJCC 4EFTA 5B1NA 3OAAG 5GW7A 1I5AA 2Q73A 1DK1A 3OR7C 3K57A 2JJ1G 3C11A 3H80A 1YIJV 1AI4A 1VMGA 2NLJC 2YXLA 4DR1O 2WLIA 4CH6A 1KYOF 1NVPB 3RVZA 1B06A 4TV8B 2IJJA 1R6NA 2AHYA 3H1HH 1FJGO 3P3NA 2AHZA 2UXDB 1U0ZA 2CK3G 3B27A 3B28A 2D2CB 4MVOA 4JI6O 1TA8A 1ZX3A 1VIBA 2PUSA 2XAQA 1L0LH 1VQ8V 3TZ5A 4LP0A 1VP7A 3RN4A 2BU6A 1EN4A 2ZE7A 1O9HA 3KCYA 5IYBO 1R3KC 4HXWA 1QBZA 1Q7YW 4HNAA 1QVFU 4NH8A 2YEVB 4K8XA 4DR6B 1WA8A 2VWKA 1I5BA 2QM7A 4OPHA 2ADPA 2F93B 2HEPA 5IN9A 3NR7A 5LHHA 4J7KA 4EB6B 5C8YA 4V25A 3OM3B 4B6CA 5B1BB 4NTXA 4MW3A 5B1AC 4NXNO 4MT8A 2XT9A 1PL4A 1NT2B 1AI6A 3JCZA 1IBMO 3ZBHA 3JSLA 2ZE8A 1A4HA 2QSAA 1GKZA 5F3KA 2PNRA 4K35A 3J7AU 4LWSB 4DV6O 3D0BA 3RWRD 1N0JA 5IT9N 2W6JG 1DLBA 3LNUA 2NR5A 2WERA 2XDLA 5B3SC 4DUHA 4BIZA 3FB6C 5TISZ 4CBCA 4FLWA 4I3HA 2YEBA 1R73A 4E4EA 2YI6A 2XJXA 3JARB 4JI2O 1HNXO 2YI8A 4B7KA 1PV0A 4HYOA 4JYYA 1ZWIC 4BAYA 1VQ4V 1PP9H 4LF9O 4PL9A 2QGNA 3B09A 5E79Z 3UT5A 3HEKA 4UVBA 4JAUA 3BM9A 2IJIA 1XMQB 3A0ZA 3E8BA 2YEGA 2XAFA 3OTFA 1Y4SA 1I94O 4C7UA 1BYQA 1NHHA 2Y0PA 2WLJA 2ZBKB 1W59A 1OZ0A 3HYYA 3I55V 4X1KA 3CS5A 3QF7A 1JR9A 4X20A 3P3PA 1ZXMA 3OPDA 3OGIB 5D6PA 5H6RA 3OUSA 1ZLZA 1VEWA 3B2EE 4R7CA 3ZHVA 4PU9A 2YIDA 2Q4PA 5CN0A 1GTOA 3LDDA 4X62B 3MHSC 2BREA 3ZIAG 2WA3A 1H2LA 2Q68A 3R66A 5B1AB 1N32O 4FIPC 1YT1A 4PA4A 3HKBB 1VF6C 1UYGA 4ZOLB 2OYQA 4B3SB 1XNQB 1UYEA 3CE2A 2LW7A 1J95A 5BMVA 2H94A 1Q81W 4O2AA 1THNA 2XX4A 1UYCA 4CC5A 4BAEA 2HHHB 4FZ0A 3CMEV 1FD9A 3J80N 4O2BB 2O1WA 3VHDA 1K5QA 4JTCB 1IBKB 1V55C 2OIGA 5B3SB 1FYJA 5CF0A 1TGOA 1N36O 1UYKA 1MSDA 3T1HO 2YC0A 4I50A 2XNDG 4Z1MG 5LA6B 1FFTB 4WFGA 2QE7G 3LSUA 3R4NA 3CC4V 3HKCA 3QDDA 3T1YB 2VQEB 3ASOB 5IWAO 4AS9A 4FM2A 3ZKDA 4O4HA 5C93A 4IIJB 5D5PA 1Q8IA 4PA6A 3VBBA 2F4VB 1JM6A 2N05A 2CTPA 1VQ9V 3CCQV 3NMQA 4BW5A 3S3XA 3B40A 2P4VA 4MTXA 4HYPA 3L73H 3L72H 4YY3O 4TQDA 3B26A 3INXA 1OCZC 1VQMV 4L94A 5FNFA 4DR3B 1K34A 2E5LO 3BAAA 4W4LA 3GIEA 4EGIA 3FFQA 2QEXV 2UUBO 1Y6XA 3U10A 3ICXA 1WPBA 1SQGA 3T1CA 5JH7A 5CTYA 3FYEB 1XI1A 3MDSA 4O4JB 4DV5O 1Y4UA 2DQ3A 4JI1B 2HHIA 2K5BA 4XDKA 2ITDC 4AQYB 2QG2A 3A0BZ 2ZIMA 3JASB 4OGQB 2YKCA 1L8DA 5D5QA 1SETA 1Q5OA 2XJJA 4XE2A 3KE6A 1XHZA 1NR7A 3C90A 3BVOA 2QFOA 2A3QA 5ITZA 2GUZB 4F6RA 4L90A 2EBOA 4X1IB 3H1KH 2BTQB 4UB8Z 1YCIA 1PNLA 4CZZA 1YC4A 4PA3A 1XNRO 1S77D 4BW9A 3BHPA 4DUZO 4GX5A 3STZC 2ATKC 3SPGA 1FXKC 2R70A 4NH9A 4LF8O 3D3QA 5KHGA 2YGEA 2OCHA 4ZHQB 1JJOA 3CEIA 2IBZH 1K3EA 2DOSA 2YEJA 4DR2B 4LNUA 2ZXWC 4YKRA 3F7VC 3MD0A 3AG3C 1QCEA 1W0KG 5E1AC 4ZIBA 4KSHA 1EFRG 2Z3YA 1GO3F 5J6AA 1AJNA 1OCZB 1FKAO 4LFCO 2YJWA 3OT7A 1DF4A 1WP8A 3ABTA 5LGUA 2XDKA 3FAVB 1YESA 3B8NA 3C0EA 3FT8A 2JEXA 2HG1A 1KP3A 1F4NA 2YJXA 4JF3A 2ZDXA 5EYPB 1WPXA 1H7SA 3AK2A 3G67A 2YKEA 5L3EA 4GCZA 3CHXA 1HNZB 3TTZA 4JYAB 3OMAB 4OXSA 2X6AA 4LPBA 3ZXOA 2FTKA 1UYDA 2Z0AA 5J71A 4MTGA 2K9PA 4I0XB 1GM9A 1XMOB 4JV5B 2Q7HA 5DM6V 1JA8A 2YE5A 1AILA 2E74B 3CWBH 4DV0B 4HZ0A 2XHXA 4ABMA 4LH6A 5M4NA 4MOTA 2UXDO 4YIPA 2YEVA 1VF5B 1GKXA 1PKXA 1FXKB 2GHYA 1FFXA 5HFMA 4XCJA 2ETNA 1YJNV 1K7DA 3RLPA 4X8AA 1I5DA 4YKYA 2ZXWB 4J42A 4PHZA 5J2UB 2CGFA 5DECA 5GGZA 4DR6O 4NR1A 5GONB 4URMA 1WB8A 3FB7C 1RSOB 2UXCO 4TOIA 3JD2A 4O4LB 3Q5JA 1R6KA 1WP7A 4BR6A 1J5EO 1F23A 2LFRA 2F95B 3OMUA 4LWSA 2PGGA 3T2SA 3Q4HB 5KUMA 4J9YB 2EIMC 4NXMB 4WUCA 3CC7V 3K59A 3O0IA 1AJPA 3JARA 3WQ9A 3UCSC 3CRRA 4GT1A 3SJAC 1UYFA 4O05A 5CTUA 4KHPB 1SC5B 3K3WA 5CA0A 1OCOC 2XJGA 1G6UA 1ENVA 1TBWA 5DN6G 5KMGB 2YEAA 3APQA 4FK5C 2B5UA 1UY7A 1F4MA 2P6JA 3OEEG 3TK1A 2RNBA 3JAMN 3T2MA 1B62A 2HLDG 3L70H 4DV2B 1MZEA 1XMQO 1CP9A 4KQVA 3CRQA 4FFKA 3W7SA 2LGWA 3A0HZ 3K58A 2YXHA 3K9SA 1KB9F 3CYGA 1IVSA 5L3CA 2V7QG 1H7UA 3D36C 4B3RB 1GK9A 2JEUA 3QO5A 3ZHSA 3OTOB 2X7RB 4DV7B 1Q43A 5GTIZ 5JJEB 2WWWA 2F23A 2JS3A 1ZW9A 4WUBA 1YETA 4P9PA 2FKXA 2FL4A 4ZOLA 4GKKB 4LWFA 1KP2A 1OHHG 2WSSG 4H33A 3FD9A 4L8JA 1Y67A 1OJHA 3CSXA 1LR1A 2N04A 1TH8A 4WFAV 4O2BA 2OT5A 2EIMB 4FLVA 3APOA 4ZBMA 2XD6A 4MP7A 4KFGA 2PI5A 1QLEC 1JCHA 1IXBA 1NQTA 4B3SO 1W2BU 1XNQO 2ZE6A 1UFIA 1TAEA 1WN7A 2YE2A 2R9AA 1JPXA 4CWPA 4IHJB 2QWPB 2HHHO 2P90A 2ZCEA 3F5TA 5LA6A 4JTAB 1R1BA 4URNA 4H13B 4WFEA 2QF6A 3HZ5A 3L71H 3N2GB 1IBKO 2EIKB 2BRCA 3AG1C 3RLQA 1NTMH 2UUAO 2HKOA 4TSFG 1I5CA 1OCOB 2XDSA 1BQZA 2VS0A 2EJRA 1KKDA 1EI1A 3E83A 1XILA 4IIJA 3ZHQA 1GJVA 5EBWC 4PA9A 1I08A 3ASNC 1KQSU 5H2FZ 3AG2C 3T1YO 1YITV 2QTOA 2B1IA 2JVDA 3FB8C 4D7SA 4B3TB 5CBGA 1BHBA 4O07A 4CWFA 4K8ZA 4MVQA 1M1KW 2F4VO 3ZX6A 2JS5A 5FPOA 4URLA 1ZL8A 4XKOA 3LDCA 5KA6A 3O6OA 4XDJA 3K03A 4MPEA 2WLHA 3X2QC 2DJVA 4NTYA 1XDCA 2CCTA 1SA0B 2YGFA 5JENA 5K1XA 5DEDA 3RYFB 3F7YC 3P30A 2CH4A 3ZEDA 4H0LB 5IDJA 4MB9A 1Y8PA 4GUNA 1VF6A 1MNGA 4O4JA 4IYIA 1AI5A 1XREA 2RCVA 1VQ6V 5B66Z 4L8ZA 1M56B 5BXZA 1KECA 3JASA 2ADQB 3JSNA 4UFZA 4B3MB 1IX9A 2YEEA 3GIGA 1B6QA 4K0KB 4FLYA 3PN1A 2ESAA 4KFMA 3E8HA 4JI1O 5BOCA 1SZTA 1US7A 1AI7A 4AQYO 2R9IA 1NU1H 2VRZA 4X1IA 2BTOA 2BTQA 3OMNB 2JJCA 3SL2A 4LCUC 3AK1A 4QE9A 1Z2GA 5BR8B 2F66C 2JGDB 5BODA 1AP6A 2FB5A 1M5IA 5LYJA 4I9WA 5FPRA 1OSFA 4ZHQA 1AROP 3ASNB 5EC1C 1GMGA 4OX9O 2YE6A 4FJCC 3AG2B 5M4EA 1ZUQA 2OIEA 4KTNA 5M4KA 4TWKA 3RYIB 3WB0A 4MP2A 2AW9A 4DR7B 1I0HA 2VWCA 4BQGA 1Q82W 1P7GA 1ZSPA 3QVNA 4Z2WA 1HR0O 2QJ1A 1U96A 4WBNB 4DR2O 1P84F 4WFHA 4MTOA 1KD1W 2Q8IA 3JCUZ 3FAVA 2QM4A 3D3IA 3X2QB 5JQGB 1Y66A 4R3AA 2BZ5A 4EKWA 2P67A 5JWPA 4JZ2A 1UJWB 5EYPA 4X9QA 4UCRA 3QTFA 1VQLV 3L9DA 2E75B 4H85A 3ZMVA 4QPJA 3TXSA 1RP3B 5H6QA 3DXRA 4XDMA 3ZRXA 1UPGA 3QNEA 5KUKA 4I0XA 1U2OA 2W6IG 