1IXOA

Enzyme-analogue substrate complex of pyridoxine 5'-phosphate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
242
structure length
235
Chain Sequence
AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzyme-ligand complexes of pyridoxine 5'-phosphate synthase: implications for substrate binding and catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords Pyridoxine 5'-Phosphate synthase
total genus 95
structure length 235
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2002-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ixoA00
3S6DA 1QCWA 3G8RA 1JUEA 4Z1CA 1J2WA 4FNQA 2WSRA 4HNTA 4UR7A 1JCNA 3TSBA 3M9YA 2C16A 4DF1A 3HQ1A 1GVOA 4E0CA 3P8IA 3E02A 4HKPA 4DQWA 4FXSA 3KHJA 4FX6M 4DF2A 1L9WA 1ZAIA 4IOTA 2OT1A 4JGDA 3RLUA 2VFIA 4MIMA 1DOSA 2RKXA 1GVRA 3HGRA 3NPUA 1M6JA 1KLZA 4R53A 4DO4A 1TJRA 1OK6A 2ZZ3A 1D3HA 4X2RA 2DZVA 2QUTA 4CCCA 4I7WA 3NQEA 5FI8A 1W37A 3CC1A 4P61A 4OE7A 1W56A 3W1NA 4E38A 3TFXA 2CW6A 3P84A 2E6YA 3TSDA 2A6NA 3MBDA 1LDCA 3ATZA 3LV6A 3L5AA 4DBDA 4ZL1A 2GVGA 1TPDA 1TPUA 3D0CA 5DCEA 4M7SA 2ISVA 3SIZA 4K39A 5CPMA 2C0AA 2FQIA 4KFPA 2FJKA 1N8FA 2DZTA 5K9CA 2ALDA 4MZ1A 3KVKA 1BWKA 5CZ0A 2GUUA 2PRLA 1GTEA 5C2XA 1K7FA 1VR6A 3W22A 2Y7EA 3P5ZA 4K7VA 3W86A 5E1QA 4C1LA 4TR9A 3W1TA 5F2LA 7TIMA 3IV3A 1H62A 3EX6A 3TDFA 3UWQA 2QDHA 2H90A 2NX1A 3QQ1A 2Y7FA 1B9BA 1V7YA 3GR8A 1VZWA 4KFOA 3GXPA 3G1HA 4LS0A 4NNBA 2V81A 3CT7A 4GXMA 1S3HA 3TQVA 4XWUA 5EPDA 4MUZA 4RZ6A 3EXRA 1A53A 1X1OA 3E0IA 4NU7A 3SR7A 3NL2A 3NGJA 5D05A 1OX6A 4K8HA 3LCHA 1XBYA 1PCWA 1F7BA 2V2CA 1G7VA 5CZTA 3UPWA 1X1ZA 2D73A 5AN7A 3R12A 2NXGA 3LHUA 1EP2A 3IRDA 3SECA 2C1HA 3LLFA 5KINA 1OFDA 2QR6A 3VKJA 2Z0IA 1X8FA 4GUIA 3W7OA 3MO7A 1LBFA 1VJIA 4N9EA 2NLIA 4LS1A 1KA9F 3TA6A 1OYBA 4UNLA 3STGA 1KM4A 5BMWA 3KVJA 2I1OA 2X1UA 3FEMA 2FB3A 3I7RA 5D09A 4UMBA 3STFA 2E5BA 3F4NA 3OHIA 4YWIA 3PY2A 2ZZ7A 1WQ5A 4R34A 3PB2A 5TQLA 2ZTJA 3M1ZA 3UQNA 1QOPA 4R7JA 1PHQA 2XFWA 3BG3A 4LW7A 1UJPA 5U4NA 5D32A 3NQ6A 1AL7A 4JIPA 2CLHA 3QH2A 1SW3A 2QCNA 3TQKA 3CU2A 1SU5A 2PCQA 1KBJA 3PBVA 4N4PA 1KM6A 1VCFA 3UXAA 4Y9AA 4JTGA 3TH6A 1FWNA 2XN1A 4UTTA 4U4MA 1Z48A 4LVAA 2A7RA 3IVSA 3CIWA 2YDAA 3BPWA 5HWMA 5F2GA 4HSNA 1LROA 3N34A 4GUHA 4XKYB 1ZCOA 1H61A 2B7OA 3FJ6A 3NR0A 3R2GA 4FO4A 1JQVA 1HO4A 3L5MA 2FIQA 2O7QA 4RXFA 1XDLA 5E0KA 1LOSA 3PULA 1FDYA 5G2WA 1X7FA 3HGSA 5LHEA 4MJMA 1NF7A 3GVGA 3HOJA 3FIGA 4PA8A 4PL2A 1NEYA 3W9ZA 3VE9A 4GE8A 3C2EA 1OABA 2TYSA 3NQDA 4LUIA 3BK0A 3QSRA 1A5SA 5AHNA 3T4CA 1R46A 1H7WA 1Z42A 3A9IA 1TTQA 4RZ4A 1C8VA 4MZYA 1FUYA 4UC5A 1SW0A 3YPIA 2WSYA 4O52A 5F4WA 3W1AA 1B3OA 2YYUA 4WJEA 1HUVA 3A5VA 3TE9A 2NX3A 1THFD 3NAVA 2TMDA 2ZYFA 1I8JA 4JR5A 1DBTA 3P67A 3TAOA 1F6KA 3LRKA 5GVJA 3CPRA 3CTLA 3ELFA 2G95A 2YFOA 1LP6A 1IIHA 2Q8LA 4NUWA 3GNNA 1DVJA 3W3OA 3IIPA 3P80A 5AHLA 1ZFJA 5AOUA 1IIGA 2QCLA 1W5OA 5FEPA 1GYLA 1BTMA 3EWWA 1CI1A 4OQVA 4K8EA 4O50A 1EPXA 4O1BA 5D30A 1WBJA 2C6QA 4ZZ9A 4WXZA 3U6WA 4MPQA 4IPJA 1W5MA 3LRLA 3W1PA 1YTEA 3S5NA 3HPZA 3RF9A 3NVTA 4PC8A 3BVJA 1M7PA 3HGOA 3LM7A 3SGZA 1MO0A 3QEZA 4AVFA 3MYOA 1W0MA 2V2HA 5LNUA 2R8WA 4IX0A 3OVRA 5D2YA 3DFQA 4HIBA 3UXDA 1PL9A 1TIMA 2J24A 4JTEA 2Z1BA 3TX9A 3W7DA 1ZJIA 5DLCA 2X1TA 4OV9A 3RMJA 3DI0A 3TQ0A 1KM5A 3KAOA 2JKEA 5E93A 1TRDA 2NX9A 4O13A 2VFEA 1FCVA 3O6DA 4M7TA 3IVTA 3HPXA 3TU9A 1A5BA 5CSRA 1RQEA 4KKXA 4N2YA 3B4UA 4NT0A 3SFKA 4XTDA 4CNOA 3HO8A 3A21A 1LCOA 2ZA2A 5C55A 1XI3A 1FWWA 1U83A 1SR9A 4UFLA 3UPBA 2JBMA 3G1XA 2P0OA 3SI9A 2GPTA 1XXXA 4JICA 3H54A 1F73A 2DZXA 2BTMA 3LRMA 4LT9A 2DZPA 3P8JA 2HSAA 1QNVA 2PRHA 3L65A 1DKWA 1R30A 3P61A 3FOKA 4JX4A 5DXXA 4AWUA 5CZJA 5LNSA 5I3IA 3B0UX 3GDMA 3K30A 1PCKA 1H7XA 3NO5A 3KOFA 4X3ZA 5D37A 1J5TA 4Y8FA 1P1XA 2QJIA 3TW6A 3TROA 3FJLA 4JTTA 4O57A 3W2UA 2G96A 5CPOA 1MXSA 4JTIA 3NL3A 4S1FA 3V1PA 4UTTC 2CLMA 2X2GA 1O4UA 1UBSA 3W23A 4WOZA 1LRNA 2Y6ZA 1MEHA 3STEA 3G0XA 4O0ZA 1VGAA 2V5BA 3N19B 3MHGA 3Q2DA 3CWOX 3HBLA 1FBAA 4LV9A 3W2MA 3ATYA 1TQXA 1NAL1 1IXPA 1ME7A 2BZNA 3I68A 3IVUA 4UTJA 1TCDA 5F4XA 1VC4A 2VFGA 4DBEA 3OG3A 4N9DA 4RCXA 1GWJA 3WJYA 2ZCGA 4FNSA 2JKAA 1M5WA 3WJZA 2WNNA 4AB4A 1ME8A 1A5AA 1GYNA 1TJPA 2VFFA 3BW4A 3HMJG 2HTMA 2YCEA 1DHPA 4WZHA 1SZGA 2JGYA 1YPFA 1I2OA 2YXGA 1TPH1 1WBHA 1J4EA 4XBSA 4IGHA 4CQ9A 3B04A 4GNJA 3C3NA 3PBUA 5HUOA 1KFJA 4LC6A 1W8SA 4IMCA 4BI7A 1OFEA 2E68A 1BKSA 3O1NA 3LCXA 3LHZA 3EWBX 1KV8A 4LC8A 4UMCA 5FF4A 3LLDA 2NWRA 2C13A 3T44A 2Y7GA 3W7KA 1F2JA 2A7PA 4GRSA 4MJZA 4NX0A 4P2VA 2B7NA 4O14A 5G1YA 2H8XA 1TSIA 1CX9A 3INPA 2ZRZA 3ZS4A 4UFKA 5G1TA 2A4AA 3MJYA 4UR8A 3TMLA 3W7RA 1TV7A 2NUYA 1OG0A 3BGJA 2R91A 4HNUA 3FFSA 1YXCA 1LZOA 2ZDRA 3OBKA 1EWEA 3DFOA 2AQWA 3GDLA 4DXVA 2CU0A 5DBTA 2ZRUA 1QR7A 4NJKA 3S5ZA 2W0UA 4JTJA 3P74A 1ZAJA 3WK0A 3O06A 3RNDA 3MHFA 3THQA 2CFFA 3LCLA 2VFDA 5F2MA 1UUOA 4Y90A 3L67A 4O10A 3PF3A 1RZMA 4GC4A 1P5BA 2NWSA 1XL9A 1ZAHA 5KMYA 2RDUA 4O0KA 4QSHA 3TW7A 1MEWA 1EWDA 1KM1A 3CEUA 1I2RA 3PAJA 1DV7A 5HR7A 1YDOA 2GQAA 2QCGA 3KFTA 3ABQA 4X9SA 1GEQA 3EXSA 4LOCA 3C61A 2CZDA 1VPXA 3HG5A 3GX9A 3T78A 3UWZA 3NQ7A 1H1ZA 2FDSA 4AHPA 3JR2A 3LCWA 