1IXMA

Crystal structure of spoob from bacillus subtilis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
168
Chain Sequence
SDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVIDAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHLFDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDIMRFEITSHECLIEIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SPORULATION RESPONSE REGULATORY PROTEIN)
publication title Formation of a novel four-helix bundle and molecular recognition sites by dimerization of a response regulator phosphotransferase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 56
structure length 168
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14682 SPOB_ab Sporulation initiation phospho-transferase B, C-terminal
A PF14689 SPOB_a Sensor_kinase_SpoOB-type, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ixmA01
3.30.565.30 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Sporulation initiation phosphotransferase B (SpoOB), C-terminal domain 1ixmA02
4QPJA 4JASA 4U7NA 3ZRXA 3DGEA 2P67A 3MD0A 4JAUA 4BIZA 2WWWA 4LC1A 4BIUA 4I5SA 5IDJA 4U7OA 4JYBA 4FPPA 3A0RA 3ZRWB 4FMTA 1F51A 1JOYA 3D36A 5B1OA 4KP4A 5B1NA 3TK1A 3ZCCA 2C2AA 2LFSA 4ZKIA 4GT1A 3ZRWA 2QM7A 2FTKA 4JYCA 2QM8A 3NXSA 4MT8A 2LFRA 4Q20A 3P32A 4MTXA 3ZRVA 4GCZA 1IXMA 4JAVA 4QPKA 5C93A
chains in the Genus database with same CATH superfamily
1ZWHA 2Q7GA 2IOPA 2VQEO 2RQ6A 1IBLO 4B3RB 1YC1A 2YEVB 3ZS8C 5JJNB 4CWRA 4HZ3A 2GTSA 3TZ0A 2ZCEA 2WSSG 2WI2A 5LHIA 2LGQA 5LA6B 3K5NA 2HKOA 2LP7A 1VF6C 4I0XB 4Z2WA 4GT8A 2OIEA 3CXHF 1BS3A 1Y4MA 2ZXWC 1AM1A 3IJ4A 1FXKC 2JEUA 4CH5A 1VQ8V 4I5SA 3GWOA 4FLZA 4UXNA 5L3CA 3GIGA 4DV3O 3CWVA 4CWSA 2UXDO 1I59A 1OCZB 1OCOC 3OWDA 1YSRA 4G2KA 2YKCA 1GN6A 3STZC 4MB9A 3BPZA 4GUNA 2L6LA 1G8MA 1SA0A 1VQPV 1SERA 5D7CA 3UCSC 4JAVA 3LSSA 2YICA 3KG2A 3JAKA 5CTWA 1VQNV 1BGYH 3MAQA 4DV2B 1AROP 3LPSA 4Z1VA 4J7ZA 4R6ZA 1TC0A 2XAGA 4DR5O 1JOYA 3BFRA 4UV9A 1GM8A 3CYOA 5LOVA 4L94A 1QCEA 2YE7A 4ZHQA 3RWRD 3JCUZ 3MDSA 4PD4F 2FXSA 2YGEA 4JF3A 3JYCA 1YCIA 4R7CA 3TZ5A 4AWOA 1VMGA 5EBLC 1AILA 1VF7A 4J41A 2GUZA 5BXZA 3UKMA 1BYQA 3AG4B 3SPHA 3AG4C 2VWJA 2YI5A 3CP1A 2DYRB 1TC6A 1MA1A 1AI6A 4O0BA 1B04A 3OUFA 1Y76A 2IH1C 2PUSA 2UUBO 4MPEA 1SESA 3ASNB 3CB2A 5KMGA 2UUAO 3ASNC 4P9PA 4TQDA 1NH2B 3GIEA 5FL7G 1NI8A 2RJZA 4ZVIA 3ZHTA 3EHHA 2EULA 1WLEA 4XIQA 3RT3C 5FNFA 1BL8A 5KX5A 3WFVA 5CBFA 1BHBA 3K98A 1H2KA 4LF4O 1OCRC 1QZRA 5B1BB 2P22C 5B1BC 1I5DA 5FNCA 2EIKB 3N27A 2EIKC 1Q43A 1Y8PA 2FYUH 1FAFA 3AG3B 4O4LA 2IJJA 4MP2A 2AGAA 2Z0AA 1N0NA 3JD2A 4GZRB 5CBHA 4ZI7A 4DR4B 2XDKA 2WI4A 2R72A 3Q4HB 4MTGA 4K8XA 3T10A 2F4VO 2AKPA 4XCJA 2HLDG 3E22B 1BXDA 3RFRA 3N2KA 3HZ5A 5BY1A 4YJ3B 3QTCA 4PDMA 4BW5A 3INWA 3G7EA 3RYFA 1MABG 2BYIA 1E1QG 3QO8A 3K58A 4H7QA 3OW2U 5D7DA 3TXSA 4FCQA 4MBCA 5FWKA 4AS9A 2BREA 5H6QA 4GLXA 5KHKA 2XK2A 1PV0A 1NHHA 4HXWA 4FM1A 3E89A 3JASA 4LF6B 4E2LA 2OTLV 1M57B 1OHHG 4YY3B 2CTPA 3UT5B 3W7SA 4B3RO 2BOCC 2ZE7A 3ZX6A 2EJ7A 3ZRWA 1IZ3A 4UFZA 4JI2B 1TUEB 4IIJB 1LR1A 2QKAA 4MOTA 1YC3A 3T2SA 1KMIZ 4CWNA 4I9WA 2HVJC 4XC0A 4LFBB 4PHZA 3RLPA 4A5UB 2PI5A 2IWUA 2XAJA 1THZA 1B3QA 2P4VA 3JCZA 5KUKA 4LWSA 5B1NA 4W7TA 1BSMA 4IYHA 1VQ9V 3VHAA 3CXCU 1YF2A 4MTFA 3LSQA 3K99A 3SYAA 3RYHA 4QNHB 1P7BA 3EKRA 4XD8A 2YEFA 2HHIA 4YKRA 2MK3A 1H2SB 1SZTA 2XNDG 4NR1A 1S5JA 4I4TB 4DV4B 1L8DA 3ETDA 5M4NA 3FT5A 3N2GB 2XABA 4DV2O 1SZXA 4L91A 3E35A 4H33A 4BW9A 1Z5BA 3SJBC 4PELA 3JATA 5GW7A 4DV5B 2NN4A 2WLLA 1WP8A 5KLVH 2BU7A 3CRKA 1LNQA 1RM1C 3KCXA 4BAYA 2K5BA 3FB6C 1SQXH 1SQBH 2XTAA 5BR8B 3SYQA 4YJ2B 3K59A 3H1JH 1NJIW 4YKUA 1O9HA 5EK0A 1GK9A 4P9OA 2GFDA 5D6PA 1EFRG 2EILB 2PZSA 2EILC 1M90W 1Q6IA 2L35A 1I94B 2YEHA 3EHFA 5J2TA 3FX7A 3ABKB 1KYOF 4U3JA 2IH3C 3CRAA 3T1KA 1YJWV 5L3FA 1YIJV 2XHRA 4E4EA 2Q67A 1R62A 3B28A 3TGUH 1JMKC 4RUEA 2ZDXA 4GGLA 2V7QG 5JVDB 1FXVA 2YSUB 5J9PC 2R9AA 1EN5A 1ZTEA 3VHDA 5JENA 2FB5A 1SQVH 2ZKJA 4XKAA 4O2AA 1QVFU 1AVMA 2AHZA 4J9ZB 3W7WA 1EZJA 1GN2A 2BCCH 1H8HG 1JVMA 4DUHA 4TUYA 2E75B 4YKYA 2IJKA 2KSDA 3K5OA 2YEEA 4NVPA 1JQ0A 2N05A 5JJEB 1NTKH 1YETA 5CA0B 4LWEA 3CHXA 5CBGA 4YHHB 3IFXA 2HHHB 4XIRA 1XDCA 3LNMB 4BXIA 2UU9B 2E76B 2KKWA 4O4IB 4U7NA 5JQGB 2Q7EA 4PDVA 2CE4A 4IYIA 4DR4O 2LJ2A 5EYPB 3RBZA 2Q0OC 3ABMB 4FM2A 3ABMC 4J10A 4L87A 5C8YA 4AILC 1N32O 2OTJV 3OWBA 1K5QA 2HJDA 5DEDA 3PEJA 4O4JA 3SDLA 1WPBA 1I7FA 4I7ZB 2ARHA 2HG1A 2WI3A 3R92A 3JATB 3R4OA 2YIAA 4XIPA 2HKJA 5BZBA 1UYFA 1QQCA 2LQTA 3VQXA 3JARA 1RPOA 3E8BA 4LF6O 2Y0PA 5LYJB 2YIBD 2HR3A 1S3JA 4GX0A 4ZIBA 4H44B 3VQYA 3BM9A 2VCIA 5J2UB 3CE2A 2EZOA 2ZNJA 1VQ7V 3OFNG 4J42A 4H81A 5IJ9A 4JI2O 1E1RG 5J2TB 2OIGA 3JALA 2VCJA 4YKTA 3CJHB 3DXRA 4LFBO 4MVMA 2Q8HA 2CTWA 4KTNA 4DV7B 2XX4A 4R50A 3K57A 2ZIMA 3G71V 4TV9B 2LW1A 2BTQB 2HVKC 3UO2A 1ZL8B 4HYPA 4UVAA 3IC9A 3ZMVA 2VQFB 1HNZB 1QLEB 1XOUA 3NMQA 3ASOC 1PM9A 1NR1A 3RGBA 4XDKA 5L3GA 3OR7C 3CMEV 5F5RA 4FFBB 4DV6O 1I0HA 2QEXV 1K97A 2QDOA 4R3MA 4WFEA 3OE7G 4URNA 1JPXA 5BR8O 1K73W 1JJOA 5LBQA 3CC4V 1ZXMA 4X9QA 2DYSB 3K97A 3LNNA 2DYSC 2PGGA 1DF4A 3WG7B 1I94O 4GX1A 4CZZA 3H4LA 5K1XA 3WG7C 1S5HC 1MNGA 1D2DA 2Q73A 1UYEA 3G4SV 1URFA 1SC5B 2ADPA 4EFBA 5FNVB 3OGCC 3AK1A 3E86A 1V55B 3ZBHA 5DECA 4D7SA 3WHAA 4IHJA 1HR0O 3RYCA 3VHCA 1GM9A 1F4NA 3K9AA 2JDIG 1YJNV 4MT8A 4GKJB 2LFRA 1P7GA 2ZD9A 3D3IA 4JGSA 3P30A 4HXZA 1JFFA 5BMVA 4YHHO 1XHXA 4X1IA 2HHHO 3R4PA 4PRVA 2UU9O 5EZYA 1M1KW 3K9SA 1EA6A 1R1BA 2ILMA 4F4LA 1JX9A 5LXTB 3QO5A 1MOFA 2CDYA 2KB1A 1TBWA 1BT8A 3SPGA 2ZR3A 3STLC 4BAEA 3U2KA 4MTXA 4X20A 3FT8A 3LMMA 2A06H 1Y74B 3O9OA 5LGTA 4EEHA 1JM6A 4P7AA 3U11A 1MZFA 1V54C 4PV1B 3RVYA 2ZDYA 1Z2GA 2ZDIC 3HB3B 5IYBO 3D36C 2GDSA 4URMA 1WPXA 3M8AA 1XMQB 4UUJC 2WI6A 4AI8A 3B24A 3CRLA 3CMAV 3E8FA 1SQQH 4XKKA 4L8ZA 5LMUB 3CRQA 5EC1C 1Q86W 2P06A 2CUGA 1Q3EA 3OTFA 2Q7HA 2XAFA 2YE4A 3BCCH 4N23A 3SPJA 4B7EA 2YEGA 1P49A 3VBBA 3D8CA 4E00A 1FXKA 1TVKA 1VQLV 3A0HZ 4DV7O 4XDMA 1KC8W 2F1MA 4CC6A 3ZRSA 2Q8IA 3SJCC 4F6RA 3AG1B 1N36B 3O6OA 4X64B 1BMFG 1P84F 4D7TA 1R6KA 4KXRA 2OT5A 3W7XA 2JGDA 1EZVH 1X4TA 3QO7A 3ML0A 3E83A 2VQFO 2UXNA 3BRCA 1S76D 1N33B 5CB4A 1U2OA 4WUBA 3H1LH 3SGIA 1U96A 1JFFB 5CN0A 5IN9A 1PL4A 1N34B 2ESAA 1MSWD 4CBCA 2Z5UA 4B7KA 1CPYA 2WPDG 2IW5A 3MD0A 5GONB 4BIUA 3C11A 4X65B 5IYZA 4NTYA 4OPAA 1L0NH 1WP7A 3L73H 4H37A 5LGNA 4FCRA 2CGFA 2Q0AA 4MVUA 1AJNA 5KA5A 3E2EA 