2ZINA 3H9VA 5HFLA 3B24A 4UXNA 3TUHA 5M4PA 2R72A 3FKSG 5B1OA 2UUCB 1HNZO 4JYAO 1UYHA 3A0WA 1FXVA 5KHIA 4J7JA 2Q67A 1Q6IA 5JJJB 1BGYH 4FCPA 3DC6A 4LF6O 4JV5O 3K5LA 3WU2Z 4E72A 2YE9A 4MVUA 1Y4MA 3A0XA 2JRIA 3KZIZ 5CB4B 2JIZG 3ZHUA 4JYCA 1FXKA 2WLNA 4DV0O 5CPHA 1B04A 3GB7C 4FMTA 4LR3A 4X1YB 1H8EG 3CJHB 4MSWC 5L3BA 3ZMUA 4JAVA 3CCMV 2P7TC 5J2UA 4HBNA 2HP8A 3K08A 5GONA 1RSOA 5KHJA 3EHFA 4O4LA 4DRXB 4DV3B 4I55A 3HZ1A 2IWUA 2YICA 1L0NH 1XEQA 5B5EZ 1N33B 1P49A 3VQXA 4W4KA 3WB1A 2WI1A 2DMXA 3ASOC 5J9PC 3Q4HA 2OWOA 3EHGA 2MW2B 3HHUA 5H5NA 3CWVA 4LF4B 3OWDA 2CCSA 3IGAC 2X6BA 3SR2C 3T1KA 3HPLC 1SESA 3TETA 3ABLC 1TVKB 3SYOA 3ZHRA 1YHQV 2DWDC 5M4MA 2EILC 3JD0A 3H4LA 3CB2A 4G2KA 2QA4V 4WCEV 2UU9B 4KHPO 1YC3A 1M4UA 1YXBA 2BCCH 1VQPV 3SGIA 3EKOA 1OCCC 4D6TH 1D5AA 4MVSA 3ZRVA 4CH3A 2Q6AA 5L3JA 2LW1A 4JPRA 4XBFA 1KKCA 3A2FA 2OTLV 5LHGA 1CPYA 3DSQA 3R4PA 3S5TA 5EK0A 3M8AA 1H38A 1PM9A 3P32A 1F51A 4V26A 3AG7A 1OV9A 1G1XB 1HWYA 2BOCC 4ICGA 3ML0A 4UCOA 3R65A 4QIWF 4DV2O 2WI7A 1SQPH 1CXZB 2YGAA 2ZDIC 2PYJA 4A5UB 3JD4A 4JGSA 1BKNA 3CC2V 1G8MA 4Q6GA 4YJ2B 3K06A 3ZRWA 3HKDB 4JI5B 4B3RO 1WAZA 2Y48A 4GFNA 4KXRA 4N21A 3SYAA 4D7TA 2GQPA 4QGPA 4MS2A 3WG7C 1Y8NA 4E00A 2XAJA 2CTRA 1S76D 2YDEA 4XIRA 3VADA 2WLMA 2XTAA 4CS4A 4IHJA 1AR4A 4OPAA 1SS3A 1MU5A 3A0RA 4JI0O 4P2ZA 3SYPA 3ABLB 1CEZA 4FLZA 3N2GA 2Y4TA 3JAWB 2VCJA 3MHHC 4GEEA 4MVZA 1RM1C 2EILB 1XL4A 2ZQMA 3CCEV 2QR4A 1K4CC 1PNKA 2N74A 5K1PA 2IU3A 4I4TA 2AZ0A 2O57A 1E79G 1RPOA 4CWNA 1OCCB 2PI4A 2L35A 1S16A 1SKVA 4B7PA 2OCCC 3Q5KA 4LFBB 4LWHA 4DXWA 1NBMG 3VOUA 4FLXA 4HZ3A 2XDXA 2W0FC 1H2KA 3T10A 4RWUA 1IZ3A 5JVDB 4KL1A 5EBLC 2BSMA 4WUDA 2LQTA 2A79B 4EFUA 5M4HA 3D36A 4EFEA 3D2RA 1XUQA 2ODMA 3ETQA 2O1UA 1SA0A 5EZYB 3ABKB 3E2EA 3E22B 3RYFA 3ZKBA 3IJ4A 4ASFA 5F2VO 3RBZA 4KUMA 1GN2A 2XABA 2BU8A 1UY9A 1Z5AA 1EZVH 5H9CA 4PDVA 2BU5A 1DGSA 5D7CA 3ETGA 3JAKB 4UV9A 5IDMA 3WG7B 2EX3A 3QO8A 2BSKB 3GWKC 1EM1A 4DV4B 3EHJA 1YI2V 1I7FA 5FNVA 3G7EA 4B3MO 1QZRA 4GX1A 5LOVB 4DUYB 2WLKA 5F5RA 2WI2A 1WLEA 3JALA 4GKJB 2EULA 1Z59A 4JYBA 4Z1VA 3K79A 1RM1B 2JGDA 1AR1B 1BZKA 4DV1B 1Q6UA 4J7ZA 3OMIB 2Z5UA 3SJQC 1EA6A 2YKIA 4DR1B 4U3JB 1QY8A 5BR8O 3RYIA 3G75A 2OCCB 4H44B 4H37A 1HNWO 3LSQA 3HYZA 1NHJA 2CGOA 4FVMA 2YEFA 1VARA 4WBNA 3CCJV 3K5NA 3OWBA 1V54C 1Y76B 2F43G 4ASBA 1UY8A 4YIOA 3KCXA 2Q8HA 4J80A 4TV8A 5JQGA 4DR7O 2YE8A 1FS0G 4AHCA 2GV9A 4AWOA 4EMVA 4BQJA 1YTFD 4JAAA 2CTQA 2QWQB 2CUGA 3O9OA 1GN6A 1ZAUA 2LFSA 3ABUA 4NTWA 1B63A 3K5OA 4NB5A 1GN3A 1SQQH 3K0GA 4NYKA 3JD1A 2HFEC 4GZRB 1SQVH 4YKQA 4FZ1A 3CYOA 5D6QA 1A32A 4P30A 5C8YB 2VCIA 4EB6A 3BABA 4E2LA 2ZT9B 2WI6A 3CCRV 1H2SB 3ZJZA 2L6LA 1GH6A 3VQYA 3RYCB 2YUAA 4BIUA 3DTUB 5CB4A 4YHHB 3IAYA 2P22C 3ZRSA 4E02A 2ZIOA 5IYZB 3FX7A 5D7RA 4R1FA 4JI2B 1L0OA 3IEDA 3CJHA 1JMKC 1HNXB 3AEIA 1BQ0A 3U2DA 4PDLA 2DN9A 4FCRA 4LF9B 1M93A 2EINC 4XKAA 3Q5LA 4DZYA 1VQKV 2AGAA 1RFYA 1IURA 4J11A 1R62A 4GLXA 2RMKB 1AB3A 2CH7B 4DRXA 2LP7A 3VQVA 4BIOA 5FNCA 2WEQA 1V54B 2EIKC 3LMMA 3IC9A 2RN9A 2UXNA 4PI0A 1RPRA 3TZ2A 1BCCH 2VQFB 1F7YA 3CRKA 4FLUA 2JK5C 4X64B 1N33O 3QTCA 4FFBB 2QWRB 4L93A 4RUFA 1D5NA 3HKEB 2RDCA 1LNQA 4X20B 2Q0AA 4LF4O 2LGQA 4EEHA 3E8GA 3TZ4A 1N32B 3O2FA 3OUFA 3TGUH 4DW1A 4GGLA 2YS8A 2A0LA 4QJFB 5EBMC 1GRJA 3E89A 2M7WA 4IYHA 3UQ8A 1H2GA 4GX2A 2OTJV 5IY5B 2QTSA 2EZPA 4IL6Z 3PJSK 5IE9A 3HKBA 2E76B 4JASA 1FXHA 3RGBA 5BMVB 4O2AB 4X62O 5KAFZ 2JKIA 1M56C 2C1IA 2DW4A 3VHCA 1WNSA 4XD8A 3G6BA 4I5SA 1KMIZ 2EINB 3D8CA 5KAIZ 5KLVH 3TJTA 1E1RG 3LSSA 2BE3A 1YT2A 3G7BA 3K0DA 2WPDG 4L87A 2BU7A 4ZKIA 4YJ2A 4O4IB 2CAZC 3A0TA 3BCCH 4X66B 4KSGA 2CE4A 3VHAA 3CGZA 1M57C 4U93A 1JJ2U 3LDEA 4O4HB 3S3WA 4RUEA 3EHHA 3BEHA 3CX5F 4UUJC 3L75H 3CPWU 2YE3A 2WI4A 2D3OW 1Y74B
chains in the Genus database with same CATH topology
1FXVA 1VQ9V 3CCQV 2Q67A 4BW5A 3W7TA 1M9NA 5IY5C 5LBQA 4MVUA 1Y4MA 1NVPD 4MTXA 1VQNV 2JIZG 3FYIB 1P7BA 4JYCA 1FXKA 2WLNA 1OCZC 1VQMV 3AG4C 1K34A 3ETEA 3K04A 2QEXV 3GB7C 3OEHG 4FMTA 1H8EG 3FB5C 4FPPA 4MSWC 5L3BA 3ZMUA 4RQFA 4JAVA 3CCMV 2P7TC 3RVYA 2K1EA 3RW0A 3K08A 4X89A 3AG3B 3T1CA 1N8RW 1K5SA 3FYEB 5KA5A 2WLLA 2UXXA 3UM7A 1NH2D 2MK3A 1G4YB 4QNHB 3TCUA 2DQ3A 4XDKA 5IYCO 2ITDC 5CBFA 3NXSA 2ITCC 2XAHA 3ASOC 5J9PC 1K33A 1SETA 1NKDA 1QVGU 2ZDIA 3I56V 1NR7A 2EZOA 1QR8A 3CP1A 1Q86W 1SERA 2EBOA 2ZD9A 3LNMB 4RAIA 1ROPA 3IGAC 1PNLA 4CZZA 4PA3A 2X6BA 3HPLC 1SESA 3OGCC 3TETA 4F4LA 3ABLC 1S77D 2XAGA 3K9AA 4UVAA 1QR9A 3SYOA 1GKFA 3EFFK 4GX5A 3STZC 2ATKC 4WF9V 3SPGA 1YHQV 1M57B 2Q69A 2DWDC 1FXKC 2WAMA 1K73W 1VQOV 2EILC 3JD0A 1MOFA 2JJ2G 1R3IC 3B77A 2DQ0A 1R3LC 4G2KA 2QA4V 2X6CA 1K3EA 4WCEV 1BHAA 3T4ZA 1VQPV 1PD3A 4HAMA 5FL7G 4ASUG 1OCCC 2ZXWC 4N23A 4MTFA 3F7VC 4MVSA 2DYSC 3MD0A 3G6EV 1YTFB 3AG3C 1QCEA 1W0KG 1IXMA 1OCRB 2Q6AA 5E1AC 3ZRVA 1EFRG 2Z3YA 1S72V 1GO3F 4JPRA 1AJQA 4XBFA 3IC7A 2A9HA 2H8PC 1DF5A 1AJNA 1OCZB 3W7XA 3AG4B 5LHGA 2OTLV 1CPYA 3JYCA 1VQ7V 3QO7A 5EK0A 5LHIA 3JD3A 1DF4A 2EIJB 3ABTA 5LGUA 1H38A 3P32A 1F51A 2IH1C 3B8NA 1HWYA 2BOCC 2JEXA 3ML0A 3R65A 4QIWF 1JVMA 1KP3A 4PA7A 1F4NA 2XOKG 4JF3A 5CA3A 1WPXA 2ZDIC 3UKMA 2R9RB 2V1DA 1XL6A 3JD4A 4JGSA 5L3EA 3CC2V 1G8MA 4GCZA 4X88A 1MSWD 3OMAB 3K06A 1W0JG 2X6AA 4OXSA 3ZRWA 3ZRWB 1YJWV 1KC8W 2FTKA 2YSUB 2Y48A 1L1FA 4G27B 4N21A 4MTGA 3SYAA 2HG5C 1JX9A 4PDMA 3LUTB 1GM9A 2HVJC 4MS2A 3WFVA 1S5HC 3WG7C 5DM6V 2XAJA 4KP4A 4U7OA 3STLC 1S76D 1I5XA 4G28B 2WLMA 2Y69C 1P4RA 3A0RA 4P2ZA 2DYRC 3SYPA 1M90W 3ABLB 1CEZA 1OCRC 3ZN0A 2YEVA 3MHHC 4MVZA 2JDIG 1PKXA 1FXKB 