1IXOA

Enzyme-analogue substrate complex of pyridoxine 5'-phosphate synthase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
242
structure length
235
Chain Sequence
b'AELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLEARG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxine 5'-Phosphate synthase
publication title Enzyme-ligand complexes of pyridoxine 5'-phosphate synthase: implications for substrate binding and catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 95
structure length 235
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2002-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ixoA00
4HIBA 5LKYA 4N9DA 2NXGA 3KVMA 3NYZA 3W7GA 2VFIA 3C8FA 3DFQA 3MI2A 1IF2A 3W7LA 2C15A 1SW0A 4OQVA 4CNOA 4NX0A 4L4MA 3LCLA 3G8EA 3GX9A 2BTMA 4X3ZA 3DENA 3QJAA 4LV9A 3TJLA 5LNSA 2V2DA 3R8RA 3HG2A 2EHHA 3MBFA 3USBA 3FYOA 1XC4A 5AYXA 4UMCA 2BWGA 2CLEA 4C1KA 1TMHA 3ZS4A 3C0JA 4JY8A 1QNVA 4EIVA 2GQ9A 4EF9A 3N2MA 4UTHA 4QQ3A 1W3IA 4ZQPA 4JTGA 4QJ1A 3QMRA 2Y63A 1T0OA 1IXOA 2QEZA 1Z48A 2NUYA 1UCWA 3LV5A 3E12A 5KITA 1P0NA 1TV7A 1NF0A 5BOOA 1ZENA 3QZEA 1K8YA 3I6RA 2NUXA 3HJZA 1AW2A 2CZFA 3TSBA 4UTMA 5F1UA 4NXSA 4Z1DA 3LCHA 2B7NA 1NVMA 2FLIA 4MVAA 2ZA3A 1JVNA 3EB2A 4LVDA 5D05A 1SQ7A 1I2NA 1PS9A 1TPB1 3GKFA 5CGQA 5LNWA 1Z44A 1LM1A 4FX6M 2E5DA 4NNAA 3L0NA 4NJJA 4N6EA 3PSVA 4O54A 3P5ZA 3IGSA 4JS3A 1Y0EA 3SGZA 3C61A 1OHLA 1RPXA 3PB0A 2A7RA 4IMEA 1R30A 4MY9A 2X1RA 3DBPA 1QPQA 1A5BA 3V1PA 3PUDA 5BMXA 3STCA 4GC4A 4XBKA 4JDBA 5CPNA 2YYUA 1U83A 1C29A 4JTEA 3EX3A 1SO6A 1FWSA 3W7DA 4HN4A 2QDHA 4NXKA 2OMAA 5DY2A 1TJPA 1LRTA 4ZL1A 2Y89A 2Y6ZA 3STGA 3C6CA 1NEYA 2W6RA 3LCXA 3MP3A 3NQMA 5I3JA 1IXNA 1LTDA 4RKAA 3A5VA 1WQ5A 1ZFJA 3S5NA 3UWUA 1XCFA 3QW3A 3JRKA 5F1VA 4IPJA 4WOQA 3CPRA 4K7YA 3L68A 3NGJA 5FEZA 2NV1A 3PBVA 4UTUA 4EWND 3QMTA 2E09A 