1FFTB 1Q5OA 2DWDC 3CX5F 3ZMUA 3X2QB 1FFXB 1S0VA 1KIJA 3G80A 1PP9H 1RPRA 2VS0A 4LP0A 2C1GA 4GX5A 2YKIA 3C3SA 4EM7A 4MW3A 3A0BZ 2UXBO 1Q6UA 2XCMA 3QTFA 3LUTB 2ZM6B 2FMLA 4PL9A 4O05A 2EIJB 1YI2V 2EIJC 4EMVA 4P30A 4MVSA 4B3MB 4FFKA 3MNRP 2DQ3A 1OCZC 2IU3A 1H8EG 2A3QA 2GTAA 3B26A 3BMYA 1TUBB 4OX9B 1SKVA 3QG5A 3ZXOA 2YEBA 4GKJO 1DLBA 2UUCB 4YKZA 1P4RA 4JASA 1BHAA 2RNBA 3WB0A 4QJFB 3K0GA 4EGIA 2BSKA 3A0YA 5H6RA 4KFMA 4LWFA 1F4MA 1HP8A 2XT9A 4PRXA 2CH7B 1XNRB 1J5EB 3EFFK 3UO3A 2QKSA 3T1HB 1AB3A 1VP7A 4JI7B 2CTQA 2NNUA 2QM8A 3QF7A 2BU2A 1B6QA 4GKKB 4AWQA 4MTOA 2HCHA 4PA6A 4DR7O 2JJCA 4JV5B 3HKBB 3R66A 2XJJA 3TZ2A 2Q6AA 1SF9A 4O2BB 2M6YA 3BABA 4J11A 1YT0A 4IL6Z 4HNAA 1KKDA 4H85A 4EB6A 1IVSA 2XHXA 2DYRC 2EINB 2X6AA 2BRCA 4CH3A 1XMQO 1TGOA 4UCVA 4XE2A 2Q68A 2X7RB 4LNUB 1IURA 2GV9A 4KL1A 2A79B 3H80A 4LF5B 2Q69A 4JZ2A 1AH8A 5LMUO 1RSOA 5FPOA 3A2FA 4DV0O 1PD3A 1UYHA 2YJWA 3O2FA 2YJXA 2WLJA 3DC6A 2H3OA 1ENVA 2QTSA 1EI1A 4DYLA 4R8CA 3ZN0A 5IDJA 4LWGA 3CCRV 2YK2A 1GKFA 2PNRA 1YDXA 5H2FZ 3K60A 1R3JC 2R9RB 2C2AA 3J80N 4L93A 4YXWG 1Y4SA 3B8NA 1TILA 4RQFA 2OWOA 2E74B 3RYIA 3AG3C 1N36O 1BZKA 4V25A 3VADA 1S77D 3CCSV 4X64O 3DGEA 3GIGB 1NR7A 1PKXA 2WWWA 2CG9A 4MSWC 2ZKOA 3OTOB 4J9YB 4ZOLA 4UCSA 3DSQA 1N33O 1SA0B 1K34A 4FLVA 5IYDO 1CP9A 3JAKB 3HKCA 1UYLA 1YXBA 1N34O 2WI7A 2LGWA 4DRXA 2QTOA 4E02A 2P7TC 2QKCA 4I50A 3FB8C 1LUWA 2AHYA 3EHJA 5LOVB 2IORA 4NH9A 4ZHQB 1AI4A 3EVKA 4FLXA 4X65O 4W4KA 2YE9A 1NS1A 3CCMV 1U0ZA 5KAFZ 1M57C 4CE2A 2W6IG 4NXMB 3O65A 1KQSU 4DO2A 1H7SA 3PN1A 2LO1A 2D3OW 5LL6Y 2GUZB 5D5PA 4YIOA 2YE6A 3OAAG 1PL0A 3FB7C 4HNAB 3ZRXA 1OV9A 3INXA 2IJHA 1Y76B 5KMGB 3GB7C 3K04A 1XNQB 2ZM6O 3SYOA 5TISZ 2XASA 1KUQA 5LP6A 5KX5B 4B3MO 4JI6B 4RUFA 1W2BU 1LUVA 4RWUA 4OX9O 1Y66A 2V4DA 2UUCO 2B1IA 2ETNA 1OJHA 4O4HA 3A0XA 1K4DC 4FLWA 4CS4A 4O4LB 1XNRO 1JR9A 3G75A 1J5EO 3SJQC 3TCUA 3T1HO 2BTOA 4TSFG 5L3DA 4DUYB 4ZI7B 3JAWA 3BY6A 1YSZA 2P6JA 2PYLA 4JI7O 3O0IA 3CCLV 4QPKA 1GH6A 4PJ0Z 1Y4UA 4FK5C 3N2KB 4GKKO 1QBZA 4ZOLB 5IT9N 4LFCB 3EKOA 5DM6V 1DTOA 2GQPA 1F7YA 1HW7A 4JV5O 3RYFB 2AXTZ 2BU5A 1UY9A 4ICGA 3J7AU 4JTCB 5CA1A 3Q5LA 1ZAUA 1NT2B 3I5DA 3ABKC 4I55A 5F3KA 3CCVV 4PDRA 3ETQA 3RW0A 2XDLA 4Q20A 4GX2A 3HHUA 1PNKA 5BOCA 4MPNA 1R3LC 4LF5O 5CTXA 1UY6A 3IC7A 1Q7YW 3JASB 4TV8A 1H2NA 1R6TA 2QWQB 3CCJV 1Y8NA 2YEDA 4DV1B 2PF4E 3ZRWB 4ASGA 4QGPA 1AR4A 1GAXA 4HYOA 5IYCO 2E3CA 4G27B 1WA8A 1KU9A 2KQXA 3ZIAG 3C0EA 3VOUA 1W0JG 5AG2A 4OGQB 3ZKBA 4X1YA 3ZM7A 4MVRA 2NLJC 4LWSB 4WFBV 4FIPC 1VIBA 4FMTA 3RYHB 4CH4A 2PTMA 3OTOO 2VRZA 3EHGA 4J80A 3L71H 2EJRA 4B7PA 4FZ0A 3K3WA 2W6JG 5GTIZ 3GWKC 3L74H 2YE5A 1S14A 2XUMA 3PJSK 1MG1A 4OPHA 3ZKDA 1FJGB 1UJWB 2ODMA 1YSCA 2WLLB 1WB7A 4J7JA 2JEXA 3C90A 4U93A 3RN4A 3M99B 5IY5B 2Q4PA 4YKQA 4NYKA 1RP3B 2F66C 4ZBMA 2IWXA 4UROA 2XAHA 4AHCA 4YY3O 2OCCB 3EHBB 4NXMO 2WERA 2HFEC 3BVOA 2BU8A 1K33A 4NTWA 4LPBA 5EC2C 4CS2A 3L9DA 1FXHA 5KUMA 1YESA 1TAEA 3FYEB 2PY5A 4U3JB 3OM3B 4JYBA 5L3JA 4YIPA 3HKDA 4AWPA 1XNQO 1Q90D 3R91A 2WA4A 4X1KA 3L72H 4TV8B 3CEIA 3KCYA 1UYGA 4FLUA 5IJ0A 2B5UA 2ZQMA 4JI6O 2QF6A 2GBOA 1COWG 4O2AB 3U67A 4MVZA 2XAQA 3AK2A 2P67A 3IGAC 2LW7A 1FD9A 4TUYB 4CWOA 3GVMA 4DV4O 4DK1A 1QLEC 4TQFA 5EBWC 3A0RA 1W59A 5CPHA 2QWRB 4JI1B 1YT2A 3H1KH 4DV5O 2XX5A 2QFOA 4WUDA 5GTHZ 2FKXA 2YI0A 5JH7A 4DUYO 2YKEA 2X0LA 1L0LH 1AJ6A 2FWZA 3CYGA 3G67A 1FKAO 2CCTA 5C8YB 2BT0A 4TT3G 1AR1B 1V9PA 3F5TA 3HYZA 5H9CA 5M4PA 1M93A 1N8RW 4DR1B 2ZDIA 4O4JB 3CC2V 5J71A 3D36A 2QE7G 4QE9A 1CEZA 4KHPB 4CWPA 4UVCA 2X6BA 2UXXA 2P5OA 2YIDA 3TZ4A 3OMUA 1BGQA 1PPJH 1YZBA 1XL6A 3BA8A 1B62A 2EIMB 1US7A 1I58A 4YKWA 2WLKA 4K3AA 2EIMC 3KE6A 2Q5ZA 4XDJA 2QWOB 3JARB 3EXAA 4WFHA 2WEQA 2QGNA 5CF0A 2C1IA 1V55C 3AG7A 2JGUA 3L70H 4X88A 4DV1O 4JI3B 2YXHA 3K08A 4XCLA 3B8MA 5IJ9B 4O04A 3APOA 2QR4A 5B1AB 5KHJA 2Y69B 3JALB 5B1AC 3DXRB 3ZMZA 2Y69C 4R3AA 3WB2A 4R1FA 1SQGA 2YI9A 4UVBA 1SQPH 1Z5VA 2QJ1A 3HKEA 4B6CA 1F51A 5A2QN 2YEIA 4O09A 2YEAA 1QYEA 4I3HA 5IJ0B 4LR3A 2QWPB 2ITDC 3FAVA 4HBNA 1K3EA 2KG7A 3NXSA 3QVNA 3DTUB 4JI8B 3TTZA 2WLIA 5M4HA 4WBNA 4DK0A 3ZMSA 3G6BA 1R3IC 2M7WA 1QU7A 4NTXA 3OW6A 3S3XA 4LC1A 1FJGO 2JJ2G 2WLHA 1WNSA 5IDMA 2BOBC 1RFYA 1M5IA 2DQ0A 2P90A 3JD3A 1D5AA 2R70A 2YEVA 4JI5B 3I56V 4UCRA 1NHJA 3FV5A 4I9QA 4HYMA 2YK9A 4TOIA 2H8MA 2ZE6A 4B3TB 5LA6A 1VF6A 3UM7A 5LHGA 5KA6A 1TIDA 2FWYA 1I5AA 4I0XA 3FD9A 1N0JA 5K1PA 2WA3A 1T5EA 3T0ZA 4IT5A 4FLTA 2XDSA 4LCUC 2E0AA 5BODA 4ASBA 4DZYA 2UUAB 3CGZA 2K9PA 3TK1A 2CCSA 1MZEA 5HFMA 1NTMH 1TA8A 2QM4A 2DW4A 1WB8A 4LBEC 3SPCA 3ZHVA 4UCUA 4ASFA 3Q5JA 3JZ3A 5E1AC 1XEQA 4LFAB 2O1WA 4JQLA 4GCZA 4XTJA 4JYAB 5FNDA 4DR6B 3AG1C 2YXLA 2ZIOA 3CPWU 2IWSA 4GEEA 4RQEA 3R4NA 4IHJB 4MP7A 1Q81W 1Z5AA 3RYCB 1Y6XA 4FCPA 4DW0A 3L75H 1AMWA 1HNZO 1NZ6A 3A8TA 4K0KB 2YI7A 1E79G 1US6A 1GN3A 3KZIZ 3CRCA 3ABUA 1AJPA 1HNWB 5BMVB 3AEIA 4JI1O 4X1IB 4JYCA 3H1IH 1I5XA 4ASUG 3B77A 5J6AA 5EZYB 2YIBA 3SJAC 2EBOA 2EX3A 1ZX3A 3SYCA 1AR5A 1KZNA 3HZ1A 3JD0A 1NVPD 1GO3F 1KD1W 3T1CA 1IBMB 5LMNB 3U2DA 2A7WA 4WUCA 4BQJA 2YI6A 1PVGA 4X20B 1UFIA 2WEPA 4KHPO 2H8PC 3BHPA 3W7UA 5LHHA 3X2QC 2JS5A 2AZ0A 3ZHRA 4L90A 1G4YB 1ZWIC 3QDDA 4DUZB 3ABLB 2D2CB 2XD6A 4DXWA 2XHTA 1Z5CA 3ABLC 4XKOA 1IBKB 1UYKA 2Y48A 4JI3O 4NH8A 1QNMA 4CE1A 4J7KA 1MU5A 3I55V 1R73A 3T0HA 4E72A 2ZXWB 5JCOC 1K7DA 1PNLA 3HEKA 3OGIB 2VW5A 1N4CA 5EIBD 2BYHA 1FXKB 1MMMA 1NBMG 1TVKB 3U0ZA 5F2VO 3DC5A 3TXQA 2ADQB 3K06A 1VF5B 4FPPA 3K5LA 1GKXA 3F7YC 3Q4HA 2ZE8A 1OCOB 4F6RB 1B06A 3E22A 1SRYA 4YKXA 4PA9A 1Y67A 2XOKG 2Y4TA 4YJ3A 1D5NA 3P32A 2JGDB 4WFGA 2YUAA 3C3TA 4JI8O 2RDCA 2ZINA 3HR0A 4LH7A 4MPCA 1ZUQA 2DE0X 5CB4B 1K9MW 5M4MA 4PDLA 2A9HA 4K35A 1GN4A 4PA7A 1ORQC 2Q9LA 1G1XB 2YDEA 4CE3A 2EZPA 1L1FA 2BE3A 2AW9A 2EINC 2W0XA 4E01A 3UT5A 1WN7A 4MS2A 3F7VC 2XHBA 4JI5O 4JI0B 2PYJA 3RVZA 3S5TA 3OMNB 5IYZB 1JJ2U 4B3TO 4IIJA 4UB6Z 1XL4A 1YTFB 4LF7B 3HYYA 1XUQA 2YS8A 4HY6A 3OR6C 2VWKA 4DR2B 1K8AW 3B40A 2YE8A 2UWDA 4LF9B 1UYDA 1YEWA 1G6UA 3IAYA 4KUMA 4HZ0A 1WAZA 2JVDA 4CWFA 2RMKB 4LFAO 5M4EA 1H2LA 3JSNA 4QPJA 4JYAO 5CTUA 4X62B 4DR6O 4X89A 1DF5A 1OCRB 4H0LB 2DMXA 4I4TA 5D7RA 1NU1H 2ITCC 4Q6GA 3UQ8A 4PA4A 3N2GA 5D6QA 3TUHA 3B25A 1H2GA 2IM9A 1XQ8A 3JD1A 2WI5A 3OEHG 4K0KO 4XBFA 3A0ZA 4CC5A 1HNWO 3Q5KA 4B3SB 1THNA 5GGZA 2DJVA 5KAIZ 4WFFA 2BSKB 2HP8A 5L3BA 4CWQA 2F23A 4PA3A 1KBHA 1F23A 4NXNB 3H01A 2XDUA 1S5LZ 4YJ2A 3WQ9A 2HJFC 1N32B 1Q82W 2N04A 