2GHYA 1RM1C 2EILB 3W7UA 1GM8A 1XL4A 2ZQMA 3CCEV 5L3GA 1K4CC 2IJKA 1PNKA 4PELA 5HFMA 2IU3A 2EIJC 1K8AW 1E79G 1NR1A 1RPOA 4XDLA 1YJNV 1K7DA 1GM7A 4R6ZA 3ZMZA 4X8AA 1OCCB 2PI4A 2ZXWB 3KG2A 1PL0A 2GSMB 2DYSB 2IH3C 2C2AA 3FB7C 2OCCC 3JD2A 4GX0A 2WLLB 4DXWA 1YJ9V 1R6KA 1NBMG 3VOUA 3ZMSA 1F23A 1BL8A 2LFRA 4HZ3A 2W0FC 5EBLC 2A79B 5KUMA 5BZBA 3D36A 4J9YB 3CD6V 3E35A 2EIMC 3ABKB 3E2EA 3CC7V 1AJPA 1EZJA 3CCSV 4UVCA 3RBZA 4KUMA 4GT1A 4P9OA 3W7WA 5H9CA 3OR6C 3K3WA 4PDVA 1DTOA 1PNMA 5EC2C 4MVRA 1K9MW 3ETGA 1COWG 4JTDB 1SRYA 1OCOC 4UV9A 3WG7B 3QO8A 4QE7A 3G4SV 1ENVA 1H8HG 1QLEB 3T4DA 1S3JA 2Y69B 5DN6G 1YI2V 5L3DA 3B8MA 5LGTA 1I5YA 4FK5C 4U7NA 1NJIW 3EHBB 2B5UA 1F4MA 2P6JA 3OEEG 4GX1A 3TK1A 2WLKA 2DYRB 5B1BC 3T2MA 2HLDG 4WFBV 1K4DC 1WLEA 3CCLV 2QKSA 5LGNA 3AG1B 1EBOA 3CMAV 4JYBA 3F5WC 1CP9A 1THZA 3K79A 1RM1B 1AR1B 1R3JC 3W7SA 1JQ0A 3OMIB 2Z5UA 3OFNG 1TUEB 3SJQC 3E8FA 5L3CA 2V7QG 3OW2U 1K97A 2QM8A 1GK9A 2JEUA 3OE7G 3QO5A 1S0VA 2X7RB 3ABKC 5B1NA 3OAAG 2WWWA 5GW7A 2XASA 3OR7C 2OCCB 5L3FA 4P9PA 2JJ1G 4H37A 3LSQA 1YIJV 4PDRA 3DGEA 1AI4A 2NLJC 1KP2A 1OHHG 2WSSG 4H33A 3CCJV 2KB1A 4LC1A 2WLIA 1V54C 2F43G 1NVPB 3RVZA 4QPKA 2IJJA 1R6NA 2AHYA 4WFAV 3CCUV 2AHZA 2OT5A 2EIMB 4ZBMA 1FS0G 2CK3G 2PI5A 1QLEC 1JCHA 1MG1A 4MVOA 1NQTA 3HB3B 1VQ5V 1W2BU 1YTFD 2XAQA 4LBEC 1JPXA 1VQ8V 5CBHA 2LFSA 2P90A 3ABUA 4RQEA 4JTAB 5IYBO 4DO2A 4WFEA 1R3KC 1QBZA 4MVMA 1Q7YW 1QVFU 2EIKB 3AG1C 2YEVB 3K0GA 1NH2B 3JD1A 2HKOA 2HFEC 4TSFG 1OCOB 2EJRA 1KKDA 1YSCA 3E83A 5EBWC 2QM7A 4TT3G 3CYOA 4PA9A 3ASNC 1KQSU 3G71V 4P30A 3AG2C 5LHHA 4MW8A 4E2LA 3OM3B 1QLNA 5B1BB 2ZR2A 3E86A 3CCRV 3ZJZA 5CMUA 4MW3A 1YITV 2QTOA 5B1AC 5IYDO 2B1IA 3ETDA 3FB8C 4BIUA 1MABG 4MT8A 3DTUB 5CBGA 1BHBA 1AI6A 3JCZA 3ZCCA 4MVQA 1M1KW 3ZRSA 3LDCA 5KA6A 4XDJA 2HR3A 3K03A 3SPHA 1JOYA 2WLHA 3X2QC 2W6JG 3AEIA 1DLBA 4PDLA 5B3SC 4RO2A 4BIZA 2EINC 3FB6C 3CXCU 3SYCA 1VQKV 3F7YC 4CBCA 3P30A 1R73A 3BY6A 5IDJA 3ABMC 4WFFA 2LP7A 1AI5A 4HYOA 4BAYA 1ZWIC 1VQ4V 1V54B 1VQ6V 2EIKC 1M56B 1KECA 2X0LA 2ZR3A 2UXNA 1V55B 1RPRA 1B6QA 4UVBA 4JAUA 4KFMA 2IJIA 3E8HA 4LP8A 3E8BA 2JK5C 1SZTA 2XAFA 1AI7A 2R9IA 4J9ZB 3OMNB 4RUFA 3GWOA 2WLJA 2NNUA 1OZ0A 3SPCA 4LCUC 3I55V 1LNQA 4QE9A 2HJFC 4R50A 2IU0A 2IJHA 3E8GA 4R8CA 5H6RA 3OUSA 4R7CA 4I9WA 3OUFA 1AROP 3ASNB 5EC1C 1GMGA 2A0LA 5CN0A 4QJFB 1GTOA 5EBMC 3LDDA 2HVKC 3AG2B 4FJCC 3E89A 3MHSC 2M7WA 3SPJA 3ZIAG 1H2GA 4GX2A 4TWKA 2Q68A 2OTJV 5IY5B 5B1AB 2EZPA 3IFXA 3PJSK 4FIPC 4PA4A 4YXWG 1E1QG 1Q82W 4JASA 1ORQC 1J95A 1FXHA 2H94A 3SYQA 4WFHA 4MTOA 1Q81W 1KD1W 2WLIB 1M56C 3CMEV 3D3IA 3X2QB 3M99B 1Y66A 3SPIA 2DW4A 1K5QA 3ZMTA 4JTCB 1V55C 4EKWA 2P67A 3CCVV 5B3SB 4I5SA 2EINB 1UJWB 1E1RG 3LSSA 4UV8A 2XNDG 4Z1MG 3ABMB 3K0DA 1VQLV 3H01A 2WPDG 4L87A 4ZKIA 2B1GA 1FFTB 3ZMVA 4WFGA 2QE7G 4QPJA 3ZN1A 3CC4V 1BMFG 5H6QA 3ZRXA 2IW5A 3ASOB 3QNEA 5KUKA 1M57C 1JJ2U 2W6IG 5HFLA 3LDEA 5C93A 4RUEA 4UXNA 2BOBC 3BEHA 2DWEC 3FKSG 5B1OA 4UUJC 4PA6A 3VBBA 3CPWU 1K92A 4Q20A 2D3OW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1N A;  2WWW A;  5IDJ A;  3A0R A;  2C2A A;  3TK1 A;  3MD0 A;  2LFS A;  3ZRV A;  1IXM A;  4ZKI A;  4GT1 A;  4GCZ A;  4QPJ A;  4BIU A;  4MT8 A;  4MTX A;  2LFR A;  3ZCC A;  3ZRW A;  4JAS A;  3DGE A;  4JYB A;  3ZRW B;  2FTK A;  4JYC A;  4LC1 A;  3ZRX A;  3NXS A;  4QPK A;  4FMT A;  5C93 A;  1JOY A;  3P32 A;  1F51 A;  2QM7 A;  4KP4 A;  3D36 A;  4U7O A;  4JAU A;  4FPP A;  5B1O A;  2P67 A;  2QM8 A;  4JAV A;  4I5S A;  4Q20 A;  4BIZ A;  4U7N A; 
#chains in the Genus database with same CATH topology
 4EEQ A;  4YJ3 B;  2YXY A;  2VQE O;  2QKA A;  1M9N A;  5LBQ A;  1BSM A;  3JAW A;  1VQN V;  1KU9 A;  2P06 A;  4CH4 A;  3ETE A;  1MX0 A;  4CE2 A;  3K04 A;  1FPO A;  3OEH G;  1URF A;  4YKW A;  4ASA A;  1Y8O A;  3C3S A;  4IGG A;  4R3M A;  2YE7 A;  3RVY A;  5JJN B;  2ZNI A;  4X89 A;  1N8R W;  2VWJ A;  4DR3 O;  4LFA B;  4W7T A;  2Q8F A;  3JZ3 A;  4DR5 B;  2UXX A;  4PJ0 Z;  1NH2 D;  2MK3 A;  1G4Y B;  3TCU A;  2M6Y A;  3PEJ A;  4HY6 A;  2XDU A;  2YEI A;  2B9Z A;  5CBF A;  3NXS A;  4UCT A;  1YS3 A;  5LP6 C;  1EN5 A;  4LFB O;  1MMM A;  5EZY A;  1KIJ A;  3E22 A;  2ZDI A;  4XIP A;  2EZO A;  2IOR A;  2V4D A;  1IDS A;  1SER A;  2GUZ A;  2ZD9 A;  4RAI A;  3BFR A;  1LUW A;  2Y0I A;  4PI2 A;  2XAG A;  5A9G A;  1NI8 A;  4CE3 A;  4I7Z B;  4WF9 V;  1M57 B;  4ZVI A;  2KSD A;  1K73 W;  1YER A;  2FXS A;  4BXI A;  1XHX A;  1MOF A;  2BSK A;  3B77 A;  2IOQ A;  2DQ0 A;  1R3L C;  4ASG A;  2X6C A;  2FYP A;  4FM1 A;  2W0X A;  2YED A;  2PYL A;  4LFC B;  3T4Z A;  4HAM A;  5FL7 G;  2VW5 A;  4LNU B;  4EFB A;  2QKC A;  4PV1 B;  3LPS A;  5LOV A;  4O0B A;  1FAF A;  3G6E V;  1YTF B;  1S72 V;  1IXM A;  1OCR B;  4YKT A;  1Z5C A;  1AJ6 A;  2C1G A;  1Q3E A;  4DV4 O;  1Z5B A;  2H8P C;  2ZM6 B;  1DF5 A;  4H7Q A;  1VQ7 V;  3QO7 A;  3JD3 A;  4XIT A;  1AR5 A;  2EIJ B;  1AM1 A;  2ZKO A;  1YSR A;  3U2K A;  2YIB D;  4AWQ A;  3INW A;  5FND A;  1IBL B;  3CRL A;  4GKJ O;  5LMU B;  3QG5 A;  4TUY B;  2PY5 A;  4PA7 A;  4CS3 A;  2R9R B;  2V1D A;  4DV1 O;  1U97 A;  2ZKJ A;  1HDJ A;  3R91 A;  1MSW D;  1YJW V;  2XHR A;  4G27 B;  1Y76 A;  1UY6 A;  4DR4 B;  4JI3 B;  3CRA A;  2IOP A;  2YIA A;  1JX9 A;  4PDM A;  3TZ0 A;  5LP6 B;  3WFV A;  3AK3 A;  4KP4 A;  4G28 B;  3PEH A;  1PPJ H;  3FT5 A;  2Y69 C;  2XK2 A;  4GQT A;  4PRX A;  2UXB B;  4HYM A;  3J81 N;  1JFF B;  2DYR C;  2ARH A;  5LMN B;  1TC0 A;  1XMO O;  2BYH A;  1YZB A;  5J2T B;  4B7E A;  3RYH B;  1X4T A;  2JDI