3OA3A 4MFDA 1AMKA 2I9EA 2YR1A 2QJGA 3C2OA 3S1VA 1S5WA 3B03A 3DENA 4PODA 3W2LA 5DY2A 4H3DA 2QCEA 1FQ0A 2ZTKA 3PUEA 2GJNA 4WY0B 3R13A 5J5DA 1UCWA 3LERA 2DP3A 3L2IA 4GWEA 2B0MA 2WPBA 5I3KA 2RHGA 3W7LA 1DORA 4LY8A 3ZWSA 5KZMA 1PIIA 2A7NA 2VELA 3G8EA 2YGYA 2TRSA 2Z2UA 1JUKA 4MKNA 4TO8A 1F76A 2WSQA 1GZGA 1YYAA 4Q32A 3W7MA 3AO0A 2GJLA 4BI5A 4ZQNA 3UY7A 2QCCA 3QSTA 4L4LA 4JYDA 3VE7A 3WJSA 2ZQ0A 1D9EA 1N7KA 2YW3A 4JX5A 2Y63A 2GQ8A 2X1SA 3F1QA 3MP4A 3HG3A 1F5ZA 5I3JA 3B06A 4XQ6A 4R33A 4A2SA 4WOQA 3N9SA 3NQVA 1S5VA 1JVNA 3KRUA 4K36A 2G97A 5BRBA 1VH7A 5LGZA 1LOLA 3ABOA 3BG9A 4RX0A 3LHYA 3NM1A 4J9JA 5G2HA 2V5LA 1OX4B 4CCEA 4K7YA 5AHIA 1XBXA 3PSVA 2J9YA 5LNRA 4L4MA 4XTIA 3EB2A 1JCXA 3OEXA 4JNMA 3TK7A 1LLWA 3QW4B 4W9TA 4YL2A 5C6MA 1VCVA 2ZA3A 3EX4A 1ONRA 4RJEA 1B4KA 1YADA 3LDVA 4BK9A 3L0NA 5LNWA 3CLMA 1LOQA 4UNKA 1YPIA 3JS3A 3MW7A 1TPB1 2PURA 3QJAA 3BARA 3TFCA 4JY8A 4JS3A 2BX7A 1ADOA 3G22A 2ZFAA 3IIXA 2JKPA 1LBMA 3MHUA 4M5PA 3L66A 3RU6A 2I14A 3U8GA 3G1FA 3GAYA 4OGZA 3TCEA 3BO9A 4JDBA 1IXOA 1P0NA 3KRZA 2NZLA 3EX1A 4FF7A 4UMAA 1GVFA 3NDOA 6ALDA 3PSWA 1AK5A 2R14A 5IM51 2DJXA 1H7RA 3IGSA 1YXDA 2J27A 1SFLA 1KBIA 3M0ZA 1W5QA 3PVFA 4ORMA 2Z6IA 2O7SA 4IPIA 1F74A 1K8ZA 1BWLA 2ZRVA 5AYZA 1YTDA 3KVMA 3LHTA 4H6KA 1YLVA 5HMSA 4JTUA 1IXNA 4LU0A 4DF0A 1G67A 3JRKA 4FXRA 1EX5A 4UFMA 4OU1A 5KZEA 4YCPA 3LHWA 1NF0A 5K9XA 5FEWA 5L9FA 1OFRA 1L6WA 3EWXA 2DJLA 1G6CA 1SSDA 1G7UA 3LB0A 4HNVA 3Q58A 1W5NA 4MOZA 5D04C 1FDJA 2VEMA 1ZNNA 3NQFA 3NYZA 1ICPA 1H1YA 5AC8A 4PH6A 4ZQMA 3M47A 3MP3A 5DBUA 1OX5A 3EWYA 3LI0A 5F1VA 1Q6RA 4UFHA 3H55A 3LXAA 4N9CA 1TPEA 2Y61A 4GUGA 2YFNA 4IUOA 4WUIA 4K38A 3W2JA 2VXNA 2XN0A 1E51A 1OYAA 3I7QA 1L2UA 4NXSA 5HWNA 3PR2A 2UV8G 1EUNA 1AG1O 2CLEA 1VQTA 4FIRA 1DJNA 3LTPA 5J5RA 3PWAA 4QNEA 4X22A 3TJLA 1TQJA 3TV8A 3CEPA 5CGQA 5D2VA 4UTMA 5C5YA 3DFNA 5KTLA 1AW5A 2YYTA 3HJZA 1KFEA 3M44A 2ATMA 3QMTA 4YXGA 1VCGA 4LNYA 2C14A 5BNKA 2Y89A 1TV8A 5G5IA 3LTSA 3QPYA 4O1DA 4JD4A 5DN1A 4UFIA 3UY8A 3S9YA 3DH7A 2RFGA 4XUGA 3DBPA 3W7CA 4O4WA 3S8HA 1DQWA 2WNQA 1SPQA 1B4EA 3UD6A 5ABTA 2E5CA 5IBXA 4IMFA 3C6CA 4EWND 3F03K 4GUFA 2H3DA 2QEZA 5G4EA 5L6UA 3F4WA 3P7YA 1KFLA 3NG3A 3QMSA 1LRQA 4NVTA 1VYSX 1SZFA 1I2QA 2A0NA 1T99A 1BEUA 1Q6OA 1GQNA 1UASA 3NL5A 1TV5A 3O07A 2AAMA 4ONVA 4FEZA 1K03A 2ZZ5A 4TIMA 3DHDA 4I9AA 4ICNA 5D03A 2C18A 4WY0F 2CLFA 3W7HA 3W74A 3CQ0A 1SFJA 4JTKA 4WD0A 1B57A 2CZEA 3LBCA 4O11A 5BMXA 2FPVA 4N02A 3MBFA 1ZHAA 4O16A 3TXVA 2VKZG 1P0KA 2DZWA 4MVAA 3UWUA 2YSWA 1YDNA 3M7WA 4N6FA 3L5LA 4MY1A 1DQXA 3W7QA 4C1KA 1ALDA 1QO5A 4LTSA 5KZDA 5HULA 5K9DA 3PM6A 2OX1A 3C2FA 2ZA1A 3L21A 3M5VA 2AGKA 1W54A 1WOAA 5FF2A 4BR1A 3ABSA 3MUXA 5HJLA 1JCYA 4QNWA 1R2RA 1DL3A 5CSSA 1CW2A 3W6YA 1MEIA 4UTUA 1Q3NA 1JRCA 4RZ5A 4LUJA 4WY0A 1H60A 2PC4A 3LI1A 1SSGA 4ZQPA 4DPQA 3LOTA 1WYIA 1ICSA 2ZZ6A 5EMUA 3R8RA 2ISSA 2JGQA 3QM3A 5AB3A 2QDGA 5A8GA 4AH7A 3QQ0A 4D2JA 1AL8A 2W79A 2QAFA 3G18A 3HGJA 2A1YA 1XDMA 1JQXA 3BLEA 3E9AA 4MZ8A 1HG3A 3TSMA 4LVDA 1WXJA 3S5YA 5FF0A 1XUZA 4NZFA 3GXNA 3PS7A 4DEFA 4XBKA 1A5CA 4ZQCA 1G4SA 3TJXA 4QISA 2VEKA 4QITA 4CNPA 1FX6A 3MWAA 4QJ1A 3KX6A 1WA3A 5D2XA 4DELA 4EOUA 2H8ZA 1QMLA 3KRSA 4QM1A 5HUPA 3P82A 3BW2A 3PG8A 3WJXA 2NXHA 2H3BA 3MYPA 1JCJA 3W1RA 1H51A 1IF2A 3PB0A 1HFBA 5CG7A 2VFHA 3EKLA 3O15A 4O54A 1OYCA 4LVBA 3TUUA 5AC7A 3LCIA 4EF9A 3G0SA 3NQMA 1TRIA 3N2XA 3MMTA 2B4GA 2QF7A 3CHVA 3L0GA 3W2KA 2WNZA 1F05A 3BLFA 3UWVA 3GR7A 3P5YA 1QFEA 3W84A 2ATSA 2G5WA 2NXIA 2GVLA 3C52A 2FPYA 1OF6A 2Q3OA 1EP1A 1OFPA 3C2RA 3TIMA 3EX2A 4NXKA 1SW7A 4JYFA 4NNAA 4AMAA 5AYYA 4TMBA 2B7PA 4NZJA 2Y70A 5DELA 1HO1A 3W1LA 3TNOA 3RK8A 4O1CA 1JR1A 1TPWA 4AAJA 3ZWTA 4NQ1A 1D3GA 4UTWA 1SZEA 1F6PA 4IQLA 1KTNA 1KM2A 3NQ8A 5EA9A 1SO6A 3NZ1A 3LHVA 1DJQA 4JTFA 4JTSA 2Y62A 4HNNA 3G1DA 1W3TA 3GNDA 5I3HA 2V82A 3FS2A 2E6AA 3W75A 2FB2A 3UYCA 1VYRA 4RXGA 1A50A 4PL1A 1TTIA 1KTCA 2LLEA 1OFBA 4ORIA 4IWWA 3M5YA 4AF0A 3FLUA 4O53A 3O8AA 2HS6A 1FWTA 3L9CA 2DORA 3GKAA 4EIVA 4ADTA 4QAIA 3M6YA 3I7SA 3LCFA 1P4CA 3W7NA 3G3DA 3NNTA 4A29A 2P10A 4N6EA 4BFAA 5AHEA 5D02A 3IIVA 1TB3A 3NQAA 3SSJA 3O6CA 1L6YA 3WK1A 3B05A 2OMAA 4UTHA 5D33A 3ZFHA 4O17A 1R2TA 2Y88A 1VHNA 4Y6GA 2HMCA 1TO3A 3TC7A 1I4NA 3NPWA 1O94A 2V2DA 4HT3A 1EP3A 3BGGA 3L68A 3S0CA 4AHQA 3V75A 4TMCA 3USBA 3DZ1A 4LVGA 3SZ8A 2E6DA 3HB9A 4JX6A 5CPLA 4ADUA 1QAPA 1S5TA 3GXTA 4M6PA 2ISWA 2ZZ1A 4O4VA 2X1RA 1TPC1 4UTWC 4UUIA 3FKKA 3NQGA 1EEPA 4ADSA 1FWRA 3C0JA 4O8RA 2E09A 4UTKA 3CIXA 3HF3A 4OWGA 5F4SA 3P62A 4CQAA 5AFDA 1LRTA 4A22A 1LBLA 1G69A 4RKAA 1OFOA 1SZNA 3O16A 4YCOA 2ZRXA 3BW3A 3QFEA 3W85A 3W88A 4GBUA 4OHQA 1JCLA 3TXZA 3KVLA 4NNCA 1G4EA 2EKCA 5EKYA 1GG1A 2YZRA 1FDZA 1XUUA 1W5PA 1W3NA 2FLIA 4IXHA 3DKJA 3NM3A 2V8ZA 1KFCA 1NVMA 1XCFA 4A21A 2W6RA 1QPNA 3OVPA 5F1UA 1OJXA 4UCGA 3DI1A 3G24A 3G1AA 5TBOA 2A6LA 3NZRA 4RK8A 4A3UA 3HG2A 4O18A 3W71A 1G4TA 2C3ZA 3C8FA 3W7PA 4E2DA 1RPXA 3G1YA 3THAA 3NQCA 1VS1A 2X16A 5LSMA 2RH9A 1HL2A 1TMHA 4FX7A 2DZSA 4QQ3A 4DPPA 1W31A 3AJXA 2QCFA 4MLRA 2NV2A 1KLYA 4MYAA 4I7UA 4RR4A 1JCMP 1XBZA 3PBWA 1QPRA 4JTLA 4JTHA 3G3MA 1K7EA 2A21A 3G0UA 