3R4MA 1YJ9V 2YGAA 2E5LB 1VARA 3LNUA 1IBMO 5LMNO 3OMAB 1GMGA 1TH8A 2WLMA 1XBLA 1Q6HA 2CK3G 4EGKA 2Q8FA 1VQ6V 2X6CA 1BQ0A 4KSHA 3ZJZA 1YS3A 4EB6B 1HNXB 3AG2B 4BQGA 4UCTA 5JVDA 3AG2C 4WCEV 1XMOB 5ITZA 4LH6A 2GSMB 2BU6A 4DUZO 5CA3A 1QLNA 1AP6A 2CGNA 1IBKO 1RSOB 5B3SB 3CGYA 1VQ5V 5IE9A 5B3SC 1QVGU 3ZHQA 2DWEC 3ZRVA 2H55A 2Z3YA 5CA0A 1YITV 5D5QA 1EM1A 2N74A 5CMUA 2FYPA 2IOQA 1U97A 4O4IA 5JQGA 2FL4A 2YXYA 3P3PA 4P8OA 5EYPA 3ABTA 3G6EV 1B63A 2GHYA 3ZMTA 3OT7A 3WU2Z 3RYIB 1KP2A 2AZ2A 4G28B 3IEDA 1Z5WA 3E8GA 4K8ZA 1ZXNA 1SQFA 4OXSA 4JTDB 4EKWA 4JAAA 5C93A 1L0OA 1R6NA 4MVQA 5JJJB 4K4OA 5CTYA 2Q2EB 2MW2B 1BKNA 3ETGA 4AQYB 1EBOA 1RM1B 4RAIA 4B08A 3R65A 2IBZH 1HDJA 4DV6B 1DGSA 3HKCB 3CCQV 3ZCCA 4DRXB 4JZGA 5LYJA 1FS0G 1JA8A 4I50B 5J2UA 4JI0O 1BCCH 2JRIA 4DW1A 1KB9F 3QNEA 1XI1A 3K5MA 3T1YB 2WAMA 1GJVA 3SYPA 1BE3H 4NB5A 4LF7O 3CCEV 1AI7A 4BR6A 2NR5A 3CJHA 1VQOV 3FB5C 4C7UA 3OMIB 3KKYA 1UPGA 1FPOA 1I5YA 4DR2O 1YC4A 3BEHA 1CXZB 2UXCB 1GKZA 4P2ZA 2DOSA 4TV9A 4FLYA 4LF9O 1S72V 4DR3B 3D0BA 3SL2A 5ITZB 3E8HA 4H13B 1GTOA 1H38A 2BTQA 3U10A 4X62O 1HR0B 1ZL8A 3MHSC 1VQKV 1NVPB 3RLRA 5LP6B 5LP6C 2ZNIA 4Z1MG 3ICXA 4UB8Z 1UYMA 2QG2A 4V26A 2WLNA 4XITA 5HFLA 1H2MA 1QR8A 5M4KA 4XDLA 4O4HB 4B3SO 3CRMA 4FFBA 4LP8A 4X66B 3K0DA 3CWBH 3TETA 1Y8OA 3CD6V 4CH6A 4NXNO 4EGHA 1I5BA 4WFAV 1QR9A 3APQA 4HAMA 2JIZG 2JK5C 3JAWB 2CAZC 2E5LO 4FZ1A 3A0WA 5IWAB 5IY5C 1VQ4V 2QM7A 3NR7A 1QY8A 2OCCC 3W7TA 1ZW9A 4JPRA 4W4LA 3D3QA 1IDSA 3CC7V 1QHTA 5FPRA 4QIWF 4LF8B 3RLQA 5KHHA 3B09A 2XJXA 2XX2A 1ZSPA 5CA1B 3CS5A 5EIBC 5FNVA 1HNXO 3T4DA 2OYQA 4I55B 1XMOO 2V1DA 2Q8VA 1OCCB 2RN9A 3LDEA 5L3EA 2ZBKB 1OCCC 5KHIA 2LFSA 2YKBA 4ASAA 3CCUV 3T2MA 2RCVA 2HEPA 3FYIB 2B9ZA 4GYCB 1M56B 4NH7A 5H5NA 1M56C 4BIZA 5JWPA 1YTFD 3B2EE 2K1EA 2YC0A 1VEWA 1H7UA 4ABMA 1AH6A 4JI4B 2VWCA 2O1UA 3SR2C 1WA8B 3ETEA 2HG5C 1NH2D 5FLXN 4D6TH 4GT1A 1YHQV 1Z59A 4TWKA 5LXTA 2OCHA 4KSGA 4X1YB 1IXMA 4QE7A 2DN9A 3HPLC 4HY1A 3ZEDA 4NKGB 1AI5A 1XILA 1PNMA 3ZHUA 4BIOA 1AJQA 1Y74A 3ASOB 1OZ0A 2CH4A 3BAAA 1MX0A 4LFCO 1YVWA 1NQTA 1JCHA 4LWHA 1KP3A 3BA9A 4UV8A 1UYIA 4AQYO 1KECA 1XHZA 1UY8A 3H1HH 4WF9V 1ZLZA 4X8AA 1UY7A 3F5WC 4JYYA 2VQEB 1IBLB 3VQWA 1X59A 3B27A 2CGOA 2W0FC 4PI0A 3T1YO 1KKCA 4O07A 1XREA 3T4ZA 3VQVA 5EBMC 3J81N 4ZKIA 1YT1A 1HWYA 1WJZA 1NTZH 4GQTA 1A32A 4L8JA 1K4CC 1NHIA 3H9VA 3D2RA 4CS3A 2F95B 4GFNA 2UXCO 4DR3O 2YEJA 2BTZA 2UXBB 3CRRA 2Y0IA 2H94A 3HKDB 1VQMV 4U7OA 5E79Z 4DV3B 2UXDB 3RKZA 1O9GA 3S3WA 4EEQA 4X1KB 3OEEG 3TJTA 4URLA 3A0TA 2YE3A 2YGFA 2ZT9B 4F6EA 5B66Z 3JAMN 1Q8IA 3MHHC 3K03A 4PI2A 3OPDA 4IGGA 2YECA 4EFUA 4X66O 2IJIA 4MW8A 2O57A 5DN6G 1DK1A 4DR5B 1IX9A 3JD4A 4JTAB 1W0KG 3B4SA 5GONA 2WI1A 4LWIA 5JH7B 1MSDA 4U3FH 1K92A 4X9LA 3ZXQA 5IWAO 3LDDA 1YERA 5LGUA 4DR7B 2O1VA 2QSAA 1V54B 1EN6A 4JAUA 2XDXA 1I08A 5A9GA 4PU9A 4LF8O 2Y4UA 1ROPA 1EN4A 1FFXA 1UYCA 3ZN1A 2UUBB 1K5SA 1A4HA 2IU0A 1FYJA 4KP4A 5B5EZ 1I5CA 3FFQA 1IXBA 4MVOA 1GM7A 2FTKA 3M7MX 3CSXA 4EFEA 2A0LA 2CTRA 4DV0B 2P4KA 4RO2A 5JCOA 2B1GA 4LF4B 1GRJA 4KFGA 1TUBA 2F93B 2JS3A 1AP5A 2EXLA 2ZR2A 1BQZA 2G38A 2QWNB 3GIFA 4BWAA 4EFTA 2QG0A 4FJCC 3G7BA 2Q8GA 5KHGA 4JI4O 2JKIA 2BSMA 2ATKC 3JSLA 1S16A 3K79A 2CH7A 1M9NA 3FKSG 2F43G 3LSUA 1ID0A 2YKJA 2YE2A 1J95A 2JJ1G 3SPIA 1OSFA 3HKEB 1SETA 2F4VB 3AK3A 3PEHA 4KQVA 2CCUA 1SS3A 4N21A 4FVMA 3THOA 2XJGA 3HKBA 3LDCA 2QA4V 3FAVB 5B1OA 2KG7B 2ZE5A 3WB1A 4O2BA 4CWTA 2WLIB 1NKDA 4DR1O 4WBNB 4FM0A 3OUSA 1M4UA 2YI8A 2R9IA 4HZ5A 3ZHSA 3OD4A 4UCOA 2PI4A 2BZ5A 3P3NA 4LNUA 1R3KC
chains in the Genus database with same CATH topology
3OGCC 4PA3A 1F23A 3H01A 3E86A 1V55B 4MVRA 2NLJC 2HJFC 4WFBV 4FIPC 1Q82W 2YEVB 1YJ9V 4FMTA 4HZ3A 3OMAB 1GM9A 1F4NA 3K9AA 2WSSG 1GMGA 2WLMA 2CK3G 5LHIA 2JDIG 1YJNV 2HKOA 2LP7A 2EJRA 4MT8A 2LFRA 3K3WA 2W6JG 2ZD9A 3D3IA 4JGSA 3P30A 1VQ6V 2X6CA 3PJSK 1MG1A 2ZXWC 1Y4MA 3ZJZA 1UJWB 1YSCA 2WLLB 3AG2B 1M1KW 1FXKC 2JEUA 3AG2C 4WCEV 4I5SA 1VQ8V 3GWOA 2JEXA 4UXNA 5L3CA 2GSMB 3M99B 4F4LA 5IY5B 1JX9A 3QO5A 4ZBMA 5CA3A 1QLNA 1MOFA 2XAHA 1OCZB 1OCOC 2KB1A 2OCCB 4G2KA 5B3SB 3STZC 3EHBB 1VQ5V 3SPGA 2ZR3A 3STLC 5B3SC 1QVGU 2HFEC 4MTXA 2DWEC 3ZRVA 1G8MA 1VQPV 1SERA 1K33A 5EC2C 4JAVA 3LSSA 3KG2A 1FXHA 5LGTA 2Z3YA 5KUMA 1YITV 1VQNV 1AROP 1V54C 3RVYA 5CMUA 3FYEB 2ZDIC 4R6ZA 3HB3B 3OM3B 5IYBO 4JYBA 2XAGA 1WPXA 4UUJC 1JOYA 4UV9A 1GM8A 3ABTA 3G6EV 3CYOA 2GHYA 3CMAV 3ZMTA 1QCEA 1KP2A 4G28B 3E8FA 3E8GA 4JF3A 3JYCA 4OXSA 4R7CA 4JTDB 5EC1C 1Q86W 2B5UA 2ZQMA 5EBLC 4EKWA 1COWG 5C93A 2XAFA 4MVZA 1R6NA 2XAQA 4N23A 3SPJA 2P67A 3IGAC 3UKMA 4MVQA 3AG4B 3SPHA 3VBBA 3AG4C 3CP1A 2DYRB 1QLEC 5EBWC 3ETGA 3A0RA 1FXKA 1AI6A 1EBOA 3OUFA 1VQLV 1RM1B 4RAIA 2IH1C 3R65A 3CCQV 1SESA 3ASNB 3ZCCA 3ASNC 4P9PA 1NH2B 1KC8W 5FL7G 3ZRSA 1FS0G 3AG1B 1WLEA 2X0LA 1BMFG 1R6KA 1BL8A 2OT5A 3QNEA 3WFVA 5CBFA 4TT3G 3W7XA 1BHBA 1AR1B 3QO7A 3ML0A 3E83A 5H9CA 1OCRC 2WAMA 2UXNA 3SYPA 1N8RW 2ZDIA 3CC2V 3CCEV 1S76D 1AI7A 5B1BB 3D36A 2QE7G 4QE9A 1VQOV 1CEZA 5B1BC 2EIKB 4UVCA 3FB5C 2EIKC 2UXXA 2X6BA 3OMIB 5CN0A 1I5YA 1MSWD 3BEHA 3AG3B 4CBCA 2IJJA 4P2ZA 1S72V 2Z5UA 3JD2A 1XL6A 5CBHA 2EIMB 1CPYA 2WLKA 2WPDG 3E8HA 2EIMC 2IW5A 1GTOA 3MD0A 4XDJA 1H38A 4MTGA 4WFHA 4BIUA 2HLDG 3MHSC 1VQKV 1V55C 1NVPB 4H37A 4X88A 5LGNA 4PDMA 4BW5A 4Z1MG 3K08A 4MVUA 3B8MA 1MABG 1AJNA 5KA5A 2WLNA 1E1QG 5B1AB 3E2EA 1FFTB 3QO8A 2DWDC 2Y69B 5B1AC 1QR8A 5HFLA 3ZMZA 4XDLA 2Y69C 3OW2U 3ZMUA 3X2QB 4LP8A 1S0VA 1RPRA 3K0DA 5H6QA 3TETA 4GX5A 4UVBA 3CD6V 4MW3A 3E89A 3LUTB 1QR9A 4E2LA 4WFAV 2OTLV 1M57B 1F51A 1OHHG 2JIZG 2JK5C 2EIJB 4HAMA 3W7SA 1YI2V 2BOCC 2EIJC 4P30A 4MVSA 5IY5C 1VQ4V 3ZRWA 2ITDC 2QM7A 2DQ3A 1K3EA 1OCZC 2IU3A 1H8EG 3DTUB 3NXSA 2OCCC 3W7TA 1TUEB 2WLIA 3ZMSA 1DLBA 1R3IC 2M7WA 4JPRA 1P4RA 3CC7V 4JASA 4I9WA 2HVJC 4QIWF 1BHAA 4QJFB 3K0GA 4LC1A 5H6RA 4KFMA 1F4MA 2JJ2G 2WLHA 2PI5A 2XAJA 3T4DA 1THZA 2BOBC 3JCZA 2DQ0A 5KUKA 2V1DA 3EFFK 1OCCB 2QKSA 3LDEA 2P90A 5B1NA 5L3EA 1OCCC 3JD3A 1VQ9V 3CXCU 2YEVA 3I56V 2LFSA 4MTFA 3CCUV 3LSQA 3SYAA 3T2MA 2NNUA 2QM8A 4QNHB 1P7BA 1B6QA 2MK3A 1SZTA 3FYIB 2XNDG 3UM7A 5LHGA 1M56B 5KA6A 4MTOA 3ETDA 4PA6A 1M56C 4BIZA 1YTFD 2K1EA 2Q6AA 3E35A 4H33A 4LCUC 4PELA 1KKDA 5GW7A 2DYRC 2WLLA 2EINB 2X6AA 3ETEA 3TK1A 1LNQA 2HG5C 5HFMA 2Q68A 2X7RB 1RM1C 1NH2D 2DW4A 4BAYA 4LBEC 3SPCA 4GT1A 3FB6C 1YHQV 4TWKA 2A79B 5E1AC 4GCZA 2Q69A 3SYQA 1IXMA 4QE7A 3AG1C 3CPWU 1NJIW 3HPLC 4RQEA 1PD3A 5EK0A 