4RXFA 1KFCA 1L6SA 4N02A 1F74A 4LUJA 5AHIA 2QCHA 5FF0A 2QCGA 4E38A 2XFWA 3O05A 5D30A 3THAA 3PBUA 3HG5A 5D2YA 4AMAA 3EEGA 2ZYFA 5DXXA 2TMDA 5G5IA 4X22A 1KFEA 3PM6A 3CB8A 1VHCA 5DN1A 3SZ8A 4LC8A 1UBSA 1S5VA 4TO8A 2YW3A 1N7KA 1G7UA 3PVFA 3T55A 3TIMA 3TW7A 3TNOA 4UFMA 5K4XA 4R33A 3SW6A 1JRCA 1K8XA 1DJNA 1X1ZA 1TPWA 1B9BA 3G0UA 5I3KA 2TRSA 2C6QA 3KRUA 4OV9A 1TREA 3Q2DA 1MO0A 1P0KA 1Q6RA 4XWUA 5F2IA 4O10A 1AW1A 5HMSA 2Z6JA 2QJHA 2YXGA 4QNWA 4E2DA 4MFDA 1ADOA 1X7FA 5E1QA 4M19A 1FCVA 2J88A 2A2IA 4WXYA 5HWJA 3IV3A 1FWRA 4AWTA 5HJLA 3W7CA 1KTNA 3TUUA 3LOTA 3N14A 3AO0A 1H1YA 2VXNA 3RU6A 1ZAJA 3LCIA 1LLZA 2H6RA 3EWXA 4UTLA 4WOZA 5LNRA 1AL8A 3A5FA 1G7VA 1X1OA 1A5CA 1ME8A 3G0SA 2CLLA 2VOMA 1DOSA 3TE9A 4WY0B 3EWBX 5LGZA 1YXCA 1I4NA 4NNCA 2H8ZA 3TXZA 3THQA 3W86A 1OFEA 4H4IA 4BFAA 2FFCA 1H7OA 3M5YA 3W1XA 4CQ9A 1KTBA 4M5PA 4XZ9A 5K3VA 1AK5A 1G69A 2YDAA 3BW2A 4AF0A 4UR7A 1VYSX 1J5TA 1LZOA 3NO5A 4JTSA 2QCNA 1CX9A 3S9YA 4AH7A 3DU0A 3HGRA 3MBDA 5KTLA 3A23A 3P61A 1Z42A 2VFDA 1B57A 4O1BA 1EA0A 1YDNA 4PODA 4LY8A 1I45A 4UTWA 1JQVA 1KFJA 3M44A 2H3BA 3R89A 3FLUA 5F4WA 3HPSA 2O7QA 3UY8A 4A3UA 3QFEA 4POCA 1DQWA 3G1YA 4DO4A 2QDGA 2NLIA 3HF3A 1XDMA 1G4PA 1VCFA 5CPMA 5FF4A 2ZBTA 4S2CA 1WXJA 2Y85A 1H7XA 4O50A 2GVLA 3TQ0A 3W7KA 1SUXA 1X6UA 3GKAA 2QR6A 3ZR4A 1M6JA 5AHLA 5EKYA 3RNDA 2B7OA 4X2RA 3A22A 1W54A 2C14A 4O15A 5C2XA 1PIIA 4KWVA 4JTFA 2C0AA 3ZWTA 3KRZA 4JX5A 1L2UA 1TTIA 3PULA 1H7RA 3MUXA 3CEUA 3W84A 1DHPA 2X30A 3NPVA 3TCEA 2Q8ZA 2X1TA 5G1TA 4CCDA 3I7QA 1SZEA 1WYIA 3BV4A 3PC0A 5D04C 2ZA1A 3EWWA 5U4NA 1EP3A 2Y70A 3HPXA 4MJZA 1TPDA 2PRLA 2Y7DA 1OF6A 2E77A 3A21A 5J5RA 5D09A 1TRDA 4MFEA 1M5WA 3LB0A 5DCBA 3W75A 4A21A 5HULA 1XFBA 1TPVA 5AB3A 5DCEA 1T96A 2JK2A 2W79A 3DAQA 4JD4A 3QEZA 4N4PA 3IGUA 4P61A 4P2VA 3DI0A 1TSIA 3ABQA 1N55A 4GNJA 3G18A 2VEMA 3G0XA 4OE7A 1VGAA 