2EGZA 4DO5A 1TTJA 3N9RA 2ABAA 1WV2A 2QCHA 3EX3A 3S1XA 5CKSA 4LV4A 4PCFA 2EHHA 4CCDA 5AHFA 5KITA 1NSJA 3GKFA 3PG9A 3VCRA 3B0PA 2E1DA 2GVJA 4N4QA 2E77A 4PFMA 1K8XA 3SJ3A 3VFLA 3W76A 3WK3A 3DFTA 2CWNA 3I65A 1T0OA 1TPVA 3FA5A 3RFAA 4UXDA 2EF9A 5FESA 1IGSA 3P60A 1OX4A 4JDYA 2QCDB 1T96A 4LWWA 5BOOA 2BLEA 4XZ9A 1PHWA 3W7EA 1OHLA 3G1VA 5LHFA 1TYGA 2WKJA 4BF9A 3N2MA 5LGXA 4AXKA 3NQ2A 1TPFA 4IJBA 2NUXA 3A5FA 1KFKA 2RDWA 3QW3A 4PTNA 1PS9A 2QJHA 1W3IA 1K8YA 2BSLA 4OV4A 3H53A 4KWVA 4JYEA 3R5EA 1XKYA 4IXXA 4Z0JA 3U2OA 2XN2A 3IGXA 3GAKA 2JK2A 2VC6A 2Y85A 1OFAA 4B5NA 4Z1BA 3GZ3A 4Q33A 2OCZA 3UWYA 2WJZA 4FB7A 5DY3A 5DCBA 4LS2A 3W07A 1ICQA 2NV1A 1K3UA 3NOEA 3QPZA 5K7JA 2ABBA 4NJIA 4Q4KA 5U7SA 5BW6A 4XKYA 1TTPA 3DXIA 1SO4A 3M16A 3M41A 3S42A 1KM0A 1T8XA 2E5DA 4ML9A 3W73A 2WO5A 2A2IA 5HNRA 4MY9A 3O63A 3UWWA 4AEOA 3C56A 1NFBA 1XC4A 3ABRA 3S1UA 3OIXA 3DFPA 4ZMGA 3T55A 3WJWA 5HR6A 3T40A 5F2IA 5K4ZA 1O60A 4AHOA 1G4PA 4S2BA 2QUVA 5HQEA 1W1ZA 4MLJA 4I7VA 3EKZA 3A22A 4ALDA 3W1UA 3IIZA 2C15A 3N14A 2DZUA 3R89A 3HG4A 5LKYA 2X30A 3TMQA 1SO5A 3MI6A 5LNVA 2P1FA 3CB8A 4K6AA 4MYXA 5I3GA 2YPIA 1FXPA 5EL1A 4UTLA 3A24A 1VYPX 1Y0EA 5H91A 1WX0A 2VENA 1K7XA 1OFQA 3IGUA 2OJPA 1FXQA 1OF8A 3Q94A 5EYWA 1PE1A 1MSSA 3CWNA 3WK2A 4FNPA 1GG0A 1MZHA 5K4XA 3C2VA 3HPSA 2DU2A 3PUDA 1Q6LA 2WQPA 2V0TA 3E96A 1LM1A 2GQ9A 1KFBA 3EWZA 3OVQA 3PUOA 3W7GA 2H6RA 2PRMA 3GIYA 4JY9A 1GVSA 4ZQRA 4LRTA 5TIMA 4TU1A 4ZVJA 4AF0B 1X6UA 1JRBA 4H4IA 3RLVA 5K2ZA 1VLWA 2FTPA 3C4UA 1ZENA 3FKRA 5MHBA 5DCDA 3G1SA 1RR2A 4RLIA 3QZEA 1JULA 4HHPA 3W72A 1PVNA 2BXVA 5HINA 5A5WA 1LLZA 4YLWA 2Z6JA 2YX0A 5EBUA 1PV8A 5T26A 2FFCA 1I2PA 5LZLA 2Y7DA 5CZSA 5HWJA 1YTKA 3EWUA 1RQBA 4O19A 3PBYA 1ZY9A 4BWLC 2CZ5A 1TREA 3VNDA 1LYXA 4CNNA 8TIMA 4POCA 5H2ZA 1JUBA 2IQTA 3L0KA 1QO2A 2QCMA 4IX2A 1O95A 1YXYA 3S5OA 4NJGA 2EAWA 3BV4A 5D2WA 3HIJA 3W87A 3I6RA 4MY8A 3MI3A 2F7FA 1C29A 4JXCA 5I3FA 3GDKA 5EY5A 2WOQA 1RV8A 4E2BA 3VI2A 3B8DA 1H50A 3M43A 3PC0A 2VEIA 1Q6QA 4EVZA 2B7QA 3E49A 3W1XA 1M7OA 3N3MA 3M5ZA 4FNTA 4IMEA 4GJ1A 3DHFA 3ZR4A 2CLLA 2OT0A 4M6VA 4FX8A 4LRSA 2ZBTA 3GLCA 4GFSA 1QPOA 4MFEA 3UZJA 4TX9A 4FNRA 3TR2A 2PE4A 1UB3A 4N9BA 4FHAA 1KM3A 1UUMA 3B0VC 1XFBA 4NJHA 2A85A 3QMRA 3LXCA 4JEQA 4O12A 2OZ0A 3IIOA 2R94A 4AWSA 3LBMA 3EEGA 2J9ZA 5DXYA 2J88A 3FYPA 2EPHA 3O6YX 1WDWA 1WOBA 3BG5A 2VEPA 1XBVA 4FIQA 4HPJA 2QKFA 2YW4A 3KXQA 2J9XA 4NJJA 1QDSA 2Q8ZA 2CLKA 5AYXA 3DU0A 4A2RA 2BWGA 3TAKA 4BWLA 1XM3A 4S2CA 4IMGA 3IEBA 1RVGA 2F84A 3SW6A 1O5XA 3CM4A 3W1QA 2GOUA 1FCQA 2VOMA 1FWSA 3GYEA 3GDTA 1FCUA 4PEKA 1O5KA 3QYQA 4GUJA 2RDTA 2A5HA 3W7IA 4KFNA 3W70A 4EF8A 4Z08A 1I45A 2HS8A 4UIOA 4QIUA 2V9DA 3NEVA 1K02A 5CPNA 2QAPA 1OK4A 2KZHA 2QUUA 3UNDA 5KSWA 2NUWA 3GDRA 4JIQA 4BI6A 2V30A 3MI2A 1H5YA 2TSYA 1OVDA 3LXBA 1GVQA 2CLOA 3LX9A 3W83A 1KV5A 5AHMA 4LVFA 4Z0SA 1LORA 3ANYA 3UZ5A 1N55A 5D2TA 3NL6A 1V5XA 3BLIA 3TC6A 4O1AA 3NXFA 2QCDA 5G4WA 1QWGA 3S1WA 1I2NA 4ZQOA 3SGUA 4IMDA 4HN4A 1QOQA 1FCBA 2ZRWA 3W2NA 3DFSA 1R2SA 1QPQA 1LTDA 2C19A 4RV8A 4WX2A 1H63A 1GPWA 1ZALA 1EA0A 3NPXA 3MP5A 5K3VA 1U5JA 2FPTA 3DAQA 5FF7A 4Y96A 1L6SA 1VLIA 1ML1A 1Z41A 4M6QA 1EIXA 5D38A 1HTIA 3E12A 1R47A 4CQ8A 4DO6A 4KWWA 1YDVA 1C9DA 2Q3RA 1GT8A 1SO3A 5SWUA 3DKLA 2CLIA 3GK0A 4O15A 1VHCA 3M5XA 4UTIA 1SQ7A 5FEZA 4FNUA 1H7NA 3QC3A 4O28A 4NX5A 2TPSA 4G1KA 1RD5A 4K37A 3Q37A 3LGEA 4YMZA 3QRHA 3SY5A 3A23A 4HSOA 1AW1A 4JN6A 1KTBA 3QF0A 5FEXA 4Z1AA 1KW1A 6TIMA 5IBXC 1EB3A 2ZZ4A 4AWTA 4UFJA 5AC6A 1GOXA 2J6XA 3DGRA 5C54A 1AW2A 5G2IA 2ZZ2A 1FY6A 4Z1DA 4CLMA 3GB6A 1Z44A 1Q45A 4M19A 3W1MA 3TKFA 3NPVA 3W7JA 4OBTA 3LTYA 1GTHA 1SUXA 3EXTA 1ME9A 5FF3A 3FYOA 2E6FA 3WFAA 1JJKA 3STCA 3N73A 3P81A 2WV8A 3LV5A 1RQHA 1VRDA 1IXQA 2CZFA 3NA8A 1H7OA 4WXYA 1H7PA 3LCGA 1EUAA 1WAUA 1GJPA 3O05A 4HPXA 4U28A 4OT7A 3T7VA 2ZRYA 4WQ6A
chains in the Genus database with same CATH superfamily
1TA3A 3G8RA 1JUEA 2CESA 4FNQA 1G1YA 2FZMA 1IZCA 1NM9A 2WSRA 1JCNA 4YPJA 3WG6A 3TSBA 3M9YA 4MWAD 3VIGA 2OEMA 4NAEA 3BAKA 1OM0A 5CBIA 3P8IA 3NO1A 4FXSA 4C6NA 1L9WA 3LK6A 3OODA 2DFAA 3N1AA 4IOTA 1ADSA 4XZNX 4J3ZA 3RLUA 5D9OA 4UQBA 2RKXA 3NPUA 4BY3A 1KLZA 4DO4A 1OK6A 3VA8A 2ZZ3A 3TTOA 4GHRA 3LZ3A 3SUUA 4CU8A 3SY1A 4CCCA 3CC1A 3VDBA 4P61A 3CB3A 3T1GA 3TFXA 2CW6A 4H8VA 3E74A 4MF4A 3AUOA 1LDCA 3ATZA 3L4ZA 1LT8A 1BTCA 1EF2A 2J77A 1ISXA 3D0CA 1KNWA 5LXXA 2ISVA 1YE4A 1UIPA 3MCNA 3SIZA 2AL1A 2QDEA 1DYSA 1YIXA 2E67A 1BWKA 4F48A 3VGHA 5BXSA 1VR6A 2Y7EA 4K7VA 4C1LA 3W1TA 3BAJA 1HF6A 5A3HA 7TIMA 3UWQA 2H90A 4U2ZA 4GINA 4M81A 2NLYA 3KEHA 3GR8A 4LYKA 2VX4A 3AWNA 3AMLA 3B0XA 3CHDA 2PAJA 3VKCA 3CT7A 4AZ6A 1H11A 3TTEA 1A53A 3A3HA 3E0IA 3WQFA 5HPOA 4PMOA 3WQPA 3QOKA 3LCHA 1P43A 5DX7A 1BAGA 1JPDX 1Q65A 1CXLA 5CZTA 5C70A 4AEFA 1EP2A 2GSHA 2PLCA 2C1HA 2IPJA 3KLLA 2WCGA 4MDPA 1X8FA 2A3BA 4GUIA 1CGYA 3MO7A 2BY0A 2BOEX 1LBFA 3BZGA 1S5NA 4HPNA 2PWHA 3PJTA 4LJ3A 5A8MA 2PGEA 4LS1A 5FL0A 2IXUA 3TA6A 5AVHA 1CGVA 1KM4A 2RGMA 1W2PA 3KVJA 1VBJA 3FEMA 2D2HA 1IWAA 3BURA 2FB3A 3FGCB 3EA2A 3VNJA 4M51A 3JUGA 4M1RA 1OSEA 3TN5A 2ODOA 4K1WA 2GDQA 4QROA 1OCJA 3GE7A 1PHQA 