1Q81W 1GK9A 4P9OA 2WLJA 1AI5A 1EFRG 1PNMA 2EILB 1ENVA 1AJQA 3ASOB 1OZ0A 4R8CA 2EILC 3ZN0A 5IDJA 1M90W 3CCRV 1NQTA 1GKFA 1JCHA 1KP3A 4UV8A 3ABKB 1R3JC 1E79G 2IH3C 2R9RB 1YJWV 5L3FA 1KECA 2C2AA 3ABUA 1AJPA 1YIJV 3AEIA 4JYCA 4YXWG 2Q67A 1I5XA 3B8NA 4ASUG 3B77A 4RQFA 4WF9V 4RUEA 4X8AA 3AG3C 2V7QG 3F5WC 2EBOA 1FXVA 2YSUB 3SYCA 5J9PC 3CCSV 1S77D 3DGEA 3JD0A 1NR7A 1PKXA 2WWWA 1NVPD 1QVFU 1GO3F 2AHZA 1KD1W 4MSWC 3T1CA 4J9ZB 3W7WA 1EZJA 1H8HG 2W0FC 1JVMA 4J9YB 3T4ZA 2IJKA 1K34A 5EBMC 1JQ0A 4ZKIA 5IYDO 1HWYA 1CP9A 5CBGA 1K4CC 3IFXA 3LNMB 2H8PC 4U7NA 2QTOA 2P7TC 3W7UA 5LHHA 3X2QC 4PDVA 3FB8C 2AHYA 3RBZA 2H94A 3ABMB 1VQMV 4U7OA 1G4YB 3ABMC 1ZWIC 1AI4A 4L87A 3ABLB 4DXWA 2OTJV 3OEEG 3ABLC 3CCMV 1K5QA 1M57C 2W6IG 1KQSU 4DO2A 2Y48A 2D3OW 3I55V 1R73A 2ZXWB 1K7DA 1PNLA 3OAAG 3MHHC 3K03A 1PL0A 3FB7C 3ZRXA 1FXKB 2IJHA 1NBMG 2IJIA 4MW8A 5DN6G 5BZBA 3K06A 3JD4A 4FPPA 3GB7C 4JTAB 3K04A 3F7YC 1W0KG 1RPOA 3E8BA 1OCOB 2HR3A 1S3JA 1K92A 4GX0A 3SYOA 1SRYA 2XASA 4PA9A 2EZOA 2XOKG 3LDDA 1VQ7V 3OFNG 3P32A 5LGUA 4RUFA 4WFGA 1W2BU 1V54B 1E1RG 1Y66A 2B1IA 4JAUA 1K9MW 4PDLA 2A9HA 1ROPA 4PA7A 1ORQC 4MVMA 3ZN1A 1K4DC 1K5SA 2IU0A 4R50A 4KP4A 2EZPA 1L1FA 3G71V 3SJQC 2EINC 3TCUA 4MVOA 1GM7A 4TSFG 5L3DA 2FTKA 3BY6A 4MS2A 3F7VC 2A0LA 2P6JA 2HVKC 3RVZA 3CCLV 4QPKA 3OMNB 4RO2A 4UVAA 1JJ2U 2B1GA 4FK5C 3ZMVA 1QBZA 1XL4A 1QLEB 1YTFB 5DM6V 1DTOA 2ZR2A 3ASOC 4FJCC 3OR6C 4JTCB 1NR1A 2ATKC 1K8AW 3ABKC 3K79A 4XDKA 5L3GA 1M9NA 3FKSG 2F43G 3OR7C 3CMEV 3CCVV 4PDRA 3RW0A 2QEXV 4KUMA 1K97A 4Q20A 4GX2A 1PNKA 4WFEA 3OE7G 1J95A 1JPXA 1R3LC 2JJ1G 3SPIA 4QPJA 1SETA 3IC7A 1Q7YW 1K73W 4X89A 1DF5A 1OCRB 5LBQA 3CCJV 3CC4V 4N21A 2DYSB 2DYSC 2ITCC 1DF4A 3ZRWB 4PA4A 3LDCA 2QA4V 3WG7B 5B1OA 4GX1A 4CZZA 4HYOA 3WG7C 1H2GA 2WLIB 1S5HC 1NKDA 3JD1A 3OEHG 5IYCO 3OUSA 2R9IA 4XBFA 4G27B 3G4SV 2PI4A 3ZIAG 3VOUA 4WFFA 1W0JG 5L3BA 1R3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QPJ A;  4JAS A;  4U7N A;  3ZRX A;  3DGE A;  2P67 A;  3MD0 A;  4JAU A;  4BIZ A;  2WWW A;  4LC1 A;  4BIU A;  4I5S A;  5IDJ A;  4U7O A;  4JYB A;  4FPP A;  3A0R A;  3ZRW B;  4FMT A;  1F51 A;  1JOY A;  3D36 A;  5B1O A;  4KP4 A;  5B1N A;  3TK1 A;  3ZCC A;  2C2A A;  2LFS A;  4ZKI A;  4GT1 A;  3ZRW A;  2QM7 A;  2FTK A;  4JYC A;  2QM8 A;  3NXS A;  4MT8 A;  2LFR A;  4Q20 A;  3P32 A;  4MTX A;  3ZRV A;  4GCZ A;  1IXM A;  4JAV A;  4QPK A;  5C93 A; 
#chains in the Genus database with same CATH topology
 1ZWH A;  2Q7G A;  2IOP A;  2VQE O;  2RQ6 A;  1IBL O;  4B3R B;  1YC1 A;  2YEV B;  3ZS8 C;  5JJN B;  4CWR A;  4HZ3 A;  2GTS A;  3TZ0 A;  2ZCE A;  2WSS G;  2WI2 A;  5LHI A;  2LGQ A;  5LA6 B;  3K5N A;  2HKO A;  2LP7 A;  1VF6 C;  4I0X B;  4Z2W A;  4GT8 A;  2OIE A;  3CXH F;  1BS3 A;  1Y4M A;  2ZXW C;  1AM1 A;  3IJ4 A;  1FXK C;  2JEU A;  4CH5 A;  1VQ8 V;  4I5S A;  3GWO A;  4FLZ A;  4UXN A;  5L3C A;  3GIG A;  4DV3 O;  3CWV A;  4CWS A;  2UXD O;  1I59 A;  1OCZ B;  1OCO C;  3OWD A;  1YSR A;  4G2K A;  2YKC A;  1GN6 A;  3STZ C;  4MB9 A;  3BPZ A;  4GUN A;  2L6L A;  1G8M A;  1SA0 A;  1VQP V;  1SER A;  5D7C A;  3UCS C;  4JAV A;  3LSS A;  2YIC A;  3KG2 A;  3JAK A;  5CTW A;  1VQN V;  1BGY H;  3MAQ A;  4DV2 B;  1ARO P;  3LPS A;  4Z1V A;  4J7Z A;  4R6Z A;  1TC0 A;  2XAG A;  4DR5 O;  1JOY A;  3BFR A;  4UV9 A;  1GM8 A;  3CYO A;  5LOV A;  4L94 A;  1QCE A;  2YE7 A;  4ZHQ A;  3RWR D;  3JCU Z;  3MDS A;  4PD4 F;  2FXS A;  2YGE A;  4JF3 A;  3JYC A;  1YCI A;  4R7C A;  3TZ5 A;  4AWO A;  1VMG A;  5EBL C;  1AIL A;  1VF7 A;  4J41 A;  2GUZ A;  5BXZ A;  3UKM A;  1BYQ A;  3AG4 B;  3SPH A;  3AG4 C;  2VWJ A;  2YI5 A;  3CP1 A;  2DYR B;  1TC6 A;  1MA1 A;  1AI6 A;  4O0B A;  1B04 A;  3OUF A;  1Y76 A;  2IH1 C;  2PUS A;  2UUB O;  4MPE A;  1SES A;  3ASN B;  3CB2 A;  5KMG A;  2UUA O;  3ASN C;  4P9P A;  4TQD A;  1NH2 B;  3GIE A;  5FL7 G;  1NI8 A;  2RJZ A;  4ZVI A;  3ZHT A;  3EHH A;  2EUL A;  1WLE A;  4XIQ A;  3RT3 C;  5FNF A;  1BL8 A;  5KX5 A;  3WFV A;  5CBF A;  1BHB A;  3K98 A;  1H2K A;  4LF4 O;  1OCR C;  1QZR A;  5B1B B;  2P22 C;  5B1B C;  1I5D A;  5FNC A;  2EIK B;  3N27 A;  2EIK C;  1Q43 A;  1Y8P A;  2FYU H;  1FAF A;  3AG3 B;  4O4L A;  2IJJ A;  4MP2 A;  2AGA A;  2Z0A A;  1N0N A;  3JD2 A;  4GZR B;  5CBH A;  4ZI7 A;  4DR4 B;  2XDK A;  2WI4 A;  2R72 A;  3Q4H B;  4MTG A;  4K8X A;  3T10 A;  2F4V O;  2AKP A;  4XCJ A;  2HLD G;  3E22 B;  1BXD A;  3RFR A;  3N2K A;  3HZ5 A;  5BY1 A;  4YJ3 B;  3QTC A;  4PDM A;  4BW5 A;  3INW A;  3G7E A;  3RYF A;  1MAB G;  2BYI A;  1E1Q G;  3QO8 A;  3K58 A;  4H7Q A;  3OW2 U;  5D7D A;  3TXS A;  4FCQ A;  4MBC A;  5FWK A;  4AS9 A;  2BRE A;  5H6Q A;  4GLX A;  5KHK A;  2XK2 A;  1PV0 A;  1NHH A;  4HXW A;  4FM1 A;  3E89 A;  3JAS A;  4LF6 B;  4E2L A;  2OTL V;  1M57 B;  1OHH G;  4YY3 B;  2CTP A;  3UT5 B;  3W7S A;  4B3R O;  2BOC C;  2ZE7 A;  3ZX6 A;  2EJ7 A;  3ZRW A;  1IZ3 A;  4UFZ A;  4JI2 B;  1TUE B;  4IIJ B;  1LR1 A;  2QKA A;  4MOT A;  1YC3 A;  3T2S A;  1KMI Z;  4CWN A;  4I9W A;  2HVJ C;  4XC0 A;  4LFB B;  4PHZ A;  3RLP A;  4A5U B;  2PI5 A;  2IWU A;  2XAJ A;  1THZ A;  1B3Q A;  2P4V A;  3JCZ A;  5KUK A;  4LWS A;  5B1N A;  4W7T A;  1BSM A;  4IYH A;  1VQ9 V;  3VHA A;  3CXC U;  1YF2 A;  4MTF A;  3LSQ A;  3K99 A;  3SYA A;  3RYH A;  4QNH B;  1P7B A;  3EKR A;  4XD8 A;  2YEF A;  2HHI A;  4YKR A;  2MK3 A;  1H2S B;  1SZT A;  2XND G;  4NR1 A;  1S5J A;  4I4T B;  4DV4 B;  1L8D A;  3ETD A;  5M4N A;  3FT5 A;  3N2G B;  2XAB A;  4DV2 O;  1SZX A;  4L91 A;  3E35 A;  4H33 A;  4BW9 A;  1Z5B A;  3SJB C;  4PEL A;  3JAT A;  5GW7 A;  4DV5 B;  2NN4 A;  2WLL A;  1WP8 A;  5KLV H;  2BU7 A;  3CRK A;  1LNQ A;  1RM1 C;  3KCX A;  4BAY A;  2K5B A;  3FB6 C;  1SQX H;  1SQB H;  2XTA A;  5BR8 B;  3SYQ A;  4YJ2 B;  3K59 A;  3H1J H;  1NJI W;  4YKU A;  1O9H A;  5EK0 A;  1GK9 A;  4P9O A;  2GFD A;  5D6P A;  1EFR G;  2EIL B;  2PZS A;  2EIL C;  1M90 W;  1Q6I A;  2L35 A;  1I94 B;  2YEH A;  3EHF A;  5J2T A;  3FX7 A;  3ABK B;  1KYO F;  4U3J A;  2IH3 C;  3CRA A;  3T1K A;  1YJW V;  5L3F A;  1YIJ V;  2XHR A;  4E4E A;  2Q67 A;  1R62 A;  3B28 A;  3TGU H;  1JMK C;  4RUE A;  2ZDX A;  4GGL A;  2V7Q G;  5JVD B;  1FXV A;  2YSU B;  5J9P C;  2R9A A;  1EN5 A;  1ZTE A;  3VHD A;  5JEN A;  2FB5 A;  1SQV H;  2ZKJ A;  4XKA A;  4O2A A;  1QVF U;  1AVM A;  2AHZ A;  4J9Z B;  3W7W A;  1EZJ A;  1GN2 A;  2BCC H;  1H8H G;  1JVM A;  