3T4CA 2G96A 4JIQA 1GPWA 4MY1A 4RX0A 1FXQA 2Q3OA 2G95A 1F7BA 5DLCA 1JUBA 3LM7A 3O6YX 3NDOA 2A7PA 1O5KA 3G3DA 3W71A 4NZJA 3MHGA 3W2UA 1FDJA 3DH7A 1ONRA 1GYNA 3NQ6A 3MI3A 4AB4A 4UFHA 4DEFA 4GJ1A 5G1YA 4IXHA 4NZFA 1P1XA 1OX4B 1K7EA 4PA8A 3VE7A 4DPPA 2QKFA 1PHQA 4O16A 3MWAA 3N9SA 3QF0A 3W87A 3NZRA 4BWLA 3VE9A 3W2MA 3GYEA 3W88A 2CFFA 1TRIA 2F84A 1WDWA 3NQGA 1C8VA 1TTQA 4MZ1A 5HUOA 4MLRA 4DXVA 4C1LA 3UZJA 5AC7A 1KFBA 4S1FA 2VC6A 3EWUA 2FIQA 5CG7A 3MW7A 4UFLA 4HPXA 1H62A 2A85A 3SSJA 4IXXA 4DO5A 5C54A 1P5BA 2V5LA 1V7YA 2P1FA 2AGKA 2OJPA 1TQXA 1A5AA 3ELFA 1O60A 3GXTA 5AOUA 1L6YA 3G1VA 4JYEA 1ZAHA 3GLCA 3W72A 1F73A 2GPTA 4JTHA 3QYQA 4AVFA 2WSYA 3W76A 1OFRA 2E6AA 5MHBA 2WNQA 2HS8A 5CKSA 3W7IA 4JGDA 1HO1A 1GTHA 2CU0A 5D2TA 3STFA 5LGXA 1B3OA 1FWTA 1VCVA 3ABSA 4NQ1A 2E68A 3O6DA 4K7VA 2VEIA 3B06A 3V75A 5DELA 3BGGA 1JCJA 5KMYA 2NV2A 3WK2A 2YR1A 1X8FA 3BVJA 4UTWC 2CWNA 3S5ZA 2RFGA 2Y7FA 1T8XA 4FX8A 3EWZA 1KM3A 4UTKA 3BLEA 3F03K 3M47A 5CZJA 1MZHA 3DZ1A 1OX5A 1G4SA 4FEZA 2VEKA 3TSDA 3PBYA 4U4MA 3MP5A 1WA3A 3KXQA 3NQ8A 3S0CA 1LRQA 5F2MA 4O17A 4GXMA 3Q94A 5GVJA 1F2JA 2E6YA 2QUUA 5K9CA 4CNNA 2ABAA 1W5PA 3PAJA 2W0UA 5F4XA 4JX4A 4N9BA 3NG3A 1WBHA 2E5BA 3O07A 3CT7A 5KZMA 4ONVA 5HWMA 3NM3A 1VLWA 3DHFA 1SW3A 3W73A 5BNKA 2Z6IA 2J27A 4TMCA 2YPIA 3GR8A 1TPFA 4O53A 3DFOA 5D33A 3C2EA 3QW4B 1YLVA 3W2KA 2WKJA 4LRTA 2OCZA 2R14A 3W6YA 2JGYA 1ML1A 5HR7A 4OHQA 2X2GA 4MLJA 4UNKA 3S8HA 3L5MA 4IMCA 3GK0A 5H91A 4WX2A 3LI0A 1PHWA 3L66A 3DFSA 4DF1A 1JCXA 2BZNA 1OYCA 4O4WA 2DORA 4HKPA 3GVGA 2V8ZA 3M41A 2ZZ1A 4M6PA 4RJEA 3TROA 3VFLA 3EKZA 3NEVA 3W2JA 4LVBA 1YYAA 5TIMA 5EL1A 3H53A 1I2QA 5EPDA 2BX7A 3GZ3A 1BTMA 3LBCA 4QISA 1L6WA 4FF7A 3KVJA 2CLFA 2FPYA 1YTEA 4MIMA 1W5NA 2ZZ2A 1DJQA 3BPWA 2Y7EA 4FNQA 3QQ1A 4A2RA 2PRHA 4UXDA 3WK3A 4CQAA 2AAMA 1OFAA 1SR9A 3M6YA 1FWWA 4IPIA 2FB3A 5SWUA 