1LT7A 3BMVA 1UJPA 3BDKA 4LW7A 1P6WA 4LAUA 4F0LA 4Q6XA 2PSNA 2ZADA 2YKKA 4L1GA 3QH2A 2CBJA 2BGNE 1HGYA 3AISA 3TQKA 3CU2A 3T2OA 3PBVA 1LWHA 4WDUA 4JTGA 2EEXA 3UF9A 1EOMA 4DYKA 4A8IA 1UP3A 3WQWA 4HNCA 5HWMA 4HSNA 3RO6A 1ZCOA 1H61A 3NR0A 1HO4A 2FIQA 4ACZA 1LOSA 5G2WA 3U0HA 3HGSA 3K8KA 4IPNB 3BMXA 4K3ZA 3HOJA 5ABFA 4ZCWA 5C9ZA 1NEYA 2A3HA 1ISYA 2TYSA 4LUIA 3BK0A 3QSRA 4YNGA 4IIBA 1H7WA 2WMFA 4P7QA 1C8VA 3E0FA 5HMDA 2QLYA 4QDWA 3YPIA 4JKKA 3CZGA 1B3OA 1EDGA 4GQGA 4MNLA 2GWNA 3NAVA 1UWQA 2ZYFA 3P67A 5FSDC 5JBFA 2OVLA 5AECA 4QAWA 3CTLA 3ZSSA 2E1WA 2XGBA 3ZZ1A 3IACA 3AIQA 3AWOA 1DVJA 3W3OA 3P80A 5FD0A 1MQPA 4Z1YA 7TAAA 1TE1A 4C6LA 1GYLA 4YHEA 1XJBA 4F0HA 1UKOA 1WBJA 6ENLA 2C6QA 4MPQA 1E0XA 3ZJ7A 1VPQA 3M4HA 3MSDA 3LY0A 2E28A 3LPOA 4PC8A 2Y2WA 4AD3A 4IL0A 3A47A 4ZXLA 3MYOA 4BJHA 2R8WA 3ITLA 4JKMA 4GISA 4IX0A 3MUIA 2ZUSA 1AQFA 2G37A 1RA5A 3IK2A 4DJDD 1PL9A 1TIMA 2J24A 2OB3A 2Z1BA 3TX9A 9XIAA 5I3DA 3KOZA 4CN4A 1ZJIA 5DLCA 1YW1A 3AICA 3ERPA 3URNA 5I78A 3FAWA 4KCUA 2XHYA 1TRDA 2NX9A 2VFEA 4M7TA 3VAVA 4GZ7A 5IHSA 1UWAA 4KKXA 3KBMA 4IG2A 4FLSA 4QFUA 5I5RA 5C55A 2BDQA 1U83A 2JBMA 4MWAE 4W8AA 2X7VA 3SI9A 3PZGA 2P50A 3SADA 1XXXA 1OD0A 4MHBA 1ZU8A 5AC5A 3UJ2A 4B2DA 3WQCA 3IJQA 1NQKA 4PCNA 3P61A 1S39A 3DCPA 4JX4A 3AHTA 5DXXA 2GWGA 2ZUVA 4AWUA 4ZSTA 3B0UX 3GDMA 5E6YA 1EOKA 1QHOA 3H21A 5DMNA 8XIAA 4HNOA 4MWAA 3NCOA 3K4DA 4TUFA 3R58A 1UUQA 3VYLA 3L4XA 4OVXA 1UD8A 4H1ZA 2VZUA 3FJLA 1Q8JA 4O57A 3W2UA 4KH2A 1QBBA 4KGLA 4JTIA 2REQA 7PTDA 3N6HA 3RGTA 1O4UA 4WOZA 3G0XA 1RCXB 2V5BA 2FZNA 2VNCA 3N19B 1S1RA 1XLCA 3SN1A 1CYGA 3CWOX 3W2MA 2ALRA 2D2GA 1TQXA 4QCEA 3B9EA 5LA2A 5F4XA 4DBEA 3OG3A 2XSXA 1O1ZA 1JF6A 3AROA 4RCXA 1UR3M 4HD5A 2JKAA 5DEZA 1SVDA 3NSMA 4QLJA 1QBAA 1ME8A 4DXXA 1O1HA 3BW4A 2HTMA 2YCEA 4WZHA 1SZGA 2JGYA 1RHCA 2IKJA 3I4EA 1OT2A 1I2OA 4JN7A 1WZKA 5TNVA 2DSVA 1WBHA 1XYCA 2O55A 1HJSA 1WNOA 3OLGA 5I06A 4HZ8A 5EGRA 4BZYA 3AU6A 4IMCA 3WDIA 2E68A 1BKSA 1GQKA 2YDQA 1KWGA 1IT8A 2ACRA 2YB4A 2WZIA 2NWRA 3K1DA 2C13A 5CC5A 1DP0A 4GRSA 4HU8A 5G1YA 2Y0FA 1P7TB 4XZBA 3B8IA 2Z00A 4ECLA 2A4AA 3TMLA 3UW6A 3ZVHA 2NUYA 2WVVB 1O5QA 1ZLPA 2R91A 3BGJA 3FFSA 3WUEA 1EWEA 3GDLA 1Y8BA 2CU0A 5DBTA 2G41A 3E0WA 3UGVA 3VD5A 1QI5A 3ARVA 1QR7A 1JPMA 1JL8A 3SQLA 3UERA 2W0UA 5CBJA 1ZAJA 1ZJAA 1HL8A 3MY9A 5I09A 1PIFA 1XS2A 4LANA 1SMDA 2CHOA 2GJXB 5IFTA 4QS6A 2P5NA 2G3IA 1XSJA 4DAIA 4M24A 1XL9A 2RDUA 5T8GA 4O0KA 3TW7A 2EBNA 1EWDA 3CEUA 3V1HA 2GQAA 3S9ZA 3MC5A 4LCRA 3NO3A 4ZODA 3GIPA 3W02A 3GNOA 1E1EA 2R6OA 4LOCA 3C61A 2Z24A 4AY8A 3U5UA 1VPXA 3HG5A 3T78A 1H41A 2W5FA 3NQ7A 3SCQA 2XFRA 1TWDA 3JR2A 3LCWA 1Y65A 1VENA 2OXNA 2PTYA 1IWPA 1ADDA 1EJRC 1V02E 4ZOAA 2ZTKA 3PUEA 2GJNA 1QUMA 1J01A 3R13A 3EOLA 3VIMA 3ZLFA 2B0MA 4BQ5A 3ZWSA 2UY2A 1PX3A 3WBWA 1R38A 2PDIA 3G8EA 2X7WA 2YGYA 4MKNA 4TO8A 3S6TA 4W4QA 1F76A 2WSQA 1GZGA 3W7MA 1SR0A 1I0BA 4LAMA 3AO0A 1XV8A 3GVWA 4DJED 4ZQNA 1H3GA 3SO7A 3QSTA 1T40A 4L4LA 4JYDA 4HA0A 1GGOA 1N7KA 2YW3A 2Y63A 2VCBA 2X1SA 4UR9A 3HG3A 5I3JA 2G4FA 3B06A 4XQ6A 2YLAA 4R33A 1E72M 1S5VA 1JXJA 1TJ0A 3WY1A 4HJWA 5BRBA 5LGZA 4CCZA 3OIHA 4GYFA 2W92A 4J9JA 2V5LA 5JH1A 1VAHA 3KL0A 1ZGDA 3WDHA 2PDYA 4HYWA 3PSVA 4M6UA 3T07A 4W9TA 4B3KA 4YL2A 5C6MA 1VCVA 1ONRA 1B4KA 1FKXA 1K9EA 4UNKA 6TAAA 3JS3A 3SCNA 4QEHA 2YL9A 1XYBA 3QJAA 3BARA 1IEXA 3SN0A 1XINA 3VNMA 1TMQA 1BXCA 3MVIA 5FJTA 3G22A 2WLYA 2ZFAA 1LBMA 2BG5A 2PF8A 3RU6A 2I14A 3G1FA 3GAYA 4YTUA 4OGZA 1F61A 2VZTA 4XAYA 3ZMRA 3K8MA 4J3XA 3KRZA 1P0DA 1KGWA 4UMAA 1GVFA 1AK5A 1UR2A 2R14A 2ON3A 3VVGA 2DJXA 7REQA 1H7RA 4JZ5A 4XB3A 2FZBA 3OYZA 3SDOA 1YXDA 2VHLA 4B4HA 3M0ZA 4AD5A 4QHRA 4GXPA 1CLKA 2O7SA 3OU8A 5KETA 3REQB 4XVEA 4MWAB 4HP5A 1Q66A 5HMSA 3U2EA 5EMKA 1V0MA 3WLRA 1DEDA 4UFMA 4OU1A 5KZEA 5K9XA 4NF7A 1MUWA 3AIVA 3B4YA 3PUGA 4XD3A 1MNZA 3BAYA 5D04C 3BQ6A 3GD6A 1H09A 3KBSA 4C60A 3M47A 3MP3A 1A3HA 1T7LA 2I5GA 3PZOA 1FH8A 3THCA 2QT3A 4NRSA 4C6FA 1SFTA 3KCJA 2YFNA 1C93A 1NFGA 1S2TA 4JQAA 2VXNA 3THDA 2XN0A 1OYAA 1L2UA 3PR2A 2UV8G 1VQTA 1DJNA 2NW0A 3VGBA 5A6BD 2I5IA 3TJLA 1TQJA 3TV8A 3CEPA 5CGQA 3CH0A 4H6RA 5D2VA 3T05A 1UKPA 3QXBA 1AW5A 1YE6A 2YYTA 2ZIDA 1JDEA 3BJSA 2WB5A 5A6KA 2C91A 3M44A 2ATMA 1EDQA 3EEZA 5IOBA 2GYIA 2ZUWA 1OIMA 4BF7A 3MS8A 3QPYA 4FA3A 5DN1A 3S9YA 1J96A 2PD5A 4LYRA 3DH7A 4XUGA 4O4WA 1DQWA 1SPQA 3K4WA 1AQMA 1HKVA 3D3AA 3UD6A 3PFMA 3C6CA 1YMYA 2XM2A 4EWND 1R85A 3M64A 4GUFA 1GONA 3STPA 3TEVA 2XWEA 5G4EA 9CGTA 4IP5A 1PZ3A 2YXXA 3WD0A 3F4WA 2PWFA 5CBBA 3QMSA 1IEVA 1LRQA 1VYSX 2D20A 4WKHA 1SZFA 1I2QA 1BEUA 4D1JA 4XVDA 3V0TA 3WD2A 2ZZ5A 3DHDA 4ICNA 2QPUA 2C18A 1Q4WA 2PC8A 2CLFA 3W7HA 2GJXA 1SFJA 5I24A 2DW6A 3E5PA 4WD0A 4LCSA 3ME3A 2FJUB 5TD4A 4Q7NA 1W3KA 3MBFA 4H8UA 5CG0A 4A3RA 2DZWA 3R1ZA 3UWUA 1J5SA 4AFYA 1ZCCA 4DM2A 3APGA 4CU6A 4LTSA 3WH8A 2E4TA 2MANA 1RBLA 3KRBA 1GKQA 1W54A 4DZ5A 3ABSA 3MUXA 4QNWA 3RPMA 6XIMA 1CXIA 3MSRA 1R2RA 4HYVA 2G8ZA 1VFLA 1IR2A 4HCDA 3W6YA 3OP2A 4UTUA 1Q3NA 3A12A 4NZ5A 1E40A 1TELA 3LI1A 1SSGA 4DUWA 3LOTA 1WYIA 3VNYA 2ZZ6A 3UXKA 3S2LA 1W91A 5AB3A 2E7FA 5A8GA 3GG8A 3LA4A 5M1TA 3H26A 3U9IA 3P0WA 4F9JA 