4DUH A;  4TUY A;  2E75 B;  4YKY A;  2IJK A;  2KSD A;  3K5O A;  2YEE A;  4NVP A;  1JQ0 A;  2N05 A;  5JJE B;  1NTK H;  1YET A;  5CA0 B;  4LWE A;  3CHX A;  5CBG A;  4YHH B;  3IFX A;  2HHH B;  4XIR A;  1XDC A;  3LNM B;  4BXI A;  2UU9 B;  2E76 B;  2KKW A;  4O4I B;  4U7N A;  5JQG B;  2Q7E A;  4PDV A;  2CE4 A;  4IYI A;  4DR4 O;  2LJ2 A;  5EYP B;  3RBZ A;  2Q0O C;  3ABM B;  4FM2 A;  3ABM C;  4J10 A;  4L87 A;  5C8Y A;  4AIL C;  1N32 O;  2OTJ V;  3OWB A;  1K5Q A;  2HJD A;  5DED A;  3PEJ A;  4O4J A;  3SDL A;  1WPB A;  1I7F A;  4I7Z B;  2ARH A;  2HG1 A;  2WI3 A;  3R92 A;  3JAT B;  3R4O A;  2YIA A;  4XIP A;  2HKJ A;  5BZB A;  1UYF A;  1QQC A;  2LQT A;  3VQX A;  3JAR A;  1RPO A;  3E8B A;  4LF6 O;  2Y0P A;  5LYJ B;  2YIB D;  2HR3 A;  1S3J A;  4GX0 A;  4ZIB A;  4H44 B;  3VQY A;  3BM9 A;  2VCI A;  5J2U B;  3CE2 A;  2EZO A;  2ZNJ A;  1VQ7 V;  3OFN G;  4J42 A;  4H81 A;  5IJ9 A;  4JI2 O;  1E1R G;  5J2T B;  2OIG A;  3JAL A;  2VCJ A;  4YKT A;  3CJH B;  3DXR A;  4LFB O;  4MVM A;  2Q8H A;  2CTW A;  4KTN A;  4DV7 B;  2XX4 A;  4R50 A;  3K57 A;  2ZIM A;  3G71 V;  4TV9 B;  2LW1 A;  2BTQ B;  2HVK C;  3UO2 A;  1ZL8 B;  4HYP A;  4UVA A;  3IC9 A;  3ZMV A;  2VQF B;  1HNZ B;  1QLE B;  1XOU A;  3NMQ A;  3ASO C;  1PM9 A;  1NR1 A;  3RGB A;  4XDK A;  5L3G A;  3OR7 C;  3CME V;  5F5R A;  4FFB B;  4DV6 O;  1I0H A;  2QEX V;  1K97 A;  2QDO A;  4R3M A;  4WFE A;  3OE7 G;  4URN A;  1JPX A;  5BR8 O;  1K73 W;  1JJO A;  5LBQ A;  3CC4 V;  1ZXM A;  4X9Q A;  2DYS B;  3K97 A;  3LNN A;  2DYS C;  2PGG A;  1DF4 A;  3WG7 B;  1I94 O;  4GX1 A;  4CZZ A;  3H4L A;  5K1X A;  3WG7 C;  1S5H C;  1MNG A;  1D2D A;  2Q73 A;  1UYE A;  3G4S V;  1URF A;  1SC5 B;  2ADP A;  4EFB A;  5FNV B;  3OGC C;  3AK1 A;  3E86 A;  1V55 B;  3ZBH A;  5DEC A;  4D7S A;  3WHA A;  4IHJ A;  1HR0 O;  3RYC A;  3VHC A;  1GM9 A;  1F4N A;  3K9A A;  2JDI G;  1YJN V;  4MT8 A;  4GKJ B;  2LFR A;  1P7G A;  2ZD9 A;  3D3I A;  4JGS A;  3P30 A;  4HXZ A;  1JFF A;  5BMV A;  4YHH O;  1XHX A;  4X1I A;  2HHH O;  3R4P A;  4PRV A;  2UU9 O;  5EZY A;  1M1K W;  3K9S A;  1EA6 A;  1R1B A;  2ILM A;  4F4L A;  1JX9 A;  5LXT B;  3QO5 A;  1MOF A;  2CDY A;  2KB1 A;  1TBW A;  1BT8 A;  3SPG A;  2ZR3 A;  3STL C;  4BAE A;  3U2K A;  4MTX A;  4X20 A;  3FT8 A;  3LMM A;  2A06 H;  1Y74 B;  3O9O A;  5LGT A;  4EEH A;  1JM6 A;  4P7A A;  3U11 A;  1MZF A;  1V54 C;  4PV1 B;  3RVY A;  2ZDY A;  1Z2G A;  2ZDI C;  3HB3 B;  5IYB O;  3D36 C;  2GDS A;  4URM A;  1WPX A;  3M8A A;  1XMQ B;  4UUJ C;  2WI6 A;  4AI8 A;  3B24 A;  3CRL A;  3CMA V;  3E8F A;  1SQQ H;  4XKK A;  4L8Z A;  5LMU B;  3CRQ A;  5EC1 C;  1Q86 W;  2P06 A;  2CUG A;  1Q3E A;  3OTF A;  2Q7H A;  2XAF A;  2YE4 A;  3BCC H;  4N23 A;  3SPJ A;  4B7E A;  2YEG A;  1P49 A;  3VBB A;  3D8C A;  4E00 A;  1FXK A;  1TVK A;  1VQL V;  3A0H Z;  4DV7 O;  4XDM A;  1KC8 W;  2F1M A;  4CC6 A;  3ZRS A;  2Q8I A;  3SJC C;  4F6R A;  3AG1 B;  1N36 B;  3O6O A;  4X64 B;  1BMF G;  1P84 F;  4D7T A;  1R6K A;  4KXR A;  2OT5 A;  3W7X A;  2JGD A;  1EZV H;  1X4T A;  3QO7 A;  3ML0 A;  3E83 A;  2VQF O;  2UXN A;  3BRC A;  1S76 D;  1N33 B;  5CB4 A;  1U2O A;  4WUB A;  3H1L H;  3SGI A;  1U96 A;  1JFF B;  5CN0 A;  5IN9 A;  1PL4 A;  1N34 B;  2ESA A;  1MSW D;  4CBC A;  2Z5U A;  4B7K A;  1CPY A;  2WPD G;  2IW5 A;  3MD0 A;  5GON B;  4BIU A;  3C11 A;  4X65 B;  5IYZ A;  4NTY A;  4OPA A;  1L0N H;  1WP7 A;  3L73 H;  4H37 A;  5LGN A;  4FCR A;  2CGF A;  2Q0A A;  4MVU A;  1AJN A;  5KA5 A;  3E2E A;  1FFT B;  1Q5O A;  2DWD C;  3CX5 F;  3ZMU A;  3X2Q B;  1FFX B;  1S0V A;  1KIJ A;  3G80 A;  1PP9 H;  1RPR A;  2VS0 A;  4LP0 A;  2C1G A;  4GX5 A;  2YKI A;  3C3S A;  4EM7 A;  4MW3 A;  3A0B Z;  2UXB O;  1Q6U A;  2XCM A;  3QTF A;  3LUT B;  2ZM6 B;  2FML A;  4PL9 A;  4O05 A;  2EIJ B;  1YI2 V;  2EIJ C;  4EMV A;  4P30 A;  4MVS A;  4B3M B;  4FFK A;  3MNR P;  2DQ3 A;  1OCZ C;  2IU3 A;  1H8E G;  2A3Q A;  2GTA A;  3B26 A;  3BMY A;  1TUB B;  4OX9 B;  1SKV A;  3QG5 A;  3ZXO A;  2YEB A;  4GKJ O;  1DLB A;  2UUC B;  4YKZ A;  1P4R A;  4JAS A;  1BHA A;  2RNB A;  3WB0 A;  4QJF B;  3K0G A;  4EGI A;  2BSK A;  3A0Y A;  5H6R A;  4KFM A;  4LWF A;  1F4M A;  1HP8 A;  2XT9 A;  4PRX A;  2CH7 B;  1XNR B;  1J5E B;  3EFF K;  3UO3 A;  2QKS A;  3T1H B;  1AB3 A;  1VP7 A;  4JI7 B;  2CTQ A;  2NNU A;  2QM8 A;  3QF7 A;  2BU2 A;  1B6Q A;  4GKK B;  4AWQ A;  4MTO A;  2HCH A;  4PA6 A;  4DR7 O;  2JJC A;  4JV5 B;  3HKB B;  3R66 A;  2XJJ A;  3TZ2 A;  2Q6A A;  1SF9 A;  4O2B B;  2M6Y A;  3BAB A;  4J11 A;  1YT0 A;  4IL6 Z;  4HNA A;  1KKD A;  4H85 A;  4EB6 A;  1IVS A;  2XHX A;  2DYR C;  2EIN B;  2X6A A;  2BRC A;  4CH3 A;  1XMQ O;  1TGO A;  4UCV A;  4XE2 A;  2Q68 A;  2X7R B;  4LNU B;  1IUR A;  2GV9 A;  4KL1 A;  2A79 B;  3H80 A;  4LF5 B;  2Q69 A;  4JZ2 A;  1AH8 A;  5LMU O;  1RSO A;  5FPO A;  3A2F A;  4DV0 O;  1PD3 A;  1UYH A;  2YJW A;  3O2F A;  2YJX A;  2WLJ A;  3DC6 A;  2H3O A;  1ENV A;  2QTS A;  1EI1 A;  4DYL A;  4R8C A;  3ZN0 A;  5IDJ A;  4LWG A;  3CCR V;  2YK2 A;  1GKF A;  2PNR A;  1YDX A;  5H2F Z;  3K60 A;  1R3J C;  2R9R B;  2C2A A;  3J80 N;  4L93 A;  4YXW G;  1Y4S A;  3B8N A;  1TIL A;  4RQF A;  2OWO A;  2E74 B;  3RYI A;  3AG3 C;  1N36 O;  1BZK A;  4V25 A;  3VAD A;  1S77 D;  3CCS V;  4X64 O;  3DGE A;  3GIG B;  1NR7 A;  1PKX A;  2WWW A;  2CG9 A;  4MSW C;  2ZKO A;  3OTO B;  4J9Y B;  4ZOL A;  4UCS A;  3DSQ A;  1N33 O;  1SA0 B;  1K34 A;  4FLV A;  5IYD O;  1CP9 A;  3JAK B;  3HKC A;  1UYL A;  1YXB A;  1N34 O;  2WI7 A;  2LGW A;  4DRX A;  2QTO A;  4E02 A;  2P7T C;  2QKC A;  4I50 A;  3FB8 C;  1LUW A;  2AHY A;  3EHJ A;  5LOV B;  2IOR A;  4NH9 A;  4ZHQ B;  1AI4 A;  3EVK A;  4FLX A;  4X65 O;  4W4K A;  2YE9 A;  1NS1 A;  3CCM V;  1U0Z A;  5KAF Z;  1M57 C;  4CE2 A;  2W6I G;  4NXM B;  3O65 A;  1KQS U;  4DO2 A;  1H7S A;  3PN1 A;  2LO1 A;  2D3O W;  5LL6 Y;  2GUZ B;  5D5P A;  4YIO A;  2YE6 A;  3OAA G;  1PL0 A;  3FB7 C;  4HNA B;  3ZRX A;  1OV9 A;  3INX A;  2IJH A;  1Y76 B;  5KMG B;  3GB7 C;  3K04 A;  1XNQ B;  2ZM6 O;  3SYO A;  5TIS Z;  2XAS A;  1KUQ A;  5LP6 A;  5KX5 B;  4B3M O;  4JI6 B;  4RUF A;  1W2B U;  1LUV A;  4RWU A;  4OX9 O;  1Y66 A;  2V4D A;  2UUC O;  2B1I A;  2ETN A;  1OJH A;  4O4H A;  3A0X A;  1K4D C;  4FLW A;  4CS4 A;  4O4L B;  1XNR O;  1JR9 A;  3G75 A;  1J5E O;  3SJQ C;  3TCU A;  3T1H O;  2BTO A;  4TSF G;  5L3D A;  4DUY