1WBJA 2ABBA 1RQEA 4TIMA 3W1LA 3C4UA 3UWZA 4LVAA 1OK4A 2ZRZA 3KVLA 1SSGA 1A50A 3O6CA 2AQWA 1NAL1 3FKKA 1G4EA 2XN1A 3BW4A 2CW6A 3ANYA 1FDZA 4GUFA 4W9TA 1Q6OA 1FBAA 4FIQA 1H61A 1LBMA 4BWLC 2QCMA 2ZTKA 4FNPA 1GOXA 1KW1A 4IMDA 5FEPA 4YXGA 1SZFA 1D3HA 3SJ3A 4DF0A 5G2IA 4UTTC 2B7QA 3CU2A 2JKEA 3LHWA 2DJLA 5BRBA 1R2RA 5I3HA 3UPWA 3NQDA 1K8ZA 2VFHA 3P80A 3F1QA 4GUJA 1YADA 4U28A 1H60A 1ZCOA 4JYDA 4HPJA 3WJZA 2BLEA 4FB7A 3KAOA 4O0ZA 4XKYB 4IJBA 3HBLA 3R12A 4AEOA 4O18A 4N9CA 3UWVA 5CSRA 2Y7GA 4FHAA 2GJLA 1GWJA 4YL2A 3W23A 3BK0A 3QH2A 2TSYA 4K36A 1IXPA 4WQ6A 3HGSA 4HNTA 1KM6A 2V2CA 2CLHA 3IVTA 4LS1A 2ZZ4A 2YGYA 1A53A 1DQXA 1EWEA 3PUEA 4Q4KA 2J24A 1S5TA 1RD5A 4ICNA 1RV8A 1XUZA 1H51A 1HFBA 3GDMA 3E02A 2J9YA 4LS0A 3O8AA 4JXCA 1JUEA 3T7VA 2Z0IA 2GQAA 3NOEA 1IIHA 5LNVA 3ABOA 3KOFA 2F7FA 4UMBA 5G2HA 3TQKA 3B05A 2JGQA 4MKNA 3NA8A 3EXSA 3CTLA 4MYAA 5D37A 3M9YA 1G6CA 1NSJA 4JYFA 4OWGA 3W22A 2ZFAA 4JR5A 1P4CA 3T78A 3G24A 3BG5A 4JNMA 3SR7A 2QCFA 1YTDA 4NUWA 1MXSA 1THFD 2QCDB 2XN2A 2ISVA 1TTPA 3IIVA 3NPUA 1YDOA 3DFNA 2YW4A 3IGXA 1W1ZA 3TQVA 5CPOA 1HL2A 5KZEA 3RLUA 1UASA 1QOQA 5DCDA 3A9IA 3FIGA 3HG4A 3NQ2A 2E5CA 3MMTA 2DZWA 1FCUA 3UWQA 1DBTA 1OFOA 3IEBA 4PL2A 3TC7A 2QCCA 1O94A 4UFIA 3MYOA 3BG3A 4BI5A 4HSOA 4MPQA 2NWRA 1EPXA 3EX1A 4N6FA 1PVNA 4JIPA 4O1AA 3L21A 2A5HA 3M43A 3LXCA 3L5AA 3NPXA 3NQEA 4EOUA 2QAFA 1GJPA 4RLIA 4TX9A 3I7SA 2ZQ0A 2J6XA 3PS7A 1G67A 1I8JA 3GR7A 3E96A 4XTIA 3JR2A 1ZJIA 3PG8A 4IMFA 4ML9A 2NZLA 2YZRA 2QCLA 5EY5A 1R47A 4ADUA 1RZMA 4LOCA 2BSLA 4NJGA 1W5OA 1TPUA 4LUIA 2PRMA 4MZ8A 3WJYA 5LNUA 1WV2A 3RLVA 5K7JA 1GG0A 2WQPA 1R2TA 2A1YA 5I3GA 1ZAIA 1CI1A 1SO3A 1UB3A 4RZ6A 2X1UA 4HNUA 3S5OA 2E6FA 2VEPA 3VI2A 1LRNA 1BWLA 2ZZ5A 1M7PA 3TKFA 2KZHA 2NUWA 5AHEA 1HUVA 1M7OA 3CHVA 4LV4A 2QJGA 3T40A 1Q6QA 1J4EA 1JRBA 2JKAA 4TR9A 3RMJA 1IIGA 1OYAA 4ADSA 