3I10A 1OG6A 2HBXA 2VWTA 3GXNA 3GXFA 2AGTA 3TLLA 4QISA 4B3ZA 3IUDA 1PIGA 4KBXA 4QJ1A 3KX6A 4B91A 4HZ7A 4WGHA 4ZENA 3XISA 4BS0A 3AYTA 2AMXA 5H8UA 1OQFA 1XLHA 5BU9A 2G3FA 3W1RA 3ARTA 2ZX6A 1H51A 1IF2A 3PB0A 1HFBA 5CG7A 1EPVA 2VFHA 3U4FA 3BLDA 3EKLA 3LUTA 3O15A 2VD9A 4XIMA 3TUUA 3TYBA 1JYVA 4ERAA 3DEQA 3FHQA 1REQA 1OADA 1BVZA 3CL6A 3CHVA 3WDQA 4G7FA 3W2KA 3E2SA 4WDTA 3WEZA 4MB3A 3PTDA 2G5WA 3C52A 2FPYA 2Q3OA 5A8NA 1J8VA 2QGHA 3EX2A 4PCPA 4CNSA 1B90A 3LQGA 1FHDA 4E8GA 4AD4A 5C9WA 4TMBA 2Y70A 2ACQA 1SJAA 1A0EA 3DG6A 1B2YA 1VFOA 3ZWTA 2I5QA 1KKOA 2OR2A 3ARYA 1F6PA 3S2CA 2P53A 5EFDA 3NQ8A 3L23A 3LHVA 1ONEA 3MVTA 4HNNA 4EP8C 2J7FA 1GORA 1S1PA 3GS6A 3FS2A 2V3FA 3WEOA 1KBKA 4KW2A 2FB2A 1VYRA 1A50A 3EDDA 1RP9A 1KTCA 1OFBA 3M5YA 2F2KA 2CWXA 3PPHA 3M6YA 3U4AA 2F61A 1V51A 2P10A 2PDMA 1NH6A 3HU7A 2VT0A 3B05A 4UTHA 3WUFA 4GABA 3ZFHA 2OQHA 4O17A 1VHNA 4Y6GA 1OZMA 3BLKA 1UWUA 1EP3A 3BGGA 3L68A 3S0CA 4AHQA 4TVDA 3V75A 3USBA 2E6DA 1JI1A 1K9FA 5GNXA 4AZIA 1AA1B 2J25A 3GXTA 1XLAA 3HFTA 2P88A 2BY3A 2RAGA 1DWFM 1TPC1 4UUIA 1EEPA 3H7VA 3CIXA 5F4SA 4CQAA 4A22A 2Y8VA 1IZKA 1G69A 4RKAA 3CZLA 3O16A 4XX6A 4DLFA 1X97A 1JCLA 3QHOA 3TXZA 2NQLA 3KVLA 3T09A 3SGGA 4NNCA 2VRQA 4GZJA 3S1GA 4REQA 2EKCA 3DC8A 1GG1A 3R7MA 4PMXA 4NKCA 4F4RA 1FDZA 2WMIB 4CQCA 2FLIA 4DJFC 1A5LC 4IXHA 2WZTA 3VZYA 3DKJA 4H6QA 3WH6A 3NM3A 4IISA 4YWSA 3V16A 5G4HC 1PDYA 1OJXA 2DSWA 5TBOA 2ZX5A 4Q8PA 4KRTA 3QR3A 3UNTA 4EAMA 4PB3A 2DUAA 2PWGA 2PDUA 4S3FA 4YYCA 6REQB 2RH9A 5EMJA 2VDHA 5AZ1A 3FN9A 4FX7A 2HCVA 4GI9A 3AJXA 2NV2A 1KLYA 3WLPA 5HANA 1UJQA 1JCMP 2R9RA 1QPRA 3M0KA 2WCSA 3G0UA 3T8LA 3E38A 1TTJA 4YIWA 4Q7BA 3PP7A 1MFVA 1XGEA 3EX3A 2P3ZA 3S1XA 4LV4A 3UCDA 3QFWA 3QHMA 5M3WA 5KITA 1BQGA 1FHUA 1UD3A 3PG9A 2CHNA 4JOMA 2QDDA 4R5EA 4R7OA 1K8XA 4ZOEA 1DE6A 3FHAA 5C9UA 3I65A 1CB2A 1TPVA 4UXDA 3ARWA 4GD0A 3I3DA 1TWWA 1T96A 1AZ1A 3AHYA 4NILA 2VUYA 3QZAA 1ONXA 4DJEC 4DJFD 5LHFA 4QXIA 4JFTA 3TYDA 3UVIA 3WLMA 3HPAA 4AXKA 1B1YA 2UWFA 1A5NC 2NUXA 3A5FA 3SEPA 2RDWA 3IANA 3QW3A 4GX9A 1K8YA 4XSLA 4GI6A 1UKQA 4WCJA 4AXNA 2NQHA 5DRIA 2PWEA 4IXXA 4Z0JA 1F6YA 4M0XA 3LSCA 3AS2A 5BRQA 1M7XA 4WRHA 1C90A 4PTWA 4JIRA 4LS2A 3W07A 1R7OA 3UYIA 2Y5EA 3CAVA 1K3UA 4B5XA 4TTUA 4NJIA 4XKYA 3VK5A 1BYDA 3M16A 3B9AA 4HGXA 5CJNA 4CNUA 2GVYA 4Y9NA 1T8XA 4ICMA 1QHZA 1EF3A 2A2IA 3QC0A 5CAKA 3O63A 3C56A 1NFBA 1REQB 4B5TA 5A6BA 3OIXA 3WMLA 3DFPA 4ZMGA 3A6OA 5K4ZA 1G4PA 5HQEA 4C5ZA 2O0TA 4ZBCA 1CTNA 3A22A 1P48A 1T41A 1UA7A 4PBFA 3C8NA 3SRKA 2I7GA 3UG8A 3VDGA 2D2JA 3AYSA 2YPIA 3LENA 2CZVA 3FSTA 3PN8A 2DT1A 1LLOA 5H91A 1Q6EA 1WX0A 2VENA 1K7XA 3IPWA 3EMCA 2OJPA 1FXQA 4J5NA 1PE1A 2Z28A 1E56A 3WK2A 4F0KA 1MZHA 1JDCA 4XD4A 3BWWA 3DYOA 3GW0A 2WQPA 2V0TA 3EGJA 1LM1A 4QP0A 1KFBA 2FGZA 1MVYA 3TN3A 3OVQA 1GZ1A 3GIYA 3ITTA 4W86A 5TIMA 2WJFA 4AX7A 4HTBA 5GNYA 1JRBA 4H4IA 1Z32X 3RLVA 2FTPA 4UQ9A 3FKRA 1ZBWA 3ITOA 4Z42C 1JULA 4HHPA 1OBAA 3W72A 1PVNA 2BXVA 4GVFA 3GR4A 3CXOA 2Z6JA 4LFYA 3GC4A 3R79A 2Y7DA 3RMEA 4G1NA 3T0AA 4G6CA 5HWJA 1YTKA 2D3NA 3LQLA 3R0UA 4FOUA 4O19A 1QK0A 1ZBKA 1W1YA 3KBJA 1RUSA 4CNNA 1LL4A 1JUBA 2FTWA 3WNLA 1QO2A 2WMKA 4NJGA 3BV4A 1WE5A 4RV3A 1GNXA 4GQBA 3R25A 4IF2A 5EY5A 2AQOA 1MFUA 3VI2A 3WFLA 2DEPA 3W28A 3OLIA 4PBEA 4PTVA 1YNYA 4IMEA 4FNTA 2BFGA 2CLLA 2OT0A 4KWSA 4M6VA 1NU5A 5D4YA 4LRSA 2ZBTA 4GFSA 3WMSA 5CC7A 3L7RA 1U1UA 3CHFA 4REQB 1UB3A 4N9BA 1UUMA 2OLSA 4M56A 3QV8A 3QMRA 3TCSA 4JEQA 4W7UA 2OZ0A 4A6GA 2CIPA 1NP2A 1W1VA 4L56A 1JGMA 5DXYA 2PDNA 2J88A 1K4GA 3FSUA 1V6VA 1XQKA 3BG5A 4FIQA 1JGIA 2ZE3A 4IICA 2QKFA 3S47A 3KXQA 4XD5A 4B92A 2L5HA 4UOQA 5AYXA 4JTQA 4A2RA 1JIBA 2BWGA 2OKOA 3TAKA 1PX8A 1LWJA 4GVHA 4S2CA 3F5LA 3SW6A 1RVGA 1IT7A 4H19A 4HHHA 1PZ1A 1BHGA 2WVSA 3VKDA 2XVPA 3TN4A 1XIHA 1O5KA 5E9XA 3LPFA 4GUJA 4C90A 3M0MA 1KCLA 2XUCA 4LPCA 3WD3A 1WKYA 3ARUA 3RX3A 3W70A 1W3HA 2GOKA 4Z08A 3MO4A 2HS8A 3HMCA 1F9CA 3S5SA 2KAUC 3SBFA 2KZHA 3HPFA 2D2OA 1PZ2A 5AVNA 2FHBA 4BI6A 3CL7A 3MI2A 1H5YA 3E0LA 3LXBA 1GVQA 2CLOA 3LX9A 3QV9A 1V3JA 5AHMA 1WKDA 2R24A 4LVFA 4OIFA 1LORA 3UZ5A 1N55A 1KRCC 4AVOA 3GVRA 1XH1A 3S1WA 5IXEA 1FCBA 1R2SA 5A69A 1GPWA 1E3XA 4ROQA 1V6WA 3DAQA 5FF7A 4Y96A 1NTHA 1HTIA 4H9ZA 4ZGYA 4WKAA 4U3CA 4DO6A 1YDVA 2O92A 3OLDA 1NARA 2Q3RA 2BHYA 1QATA 5SWUA 1VHCA 3M5XA 4UTIA 3RG6A 4UTFA 4Z17A 3QC3A 4NX5A 1J6OA 5HDRA 3LGEA 3T81A 4C6OA 1E4MM 4JN6A 5A6JA 3VGFA 3RCYA 3FAXA 3V3WA 3VIOA 3J7HA 3N2BA 5IBXC 1Z89A 4PMUA 2VGGA 5AC6A 3DGRA 1VJZA 2PPGA 5JMUA 1AW2A 3MUY1 1P6CA 4Z1DA 1A4MA 4M19A 1Q45A 1Q13A 3GBEA 1HJXA 1HX0A 3W1MA 3BC9A 3NPVA 3WZ0E 2GFTA 2HE5A 2PTXA 3EXTA 4MJ4A 1UMYA 3MZNA 3FYOA 2E6FA 1V0NA 1XLFA 3A4JA 3STCA 3P81A 2QS8A 2VJXA 1R5YA 1IXQA 2CZFA 4CEUC 4WXYA 4ATWA 4DBUA 4S3GA 4PB4A 3EDEA 4ZB2A 3IJ6A 1K9DA 4QJ4B 4J2PA 2DW7A 1UHVA 1F8IA 1X8CA 4UR7A 1SGJA 2C16A 3WNMA 3HQ1A 3TWAA 3BXWA 2WMGA 4V28A 1F07A 1M03A 3E02A 4FX6M 5BZAA 2POTA 1UD6A 1DWGM 2AQVA 4MIMA 1C7TA 1OCQA 1DOSA 3HGRA 1KC7A 2WJEA 2BVTA 3AOFA 3GFYA 4C6PA 2JFEX 1D3HA 4PMZA 1KB3A 4I7WA 1Y7VA 2J7CA 1W56A 4E38A 2CBUA 2E9LA 3P84A 4F66A 2E6YA 5CLWA 2A6NA 2XFYA 1MW0A 3LV6A 3KBWA 2GVGA 