B;  4ZI7 B;  3JAW A;  3BY6 A;  1YSZ A;  2P6J A;  2PYL A;  4JI7 O;  3O0I A;  3CCL V;  4QPK A;  1GH6 A;  4PJ0 Z;  1Y4U A;  4FK5 C;  3N2K B;  4GKK O;  1QBZ A;  4ZOL B;  5IT9 N;  4LFC B;  3EKO A;  5DM6 V;  1DTO A;  2GQP A;  1F7Y A;  1HW7 A;  4JV5 O;  3RYF B;  2AXT Z;  2BU5 A;  1UY9 A;  4ICG A;  3J7A U;  4JTC B;  5CA1 A;  3Q5L A;  1ZAU A;  1NT2 B;  3I5D A;  3ABK C;  4I55 A;  5F3K A;  3CCV V;  4PDR A;  3ETQ A;  3RW0 A;  2XDL A;  4Q20 A;  4GX2 A;  3HHU A;  1PNK A;  5BOC A;  4MPN A;  1R3L C;  4LF5 O;  5CTX A;  1UY6 A;  3IC7 A;  1Q7Y W;  3JAS B;  4TV8 A;  1H2N A;  1R6T A;  2QWQ B;  3CCJ V;  1Y8N A;  2YED A;  4DV1 B;  2PF4 E;  3ZRW B;  4ASG A;  4QGP A;  1AR4 A;  1GAX A;  4HYO A;  5IYC O;  2E3C A;  4G27 B;  1WA8 A;  1KU9 A;  2KQX A;  3ZIA G;  3C0E A;  3VOU A;  1W0J G;  5AG2 A;  4OGQ B;  3ZKB A;  4X1Y A;  3ZM7 A;  4MVR A;  2NLJ C;  4LWS B;  4WFB V;  4FIP C;  1VIB A;  4FMT A;  3RYH B;  4CH4 A;  2PTM A;  3OTO O;  2VRZ A;  3EHG A;  4J80 A;  3L71 H;  2EJR A;  4B7P A;  4FZ0 A;  3K3W A;  2W6J G;  5GTI Z;  3GWK C;  3L74 H;  2YE5 A;  1S14 A;  2XUM A;  3PJS K;  1MG1 A;  4OPH A;  3ZKD A;  1FJG B;  1UJW B;  2ODM A;  1YSC A;  2WLL B;  1WB7 A;  4J7J A;  2JEX A;  3C90 A;  4U93 A;  3RN4 A;  3M99 B;  5IY5 B;  2Q4P A;  4YKQ A;  4NYK A;  1RP3 B;  2F66 C;  4ZBM A;  2IWX A;  4URO A;  2XAH A;  4AHC A;  4YY3 O;  2OCC B;  3EHB B;  4NXM O;  2WER A;  2HFE C;  3BVO A;  2BU8 A;  1K33 A;  4NTW A;  4LPB A;  5EC2 C;  4CS2 A;  3L9D A;  1FXH A;  5KUM A;  1YES A;  1TAE A;  3FYE B;  2PY5 A;  4U3J B;  3OM3 B;  4JYB A;  5L3J A;  4YIP A;  3HKD A;  4AWP A;  1XNQ O;  1Q90 D;  3R91 A;  2WA4 A;  4X1K A;  3L72 H;  4TV8 B;  3CEI A;  3KCY A;  1UYG A;  4FLU A;  5IJ0 A;  2B5U A;  2ZQM A;  4JI6 O;  2QF6 A;  2GBO A;  1COW G;  4O2A B;  3U67 A;  4MVZ A;  2XAQ A;  3AK2 A;  2P67 A;  3IGA C;  2LW7 A;  1FD9 A;  4TUY B;  4CWO A;  3GVM A;  4DV4 O;  4DK1 A;  1QLE C;  4TQF A;  5EBW C;  3A0R A;  1W59 A;  5CPH A;  2QWR B;  4JI1 B;  1YT2 A;  3H1K H;  4DV5 O;  2XX5 A;  2QFO A;  4WUD A;  5GTH Z;  2FKX A;  2YI0 A;  5JH7 A;  4DUY O;  2YKE A;  2X0L A;  1L0L H;  1AJ6 A;  2FWZ A;  3CYG A;  3G67 A;  1FKA O;  2CCT A;  5C8Y B;  2BT0 A;  4TT3 G;  1AR1 B;  1V9P A;  3F5T A;  3HYZ A;  5H9C A;  5M4P A;  1M93 A;  1N8R W;  4DR1 B;  2ZDI A;  4O4J B;  3CC2 V;  5J71 A;  3D36 A;  2QE7 G;  4QE9 A;  1CEZ A;  4KHP B;  4CWP A;  4UVC A;  2X6B A;  2UXX A;  2P5O A;  2YID A;  3TZ4 A;  3OMU A;  1BGQ A;  1PPJ H;  1YZB A;  1XL6 A;  3BA8 A;  1B62 A;  2EIM B;  1US7 A;  1I58 A;  4YKW A;  2WLK A;  4K3A A;  2EIM C;  3KE6 A;  2Q5Z A;  4XDJ A;  2QWO B;  3JAR B;  3EXA A;  4WFH A;  2WEQ A;  2QGN A;  5CF0 A;  2C1I A;  1V55 C;  3AG7 A;  2JGU A;  3L70 H;  4X88 A;  4DV1 O;  4JI3 B;  2YXH A;  3K08 A;  4XCL A;  3B8M A;  5IJ9 B;  4O04 A;  3APO A;  2QR4 A;  5B1A B;  5KHJ A;  2Y69 B;  3JAL B;  5B1A C;  3DXR B;  3ZMZ A;  2Y69 C;  4R3A A;  3WB2 A;  4R1F A;  1SQG A;  2YI9 A;  4UVB A;  1SQP H;  1Z5V A;  2QJ1 A;  3HKE A;  4B6C A;  1F51 A;  5A2Q N;  2YEI A;  4O09 A;  2YEA A;  1QYE A;  4I3H A;  5IJ0 B;  4LR3 A;  2QWP B;  2ITD C;  3FAV A;  4HBN A;  1K3E A;  2KG7 A;  3NXS A;  3QVN A;  3DTU B;  4JI8 B;  3TTZ A;  2WLI A;  5M4H A;  4WBN A;  4DK0 A;  3ZMS A;  3G6B A;  1R3I C;  2M7W A;  1QU7 A;  4NTX A;  3OW6 A;  3S3X A;  4LC1 A;  1FJG O;  2JJ2 G;  2WLH A;  1WNS A;  5IDM A;  2BOB C;  1RFY A;  1M5I A;  2DQ0 A;  2P90 A;  3JD3 A;  1D5A A;  2R70 A;  2YEV A;  4JI5 B;  3I56 V;  4UCR A;  1NHJ A;  3FV5 A;  4I9Q A;  4HYM A;  2YK9 A;  4TOI A;  2H8M A;  2ZE6 A;  4B3T B;  5LA6 A;  1VF6 A;  3UM7 A;  5LHG A;  5KA6 A;  1TID A;  2FWY A;  1I5A A;  4I0X A;  3FD9 A;  1N0J A;  5K1P A;  2WA3 A;  1T5E A;  3T0Z A;  4IT5 A;  4FLT A;  2XDS A;  4LCU C;  2E0A A;  5BOD A;  4ASB A;  4DZY A;  2UUA B;  3CGZ A;  2K9P A;  3TK1 A;  2CCS A;  1MZE A;  5HFM A;  1NTM H;  1TA8 A;  2QM4 A;  2DW4 A;  1WB8 A;  4LBE C;  3SPC A;  3ZHV A;  4UCU A;  4ASF A;  3Q5J A;  3JZ3 A;  5E1A C;  1XEQ A;  4LFA B;  2O1W A;  4JQL A;  4GCZ A;  4XTJ A;  4JYA B;  5FND A;  4DR6 B;  3AG1 C;  2YXL A;  2ZIO A;  3CPW U;  2IWS A;  4GEE A;  4RQE A;  3R4N A;  4IHJ B;  4MP7 A;  1Q81 W;  1Z5A A;  3RYC B;  1Y6X A;  4FCP A;  4DW0 A;  3L75 H;  1AMW A;  1HNZ O;  1NZ6 A;  3A8T A;  4K0K B;  2YI7 A;  1E79 G;  1US6 A;  1GN3 A;  3KZI Z;  3CRC A;  3ABU A;  1AJP A;  1HNW B;  5BMV B;  3AEI A;  4JI1 O;  4X1I B;  4JYC A;  3H1I H;  1I5X A;  4ASU G;  3B77 A;  5J6A A;  5EZY B;  2YIB A;  3SJA C;  2EBO A;  2EX3 A;  1ZX3 A;  3SYC A;  1AR5 A;  1KZN A;  3HZ1 A;  3JD0 A;  1NVP D;  1GO3 F;  1KD1 W;  3T1C A;  1IBM B;  5LMN B;  3U2D A;  2A7W A;  4WUC A;  4BQJ A;  2YI6 A;  1PVG A;  4X20 B;  1UFI A;  2WEP A;  4KHP O;  2H8P C;  3BHP A;  3W7U A;  5LHH A;  3X2Q C;  2JS5 A;  2AZ0 A;  3ZHR A;  4L90 A;  1G4Y B;  1ZWI C;  3QDD A;  4DUZ B;  3ABL B;  2D2C B;  2XD6 A;  4DXW A;  2XHT A;  1Z5C A;  3ABL C;  4XKO A;  1IBK B;  1UYK A;  2Y48 A;  4JI3 O;  4NH8 A;  1QNM A;  4CE1 A;  4J7K A;  1MU5 A;  3I55 V;  1R73 A;  3T0H A;  4E72 A;  2ZXW B;  5JCO C;  1K7D A;  1PNL A;  3HEK A;  3OGI B;  2VW5 A;  1N4C A;  5EIB D;  2BYH A;  1FXK B;  1MMM A;  1NBM G;  1TVK B;  3U0Z A;  5F2V O;  3DC5 A;  3TXQ A;  2ADQ B;  3K06 A;  1VF5 B;  4FPP A;  3K5L A;  1GKX A;  3F7Y C;  3Q4H A;  2ZE8 A;  1OCO B;  4F6R B;  1B06 A;  3E22 A;  1SRY A;  4YKX A;  4PA9 A;  1Y67 A;  2XOK G;  2Y4T A;  4YJ3 A;  1D5N A;  3P32 A;  2JGD B;  4WFG A;  2YUA A;  3C3T A;  4JI8 O;  2RDC A;  2ZIN A;  3HR0 A;  4LH7 A;  4MPC A;  1ZUQ A;  2DE0 X;  5CB4 B;  1K9M W;  5M4M A;  4PDL A;  2A9H A;  4K35 A;  1GN4 A;  4PA7 A;  1ORQ C;  2Q9L A;  1G1X B;  2YDE A;  4CE3 A;  2EZP A;  1L1F A;  2BE3 A;  2AW9 A;  2EIN C;  2W0X A;  4E01 A;  3UT5 A;  1WN7 A;  4MS2 A;  3F7V C;  2XHB A;  4JI5 O;  4JI0 B;  2PYJ A;  3RVZ A;  3S5T A;  3OMN B;  5IYZ B;  1JJ2 U;  4B3T O;  4IIJ A;  4UB6 Z;  1XL4 A;  1YTF B;  4LF7 B;  3HYY A;  1XUQ A;  2YS8 A;  4HY6 A;  3OR6 C;  2VWK A;  4DR2 B;  1K8A W;  3B40 A;  2YE8 A;  2UWD A;  4LF9 B;  1UYD A;  1YEW A;  1G6U A;  3IAY A;  4KUM A;  4HZ0 A;  1WAZ A;  2JVD A;  4CWF A;  2RMK B;  4LFA O;  5M4E A;  1H2L A;  3JSN A;  4QPJ A;  4JYA O;  5CTU A;  4X62 B;  4DR6 O;  4X89 A;  1DF5 A;  1OCR B;  4H0L B;  2DMX A;  4I4T A;  5D7R A;  1NU1 H;  2ITC C;  4Q6G A;  3UQ8 A;  4PA4 A;  3N2G A;  5D6Q A;  3TUH A;  3B25 A;  1H2G A;  2IM9 A;  1XQ8 