4QNEA 4UMAA 5G4EA 3FJLA 1ME9A 4WY0A 3LRLA 3ATZA 4MYXA 4JN6A 4WD0A 4BI6A 1FWNA 1E51A 2DZPA 5AHMA 5KINA 1TO3A 4O4VA 1SZNA 3O15A 2ZRVA 4YWIA 2VENA 4ORMA 3LHUA 4AHQA 1F76A 3I68A 5HNRA 6TIMA 4KKXA 3S1VA 3W2NA 1VLIA 3P84A 3S1UA 1QDSA 4WUIA 1V5XA 2ZZ7A 2NWSA 4MOZA 1OFPA 4O8RA 3P7YA 2Q8LA 2RDWA 4FX7A 3C2VA 3O06A 3OBKA 3GAYA 4O19A 5I3FA 1QFEA 4AHOA 3DFTA 1W5QA 2R8WA 1VZWA 4AAJA 3L0KA 1W0MA 1LCOA 3L0GA 2C18A 2WOQA 4CQ8A 4FNTA 1KBJA 2X16A 4GRSA 1H5YA 2E1DA 3L2IA 1KM4A 1BKSA 4A2SA 4M7TA 4JX6A 2CLOA 1SPQA 2HTMA 3M7WA 5BMWA 2FDSA 5FF7A 3W1QA 2GJNA 4N2YA 4ZVJA 4BF9A 3GAKA 2EPHA 4GUGA 1QO2A 1EWDA 1YPIA 3K30A 4KWWA 4QSHA 4Z1AA 1GT8A 3HPZA 1AG1O 1NF7A 3W7MA 1RQHA 3GNDA 3CEPA 1WX0A 2I1OA 5AHFA 5D2VA 4ZQOA 2FB2A 3W1PA 1W56A 3W7PA 2GVJA 4JICA 3PF3A 4G1KA 5DBUA 1OABA 1SFJA 2C1HA 4H6KA 4NJHA 1MEHA 3HOJA 3DKLA 1KLYA 1W5MA 3U8GA 2ZRWA 1KBIA 5L9FA 2DJXA 3L9CA 3PY2A 3W7OA 4QIUA 1TJRA 4K8HA 2YFOA 3LCWA 1H1ZA 2ZDRA 4LVGA 3TMLA 3W1MA 4CLMA 3GDLA 1VH7A 4RCXA 3VNDA 3CQ0A 4OT7A 3OHIA 2RHGA 1OX6A 3WJWA 3IIXA 5F2LA 3FA5A 4UCGA 4GFSA 5LSMA 3HGOA 4R53A 3H55A 3LX9A 2PC4A 2HS6A 2VFFA 5K9XA 4O1DA 1FXPA 1OVDA 1VCGA 3HB9A 1QPOA 2RDUA 4E0CA 3S1XA 1UJPA 3W74A 4YMZA 5HINA 3NQFA 1VR6A 3UYCA 5DY3A 2DZXA 3M16A 4HNVA 5G2WA 1LLWA 4KFOA 5HWNA 4FNUA 3C2FA 4Z08A 4B5NA 3ZFHA 4LC6A 3UNDA 2ISWA 3NNTA 1QMLA 4PCFA 1VJIA 5IBXA 1FY6A 4M6VA 3LDVA 2QUVA 5LHEA 1OG0A 3PWAA 3M5ZA 2DZSA 5T26A 3P8JA 5D2XA 1GG1A 2CZ5A 3GXPA 4NNBA 3L67A 3UWWA 1LP6A 4N9EA 4XTDA 3EX2A 5TBOA 1GVRA 5K2ZA 3NM1A 4J9JA 1H63A 1OX4A 3FOKA 3I65A 1XXXA 4DBDA 4K6AA 2YX0A 1Q3NA 4FXRA 2EF9A 4ZMGA 3IIPA 1TV8A 3SIZA 3RK8A 2CLKA 3QRHA 4MZYA 3WK0A 3RFAA 4XBSA 6ALDA 1J2WA 1PCWA 3PUOA 1OJXA 2CLMA 2JBMA 1EUAA 1TIMA 3N19B 1FX6A 5D2WA 4UTJA 3I7RA 1KA9F 2G5WA 1S5WA 5FEXA 3P5YA 3VCRA 2B7PA 4OGZA 4Z0JA 4KFPA 3W1UA 3OVPA 1KM0A 1GYLA 2FQIA 