5BCAA 4MAZA 1FWDC 2J4GA 1TPDA 4NZ3A 1X98A 2EPOA 4LAKA 2OYMA 4M7SA 1GQJA 1EFZA 2FZ8A 5EBAA 2C0AA 1V7AA 3R11A 1N8FA 5K9CA 2ALDA 4LXFA 3KVKA 3W26A 1FVPA 3W86A 5E1QA 2Q02A 3EWCA 4IMAA 4MM1A 4CN6A 1H62A 2PP1A 2JIEA 3FCPA 3QQ1A 2QYGA 4CD6A 3NZPA 1TR1A 2QVNA 1B9BA 4W85A 1W3LA 5CC3A 4YVVA 4ZR8A 4LS0A 4NNBA 1S3HA 5EPDA 4V27A 3WLNA 5CLTA 4JFUA 3SR7A 3WBXA 1KWKA 5D05A 1OX6A 4L9ZA 1XBYA 1PCWA 5FA5A 1G7VA 3MSGA 1X1ZA 3VFCA 2DVUA 2QV4A 2NXGA 5GQBA 5KINA 3POCA 1V4YA 4A35A 3KUMA 2PDWA 2BOFX 4N9EA 3BZJA 2NLIA 1KA9F 1UWIA 5BMWA 3SCPA 4AQLA 4F9DA 1F3WA 1S2WA 4KGJA 1R3RA 4UMBA 4W89A 3STFA 1FKWA 4AX6A 3UT0A 2JEQA 3PY2A 4I3GA 2VC5A 1OEPA 3PB2A 5TQLA 3M1ZA 1QOPA 2XFWA 4OOZA 2FMOA 1MW1A 3NQ6A 1YHTA 2OWCA 5FJJA 1SW3A 2QCNA 1HQTA 1LJYA 1SU5A 3LG3A 4PMQA 4DUOA 2GK1B 1XSIA 3V5FA 4S23A 1J2BA 4Y9AA 3VIIA 4PN2A 3VOJA 4XO7A 1FWNA 3E0VA 1XX1A 2XZ7A 4LVAA 3IVSA 4OTKA 2G50A 5REQB 1VBHA 4GUHA 1YKWA 2HROA 5TAOA 3FJ6A 4IJCA 4RXFA 4TX6A 3PULA 1BPLB 1W17A 5FJUA 4MJMA 1NF7A 3GVGA 4IPLA 4PL2A 4PA8A 1C8YA 3W9ZA 4GFIA 2IUZA 1PSCA 3VIFA 3O2LA 1KFWA 4GE8A 3C2EA 5A6TC 4F2BA 1OABA 3BTNA 3NQDA 1AZ2A 1V6YA 5AHNA 1J79A 3A9IA 4RZ4A 2WPGA 4UC5A 2G0WA 1AQHA 1SW0A 3TTQA 2CKSA 1O7AA 3BLLA 1PYMA 1THFD 2TMDA 4JR5A 1BD0A 1AJ0A 2UY3A 2HPIA 3VOCA 5A8OA 3ELFA 2YFOA 3P93A 5AC4A 1LP6A 1IIHA 4NY2A 4J1OA 4NUWA 2Q8LA 4CD7A 1QNOA 3ZIZA 5AOUA 3EWWA 1BTMA 1XLIA 2OX4A 4K8EA 4RNIA 3CV1A 3RM8A 1EPXA 2PDKA 2WSPA 2ZKMX 5LIWX 4ZE4A 3U6WA 3IAQA 1V0KA 4CD4A 3LRLA 1YTEA 3NVTA 4J3VA 3BVJA 2Y4SA 1C8XA 3HGOA 5IRPA 3EAUA 4LAOA 4GNKB 5LNUA 3U7VA 2XYLA 3DFQA 4HIBA 3OPSA 3RX2A 1E6PA 3CWHA 1PB0A 4OV9A 3RMJA 2XU2A 5E93A 1FCVA 4Q8UA 1I60A 4Q4RA 2W4XA 3MTWA 5JUVA 2DSKA 3SFKA 3HO8A 3H2MA 3VX0A 1LCOA 2ZA2A 2PBOA 1DJGA 1FWWA 1E1CB 2IQ0A 3UPBA 5FJRA 3LMYA 3UESA 3EDFA 3CUGA 4ACYA 1IGWA 4QJ3B 2SFPA 3LRMA 1H2JA 3L65A 4L80A 1R30A 4EKJA 3DHUA 3ABZA 3C0QA 4PMJA 1PCKA 1G0CA 2INFA 2GUBA 6XIAA 3A4XA 4IFRA 3KOFA 4RE3A 1J6PA 1NY1A 4X3ZA 3OB8A 1BG9A 2QJIA 3SSZA 3E6EA 3MDUA 4JTTA 5CPOA 1MXSA 2ZVIA 1EO5A 3V1PA 1VPYA 1JZ2A 4DJEA 2E9MA 3ZSTA 3BCJA 3V18A 1DWAM 2X2GA 3O9NA 1EX1A 4FALA 1LRNA 3H4XA 4LUTA 1MEHA 2Q8XA 3EOUA 1MW2A 3CQIA 2O56A 3MHGA 1Q7ZA 3W29A 2WWDA 3VD3A 3Q2DA 1LQ0A 3HBLA 5CCZA 4LV9A 5LIXX 1OCBA 2BZNA 1IXPA 5D9NA 3I68A 4UTJA 4GQ0A 1QT1A 1TCDA 4FAMA 2F6XA 4S3EA 1GWJA 1VFUA 1M41A 4FNSA 1GYNA 4C1NB 4EK7A 2ZUUA 4XD6A 1SFSA 1XLBA 4FMVA 1XIEA 4NSBA 2IMRA 1TPH1 1J4EA 4H83A 3T4WA 4CQ9A 4JEJA 1JZ4A 1TWZA 4X60A 4GKLA 3K5XA 1VIZA 4GO9A 3U2CA 2FDMA 4WSKA 1KFJA 3F4CA 1H49A 4LC6A 1W8SA 4BI7A 3LCXA 3LHZA 1KV8A 4R7WA 3GTHA 4C6KA 3T44A 3KOWA 2Y7GA 3ALGA 2B7NA 2QVHA 4DZAA 2ADAA 1EQPA 2XDFA 3CUHA 2H8XA 3GFXA 4O14A 1TSIA 3ZM8A 1CX9A 3HQPA 3WLOA 1HJQA 4UFKA 5G1TA 3WUGA 2J7BA 2VVNA 1TV7A 4HNUA 2WMHA 4PTXA 2W9MA 3DFOA 3T8QA 2Y24A 5HQMA 3FVDA 4G9PA 4IFKB 4Z2HA 4JTJA 2EJ1A 3P74A 5I03A 3T2PA 3MHFA 1DWIM 2CFFA 5F2MA 4L9XA 3MMUA 2GK1A 3BMWA 1HVQA 3K2GA 3HN3A 1ZL1A 3N6JA 1OCNA 3WD1A 1RJPA 1CENA 2PU0A 5HNUA 1HP5A 4P7OA 1MEWA 1KM1A 3B8VA 1I2RA 2HQAA 3PAJA 1YDOA 1AH3A 3HV8A 1GOIA 1XSKA 4B15A 3ABQA 3EWDA 4X9SA 1KR1A 1MUCA 4MUPA 3EXSA 3CH9A 1GK8A 1XIDA 3GX9A 4KETA 3KCLA 4M1BA 2GGEA 4HK6A 2G3NA 3F2CA 3SCRA 1QWKA 4ZXOA 3QTGA 5KEZA 2JE8A 4GIRA 6A3HA 2ASHA 3C2OA 4P7NA 3S1VA 3HQNA 3B03A 1OY0A 3DENA 1A0DA 3DC0A 5DY2A 4KEZA 4UQDA 4AZGA 2QCEA 3MWCA 1YRRA 2PB1A 5J5DA 1PKNA 2YL8A 1WDRA 7XIMA 3LERA 4LX4A 4GWEA 3VC5A 5I3KA 2RHGA 3VZXA 3W7LA 5JVLA 4LY8A 3G77A 5KZMA 4KIRA 1PIIA 1KXHA 2A7NA 2VELA 3N2CA 4GY7A 3VD9A 5FOOA 2Z2UA 2Z7GA 3CNYA 3RITA 1G9HA 3L2LA 1TWSA 2BMBA 4Q32A 5C9RA 4LNCA 4Q8TA 1WDPA 4BI5A 3H12A 5LIUX 1V08A 3UY7A 2QCCA 1J0KA 3OGVA 4BHYA 4HU4A 1GW1A 4AZBA 2H9AB 4A2SA 2Q01A 2GJPA 4QR6A 2FVKA 3NQVA 2G97A 4B4FA 3ZJKA 4UB9A 3OG2A 1LOLA 4IZGA 3ABOA 3BG9A 1GKPA 3LHYA 5G2HA 1GOMA 2DSZA 2DPEA 1XBXA 2J9YA 2HPMA 4XTIA 3EB2A 3FA3A 3BAXA 3PBGA 3OEXA 3N13A 3TK7A 1LLWA 4FXFA 3QW4B 4NZ1A 3POHA 4RJEA 4PMDA 1R3SA 6PTDA 1QRQA 5LNWA 4JQ2A 3CK5A 5DQPA 3CO8A 2PURA 4L1WA 5C0QA 3M0JA 3TFCA 4JS3A 1E1CA 4QE4A 2JKPA 3VOIA 3MHUA 1OIFA 2D69A 3EOOA 3U8GA 3VGGA 4IP7A 1L8PA 2RJHA 1IXOA 1P0NA 4H7ZA 3R0KA 4YN5A 3EPMA 1E0WA 1R3WA 3EX1A 3L4TA 5D9PA 2BNJA 4WJXA 3W24A 4H9MA 4LEQA 1ISVA 1TG7A 1FTXA 4RDWA 4S3DA 5B7ZA 3WF3A 4P5UA 1J0YA 1SFLA 1KBIA 1VKFA 5A6MA 3S3GA 2UZ9A 1RH9A 3H4GA 4IPIA 1UD5A 4EXQA 4H41A 3KVMA 3DOPA 1MQRA 3DIPA 1ZSXA 3H7RA 2R1KA 4S39A 4JTUA 4QE1A 1EHAA 3JRKA 2WXDM 1EX5A 3VILA 2J7GA 1QW9A 4YVXA 4YCPA 3VGEA 4HB7A 4MKVA 5E9AA 1W5NA 1JNEA 1FDJA 3VOFA 1ZNNA 1ICPA 2YA1A 3WQDA 3LI0A 4ZFCA 3HZ3A 3FGCA 4UFHA 3H55A 4N9CA 4DWDA 5AYBA 4IUOA 2Y5JA 1V03A 3I7QA 5DANA 4NXSA 4RE0A 1K1DA 3WLJA 1TUFA 3CPUA 1ZPTA 3LLXA 2D22A 1Q7QA 3LTPA 1BVNP 1A3XA 3EPNA 3BOLA 3AS1A 2VTFA 4LQ1A 1RK6A 1BWVA 4IIFA 2XFFA 4K8GA 3HJZA 3B8WA 1KFEA 1A5KC 3CYJA 3KDOA 1EXBA 5BNKA 4M3PA 1A80A 4W87A 5G5IA 3ZR5A 3LTSA 3RDKA 4UFIA 1PWLA 3TQPA 3W7CA 4IFOA 4P7RA 1S2VA 5ABFB 1B4EA 2VYOA 2E5CA 1TE6A 2HWGA 4TQTA 1DWJM 2Z1KA 2PWDA 5IHRA 4GYJA 3CQHA 1Y5WA 3P7YA 3ZR6A 1EA9C 4US5D 1KFLA 1QNPA 4NVTA 2RGLA 1Q6OA 1GQNA 1UASA 4IFKA 5IDIA 4QQUA 