A;  3JD1 A;  2WI5 A;  3OEH G;  4K0K O;  4XBF A;  3A0Z A;  4CC5 A;  1HNW O;  3Q5K A;  4B3S B;  1THN A;  5GGZ A;  2DJV A;  5KAI Z;  4WFF A;  2BSK B;  2HP8 A;  5L3B A;  4CWQ A;  2F23 A;  4PA3 A;  1KBH A;  1F23 A;  4NXN B;  3H01 A;  2XDU A;  1S5L Z;  4YJ2 A;  3WQ9 A;  2HJF C;  1N32 B;  1Q82 W;  2N04 A;  3R4M A;  1YJ9 V;  2YGA A;  2E5L B;  1VAR A;  3LNU A;  1IBM O;  5LMN O;  3OMA B;  1GMG A;  1TH8 A;  2WLM A;  1XBL A;  1Q6H A;  2CK3 G;  4EGK A;  2Q8F A;  1VQ6 V;  2X6C A;  1BQ0 A;  4KSH A;  3ZJZ A;  1YS3 A;  4EB6 B;  1HNX B;  3AG2 B;  4BQG A;  4UCT A;  5JVD A;  3AG2 C;  4WCE V;  1XMO B;  5ITZ A;  4LH6 A;  2GSM B;  2BU6 A;  4DUZ O;  5CA3 A;  1QLN A;  1AP6 A;  2CGN A;  1IBK O;  1RSO B;  5B3S B;  3CGY A;  1VQ5 V;  5IE9 A;  5B3S C;  1QVG U;  3ZHQ A;  2DWE C;  3ZRV A;  2H55 A;  2Z3Y A;  5CA0 A;  1YIT V;  5D5Q A;  1EM1 A;  2N74 A;  5CMU A;  2FYP A;  2IOQ A;  1U97 A;  4O4I A;  5JQG A;  2FL4 A;  2YXY A;  3P3P A;  4P8O A;  5EYP A;  3ABT A;  3G6E V;  1B63 A;  2GHY A;  3ZMT A;  3OT7 A;  3WU2 Z;  3RYI B;  1KP2 A;  2AZ2 A;  4G28 B;  3IED A;  1Z5W A;  3E8G A;  4K8Z A;  1ZXN A;  1SQF A;  4OXS A;  4JTD B;  4EKW A;  4JAA A;  5C93 A;  1L0O A;  1R6N A;  4MVQ A;  5JJJ B;  4K4O A;  5CTY A;  2Q2E B;  2MW2 B;  1BKN A;  3ETG A;  4AQY B;  1EBO A;  1RM1 B;  4RAI A;  4B08 A;  3R65 A;  2IBZ H;  1HDJ A;  4DV6 B;  1DGS A;  3HKC B;  3CCQ V;  3ZCC A;  4DRX B;  4JZG A;  5LYJ A;  1FS0 G;  1JA8 A;  4I50 B;  5J2U A;  4JI0 O;  1BCC H;  2JRI A;  4DW1 A;  1KB9 F;  3QNE A;  1XI1 A;  3K5M A;  3T1Y B;  2WAM A;  1GJV A;  3SYP A;  1BE3 H;  4NB5 A;  4LF7 O;  3CCE V;  1AI7 A;  4BR6 A;  2NR5 A;  3CJH A;  1VQO V;  3FB5 C;  4C7U A;  3OMI B;  3KKY A;  1UPG A;  1FPO A;  1I5Y A;  4DR2 O;  1YC4 A;  3BEH A;  1CXZ B;  2UXC B;  1GKZ A;  4P2Z A;  2DOS A;  4TV9 A;  4FLY A;  4LF9 O;  1S72 V;  4DR3 B;  3D0B A;  3SL2 A;  5ITZ B;  3E8H A;  4H13 B;  1GTO A;  1H38 A;  2BTQ A;  3U10 A;  4X62 O;  1HR0 B;  1ZL8 A;  3MHS C;  1VQK V;  1NVP B;  3RLR A;  5LP6 B;  5LP6 C;  2ZNI A;  4Z1M G;  3ICX A;  4UB8 Z;  1UYM A;  2QG2 A;  4V26 A;  2WLN A;  4XIT A;  5HFL A;  1H2M A;  1QR8 A;  5M4K A;  4XDL A;  4O4H B;  4B3S O;  3CRM A;  4FFB A;  4LP8 A;  4X66 B;  3K0D A;  3CWB H;  3TET A;  1Y8O A;  3CD6 V;  4CH6 A;  4NXN O;  4EGH A;  1I5B A;  4WFA V;  1QR9 A;  3APQ A;  4HAM A;  2JIZ G;  2JK5 C;  3JAW B;  2CAZ C;  2E5L O;  4FZ1 A;  3A0W A;  5IWA B;  5IY5 C;  1VQ4 V;  2QM7 A;  3NR7 A;  1QY8 A;  2OCC C;  3W7T A;  1ZW9 A;  4JPR A;  4W4L A;  3D3Q A;  1IDS A;  3CC7 V;  1QHT A;  5FPR A;  4QIW F;  4LF8 B;  3RLQ A;  5KHH A;  3B09 A;  2XJX A;  2XX2 A;  1ZSP A;  5CA1 B;  3CS5 A;  5EIB C;  5FNV A;  1HNX O;  3T4D A;  2OYQ A;  4I55 B;  1XMO O;  2V1D A;  2Q8V A;  1OCC B;  2RN9 A;  3LDE A;  5L3E A;  2ZBK B;  1OCC C;  5KHI A;  2LFS A;  2YKB A;  4ASA A;  3CCU V;  3T2M A;  2RCV A;  2HEP A;  3FYI B;  2B9Z A;  4GYC B;  1M56 B;  4NH7 A;  5H5N A;  1M56 C;  4BIZ A;  5JWP A;  1YTF D;  3B2E E;  2K1E A;  2YC0 A;  1VEW A;  1H7U A;  4ABM A;  1AH6 A;  4JI4 B;  2VWC A;  2O1U A;  3SR2 C;  1WA8 B;  3ETE A;  2HG5 C;  1NH2 D;  5FLX N;  4D6T H;  4GT1 A;  1YHQ V;  1Z59 A;  4TWK A;  5LXT A;  2OCH A;  4KSG A;  4X1Y B;  1IXM A;  4QE7 A;  2DN9 A;  3HPL C;  4HY1 A;  3ZED A;  4NKG B;  1AI5 A;  1XIL A;  1PNM A;  3ZHU A;  4BIO A;  1AJQ A;  1Y74 A;  3ASO B;  1OZ0 A;  2CH4 A;  3BAA A;  1MX0 A;  4LFC O;  1YVW A;  1NQT A;  1JCH A;  4LWH A;  1KP3 A;  3BA9 A;  4UV8 A;  1UYI A;  4AQY O;  1KEC A;  1XHZ A;  1UY8 A;  3H1H H;  4WF9 V;  1ZLZ A;  4X8A A;  1UY7 A;  3F5W C;  4JYY A;  2VQE B;  1IBL B;  3VQW A;  1X59 A;  3B27 A;  2CGO A;  2W0F C;  4PI0 A;  3T1Y O;  1KKC A;  4O07 A;  1XRE A;  3T4Z A;  3VQV A;  5EBM C;  3J81 N;  4ZKI A;  1YT1 A;  1HWY A;  1WJZ A;  1NTZ H;  4GQT A;  1A32 A;  4L8J A;  1K4C C;  1NHI A;  3H9V A;  3D2R A;  4CS3 A;  2F95 B;  4GFN A;  2UXC O;  4DR3 O;  2YEJ A;  2BTZ A;  2UXB B;  3CRR A;  2Y0I A;  2H94 A;  3HKD B;  1VQM V;  4U7O A;  5E79 Z;  4DV3 B;  2UXD B;  3RKZ A;  1O9G A;  3S3W A;  4EEQ A;  4X1K B;  3OEE G;  3TJT A;  4URL A;  3A0T A;  2YE3 A;  2YGF A;  2ZT9 B;  4F6E A;  5B66 Z;  3JAM N;  1Q8I A;  3MHH C;  3K03 A;  4PI2 A;  3OPD A;  4IGG A;  2YEC A;  4EFU A;  4X66 O;  2IJI A;  4MW8 A;  2O57 A;  5DN6 G;  1DK1 A;  4DR5 B;  1IX9 A;  3JD4 A;  4JTA B;  1W0K G;  3B4S A;  5GON A;  2WI1 A;  4LWI A;  5JH7 B;  1MSD A;  4U3F H;  1K92 A;  4X9L A;  3ZXQ A;  5IWA O;  3LDD A;  1YER A;  5LGU A;  4DR7 B;  2O1V A;  2QSA A;  1V54 B;  1EN6 A;  4JAU A;  2XDX A;  1I08 A;  5A9G A;  4PU9 A;  4LF8 O;  2Y4U A;  1ROP A;  1EN4 A;  1FFX A;  1UYC A;  3ZN1 A;  2UUB B;  1K5S A;  1A4H A;  2IU0 A;  1FYJ A;  4KP4 A;  5B5E Z;  1I5C A;  3FFQ A;  1IXB A;  4MVO A;  1GM7 A;  2FTK A;  3M7M X;  3CSX A;  4EFE A;  2A0L A;  2CTR A;  4DV0 B;  2P4K A;  4RO2 A;  5JCO A;  2B1G A;  4LF4 B;  1GRJ A;  4KFG A;  1TUB A;  2F93 B;  2JS3 A;  1AP5 A;  2EXL A;  2ZR2 A;  1BQZ A;  2G38 A;  2QWN B;  3GIF A;  4BWA A;  4EFT A;  2QG0 A;  4FJC C;  3G7B A;  2Q8G A;  5KHG A;  4JI4 O;  2JKI A;  2BSM A;  2ATK C;  3JSL A;  1S16 A;  3K79 A;  2CH7 A;  1M9N A;  3FKS G;  2F43 G;  3LSU A;  1ID0 A;  2YKJ A;  2YE2 A;  1J95 A;  2JJ1 G;  3SPI A;  1OSF A;  3HKE B;  1SET A;  2F4V B;  3AK3 A;  3PEH A;  4KQV A;  2CCU A;  1SS3 A;  4N21 A;  4FVM A;  3THO A;  2XJG A;  3HKB A;  3LDC A;  2QA4 V;  3FAV B;  5B1O A;  2KG7 B;  2ZE5 A;  3WB1 A;  4O2B A;  4CWT A;  2WLI B;  1NKD A;  4DR1 O;  4WBN B;  4FM0 A;  3OUS A;  1M4U A;  2YI8 A;  2R9I A;  4HZ5 A;  3ZHS A;  3OD4 A;  4UCO A;  2PI4 A;  2BZ5 A;  3P3N A;  4LNU A;  1R3K C; 
#chains in the Genus database with same CATH homology