G;  5KHK A;  1NHI A;  1FFX B;  4JI8 B;  2UXC B;  5L3G A;  2CCU A;  5A2Q N;  2LJ2 A;  3EXA A;  1J5E B;  1K8A W;  4R6Z A;  3ZMZ A;  2QWO B;  3KG2 A;  3O65 A;  1PL0 A;  4MBC A;  2GSM B;  3RYC A;  2IWX A;  3HR0 A;  3BPZ A;  2WLL B;  4HXZ A;  2YKB A;  1BL8 A;  3BA8 A;  5IYZ A;  5BZB A;  1TIL A;  3E35 A;  3B4S A;  3GVM A;  2FWZ A;  4YHH O;  1KBH A;  4P7A A;  1EZJ A;  3R92 A;  1X59 A;  2CH7 A;  4K4O A;  4LF7 B;  4ZI7 B;  1UYI A;  3W7W A;  5CA0 B;  1WJZ A;  4LWE A;  4NXM O;  4MVR A;  1K9M W;  1XOU A;  4URO A;  1SRY A;  2YK2 A;  1N4C A;  4K3A A;  4QE7 A;  1H8H G;  3T4D A;  2Y69 B;  3H1I H;  5L3D A;  5KMG A;  3B8M A;  5LGT A;  5EIB D;  1NS1 A;  2Q5Z A;  4LH7 A;  4FFB A;  2BT0 A;  3R4O A;  1AVM A;  2KKW A;  2DYR B;  3HKE A;  4WFB V;  1K4D C;  4J41 A;  1N0N A;  3CCL V;  2QKS A;  1MA1 A;  5LGN A;  1EBO A;  2VQF O;  4CH5 A;  4UCV A;  2YI5 A;  3F5W C;  3T0Z A;  4X64 O;  4CWT A;  4E01 A;  1R3J C;  2HJD A;  1AP5 A;  1MZF A;  2YKJ A;  3OFN G;  1TUE B;  3E8F A;  5IJ9 B;  1K97 A;  1YF2 A;  2QM8 A;  3OE7 G;  3OW2 U;  2IWS A;  4CWS A;  1S0V A;  1ID0 A;  3ABK C;  2XAS A;  5L3F A;  2ILM A;  4PDR A;  3DGE A;  2KB1 A;  4LC1 A;  1SQX H;  3OTO O;  3FV5 A;  1YT0 A;  4DV7 O;  3RKZ A;  2YEC A;  4QPK A;  3OD4 A;  3ZXQ A;  3EVK A;  5BY1 A;  3CCU V;  5KHH A;  1N34 B;  5JCO C;  2UUA B;  1MG1 A;  3MAQ A;  3HB3 B;  1VQ5 V;  4GKK O;  1TUB B;  4LBE C;  2XHT A;  5CBH A;  4RQE A;  4O4I A;  4DO2 A;  2ZDY A;  4MVM A;  3N27 A;  1NH2 B;  1YSC A;  1US6 A;  2O1V A;  1XBL A;  1Q90 D;  4TT3 G;  2KG7 B;  4X65 B;  3G71 V;  4JI7 B;  1Y74 A;  4TV9 B;  4X66 O;  4YJ3 A;  2AZ2 A;  4MW8 A;  1QLN A;  4JI4 B;  3K5M A;  2ZR2 A;  3E86 A;  5CMU A;  2FML A;  4NKG B;  5IYD O;  3ETD A;  3N2K B;  1MAB G;  3ZCC A;  1S14 A;  2YI9 A;  2GFD A;  1ZL8 B;  2FYU H;  1H2N A;  2HR3 A;  3SPH A;  1T5E A;  1JOY A;  2Q0O C;  1UYM A;  4MPN A;  4B3T O;  2KQX A;  4RO2 A;  3CXC U;  3JAT B;  3SYC A;  3K98 A;  2GTS A;  3BY6 A;  3RFR A;  2RQ6 A;  3ABM C;  4WFF A;  5CA1 B;  3SDL A;  5AG2 A;  3TXQ A;  2X0L A;  2ZR3 A;  4XCL A;  4LFA O;  3GIG B;  4DR5 O;  2Y4U A;  1V55 B;  5IJ0 B;  3DC5 A;  5CTW A;  4LP8 A;  4FLT A;  1QYE A;  4AI8 A;  4DYL A;  1AH8 A;  5LXT B;  1HW7 A;  4J9Z B;  3GWO A;  2NNU A;  4LF5 B;  3BA9 A;  3SPC A;  4OX9 B;  1I58 A;  1GN4 A;  4K0K O;  4DK1 A;  2HJF C;  4R50 A;  2IU0 A;  2IJH A;  4R8C A;  2WI5 A;  5LYJ B;  2HCH A;  1HR0 B;  2P5O A;  2LO1 A;  2HVK C;  1YC1 A;  5KX5 B;  4UCS A;  3SPJ A;  3WB2 A;  1FJG B;  2AKP A;  4O09 A;  3IFX A;  5EIB C;  3WHA A;  2Q7G A;  4YXW G;  1E1Q G;  1Z5W A;  4JI6 B;  1ORQ C;  2CTW A;  2EJ7 A;  1XQ8 A;  1I59 A;  1YEW A;  3SYQ A;  2WLI B;  3UO3 A;  2DE0 X;  4MPC A;  4CWR A;  2GDS A;  3M99 B;  3SPI A;  3ZMT A;  1UYL A;  4TUY A;  3CCV V;  1O9G A;  2QDO A;  2ZM6 O;  3K60 A;  4UV8 A;  3ABM B;  2HKJ A;  3H01 A;  2B1G A;  4I9Q A;  3C3T A;  4GT8 A;  3ZN1 A;  1IBL O;  4YKZ A;  1BMF G;  3ZHT A;  4HNA B;  5LMU O;  3DXR B;  1BT8 A;  1KZN A;  4EM7 A;  2IW5 A;  1WA8 B;  4LF6 B;  3I5D A;  5LP6 A;  4NXN B;  2IM9 A;  2BOB C;  2DWE C;  1IBM B;  1SQB H;  1YSZ A;  4O04 A;  1K92 A;  1VF7 A;  4Q20 A;  4YKX A;  2E3C A;  4DR4 O;  4JI3 O;  2NN4 A;  4J10 A;  4DV6 B;  3W7T A;  1JFF A;  5IY5 C;  5J2T A;  3M7M X;  1NVP D;  4EGH A;  1HP8 A;  2Q8V A;  3RYH A;  1BE3 H;  1P7B A;  3FYI B;  2UUC O;  4XKK A;  3AG4 C;  1WB7 A;  4CS2 A;  1BS3 A;  1S5J A;  2UXB O;  4L91 A;  4X1Y A;  1YDX A;  3FB5 C;  5LMN O;  4FPP A;  4RQF A;  5D7D A;  4B08 A;  2H8M A;  5FWK A;  2K1E A;  3RW0 A;  2BTZ A;  1B3Q A;  4JI8 O;  3AG3 B;  3K97 A;  1K5S A;  1QQC A;  5KA5 A;  2WLL A;  3UM7 A;  4YKU A;  2CDY A;  4I55 B;  4QNH B;  5IYC O;  2Q9L A;  2ZE5 A;  4LWG A;  4DK0 A;  2XUM A;  1I94 B;  1GAX A;  4TQF A;  2ITC C;  4H81 A;  2XAH A;  3UT5 B;  4HY1 A;  1K33 A;  3THO A;  2WA4 A;  2YI0 A;  1NKD A;  1QVG U;  4DV3 O;  3U67 A;  1PVG A;  3LNN A;  3I56 V;  1BXD A;  4CE1 A;  1QR8 A;  3CP1 A;  1Q86 W;  1ZWH A;  3LNM B;  1ROP A;  4IT5 A;  4ZI7 A;  3OGC C;  1EN6 A;  4F4L A;  1Z5V A;  4X1K B;  1TVK A;  3K9A A;  4UVA A;  1QR9 A;  2G38 A;  1GKF A;  3EFF K;  2Q69 A;  1D2D A;  3A8T A;  2WAM A;  1VQO V;  2XX5 A;  2Q7E A;  2ZNJ A;  2JJ2 G;  1R3I C;  4PD4 F;  1TC6 A;  4LF7 O;  3UO2 A;  3GIF A;  1BHA A;  2PTM A;  1PD3 A;  4ASU G;  1KUQ A;  1NTZ H;  4N23 A;  2P4K A;  3G80 A;  2XCM A;  4MTF A;  2DYS C;  5FLX N;  4AWP A;  1SZX A;  5CTX A;  2BYI A;  1AJQ A;  1R6T A;  3IC7 A;  2A9H A;  1N36 B;  3U0Z A;  4JZG A;  3W7X A;  2UU9 O;  3AG4 B;  3T1H B;  3JYC A;  5LHI A;  4HZ5 A;  4XTJ A;  2XHB A;  2H55 A;  3A0Y A;  2IH1 C;  4CC6 A;  4UB6 Z;  5IJ9 A;  3H1J H;  1JVM A;  2F1M A;  4NVP A;  4EGK A;  2XOK G;  5CA3 A;  5IWA B;  2YE4 A;  4I50 B;  3UKM A;  1XL6 A;  2PF4 E;  1LUV A;  1V9P A;  2WEP A;  3BRC A;  2XX2 A;  4X88 A;  1W0J G;  3ZRW B;  1KC8 W;  1SF9 A;  3HKD A;  3HKC B;  2YSU B;  1L1F A;  2RJZ A;  4FM0 A;  3CRM A;  2PZS A;  4JI0 B;  3KKY A;  2HG5 C;  3LUT B;  2HVJ C;  1S5H C;  3B25 A;  4U7O A;  1Q6H A;  3STL C;  1I5X A;  3U11 A;  3ZS8 C;  4YY3 B;  2JGU A;  1P4R A;  4AIL C;  3T0H A;  1TUB A;  4JI5 O;  2E5L B;  1AH6 A;  2UUB B;  3R4M A;  2A7W A;  2YI7 A;  4JQL A;  1M90 W;  5GTH Z;  4FCQ A;  2H3O A;  1OCR C;  3ZN0 A;  1N34 O;  5LL6 Y;  4X9L A;  1ZXN A;  4GYC B;  3W7U A;  3SJB C;  1GM8 A;  2IJK A;  4PEL A;  4I4T B;  2EIJ C;  2KG7 A;  4DV5 B;  3RLR A;  1NR1 A;  4XDL A;  2QG0 A;  2EXL A;  4XC0 A;  4F6E A;  1GM7 A;  4TV9 A;  2GTA A;  2FWY A;  4P8O