4PEKA 4A22A 2PE4A 1EUNA 2NX1A 4FNRA 4EVZA 4YCOA 4EF8A 4IMGA 1KM2A 3CIXA 3C2RA 5AC8A 1C9DA 3S5YA 1R46A 3TX9A 3DKJA 2J9ZA 2Y62A 3LTYA 4Z1BA 2QUTA 4IOTA 2NXIA 5A8GA 3W83A 3C56A 3IIOA 3MO7A 1MEIA 3OEXA 3SGUA 3G22A 1LROA 2ZRYA 3W9ZA 1QWGA 3ABRA 4ADTA 4UC5A 4NVTA 3CM4A 4TU1A 2X1SA 2A21A 1LOLA 1RQBA 3WK1A 1VHNA 1AW5A 3GDTA 2WSRA 3U6WA 3UWYA 3F4WA 2VFGA 3W7JA 1LBLA 1VPXA 1XI3A 3P81A 4ORIA 4JTLA 5IM51 1LOQA 3LRMA 3O63A 1LYXA 2JKPA 3NL5A 1AMKA 5F4SA 4MUZA 3FFSA 2NXHA 1ALDA 1ZALA 8TIMA 3W7NA 3YPIA 3TFCA 4R34A 2ALDA 2D73A 1OF8A 1SO5A 1TV5A 1DORA 1I2RA 4LRSA 1QPRA 3G8RA 4DELA 3DHDA 4IX0A 1DVJA 3OG3A 3W7QA 3OVQA 2I14A 2UV8G 1FUYA 4HHPA 3LCGA 3ZWSA 3L65A 2EGZA 4JTIA 3G1FA 2FJKA 5EYWA 3LHVA 5CPLA 4H3DA 3S6DA 1QCWA 4ZQMA 1KV5A 5DBTA 3H54A 5AFDA 1F6PA 4DO6A 3QM3A 3RF9A 2QCEA 3CWOX 5HR6A 4O28A 3G1XA 4UTIA 5FI8A 3C52A 3AJXA 3EX6A 4GUIA 7TIMA 3M0ZA 4FIRA 1FCQA 5AHNA 2FTPA 4JTTA 3FKRA 2EAWA 3B4UA 1KFLA 2OX1A 3FYPA 3WJSA 1HG3A 5FF3A 4LT9A 1D3GA 4QM1A 1Q6LA 5EMUA 1EEPA 1QPNA 4FXSA 4UUIA 1TB3A 2TYSA 4UIOA 1SW7A 3TV8A 3UXAA 1DL3A 3W1TA 4LVFA 1WOAA 2QF7A 3HMJG 5FF2A 3LCFA 2WJZA 2C19A 2DZUA 1ZY9A 3UQNA 3TXVA 2CLIA 4RV8A 1RR2A 3BGJA 2YSWA 5A5WA 1JCYA 1NFBA 2NX9A 2ATMA 4PC8A 4K37A 3CLMA 4GWEA 2XN0A 1B4KA 4BK9A 2OT0A 4I7WA 1G4TA 5L6UA 3SI9A 5IBXC 4LU0A 4UR8A 3EX4A 3N9RA 4GUHA 2RDTA 1ICPA 2A0NA 2IQTA 4RZ4A 3N73A 3QPZA 4IWWA 1F05A 4QITA 4NU7A 4ZQCA 1TYGA 1SU5A 1YDVA 1VQTA 2EKCA 4ZZ9A 2V0TA 4MJMA 1TQJA 3MYPA 1K3UA 1F6KA 3MHUA 1H7PA 3W3OA 3TW6A 3NAVA 1SZGA 2A7NA 4K38A 5AN7A 3UY7A 4GE8A 4WJEA 3LXAA 3TFXA 1KM5A 1QR7A 2ATSA 3M1ZA 3UD6A 4PTNA 2GOUA 4DPQA 2H3DA 4DF2A 4KFNA 1SO4A 3A24A 1BEUA 3GDKA 2LLEA 3UXDA 3BW3A 4AF0B 3KVKA 1KV8A 1GVFA 4DQWA 3N3MA 5K4ZA 3NVTA 3TSMA 1O4UA 3B03A 2RKXA 4PFMA 3GXNA 3HIJA 2Q3RA 3G1AA 1WAUA 3STEA 5D38A 1XBXA 2P0OA 4UFJA 1R2SA 4IX2A 2VELA 