 3OGC C;  4PA3 A;  1F23 A;  3H01 A;  3E86 A;  1V55 B;  4MVR A;  2NLJ C;  2HJF C;  4WFB V;  4FIP C;  1Q82 W;  2YEV B;  1YJ9 V;  4FMT A;  4HZ3 A;  3OMA B;  1GM9 A;  1F4N A;  3K9A A;  2WSS G;  1GMG A;  2WLM A;  2CK3 G;  5LHI A;  2JDI G;  1YJN V;  2HKO A;  2LP7 A;  2EJR A;  4MT8 A;  2LFR A;  3K3W A;  2W6J G;  2ZD9 A;  3D3I A;  4JGS A;  3P30 A;  1VQ6 V;  2X6C A;  3PJS K;  1MG1 A;  2ZXW C;  1Y4M A;  3ZJZ A;  1UJW B;  1YSC A;  2WLL B;  3AG2 B;  1M1K W;  1FXK C;  2JEU A;  3AG2 C;  4WCE V;  4I5S A;  1VQ8 V;  3GWO A;  2JEX A;  4UXN A;  5L3C A;  2GSM B;  3M99 B;  4F4L A;  5IY5 B;  1JX9 A;  3QO5 A;  4ZBM A;  5CA3 A;  1QLN A;  1MOF A;  2XAH A;  1OCZ B;  1OCO C;  2KB1 A;  2OCC B;  4G2K A;  5B3S B;  3STZ C;  3EHB B;  1VQ5 V;  3SPG A;  2ZR3 A;  3STL C;  5B3S C;  1QVG U;  2HFE C;  4MTX A;  2DWE C;  3ZRV A;  1G8M A;  1VQP V;  1SER A;  1K33 A;  5EC2 C;  4JAV A;  3LSS A;  3KG2 A;  1FXH A;  5LGT A;  2Z3Y A;  5KUM A;  1YIT V;  1VQN V;  1ARO P;  1V54 C;  3RVY A;  5CMU A;  3FYE B;  2ZDI C;  4R6Z A;  3HB3 B;  3OM3 B;  5IYB O;  4JYB A;  2XAG A;  1WPX A;  4UUJ C;  1JOY A;  4UV9 A;  1GM8 A;  3ABT A;  3G6E V;  3CYO A;  2GHY A;  3CMA V;  3ZMT A;  1QCE A;  1KP2 A;  4G28 B;  3E8F A;  3E8G A;  4JF3 A;  3JYC A;  4OXS A;  4R7C A;  4JTD B;  5EC1 C;  1Q86 W;  2B5U A;  2ZQM A;  5EBL C;  4EKW A;  1COW G;  5C93 A;  2XAF A;  4MVZ A;  1R6N A;  2XAQ A;  4N23 A;  3SPJ A;  2P67 A;  3IGA C;  3UKM A;  4MVQ A;  3AG4 B;  3SPH A;  3VBB A;  3AG4 C;  3CP1 A;  2DYR B;  1QLE C;  5EBW C;  3ETG A;  3A0R A;  1FXK A;  1AI6 A;  1EBO A;  3OUF A;  1VQL V;  1RM1 B;  4RAI A;  2IH1 C;  3R65 A;  3CCQ V;  1SES A;  3ASN B;  3ZCC A;  3ASN C;  4P9P A;  1NH2 B;  1KC8 W;  5FL7 G;  3ZRS A;  1FS0 G;  3AG1 B;  1WLE A;  2X0L A;  1BMF G;  1R6K A;  1BL8 A;  2OT5 A;  3QNE A;  3WFV A;  5CBF A;  4TT3 G;  3W7X A;  1BHB A;  1AR1 B;  3QO7 A;  3ML0 A;  3E83 A;  5H9C A;  1OCR C;  2WAM A;  2UXN A;  3SYP A;  1N8R W;  2ZDI A;  3CC2 V;  3CCE V;  1S76 D;  1AI7 A;  5B1B B;  3D36 A;  2QE7 G;  4QE9 A;  1VQO V;  1CEZ A;  5B1B C;  2EIK B;  4UVC A;  3FB5 C;  2EIK C;  2UXX A;  2X6B A;  3OMI B;  5CN0 A;  1I5Y A;  1MSW D;  3BEH A;  3AG3 B;  4CBC A;  2IJJ A;  4P2Z A;  1S72 V;  2Z5U A;  3JD2 A;  1XL6 A;  5CBH A;  2EIM B;  1CPY A;  2WLK A;  2WPD G;  3E8H A;  2EIM C;  2IW5 A;  1GTO A;  3MD0 A;  4XDJ A;  1H38 A;  4MTG A;  4WFH A;  4BIU A;  2HLD G;  3MHS C;  1VQK V;  1V55 C;  1NVP B;  4H37 A;  4X88 A;  5LGN A;  4PDM A;  4BW5 A;  4Z1M G;  3K08 A;  4MVU A;  3B8M A;  1MAB G;  1AJN A;  5KA5 A;  2WLN A;  1E1Q G;  5B1A B;  3E2E A;  1FFT B;  3QO8 A;  2DWD C;  2Y69 B;  5B1A C;  1QR8 A;  5HFL A;  3ZMZ A;  4XDL A;  2Y69 C;  3OW2 U;  3ZMU A;  3X2Q B;  4LP8 A;  1S0V A;  1RPR A;  3K0D A;  5H6Q A;  3TET A;  4GX5 A;  4UVB A;  3CD6 V;  4MW3 A;  3E89 A;  3LUT B;  1QR9 A;  4E2L A;  4WFA V;  2OTL V;  1M57 B;  1F51 A;  1OHH G;  2JIZ G;  2JK5 C;  2EIJ B;  4HAM A;  3W7S A;  1YI2 V;  2BOC C;  2EIJ C;  4P30 A;  4MVS A;  5IY5 C;  1VQ4 V;  3ZRW A;  2ITD C;  2QM7 A;  2DQ3 A;  1K3E A;  1OCZ C;  2IU3 A;  1H8E G;  3DTU B;  3NXS A;  2OCC C;  3W7T A;  1TUE B;  2WLI A;  3ZMS A;  1DLB A;  1R3I C;  2M7W A;  4JPR A;  1P4R A;  3CC7 V;  4JAS A;  4I9W A;  2HVJ C;  4QIW F;  1BHA A;  4QJF B;  3K0G A;  4LC1 A;  5H6R A;  4KFM A;  1F4M A;  2JJ2 G;  2WLH A;  2PI5 A;  2XAJ A;  3T4D A;  1THZ A;  2BOB C;  3JCZ A;  2DQ0 A;  5KUK A;  2V1D A;  3EFF K;  1OCC B;  2QKS A;  3LDE A;  2P90 A;  5B1N A;  5L3E A;  1OCC C;  3JD3 A;  1VQ9 V;  3CXC U;  2YEV A;  3I56 V;  2LFS A;  4MTF A;  3CCU V;  3LSQ A;  3SYA A;  3T2M A;  2NNU A;  2QM8 A;  4QNH B;  1P7B A;  1B6Q A;  2MK3 A;  1SZT A;  3FYI B;  2XND G;  3UM7 A;  5LHG A;  1M56 B;  5KA6 A;  4MTO A;  3ETD A;  4PA6 A;  1M56 C;  4BIZ A;  1YTF D;  2K1E A;  2Q6A A;  3E35 A;  4H33 A;  4LCU C;  4PEL A;  1KKD A;  5GW7 A;  2DYR C;  2WLL A;  2EIN B;  2X6A A;  3ETE A;  3TK1 A;  1LNQ A;  2HG5 C;  5HFM A;  2Q68 A;  2X7R B;  1RM1 C;  1NH2 D;  2DW4 A;  4BAY A;  4LBE C;  3SPC A;  4GT1 A;  3FB6 C;  1YHQ V;  4TWK A;  2A79 B;  5E1A C;  4GCZ A;  2Q69 A;  3SYQ A;  1IXM A;  4QE7 A;  3AG1 C;  3CPW U;  1NJI W;  3HPL C;  4RQE A;  1PD3 A;  5EK0 A;  1Q81 W;  1GK9 A;  4P9O A;  2WLJ A;  1AI5 A;  1EFR G;  1PNM A;  2EIL B;  1ENV A;  1AJQ A;  3ASO B;  1OZ0 A;  4R8C A;  2EIL C;  3ZN0 A;  5IDJ A;  1M90 W;  3CCR V;  1NQT A;  1GKF A;  1JCH A;  1KP3 A;  4UV8 A;  3ABK B;  1R3J C;  1E79 G;  2IH3 C;  2R9R B;  1YJW V;  5L3F A;  1KEC A;  2C2A A;  3ABU A;  1AJP A;  1YIJ V;  3AEI A;  4JYC A;  4YXW G;  2Q67 A;  1I5X A;  3B8N A;  4ASU G;  3B77 A;  4RQF A;  4WF9 V;  4RUE A;  4X8A A;  3AG3 C;  2V7Q G;  3F5W C;  2EBO A;  1FXV A;  2YSU B;  3SYC A;  5J9P C;  3CCS V;  1S77 D;  3DGE A;  3JD0 A;  1NR7 A;  1PKX A;  2WWW A;  1NVP D;  1QVF U;  1GO3 F;  2AHZ A;  1KD1 W;  4MSW C;  3T1C A;  4J9Z B;  3W7W A;  1EZJ A;  1H8H G;  2W0F C;  1JVM A;  4J9Y B;  3T4Z A;  2IJK A;  1K34 A;  5EBM C;  1JQ0 A;  4ZKI A;  5IYD O;  1HWY A;  1CP9 A;  5CBG A;  1K4C C;  3IFX A;  3LNM B;  2H8P C;  4U7N A;  2QTO A;  2P7T C;  3W7U A;  5LHH A;  3X2Q C;  4PDV A;  3FB8 C;  2AHY A;  3RBZ A;  2H94 A;  3ABM B;  1VQM V;  4U7O A;  1G4Y B;  3ABM C;  1ZWI C;  1AI4 A;  4L87 A;  3ABL B;  4DXW A;  2OTJ V;  3OEE G;  3ABL C;  3CCM V;  1K5Q A;  1M57 C;  2W6I G;  1KQS U;  4DO2 A;  2Y48 A;  2D3O W;  3I55 V;  1R73 A;  2ZXW B;  1K7D A;  1PNL A;  3OAA G;  3MHH C;  3K03 A;  1PL0 A;  3FB7 C;  3ZRX A;  1FXK B;  2IJH A;  1NBM G;  2IJI A;  4MW8 A;  5DN6 G;  5BZB A;  3K06 A;  3JD4 A;  4FPP A;  3GB7 C;  4JTA B;  3K04 A;  3F7Y C;  1W0K G;  1RPO A;  3E8B A;  1OCO B;  2HR3 A;  1S3J A;  1K92 A;  4GX0 A;  3SYO A;  1SRY A;  2XAS A;  4PA9 A;  2EZO A;  2XOK G;  3LDD A;  1VQ7 V;  3OFN G;  3P32 A;  5LGU A;  4RUF A;  4WFG A;  1W2B U;  1V54 B;  1E1R G;  1Y66 A;  2B1I A;  4JAU A;  1K9M W;  4PDL A;  2A9H A;  1ROP A;  4PA7 A;  1ORQ C;  4MVM A;  3ZN1 A;  1K4D C;  1K5S A;  2IU0 A;  4R50 A;  4KP4 A;  2EZP A;  1L1F A;  3G71 V;  3SJQ C;  2EIN C;  3TCU A;  4MVO A;  1GM7 A;  4TSF G;  5L3D A;  2FTK A;  3BY6 A;  4MS2 A;  3F7V C;  2A0L A;  2P6J A;  2HVK C;  3RVZ A;  3CCL V;  4QPK A;  3OMN B;  4RO2 A;  4UVA A;  1JJ2 U;  2B1G A;  4FK5 C;  3ZMV A;  1QBZ A;  1XL4 A;  1QLE B;  1YTF B;  5DM6 V;  1DTO A;  2ZR2 A;  3ASO C;  4FJC C;  3OR6 C;  4JTC B;  1NR1 A;  2ATK C;  1K8A W;  3ABK C;  3K79 A;  4XDK A;  5L3G A;  1M9N A;  3FKS G;  2F43 G;  3OR7 C;  3CME V;  3CCV V;  4PDR A;  3RW0 A;  2QEX V;  4KUM A;  1K97 A;  4Q20 A;  4GX2 A;  1PNK A;  4WFE A;  3OE7 G;  1J95 A;  1JPX A;  1R3L C;  2JJ1 G;  3SPI A;  4QPJ A;  1SET A;  3IC7 A;  1Q7Y W;  1K73 W;  4X89 A;  1DF5 A;  1OCR B;  5LBQ A;  3CCJ V;  3CC4 V;  4N21 A;  2DYS B;  2DYS C;  2ITC C;  1DF4 A;  3ZRW B;  4PA4 A;  3LDC A;  2QA4 V;  3WG7 B;  5B1O A;  4GX1 A;  4CZZ A;  4HYO A;  3WG7 C;  1H2G A;  2WLI B;  1S5H C;  1NKD A;  3JD1 A;  3OEH G;  5IYC O;  3OUS A;  2R9I A;  4XBF A;  4G27 B;  3G4S V;  2PI4 A;  3ZIA G;  3VOU A;  4WFF A;  1W0J G;  5L3B A;  1R3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...