A;  2DYS B;  2IH3 C;  2C2A A;  1H2M A;  1NZ6 A;  5JH7 B;  4GX0 A;  3N2K A;  1YJ9 V;  3CGY A;  3ZMS A;  4X65 O;  3ZM7 A;  2Q8G A;  4JI7 O;  2A06 H;  5JVD A;  3VQW A;  4JI4 O;  1XNR B;  3CD6 V;  1S5L Z;  1ZTE A;  4DUZ B;  3JAT A;  4NH7 A;  3CCS V;  2CGN A;  5ITZ B;  4LF8 B;  4F6R B;  4UVC A;  2AXT Z;  2E0A A;  3CRC A;  5CA1 A;  4P9O A;  3MNR P;  3OR6 C;  2WI3 A;  1DTO A;  1PNM A;  5EC2 C;  2BU2 A;  4DW0 A;  1COW G;  4JTD B;  3EKR A;  3OW6 A;  4UCU A;  3JAK A;  3H1L H;  5IJ0 A;  5JCO A;  3G4S V;  4U3F H;  2Q2E B;  1QLE B;  3RT3 C;  1S3J A;  2QWN B;  2YIB A;  1I5Y A;  3L74 H;  4U7N A;  5LXT A;  5FNV B;  3EHB B;  1NJI W;  1QNM A;  3CXH F;  1BGQ A;  4XIQ A;  4BWA A;  2UWD A;  3K99 A;  5B1B C;  3JAL B;  4CWO A;  2GBO A;  4LWI A;  3BMY A;  3AG1 B;  2YK9 A;  3CMA V;  1QHT A;  2YEH A;  1NTK H;  1THZ A;  4PRV A;  1JQ0 A;  1QU7 A;  1HNW B;  4DUY O;  4LF5 O;  1TID A;  1AMW A;  4CWQ A;  1YVW A;  2CG9 A;  5KX5 A;  1SQF A;  4U3J A;  3SJC C;  4EFT A;  5B1N A;  3OAA G;  5GW7 A;  1I5A A;  2Q73 A;  1DK1 A;  3OR7 C;  3K57 A;  2JJ1 G;  3C11 A;  3H80 A;  1YIJ V;  1AI4 A;  1VMG A;  2NLJ C;  2YXL A;  4DR1 O;  2WLI A;  4CH6 A;  1KYO F;  1NVP B;  3RVZ A;  1B06 A;  4TV8 B;  2IJJ A;  1R6N A;  2AHY A;  3H1H H;  1FJG O;  3P3N A;  2AHZ A;  2UXD B;  1U0Z A;  2CK3 G;  3B27 A;  3B28 A;  2D2C B;  4MVO A;  4JI6 O;  1TA8 A;  1ZX3 A;  1VIB A;  2PUS A;  2XAQ A;  1L0L H;  1VQ8 V;  3TZ5 A;  4LP0 A;  1VP7 A;  3RN4 A;  2BU6 A;  1EN4 A;  2ZE7 A;  1O9H A;  3KCY A;  5IYB O;  1R3K C;  4HXW A;  1QBZ A;  1Q7Y W;  4HNA A;  1QVF U;  4NH8 A;  2YEV B;  4K8X A;  4DR6 B;  1WA8 A;  2VWK A;  1I5B A;  2QM7 A;  4OPH A;  2ADP A;  2F93 B;  2HEP A;  5IN9 A;  3NR7 A;  5LHH A;  4J7K A;  4EB6 B;  5C8Y A;  4V25 A;  3OM3 B;  4B6C A;  5B1B B;  4NTX A;  4MW3 A;  5B1A C;  4NXN O;  4MT8 A;  2XT9 A;  1PL4 A;  1NT2 B;  1AI6 A;  3JCZ A;  1IBM O;  3ZBH A;  3JSL A;  2ZE8 A;  1A4H A;  2QSA A;  1GKZ A;  5F3K A;  2PNR A;  4K35 A;  3J7A U;  4LWS B;  4DV6 O;  3D0B A;  3RWR D;  1N0J A;  5IT9 N;  2W6J G;  1DLB A;  3LNU A;  2NR5 A;  2WER A;  2XDL A;  5B3S C;  4DUH A;  4BIZ A;  3FB6 C;  5TIS Z;  4CBC A;  4FLW A;  4I3H A;  2YEB A;  1R73 A;  4E4E A;  2YI6 A;  2XJX A;  3JAR B;  4JI2 O;  1HNX O;  2YI8 A;  4B7K A;  1PV0 A;  4HYO A;  4JYY A;  1ZWI C;  4BAY A;  1VQ4 V;  1PP9 H;  4LF9 O;  4PL9 A;  2QGN A;  3B09 A;  5E79 Z;  3UT5 A;  3HEK A;  4UVB A;  4JAU A;  3BM9 A;  2IJI A;  1XMQ B;  3A0Z A;  3E8B A;  2YEG A;  2XAF A;  3OTF A;  1Y4S A;  1I94 O;  4C7U A;  1BYQ A;  1NHH A;  2Y0P A;  2WLJ A;  2ZBK B;  1W59 A;  1OZ0 A;  3HYY A;  3I55 V;  4X1K A;  3CS5 A;  3QF7 A;  1JR9 A;  4X20 A;  3P3P A;  1ZXM A;  3OPD A;  3OGI B;  5D6P A;  5H6R A;  3OUS A;  1ZLZ A;  1VEW A;  3B2E E;  4R7C A;  3ZHV A;  4PU9 A;  2YID A;  2Q4P A;  5CN0 A;  1GTO A;  3LDD A;  4X62 B;  3MHS C;  2BRE A;  3ZIA G;  2WA3 A;  1H2L A;  2Q68 A;  3R66 A;  5B1A B;  1N32 O;  4FIP C;  1YT1 A;  4PA4 A;  3HKB B;  1VF6 C;  1UYG A;  4ZOL B;  2OYQ A;  4B3S B;  1XNQ B;  1UYE A;  3CE2 A;  2LW7 A;  1J95 A;  5BMV A;  2H94 A;  1Q81 W;  4O2A A;  1THN A;  2XX4 A;  1UYC A;  4CC5 A;  4BAE A;  2HHH B;  4FZ0 A;  3CME V;  1FD9 A;  3J80 N;  4O2B B;  2O1W A;  3VHD A;  1K5Q A;  4JTC B;  1IBK B;  1V55 C;  2OIG A;  5B3S B;  1FYJ A;  5CF0 A;  1TGO A;  1N36 O;  1UYK A;  1MSD A;  3T1H O;  2YC0 A;  4I50 A;  2XND G;  4Z1M G;  5LA6 B;  1FFT B;  4WFG A;  2QE7 G;  3LSU A;  3R4N A;  3CC4 V;  3HKC A;  3QDD A;  3T1Y B;  2VQE B;  3ASO B;  5IWA O;  4AS9 A;  4FM2 A;  3ZKD A;  4O4H A;  5C93 A;  4IIJ B;  5D5P A;  1Q8I A;  4PA6 A;  3VBB A;  2F4V B;  1JM6 A;  2N05 A;  2CTP A;  1VQ9 V;  3CCQ V;  3NMQ A;  4BW5 A;  3S3X A;  3B40 A;  2P4V A;  4MTX A;  4HYP A;  3L73 H;  3L72 H;  4YY3 O;  4TQD A;  3B26 A;  3INX A;  1OCZ C;  1VQM V;  4L94 A;  5FNF A;  4DR3 B;  1K34 A;  2E5L O;  3BAA A;  4W4L A;  3GIE A;  4EGI A;  3FFQ A;  2QEX V;  2UUB O;  1Y6X A;  3U10 A;  3ICX A;  1WPB A;  1SQG A;  3T1C A;  5JH7 A;  5CTY A;  3FYE B;  1XI1 A;  3MDS A;  4O4J B;  4DV5 O;  1Y4U A;  2DQ3 A;  4JI1 B;  2HHI A;  2K5B A;  4XDK A;  2ITD C;  4AQY B;  2QG2 A;  3A0B Z;  2ZIM A;  3JAS B;  4OGQ B;  2YKC A;  1L8D A;  5D5Q A;  1SET A;  1Q5O A;  2XJJ A;  4XE2 A;  3KE6 A;  1XHZ A;  1NR7 A;  3C90 A;  3BVO A;  2QFO A;  2A3Q A;  5ITZ A;  2GUZ B;  4F6R A;  4L90 A;  2EBO A;  4X1I B;  3H1K H;  2BTQ B;  4UB8 Z;  1YCI A;  1PNL A;  4CZZ A;  1YC4 A;  4PA3 A;  1XNR O;  1S77 D;  4BW9 A;  3BHP A;  4DUZ O;  4GX5 A;  3STZ C;  2ATK C;  3SPG A;  1FXK C;  2R70 A;  4NH9 A;  4LF8 O;  3D3Q A;  5KHG A;  2YGE A;  2OCH A;  4ZHQ B;  1JJO A;  3CEI A;  2IBZ H;  1K3E A;  2DOS A;  2YEJ A;  4DR2 B;  4LNU A;  2ZXW C;  4YKR A;  3F7V C;  3MD0 A;  3AG3 C;  1QCE A;  1W0K G;  5E1A C;  4ZIB A;  4KSH A;  1EFR G;  2Z3Y A;  1GO3 F;  5J6A A;  1AJN A;  1OCZ B;  1FKA O;  4LFC O;  2YJW A;  3OT7 A;  1DF4 A;  1WP8 A;  3ABT A;  5LGU A;  2XDK A;  3FAV B;  1YES A;  3B8N A;  3C0E A;  3FT8 A;  2JEX A;  2HG1 A;  1KP3 A;  1F4N A;  2YJX A;  4JF3 A;  2ZDX A;  5EYP B;  1WPX A;  1H7S A;  3AK2 A;  3G67 A;  2YKE A;  5L3E A;  4GCZ A;  3CHX A;  1HNZ B;  3TTZ A;  4JYA B;  3OMA B;  4OXS A;  2X6A A;  4LPB A;  3ZXO A;  2FTK A;  1UYD A;  2Z0A A;  5J71 A;  4MTG A;  2K9P A;  4I0X B;  1GM9 A;  1XMO B;  4JV5 B;  2Q7H A;  5DM6 V;  1JA8 A;  2YE5 A;  1AIL A;  2E74 B;  3CWB H;  4DV0 B;  4HZ0 A;  2XHX A;  4ABM A;  4LH6 A;  5M4N A;  4MOT A;  2UXD O;  4YIP A;  2YEV A;  1VF5 B;  1GKX A;  1PKX A;  1FXK