1TV5A 4ONVA 1K03A 4TIMA 3UZXA 3NDZA 3LU2A 3OJGA 2MUCA 2CZEA 3LBCA 2J79A 4E2VA 4GNVA 4GGHA 2YOCA 2FPVA 2VRJA 4O16A 2VKZG 3UXLA 1J11A 3A3WA 2P0IA 5I7GA 3L5LA 4MY1A 3D3FA 1G01A 3W7QA 4C1KA 1ALDA 1XG4A 2PI6A 3P6LA 5HULA 2NVAA 1XQLA 2OX1A 3C2FA 2PDCA 2ZA1A 3L21A 1UQYA 1WOAA 2EO7A 4BR1A 3URQA 3T0DA 3WL0A 3VX1A 1FWGC 1UW9A 2J66A 1YNQA 3URBA 2PF0A 1R9YA 1EYWA 1JRCA 4NAFB 5FAJA 1H60A 3R6IA 2VEFA 4E4PA 3MKKA 3R8RA 2ZXQA 2QDGA 5HA7A 1AL8A 2W79A 3G18A 4GCAA 4IG2B 1TZ7A 3UA4A 3F2BA 4GZIA 1XDMA 4MG4A 5XIMA 1HG3A 2E9BA 5FF0A 3WN6A 4E8CA 4GX8A 4XBKA 3GO2A 1FX6A 1C7SA 1XPYA 2QJMA 5D2XA 2H9AA 4HHMA 3VABA 1QMLA 5HUPA 3KRSA 2GLKA 2Y5SA 3BW2A 3PG8A 4UQEA 4EWJA 4YTSA 4YJ5A 2H3BA 1ZS2A 3VPLA 4HN8A 4C7DA 4W88A 5J04A 3FX4A 4HBKA 3KM8A 3PBMA 4H9TA 3SM0A 2PBGA 4EF9A 3LD5A 1UKTA 3G0SA 1GCYA 1M3UA 3NQMA 3KLKA 3S83A 2XJ7A 4Q8VA 1OC7A 3BL3A 3BLFA 3W84A 2ATSA 5CSYA 2NXIA 4A05A 3UR5A 1OFPA 1UD2A 3CQKA 1SW7A 4JN8A 2ZC1A 2GUYA 1UZ1A 4NNAA 3DN5A 1HO1A 4EANA 1T8QA 3ZT5A 4C6EA 3W82A 2VVSA 4O1CA 1JR1A 2WYSA 4H7CA 2NV9A 1G5AA 1J0HA 4HK7A 1UA3A 2OZTA 5EU9A 4Q8OA 5EA9A 2YL6A 3N2TA 4JTSA 4MJ2A 3UZZA 4XZWA 3G1DA 4IQDA 1WUFA 2O9RA 2E6AA 4J3WA 3NGFA 3FNDA 2IXVA 2OKTA 1TTIA 3R8HA 2VD8A 4C7GA 2LLEA 4IWWA 3H24A 4AF0A 4AIUA 3O8AA 4GGBA 1FWTA 3GKAA 4PUNA 2GSEA 3TJ4A 1US2A 1OGBA 3W7NA 4N6EA 3OZYA 2WCAA 1TB3A 3SSJA 1GEHA 1E9ZB 1S2CA 1EZ2A 2ICSA 1L0PA 4P8XA 4E8DA 1DJZA 1J0JA 1GVEA 1TMLA 5HMEA 3ZVHB 3TC7A 4Z2LA 1RD6A 2ISFA 2OTDA 3W38A 3R0DA 3I6EA 1CZ1A 3U7BA 4TMCA 4D6FA 2WSKA 2PDLA 4JX6A 3WCZA 3WNNA 2XH2A 2Z7KA 1S5TA 2ZZ1A 3WBAA 3UR8A 2Z2AA 4LH8A 4DAFA 3FKKA 5DMLA 8RUCA 4JTRA 4G7EA 3ZVIA 3KP0A 3U5YA 2WZMA 4OWGA 3A3XA 1LRTA 2X0YA 3GU1A 4BQ2A 3VIJA 4R27A 2W67A 1U1JA 3QFEA 3G6LA 3W85A 3W88A 4XZMX 4XKMA 4HPGA 1PO9A 1G4EA 1CIUA 4KPLA 1ODUA 2OYKA 1QJWA 3NXLA 3KE0A 1X96A 4HHLA 3UJSA 3O3RA 1E70M 1C92A 2CETA 4IIEA 1XCFA 3F7JA 3RN6A 2W6RA 1QPNA 5F1UA 4UCGA 2G3JA 4D8ZA 3HG2A 4O18A 2C3ZA 3WL1A 2EXOA 3G1YA 1WZAA 3THAA 1DIOA 4F3HA 2QJJA 2X16A 5GNZA 1HL2A 2BVYA 4PRRA 3MQTA 2PODA 4DPPA 4CEXC 3PZMA 3BOFA 3SUWA 4RR4A 4HOWA 4JTHA 1KBLA 2BY1A 4PYSA 2A21A 2EGZA 3NDYA 4DYJA 2ABAA 1V77A 2V68A 2VEGA 3TVAA 4PCFA 2QIIA 3PWIA 3CMFA 2OO6A 1A4LA 1NSJA 1GQLA 3CV2A 3VCRA 3B0PA 3N2OA 3KTXA 2E1DA 2GVJA 2E77A 2JEPA 4PFMA 2J7HA 2IPGA 3N9KA 3SJ3A 3W76A 4F0SA 4FK9A 2CBVA 1T0OA 2YCJA 3FA5A 3IJLA 1B3YA 3U2ZA 1FWHC 1MUMA 3MCMA 4JDYA 2VX6A 2EQDA 4AC1X 5FKYA 2OLAA 3OYXA 4R9XA 2WKJA 2OOGA 4BF9A 4Y9MA 1M01A 4PCTA 4FLRA 3NQ2A 4IJBA 4NG3A 2G3MA 1PS9A 3EKGA 1ELSA 1W3JA 2BSLA 2XVNA 2DIEA 3BJTA 1UR9A 2Y8UA 4GACA 2OSWA 2IPFA 3R5EA 4NP7A 4IHCA 1PTGA 1XKYA 3KWXA 1EC8A 3JW7A 3MUAA 2VC6A 1TJ1A 2ZWZA 1GVYA 4B5NA 4Z1BA 2WJZA 4FB7A 4UBPC 1TVNA 4Y9OA 3WMBA 3VGDA 2F9RA 3ZO9A 3SQSA 2YJQA 2V67A 2XGZA 1S2AA 1O6IA 5K7JA 2ABBA 1LQ2A 3VKBA 3REQA 1VF8A 1WUEA 4GVIA 8CGTA 2IKGA 1DWHM 3GHTA 3OBEA 3WELA 1PTAA 2D24A 4ML9A 4WLCA 4HMNA 4QS5A 4CU7A 1J9YA 5HNRA 1JAKA 3S1UA 4GH3A 1XIJA 3T55A 2VX5A 5HR6A 4PUMA 3T40A 1O60A 4AHOA 4S2BA 1LF1A 2OOFA 4Q8NA 5CAHA 4I7VA 3EKZA 1E0UA 3WF2A 3WQ5A 2Z25A 2ONEA 4J3TA 3Q67A 2DZUA 1M68A 3R89A 2DGAA 5LKYA 3S9IA 3TMQA 4BQ4A 4PB5A 3OGSA 4H9YA 5LNVA 1UOZA 1XD0A 4C6MA 3ARPA 1Z9AA 1FXPA 5EL1A 3A24A 1VYPX 3UFYA 4NZCA 3SRHA 3IGUA 1OF8A 5EYWA 4F8XA 1JEZA 4GIAA 3HPSA 1B3WA 2W63A 3WYZA 3NTYA 4E2OA 2DU2A 1Z7AA 3WNKA 4JNYA 2GQ9A 4ZA0A 3H8AA 1JZ3A 2Q09A 2H6RA 3AZTA 4YTTA 1GVSA 2BS9A 1HIZA 1HP4A 3HTWA 4GZEA 5A94A 4ZVJA 4AF0B 3DUGA 2VGIA 3WLQA 3W53A 4FP1A 3C4UA 5DCDA 1RR2A 3GTIA 2F6UA 3ZJ8A 3FDKA 4A3YA 4D9PA 4GMEA 2PGFA 1WO2A 2YX0A 2BXZA 3B0YA 4FZIA 5T26A 2FFCA 5LZLA 1WKFA 3SCWA 3EWUA 4AW7A 2X41A 3PBYA 4W8BA 3VTRA 1CLXA 2C7FA 2VP8A 2F6KA 4PUWA 1QPKA 8TIMA 4AC7C 5BYWA 3CZEA 1PAMA 1XLMA 2IKIA 2QCMA 3S5OA 2EAWA 1WDQA 3I6RA 4MY8A 4QG8A 1C29A 3F2DA 3WKZA 4LSBA 4E2BA 5GJPA 3VKKA 1H50A 3UGRA 4ASTA 3ZJ6A 2VEIA 1BXBA 8XIMA 3AQUA 1M7OA 3N3MA 3B8UA 2VZOA 3ZR4A 4ATDA 3KDNA 1IR1A 4MFEA 3JZUA 3T0TA 4NASA 5M17A 1CGWA 1KM3A 2BB0A 4A4AA 2D3LA 3VMOA 4AG0A 1FP8A 3VZZA 4O12A 1BSLA 3IIOA 1UR1A 1BSIA 3LBMA 3CAQA 2EPHA 4P8VA 3O6YX 1WOBA 3PZ9A 1UROA 1GW9A 1LL6A 3CASA 4IJRA 3I3BA 1UR4A 4QX4A 2J9XA 4FOJA 4NJJA 3QGKC 2PLMA 2AKMA 1RK5A 3DU0A 4OBSA 3GH7A 2XWDA 3CQJA 3OOQA 4BWLA 1XM3A 1EH9A 4IMGA 1X6NA 2F84A 3TYZA 2BP1A 3CM4A 3W1QA 4PEKA 3D46A 4JKLA 1XPGA 2RDTA 3I6TA 2GDVA 2A5HA 2CCRA 4GYPA 4PBGA 2PDBA 2J7DA 4GXWA 1I45A 1XRSA 3WF0A 2V9DA 4QG6A 4TVCA 2QUUA 3UNDA 3RYSA 1XICA 2OSYA 2NUWA 4JIQA 3ARRA 3GWQA 2PDFA 2R1PA 2YA2A 3ZLHA 4Z0SA 1M1BA 4ZO9A 1MQQA 1TFVA 3ANYA 2BHZA 2PDHA 1XFCA 3BLIA 5G4WA 2CEQA 2O4QA 1QWGA 2GGIA 3SGUA 1GOKA 3KL3A 5FIPA 4FR1A 3OTRA 2QNEA 2ZRWA 5FJPA 3DFSA 1QPQA 1HZYA 1X38A 3BSGA 1JNDA 4RV8A 4WX2A 1ZALA 1V8EA 3NPXA 5K3VA 3I3EA 2FPTA 1F3TA 3DYMA 1ML1A 4NRRA 4ICCX 3LBOA 2R82A 1GT8A 2MNRA 1SO3A 3DKLA 4O15A 2D0HA 3GU9A 3VINA 4PMYA 4PTMA 1SQ7A 3VXGA 1H7NA 1NJJA 4O28A 2CXGA 2X0SA 1DJWA 2TPSA 4G1KA 4LCQA 2I57A 3QRHA 5LXEA 3ANUA 3QF0A 2ZUMA 1KW1A 2JF6A 1EB3A 3E2RA 2ZZ4A 2GVEA 4AWTA 1U30A 1A0CA 1GOXA 1RLCL 4CVUA 3DFHA 4H01A 4JL1A 5C54A 5AKQA 4HTYA 1FY6A 1J18A 