B;  2GHY A;  1FFX A;  5HFM A;  4XCJ A;  2ETN A;  1YJN V;  1K7D A;  3RLP A;  4X8A A;  1I5D A;  4YKY A;  2ZXW B;  4J42 A;  4PHZ A;  5J2U B;  2CGF A;  5DEC A;  5GGZ A;  4DR6 O;  4NR1 A;  5GON B;  4URM A;  1WB8 A;  3FB7 C;  1RSO B;  2UXC O;  4TOI A;  3JD2 A;  4O4L B;  3Q5J A;  1R6K A;  1WP7 A;  4BR6 A;  1J5E O;  1F23 A;  2LFR A;  2F95 B;  3OMU A;  4LWS A;  2PGG A;  3T2S A;  3Q4H B;  5KUM A;  4J9Y B;  2EIM C;  4NXM B;  4WUC A;  3CC7 V;  3K59 A;  3O0I A;  1AJP A;  3JAR A;  3WQ9 A;  3UCS C;  3CRR A;  4GT1 A;  3SJA C;  1UYF A;  4O05 A;  5CTU A;  4KHP B;  1SC5 B;  3K3W A;  5CA0 A;  1OCO C;  2XJG A;  1G6U A;  1ENV A;  1TBW A;  5DN6 G;  5KMG B;  2YEA A;  3APQ A;  4FK5 C;  2B5U A;  1UY7 A;  1F4M A;  2P6J A;  3OEE G;  3TK1 A;  2RNB A;  3JAM N;  3T2M A;  1B62 A;  2HLD G;  3L70 H;  4DV2 B;  1MZE A;  1XMQ O;  1CP9 A;  4KQV A;  3CRQ A;  4FFK A;  3W7S A;  2LGW A;  3A0H Z;  3K58 A;  2YXH A;  3K9S A;  1KB9 F;  3CYG A;  1IVS A;  5L3C A;  2V7Q G;  1H7U A;  3D36 C;  4B3R B;  1GK9 A;  2JEU A;  3QO5 A;  3ZHS A;  3OTO B;  2X7R B;  4DV7 B;  1Q43 A;  5GTI Z;  5JJE B;  2WWW A;  2F23 A;  2JS3 A;  1ZW9 A;  4WUB A;  1YET A;  4P9P A;  2FKX A;  2FL4 A;  4ZOL A;  4GKK B;  4LWF A;  1KP2 A;  1OHH G;  2WSS G;  4H33 A;  3FD9 A;  4L8J A;  1Y67 A;  1OJH A;  3CSX A;  1LR1 A;  2N04 A;  1TH8 A;  4WFA V;  4O2B A;  2OT5 A;  2EIM B;  4FLV A;  3APO A;  4ZBM A;  2XD6 A;  4MP7 A;  4KFG A;  2PI5 A;  1QLE C;  1JCH A;  1IXB A;  1NQT A;  4B3S O;  1W2B U;  1XNQ O;  2ZE6 A;  1UFI A;  1TAE A;  1WN7 A;  2YE2 A;  2R9A A;  1JPX A;  4CWP A;  4IHJ B;  2QWP B;  2HHH O;  2P90 A;  2ZCE A;  3F5T A;  5LA6 A;  4JTA B;  1R1B A;  4URN A;  4H13 B;  4WFE A;  2QF6 A;  3HZ5 A;  3L71 H;  3N2G B;  1IBK O;  2EIK B;  2BRC A;  3AG1 C;  3RLQ A;  1NTM H;  2UUA O;  2HKO A;  4TSF G;  1I5C A;  1OCO B;  2XDS A;  1BQZ A;  2VS0 A;  2EJR A;  1KKD A;  1EI1 A;  3E83 A;  1XIL A;  4IIJ A;  3ZHQ A;  1GJV A;  5EBW C;  4PA9 A;  1I08 A;  3ASN C;  1KQS U;  5H2F Z;  3AG2 C;  3T1Y O;  1YIT V;  2QTO A;  2B1I A;  2JVD A;  3FB8 C;  4D7S A;  4B3T B;  5CBG A;  1BHB A;  4O07 A;  4CWF A;  4K8Z A;  4MVQ A;  1M1K W;  2F4V O;  3ZX6 A;  2JS5 A;  5FPO A;  4URL A;  1ZL8 A;  4XKO A;  3LDC A;  5KA6 A;  3O6O A;  4XDJ A;  3K03 A;  4MPE A;  2WLH A;  3X2Q C;  2DJV A;  4NTY A;  1XDC A;  2CCT A;  1SA0 B;  2YGF A;  5JEN A;  5K1X A;  5DED A;  3RYF B;  3F7Y C;  3P30 A;  2CH4 A;  3ZED A;  4H0L B;  5IDJ A;  4MB9 A;  1Y8P A;  4GUN A;  1VF6 A;  1MNG A;  4O4J A;  4IYI A;  1AI5 A;  1XRE A;  2RCV A;  1VQ6 V;  5B66 Z;  4L8Z A;  1M56 B;  5BXZ A;  1KEC A;  3JAS A;  2ADQ B;  3JSN A;  4UFZ A;  4B3M B;  1IX9 A;  2YEE A;  3GIG A;  1B6Q A;  4K0K B;  4FLY A;  3PN1 A;  2ESA A;  4KFM A;  3E8H A;  4JI1 O;  5BOC A;  1SZT A;  1US7 A;  1AI7 A;  4AQY O;  2R9I A;  1NU1 H;  2VRZ A;  4X1I A;  2BTO A;  2BTQ A;  3OMN B;  2JJC A;  3SL2 A;  4LCU C;  3AK1 A;  4QE9 A;  1Z2G A;  5BR8 B;  2F66 C;  2JGD B;  5BOD A;  1AP6 A;  2FB5 A;  1M5I A;  5LYJ A;  4I9W A;  5FPR A;  1OSF A;  4ZHQ A;  1ARO P;  3ASN B;  5EC1 C;  1GMG A;  4OX9 O;  2YE6 A;  4FJC C;  3AG2 B;  5M4E A;  1ZUQ A;  2OIE A;  4KTN A;  5M4K A;  4TWK A;  3RYI B;  3WB0 A;  4MP2 A;  2AW9 A;  4DR7 B;  1I0H A;  2VWC A;  4BQG A;  1Q82 W;  1P7G A;  1ZSP A;  3QVN A;  4Z2W A;  1HR0 O;  2QJ1 A;  1U96 A;  4WBN B;  4DR2 O;  1P84 F;  4WFH A;  4MTO A;  1KD1 W;  2Q8I A;  3JCU Z;  3FAV A;  2QM4 A;  3D3I A;  3X2Q B;  5JQG B;  1Y66 A;  4R3A A;  2BZ5 A;  4EKW A;  2P67 A;  5JWP A;  4JZ2 A;  1UJW B;  5EYP A;  4X9Q A;  4UCR A;  3QTF A;  1VQL V;  3L9D A;  2E75 B;  4H85 A;  3ZMV A;  4QPJ A;  3TXS A;  1RP3 B;  5H6Q A;  3DXR A;  4XDM A;  3ZRX A;  1UPG A;  3QNE A;  5KUK A;  4I0X A;  1U2O A;  2W6I G;  2ZIN A;  3H9V A;  5HFL A;  3B24 A;  4UXN A;  3TUH A;  5M4P A;  2R72 A;  3FKS G;  5B1O A;  2UUC B;  1HNZ O;  4JYA O;  1UYH A;  3A0W A;  1FXV A;  5KHI A;  4J7J A;  2Q67 A;  1Q6I A;  5JJJ B;  1BGY H;  4FCP A;  3DC6 A;  4LF6 O;  4JV5 O;  3K5L A;  3WU2 Z;  4E72 A;  2YE9 A;  4MVU A;  1Y4M A;  3A0X A;  2JRI A;  3KZI Z;  5CB4 B;  2JIZ G;  3ZHU A;  4JYC A;  1FXK A;  2WLN A;  4DV0 O;  5CPH A;  1B04 A;  3GB7 C;  4FMT A;  4LR3 A;  4X1Y B;  1H8E G;  3CJH B;  4MSW C;  5L3B A;  3ZMU A;  4JAV A;  3CCM V;  2P7T C;  5J2U A;  4HBN A;  2HP8 A;  3K08 A;  5GON A;  1RSO A;  5KHJ A;  3EHF A;  4O4L A;  4DRX B;  4DV3 B;  4I55 A;  3HZ1 A;  2IWU A;  2YIC A;  1L0N H;  1XEQ A;  5B5E Z;  1N33 B;  1P49 A;  3VQX A;  4W4K A;  3WB1 A;  2WI1 A;  2DMX A;  3ASO C;  5J9P C;  3Q4H A;  2OWO A;  3EHG A;  2MW2 B;  3HHU A;  5H5N A;  3CWV A;  4LF4 B;  3OWD A;  2CCS A;  3IGA C;  2X6B A;  3SR2 C;  3T1K A;  3HPL C;  1SES A;  3TET A;  3ABL C;  1TVK B;  3SYO A;  3ZHR A;  1YHQ V;  2DWD C;  5M4M A;  2EIL C;  3JD0 A;  3H4L A;  3CB2 A;  4G2K A;  2QA4 V;  4WCE V;  2UU9 B;  4KHP O;  1YC3 A;  1M4U A;  1YXB A;  2BCC H;  1VQP V;  3SGI A;  3EKO A;  1OCC C;  4D6T H;  1D5A A;  4MVS A;  3ZRV A;  4CH3 A;  2Q6A A;  5L3J A;  2LW1 A;  4JPR A;  4XBF A;  1KKC A;  3A2F A;  2OTL V;  5LHG A;  1CPY A;  3DSQ A;  3R4P A;  3S5T A;  5EK0 A;  3M8A A;  1H38 A;  1PM9 A;  3P32 A;  1F51 A;  4V26 A;  3AG7 A;  1OV9 A;  1G1X B;  1HWY A;  2BOC C;  4ICG A;  3ML0 A;  4UCO A;  3R65 A;  4QIW F;  4DV2 O;  2WI7 A;  1SQP H;  1CXZ B;  2YGA A;  2ZDI C;  2PYJ A;  4A5U B;  3JD4 A;  4JGS A;  1BKN A;  3CC2 V;  1G8M A;  4Q6G A;  4YJ2 B;  3K06 A;  3ZRW A;  3HKD B;  4JI5 B;  4B3R O;  1WAZ A;  2Y48 A;  4GFN A;  4KXR A;  4N21 A;  3SYA A;  4D7T A;  2GQP A;  4QGP A;  4MS2 A;  3WG7 C;  1Y8N A;  4E00 A;  2XAJ A;  2CTR A;  1S76 D;  2YDE A;  4XIR A;  3VAD A;  2WLM A;  2XTA A;  4CS4 A;  4IHJ A;  1AR4 A;  4OPA A;  1SS3 A;  1MU5 A;  3A0R A;  4JI0 O;  4P2Z A;  3SYP A;  3ABL B;  1CEZ A;  4FLZ A;  3N2G A;  2Y4T A;  3JAW B;  2VCJ A;  3MHH C;  4GEE A;  4MVZ A;  1RM1 C;  2EIL B;  1XL4 A;  2ZQM A;  3CCE V;  2QR4 A;  1K4C C;  1PNK A;  2N74 A;  5K1P A;  2IU3 A;  4I4T A;  2AZ0 A;  2O57 A;  1E79 G;  1RPO A;  4CWN A;  1OCC B;  2PI4 A;  2L35 A;  1S16 A;  1SKV A;  4B7P A;  2OCC C;  3Q5K A;  4LFB B;  4LWH A;  4DXW A;  1NBM G;  3VOU A;  4FLX A;  4HZ3 A;  2XDX A;  2W0F C;  1H2K A;  3T10 A;  4RWU A;  1IZ3 A;  5JVD B;  4KL1 A;  5EBL C;  2BSM A;  4WUD A;  2LQT A;  2A79 B;  4EFU A;  5M4H A;  3D36 A;  4EFE A;  3D2R A;  1XUQ A;  2ODM A;  3ETQ A;  2O1U A;  1SA0 A;  5EZY B;  3ABK B;  3E2E A;  3E22 B;  3RYF A;  3ZKB A;  3IJ4 A;  4ASF A;  5F2V O;  3RBZ A;  4KUM A;  1GN2 A;  2XAB A;  2BU8 A;  1UY9 A;  1Z5A A;  1EZV H;  5H9C A;  4PDV A;  2BU5 A;  1DGS A;  5D7C A;  3ETG A;  3JAK B;  4UV9 A;  5IDM A;  3WG7 B;  2EX3 A;  3QO8 A;  2BSK B;  3GWK C;  1EM1 A;  4DV4 B;  3EHJ A;  1YI2 V;  1I7F A;  5FNV A;  3G7E A;  4B3M O;  1QZR A;  4GX1 A;  5LOV B;  4DUY B;  2WLK A;  5F5R A;  2WI2 A;  1WLE A;  3JAL A;  4GKJ B;  2EUL A;  1Z59 A;  4JYB A;  4Z1V A;  3K79 A;  1RM1 B;  2JGD A;  1AR1 B;  1BZK A;  4DV1 B;  1Q6U A;  4J7Z A;  3OMI B;  2Z5U A;  3SJQ C;  1EA6 A;  2YKI A;  4DR1 B;  4U3J B;  1QY8 A;  5BR8 O;  3RYI A;  3G75 A;  2OCC B;  4H44 B;  4H37 A;  1HNW O;  3LSQ A;  3HYZ A;  1NHJ A;  2CGO A;  4FVM A;  2YEF A;  1VAR A;  4WBN A;  3CCJ V;  3K5N A;  3OWB A;  1V54 C;  1Y76 B;  2F43 G;  4ASB A;  1UY8 A;  4YIO A;  3KCX A;  2Q8H A;  4J80 A;  4TV8 A;  5JQG A;  4DR7 O;  2YE8 A;  1FS0 G;  4AHC A;  2GV9 A;  4AWO A;  4EMV A;  4BQJ A;  1YTF D;  4JAA A;  2CTQ A;  2QWQ B;  2CUG A;  3O9O A;  1GN6 A;  1ZAU A;  2LFS A;  3ABU A;  4NTW A;  1B63 A;  3K5O A;  4NB5 A;  1GN3 A;  1SQQ H;  3K0G A;  4NYK A;  3JD1 A;  2HFE C;  4GZR B;  1SQV H;  4YKQ A;  4FZ1 A;  3CYO A;  5D6Q A;  1A32 A;  4P30 A;  5C8Y B;  2VCI A;  4EB6 A;  3BAB A;  4E2L A;  2ZT9 B;  2WI6 A;  3CCR V;  1H2S B;  3ZJZ A;  2L6L A;  1GH6 A;  3VQY A;  3RYC B;  2YUA A;  4BIU A;  3DTU B;  5CB4 A;  4YHH B;  3IAY A;  2P22 C;  3ZRS A;  4E02 A;  2ZIO A;  5IYZ B;  3FX7 A;  5D7R A;  4R1F A;  4JI2 B;  1L0O A;  3IED A;  3CJH A;  1JMK C;  1HNX B;  3AEI A;  1BQ0 A;  3U2D A;  4PDL A;  2DN9 A;  4FCR A;  4LF9 B;  1M93 A;  2EIN C;  4XKA A;  3Q5L A;  4DZY A;  1VQK V;  2AGA A;  1RFY A;  1IUR A;  4J11 A;  1R62 A;  4GLX A;  2RMK B;  1AB3 A;  2CH7 B;  4DRX A;  2LP7 A;  3VQV A;  4BIO A;  5FNC A;  2WEQ A;  1V54 B;  2EIK C;  3LMM A;  3IC9 A;  2RN9 A;  2UXN A;  4PI0 A;  1RPR A;  3TZ2 A;  1BCC H;  2VQF B;  1F7Y A;  3CRK A;  4FLU A;  2JK5 C;  4X64 B;  1N33 O;  3QTC A;  4FFB B;  2QWR B;  4L93 A;  4RUF A;  1D5N A;  3HKE B;  2RDC A;  1LNQ A;  4X20 B;  2Q0A A;  4LF4 O;  2LGQ A;  4EEH A;  3E8G A;  3TZ4 A;  1N32 B;  3O2F A;  3OUF A;  3TGU H;  4DW1 A;  4GGL A;  2YS8 A;  2A0L A;  4QJF B;  5EBM C;  1GRJ A;  3E89 A;  2M7W A;  4IYH A;  3UQ8 A;  1H2G A;  4GX2 A;  2OTJ V;  5IY5 B;  2QTS A;  2EZP A;  4IL6 Z;  3PJS K;  5IE9 A;  3HKB A;  2E76 B;  4JAS A;  1FXH A;  3RGB A;  5BMV B;  4O2A B;  4X62 O;  5KAF Z;  2JKI A;  1M56 C;  2C1I A;  2DW4 A;  3VHC A;  1WNS A;  4XD8 A;  3G6B A;  4I5S A;  1KMI Z;  2EIN B;  3D8C A;  5KAI Z;  5KLV H;  3TJT A;  1E1R G;  3LSS A;  2BE3 A;  1YT2 A;  3G7B A;  3K0D A;  2WPD G;  4L87 A;  2BU7 A;  4ZKI A;  4YJ2 A;  4O4I B;  2CAZ C;  3A0T A;  3BCC H;  4X66 B;  4KSG A;  2CE4 A;  3VHA A;  3CGZ A;  1M57 C;  4U93 A;  1JJ2 U;  3LDE A;  4O4H B;  3S3W A;  4RUE A;  3EHH A;  3BEH A;  3CX5 F;  4UUJ C;  3L75 H;  3CPW U;  2YE3 A;  2WI4 A;  2D3O W;  1Y74 B; 
#chains in the Genus database with same CATH homology
 1FXV A;  1VQ9 V;  3CCQ V;  2Q67 A;  4BW5 A;  3W7T A;  1M9N A;  5IY5 C;  5LBQ A;  4MVU A;  1Y4M A;  1NVP D;  4MTX A;  1VQN V;  2JIZ G;  3FYI B;  1P7B A;  4JYC A;  1FXK A;  2WLN A;  1OCZ C;  1VQM V;  3AG4 C;  1K34 A;  3ETE A;  3K04 A;  2QEX V;  3GB7 C;  3OEH G;  4FMT A;  1H8E G;  3FB5 C;  4FPP A;  4MSW C;  5L3B A;  3ZMU A;  4RQF A;  4JAV A;  3CCM V;  2P7T C;  3RVY A;  2K1E A;  3RW0 A;  3K08 A;  4X89 A;  3AG3 B;  3T1C A;  1N8R W;  1K5S A;  3FYE B;  5KA5 A;  2WLL A;  2UXX A;  3UM7 A;  1NH2 D;  2MK3 A;  1G4Y B;  4QNH B;  3TCU A;  2DQ3 A;  4XDK A;  5IYC O;  2ITD C;  5CBF A;  3NXS A;  2ITC C;  2XAH A;  3ASO C;  5J9P C;  1K33 A;  1SET A;  1NKD A;  1QVG U;  2ZDI A;  3I56 V;  1NR7 A;  2EZO A;  1QR8 A;  3CP1 A;  1Q86 W;  1SER A;  2EBO A;  2ZD9 A;  3LNM B;  4RAI A;  1ROP A;  3IGA C;  1PNL A;  4CZZ A;  4PA3 A;  2X6B A;  3HPL C;  1SES A;  3OGC C;  3TET A;  4F4L A;  3ABL C;  1S77 D;  2XAG A;  3K9A A;  4UVA A;  1QR9 A;  3SYO A;  1GKF A;  3EFF K;  4GX5 A;  3STZ C;  2ATK C;  4WF9 V;  3SPG A;  1YHQ V;  1M57 B;  2Q69 A;  2DWD C;  1FXK C;  2WAM A;  1K73 W;  1VQO V;  2EIL C;  3JD0 A;  1MOF A;  2JJ2 G;  1R3I C;  3B77 A;  2DQ0 A;  1R3L C;  4G2K A;  2QA4 V;  2X6C A;  1K3E A;  4WCE V;  1BHA A;  3T4Z A;  1VQP V;  1PD3 A;  4HAM A;  5FL7 G;  4ASU G;  1OCC C;  2ZXW C;  4N23 A;  4MTF A;  3F7V C;  4MVS A;  2DYS C;  3MD0 A;  3G6E V;  1YTF B;  3AG3 C;  1QCE A;  1W0K G;  1IXM A;  1OCR B;  2Q6A A;  5E1A C;  3ZRV A;  1EFR G;  2Z3Y A;  1S72 V;  1GO3 F;  4JPR A;  1AJQ A;  4XBF A;  3IC7 A;  2A9H A;  2H8P C;  1DF5 A;  1AJN