1Z44A 2VR2A 3TKFA 2DV0A 3M0HA 2VUNA 2EG7A 1SUXA 1US0A 3WH7A 2TAAA 1VP5A 3XINA 3N73A 1VRDA 3GY1A 1H7OA 3BAIA 5DMYA 1W1TA 1WAUA 3MCOA 4B2DD 4WSHA 4AD1A 3IUHA 1EKOA 1DJYA 3WF4A 2ZRYA 4WQ6A 2CBIA 1XISA 1CGXA 3S6DA 1Z3NA 5CJMA 4Z1CA 3M0XA 1V3LA 4HNTA 3OBAA 1BRLB 4EPBC 3GU2A 4GYKA 4DF1A 2XGIA 4E0CA 2V5DA 4HKPA 3BICA 3KHJA 1V02A 3T0CA 3W4RA 3BQ5A 4NYYA 3AI0A 4PULA 4OBRA 1GVRA 3WUBA 1M6JA 2DVXA 4WIWA 4R53A 3ZYZA 1DXFA 3M07A 3P3BA 1TJRA 1YBQB 1MZRA 4GJJA 4X2RA 4H7VA 1KBBA 2QUTA 2WMIA 1Q6CA 4JQ3A 3NQEA 5FI8A 4OE7A 5HATA 3W1NA 3PTMA 3UR7A 3TSDA 5HNTA 1R3QA 3L5AA 4ZL1A 3MU7A 4GQRA 2AKZA 5I2UA 4EACA 4CD8A 1TPUA 3H23A 1K4HA 1PTDA 2JIWA 4K39A 2DQXA 4KFPA 1E4LA 2FJKA 2DZTA 3M46A 1MDRA 5CZ0A 2PRLA 1GTEA 1BGAA 2RDXA 3AMGA 4GCXA 4TR9A 4UOZA 1BF2A 3UWEA 4EXAA 3IV3A 3EX6A 2QDHA 2NX1A 4NI8A 3L4VA 2DSUA 4KFOA 2V5KA 4N7QA 4AIOA 3KTSA 4L6HA 2V81A 4GXMA 3F4VA 4D6IA 3TQVA 4XWUA 2HK0A 4RZ6A 3EXRA 4U31A 3WDPP 3M6DA 3DGBA 1XLLA 1XYLA 3UU0A 3TYCA 2V2CA 3GUGA 4LYQA 3USZA 1PX4A 4PR4A 5AN7A 3LHUA 2WLZA 5C2GA 1IV8A 1QOXA 1SJCA 1WPCA 2QR6A 1RVKA 3TOPA 5BROA 1VJIA 3V4BA 1JPHA 3NIYA 1IQ8A 4YVPA 1OYBA 3UCCA 4UNLA 1AQ0A 1K70A 2V5CA 1VEMA 2X1UA 3APYA 3I7RA 5D09A 4IIDA 3PK7A 1VRXA 2E5BA 3BANA 3F4NA 3FV9A 1CBGA 4DZIA 4YWIA 2ZZ7A 2V3DA 4R34A 2ZTJA 3UQNA 3BG3A 1R9ZA 5U4NA 1Q63A 1BKHA 3NZQA 5D32A 1AL7A 4JIPA 2CLHA 1UC4A 1NWUA 3WDJA 1KCXA 1R87A 4GY1A 3VIHA 4ZB0A 3UXAA 1VB9A 1FWIC 2XN1A 1FWEC 2YXOA 2A7RA 2YDAA 3BPWA 3MZ2A 5FAGA 4Y9PA 1LROA 3N34A 4AIEA 1UG6A 4XKYB 4FO4A 1E55A 1Q8AA 2VZVA 3L5MA 1XDLA 3QBUA 5E0KA 1FDYA 3SUTA 1E43A 3GVQA 2HEJA 1NOFA 4LALA 5A2BA 5JBEA 1Q2SA 3VE9A 4Z2JA 1TWIA 1R46A 1TTQA 1TZZA 4GY0A 3CIVA 1FUYA 5AY7A 5DT5A 2WZHA 2WSYA 3CZKA 3W1AA 5A6AA 1V3KA 4L64A 3WDRA 4WJEA 3GBDA 1S5MA 4O1FA 3LSBA 3CHEA 1I8JA 3LYEA 4MTVA 1F6KA 1HT6A 5GVJA 4HMEA 4OUIA 4OECA 3WIJA 3GNNA 1ZP4A 3IIPA 2OEKA 4ZEPA 3EYPA 3QR1A 4O50A 4O1BA 1D3CA 4GI8A 1EO7A 4ZZ9A 4WXZA 4MB1A 1TIWA 1V6UA 1YEYA 4KWOA 1XKJA 3W01A 1ZTVA 3W1PA 4AIBA 1N8WA 3HPZA 3RR4A 4W84A 1LG1A 4PE8A 4DUXA 4B5UA 4MPKA 3LM7A 3SGZA 3VKAA 3QEZA 4HMCA 4AVFA 1W0MA 2V2HA 4W93A 4TVUA 1C91A 4ZO8A 1GVIA 2V3GA 3UXDA 2AAAA 5A8PA 2HK1A 1Z8AA 4JTEA 6CGTA 1RXOB 1QNSA 1EDTA 1BXNA 2FMNA 1XF0A 2ZUTA 4C91A 5BWAA 1NWTA 5DF0A 3RRXA 3TQ0A 3PZNA 3OLEA 2QPXA 2WC3A 5CPSA 3TU9A 5CSRA 4P7LA 1X7IA 4NT0A 3A21A 1BRLA 2HVOA 1XI3A 2OO0A 1SR9A 1EC7A 3GSMA 3ORWA 3K1GA 2QQ6A 2PZNA 2Z1WA 2PLKA 1KQZA 3GVVA 2GPTA 1XDJA 3UPMA 4GOAA 3H54A 3H6OA 1PJ9A 2DZXA 3NVDA 3O6AA 1NWRA 2QUMA 3GRIA 4AVNA 2PRHA 1NDZA 4WDWA 2PGRA 5HMFA 4O8AA 3WH9A 1XRTA 4GJIA 1VBGA 3JU2A 1UR0A 1YBQA 4AMCA 3K30A 4DYEA 1KR0A 1H7XA 2W66A 4XK2A 3NO5A 5ECVA 4TXEA 3W6LA 4DZHA 3MB9A 5M5DA 2RJGA 3TW6A 4C6JA 1MXGA 4I8DA 3VMPA 5M2FX 1K6WA 3SRDA 2G96A 3GHRA 4B5VA 4AISA 4S1FA 3BUVA 3NL3A 4KEMA 4UTTC 4E3VA 3OO2A 2CLMA 4D6EA 4IL2A 1XGZA 3AYVA 1UBSA 3AXHA 3W23A 4C65A 2Y6ZA 3STEA 5EMLA 4O0ZA 1LUCB 1VGAA 4DXKA 5HJXA 4NI3A 2QPSA 1NAL1 1ME7A 3WLIA 2PP3A 1VC4A 2XH7A 5I00A 1GHRA 3GNPA 5HQLA 2DIKA 1QI3A 4Q7IA 2C8NA 4NL1A 1M5WA 3WJZA 1A5AA 1TJPA 2VFFA 3HMJG 2CLPA 1V93A 1DHPA 1XLEA 1OD8A 1UYQA 3KP1A 2YXGA 2E0PA 4XBSA 3PZQA 1GZJA 3B04A 4GNJA 4ZTYA 3AYRA 4AUBA 1JD7A 3C3NA 3PBUA 5HUOA 4DI9A 2QGYA 2X09A 1OFEA 3S2JA 4UMCA 1T6MA 3JVAA 1ZJBA 4MJZA 4NX0A 4P2VA 5BRPA 3PZTA 1FFRA 3UBPC 3SUVA 1XLKA 1DTUA 2ZRZA 1D7FA 4QLLA 1HXJA 4UR8A 3PPFA 2J7EA 1EIBA 3KWSA 4X0NA 3BGAA 3CL8A 1LZOA 2ZDRA 4JQ4A 1EJUC 2ZRUA 4K2SA 1XRVA 4NJKA 3DDMA 1ZZMA 1HKWA 1V79A 3O06A 3WK0A 3TLQA 1CB7B 3RNDA 3R4IA 3A9BA 5CSUA 1UUOA 1XHGA 4Y90A 4O10A 1RZMA 2RUSA 2ZOXA 3AAMA 3MKCA 5CC6A 1KGUA 5KMYA 1QXLA 4QBXA 4QSHA 2F38A 1DV7A 5EB8A 3NSXA 5JU6A 1GEQA 1VBUA 2J6VA 2CZDA 1HJWA 5GJNA 1FA2A 4V33A 3AIBA 1H1ZA 4AHPA 3QHNA 1NDWA 4MFDA 2I9EA 1D8WA 5E09A 2QJGA 2UY5A 1S5WA 3QOMA 4PODA 3W2LA 4H3DA 5C9XA 3AU2A 4WY0B 3LMZA 4C6BA 1CXEA 1UCWA 4TV5A 3L2IA 4DB7A 4AD2A 2WPBA 1KRAC 5FSEC 1R6WA 1EGMA 4I6KA 1B3ZA 5C7HA 3NZGA 3LGDA 1YYAA 4RPPA 4HZ6A 3QY8A 5E70A 3M0YA 2ZVRA 2V6AA 4H04A 3WJSA 1D9EA 3F1QA 3VDAA 1F5ZA 2EG8A 3QY6A 1OC6A 2BHUA 1QU4A 3SJNA 3KRUA 4E5TA 1WP6A 1CT5A 2GGHA 3WO8A 4RX0A 3NM1A 1RY8A 1OX4B 4K7YA 4A8NA 2IW0A 1E6XM 4L4MA 5LNRA 2BGQA 1JZ5A 4JNMA 4DN1A 1R3YA 2CKRA 2ZA3A 4UNIA 3EX4A 2XG9A 2QJNA 3LDVA 1LOQA 4LUSA 2XZ9A 4QDMA 2XH4A 2A79A 4JY8A 4R85A 4GA8A 5BXPA 4M5PA 2FZ9A 2C1GA 4W5ZA 3BO9A 4JDBA 1HKMA 3CO4A 5A2AA 4W7WA 2NZLA 3N04A 1RY0A 1WZMA 4L4PA 3CGTA 4W8LA 3PSWA 5D8WA 5HNNA 4A3QA 4QG9A 3PVFA 1W5QA 2Z6IA 1F74A 2WC7A 1BWLA 1ZP3A 5AYZA 1PDZA 1YTDA 3HA1A 2E8ZA 1YLVA 3BJFA 4LU0A 4DF0A 1Q2RA 1G67A 4FXRA 4JNZA 1IZJA 1E6QM 3RUBL 3LHWA 3SB0A 4QSFA 1D2KA 2DT0A 2WHJA 1NF0A 3IUIA 3QLDA 1Q6FA 1OFRA 1L6WA 3EWXA 1UP0A 2DJLA 1G6CA 1W2VA 1R0MA 3FJ4A 1G7UA 1UR8A 2QXWA 3LB0A 3PPGA 1XCXA 3Q58A 4NYUA 2BVDA 4MOZA 4EPEC 3CPGA 3NYZA 4PH6A 4L65A 4ZQMA 4PUDA 1OX5A 1QK2A 3RJYA 5GJMA 2FZDA 5F1VA 1EBHA 1XR2A 3LXAA 1TUXA 1TPEA 2Y61A 4GUGA 1JYNA 4K38A 4A8LA 1Z6KA 3EB3A 3VNZA 4GI4A 3W2JA 2WK2A 2W61A 2D1ZA 4D8LA 3WLKX 5HWNA 1UP2A 1BGGA 1AG1O 1LL7A 4M8UA 4FIRA 4BA0A 3PWAA 4X22A 4DWSB 5M03A 1R8LA 2A3LA