A;  1OCZ B;  3W7X A;  3AG4 B;  5LHG A;  2OTL V;  1CPY A;  3JYC A;  1VQ7 V;  3QO7 A;  5EK0 A;  5LHI A;  3JD3 A;  1DF4 A;  2EIJ B;  3ABT A;  5LGU A;  1H38 A;  3P32 A;  1F51 A;  2IH1 C;  3B8N A;  1HWY A;  2BOC C;  2JEX A;  3ML0 A;  3R65 A;  4QIW F;  1JVM A;  1KP3 A;  4PA7 A;  1F4N A;  2XOK G;  4JF3 A;  5CA3 A;  1WPX A;  2ZDI C;  3UKM A;  2R9R B;  2V1D A;  1XL6 A;  3JD4 A;  4JGS A;  5L3E A;  3CC2 V;  1G8M A;  4GCZ A;  4X88 A;  1MSW D;  3OMA B;  3K06 A;  1W0J G;  2X6A A;  4OXS A;  3ZRW A;  3ZRW B;  1YJW V;  1KC8 W;  2FTK A;  2YSU B;  2Y48 A;  1L1F A;  4G27 B;  4N21 A;  4MTG A;  3SYA A;  2HG5 C;  1JX9 A;  4PDM A;  3LUT B;  1GM9 A;  2HVJ C;  4MS2 A;  3WFV A;  1S5H C;  3WG7 C;  5DM6 V;  2XAJ A;  4KP4 A;  4U7O A;  3STL C;  1S76 D;  1I5X A;  4G28 B;  2WLM A;  2Y69 C;  1P4R A;  3A0R A;  4P2Z A;  2DYR C;  3SYP A;  1M90 W;  3ABL B;  1CEZ A;  1OCR C;  3ZN0 A;  2YEV A;  3MHH C;  4MVZ A;  2JDI G;  1PKX A;  1FXK B;  2GHY A;  1RM1 C;  2EIL B;  3W7U A;  1GM8 A;  1XL4 A;  2ZQM A;  3CCE V;  5L3G A;  1K4C C;  2IJK A;  1PNK A;  4PEL A;  5HFM A;  2IU3 A;  2EIJ C;  1K8A W;  1E79 G;  1NR1 A;  1RPO A;  4XDL A;  1YJN V;  1K7D A;  1GM7 A;  4R6Z A;  3ZMZ A;  4X8A A;  1OCC B;  2PI4 A;  2ZXW B;  3KG2 A;  1PL0 A;  2GSM B;  2DYS B;  2IH3 C;  2C2A A;  3FB7 C;  2OCC C;  3JD2 A;  4GX0 A;  2WLL B;  4DXW A;  1YJ9 V;  1R6K A;  1NBM G;  3VOU A;  3ZMS A;  1F23 A;  1BL8 A;  2LFR A;  4HZ3 A;  2W0F C;  5EBL C;  2A79 B;  5KUM A;  5BZB A;  3D36 A;  4J9Y B;  3CD6 V;  3E35 A;  2EIM C;  3ABK B;  3E2E A;  3CC7 V;  1AJP A;  1EZJ A;  3CCS V;  4UVC A;  3RBZ A;  4KUM A;  4GT1 A;  4P9O A;  3W7W A;  5H9C A;  3OR6 C;  3K3W A;  4PDV A;  1DTO A;  1PNM A;  5EC2 C;  4MVR A;  1K9M W;  3ETG A;  1COW G;  4JTD B;  1SRY A;  1OCO C;  4UV9 A;  3WG7 B;  3QO8 A;  4QE7 A;  3G4S V;  1ENV A;  1H8H G;  1QLE B;  3T4D A;  1S3J A;  2Y69 B;  5DN6 G;  1YI2 V;  5L3D A;  3B8M A;  5LGT A;  1I5Y A;  4FK5 C;  4U7N A;  1NJI W;  3EHB B;  2B5U A;  1F4M A;  2P6J A;  3OEE G;  4GX1 A;  3TK1 A;  2WLK A;  2DYR B;  5B1B C;  3T2M A;  2HLD G;  4WFB V;  1K4D C;  1WLE A;  3CCL V;  2QKS A;  5LGN A;  3AG1 B;  1EBO A;  3CMA V;  4JYB A;  3F5W C;  1CP9 A;  1THZ A;  3K79 A;  1RM1 B;  1AR1 B;  1R3J C;  3W7S A;  1JQ0 A;  3OMI B;  2Z5U A;  3OFN G;  1TUE B;  3SJQ C;  3E8F A;  5L3C A;  2V7Q G;  3OW2 U;  1K97 A;  2QM8 A;  1GK9 A;  2JEU A;  3OE7 G;  3QO5 A;  1S0V A;  2X7R B;  3ABK C;  5B1N A;  3OAA G;  2WWW A;  5GW7 A;  2XAS A;  3OR7 C;  2OCC B;  5L3F A;  4P9P A;  2JJ1 G;  4H37 A;  3LSQ A;  1YIJ V;  4PDR A;  3DGE A;  1AI4 A;  2NLJ C;  1KP2 A;  1OHH G;  2WSS G;  4H33 A;  3CCJ V;  2KB1 A;  4LC1 A;  2WLI A;  1V54 C;  2F43 G;  1NVP B;  3RVZ A;  4QPK A;  2IJJ A;  1R6N A;  2AHY A;  4WFA V;  3CCU V;  2AHZ A;  2OT5 A;  2EIM B;  4ZBM A;  1FS0 G;  2CK3 G;  2PI5 A;  1QLE C;  1JCH A;  1MG1 A;  4MVO A;  1NQT A;  3HB3 B;  1VQ5 V;  1W2B U;  1YTF D;  2XAQ A;  4LBE C;  1JPX A;  1VQ8 V;  5CBH A;  2LFS A;  2P90 A;  3ABU A;  4RQE A;  4JTA B;  5IYB O;  4DO2 A;  4WFE A;  1R3K C;  1QBZ A;  4MVM A;  1Q7Y W;  1QVF U;  2EIK B;  3AG1 C;  2YEV B;  3K0G A;  1NH2 B;  3JD1 A;  2HKO A;  2HFE C;  4TSF G;  1OCO B;  2EJR A;  1KKD A;  1YSC A;  3E83 A;  5EBW C;  2QM7 A;  4TT3 G;  3CYO A;  4PA9 A;  3ASN C;  1KQS U;  3G71 V;  4P30 A;  3AG2 C;  5LHH A;  4MW8 A;  4E2L A;  3OM3 B;  1QLN A;  5B1B B;  2ZR2 A;  3E86 A;  3CCR V;  3ZJZ A;  5CMU A;  4MW3 A;  1YIT V;  2QTO A;  5B1A C;  5IYD O;  2B1I A;  3ETD A;  3FB8 C;  4BIU A;  1MAB G;  4MT8 A;  3DTU B;  5CBG A;  1BHB A;  1AI6 A;  3JCZ A;  3ZCC A;  4MVQ A;  1M1K W;  3ZRS A;  3LDC A;  5KA6 A;  4XDJ A;  2HR3 A;  3K03 A;  3SPH A;  1JOY A;  2WLH A;  3X2Q C;  2W6J G;  3AEI A;  1DLB A;  4PDL A;  5B3S C;  4RO2 A;  4BIZ A;  2EIN C;  3FB6 C;  3CXC U;  3SYC A;  1VQK V;  3F7Y C;  4CBC A;  3P30 A;  1R73 A;  3BY6 A;  5IDJ A;  3ABM C;  4WFF A;  2LP7 A;  1AI5 A;  4HYO A;  4BAY A;  1ZWI C;  1VQ4 V;  1V54 B;  1VQ6 V;  2EIK C;  1M56 B;  1KEC A;  2X0L A;  2ZR3 A;  2UXN A;  1V55 B;  1RPR A;  1B6Q A;  4UVB A;  4JAU A;  4KFM A;  2IJI A;  3E8H A;  4LP8 A;  3E8B A;  2JK5 C;  1SZT A;  2XAF A;  1AI7 A;  2R9I A;  4J9Z B;  3OMN B;  4RUF A;  3GWO A;  2WLJ A;  2NNU A;  1OZ0 A;  3SPC A;  4LCU C;  3I55 V;  1LNQ A;  4QE9 A;  2HJF C;  4R50 A;  2IU0 A;  2IJH A;  3E8G A;  4R8C A;  5H6R A;  3OUS A;  4R7C A;  4I9W A;  3OUF A;  1ARO P;  3ASN B;  5EC1 C;  1GMG A;  2A0L A;  5CN0 A;  4QJF B;  1GTO A;  5EBM C;  3LDD A;  2HVK C;  3AG2 B;  4FJC C;  3E89 A;  3MHS C;  2M7W A;  3SPJ A;  3ZIA G;  1H2G A;  4GX2 A;  4TWK A;  2Q68 A;  2OTJ V;  5IY5 B;  5B1A B;  2EZP A;  3IFX A;  3PJS K;  4FIP C;  4PA4 A;  4YXW G;  1E1Q G;  1Q82 W;  4JAS A;  1ORQ C;  1J95 A;  1FXH A;  2H94 A;  3SYQ A;  4WFH A;  4MTO A;  1Q81 W;  1KD1 W;  2WLI B;  1M56 C;  3CME V;  3D3I A;  3X2Q B;  3M99 B;  1Y66 A;  3SPI A;  2DW4 A;  1K5Q A;  3ZMT A;  4JTC B;  1V55 C;  4EKW A;  2P67 A;  3CCV V;  5B3S B;  4I5S A;  2EIN B;  1UJW B;  1E1R G;  3LSS A;  4UV8 A;  2XND G;  4Z1M G;  3ABM B;  3K0D A;  1VQL V;  3H01 A;  2WPD G;  4L87 A;  4ZKI A;  2B1G A;  1FFT B;  3ZMV A;  4WFG A;  2QE7 G;  4QPJ A;  3ZN1 A;  3CC4 V;  1BMF G;  5H6Q A;  3ZRX A;  2IW5 A;  3ASO B;  3QNE A;  5KUK A;  1M57 C;  1JJ2 U;  2W6I G;  5HFL A;  3LDE A;  5C93 A;  4RUE A;  4UXN A;  2BOB C;  3BEH A;  2DWE C;  3FKS G;  5B1O A;  4UUJ C;  4PA6 A;  3VBB A;  3CPW U;  1K92 A;  4Q20 A;  2D3O W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...