1ICSA 4XKYA 4O11A 3TR2A 2CZDA 3IVSA 1ZHAA 5EBUA 1YXYA 2PCQA 3INPA 5D02A 3QQ0A 3W07A 2YCEA 4Z1CA 1LOSA 4I7UA 1H50A 1JCMP 2C13A 1YXDA 1FCBA 1EIXA 3B0VC 3LTPA 1KFKA 4ZQNA 1U5JA 1XBYA 4O57A 2OT1A 5G4WA 5CZ0A 5EA9A 3G1HA 4WY0F 1ICQA 1DV7A 3O16A 3SECA 4NX5A 5I3IA 3OA3A 3ATYA 3F4NA 5HQEA 3LI1A 3JS3A 3PR2A 2V82A 1GVOA 2ZZ6A 1IGSA 5AYZA 3D0CA 4QAIA 1LORA 2ZZ3A 4NJIA 4WZHA 3BLIA 4TMBA 4O1CA 4E2BA 3PSWA 1EX5A 1KTCA 5C6MA 3W70A 1EB3A 2HSAA 3HGJA 1EP2A 2I9EA 3S42A 1BWKA 1UUOA 3S1WA 1OFDA 1IXQA 4NJKA 1JQXA 4M6QA 5C5YA 3QC3A 3B0UX 3B04A 4LNYA 1VYRA 3TH6A 3SY5A 3HO8A 1DKWA 1QOPA 3BG9A 1HTIA 2WSQA 2ZTJA 4OBTA 3B8DA 1LBFA 3DI1A 3FS2A 3IRDA 4Z0SA 1GVSA 2CZEA 2B4GA 2QCDA 4RK8A 4DBEA 1TPEA 1O95A 2J9XA 4Y6GA 3W2LA 3BARA 2WO5A 4WXZA 4GBUA 1D9EA 4IUOA 1XM3A 3P62A 4O12A 2VKZG 1TPH1 3EXRA 1XKYA 2R94A 3TJXA 3TK7A 3MP4A 2R91A 5D03A 5E0KA 4NT0A 3C2OA 1AL7A 5ABTA 4JTJA 5KZDA 3TMQA 3G1DA 3LBMA 4S2BA 1QO5A 3GDRA 1PV8A 5C55A 1TCDA 5U7SA 1UUMA 3HG3A 1S3HA 3E49A 1XUUA 3BO9A 3LHTA 2H8XA 1YPFA 4IQLA 4Y90A 2VFEA 4O14A 1F5ZA 5AC6A 1Z41A 1I2PA 3EKLA 3KRSA 5F2GA 1RVGA 1VRDA 1MEWA 3OIXA 1W3TA 4D2JA 3G3MA 3KX6A 3LTSA 3DXIA 3P74A 5CSSA 3KHJA 1JJKA 3Q37A 3R2GA 4Y9AA 2A4AA 2V81A 4LWWA 4CCEA 3GIYA 4AWSA 3NL2A 4K8EA 1Q45A 2FPVA 2WNZA 1KM1A 3QPYA 3W1RA 1GQNA 4Q33A 4IGHA 1I2OA 1L9WA 2QJIA 3QSTA 2FPTA 4AHPA 1W3NA 2V30A 3LLFA 3UPBA 3W1NA 5CZTA 1H7NA 2OZ0A 4JDYA 3G1SA 3B0PA 3QSRA 4N4QA 5KSWA 1GZGA 1XL9A 1ZNNA 1OYBA 1XDLA 1PE1A 1PL9A 1W37A 4K39A 4JTKA 4O0KA 3L5LA 3P8IA 2WV8A 3NL3A 4FNSA 3M5XA 4Y8FA 2Y88A 3BLFA 2G97A 4I9AA 3LGEA 3IIZA 1WOBA 2V2HA 4HT3A 3TDFA 3MJYA 1SSDA 2TPSA 1GVQA 3NQ7A 4RXGA 1A5SA 3NPWA 3R5EA 2E6DA 3WFAA 3SFKA 1QAPA 2C3ZA 4Y96A 3C3NA 4MY8A 3CC1A 2DP3A 1PCKA 1W31A 4HSNA 3P67A 1MSSA 3LLDA 3NQAA 1SFLA 1W8SA 5J5DA 1T99A 4L4LA 2ZA2A 3FJ6A 3NXFA 5K9DA 1ME7A 1K03A 2GUUA 5H2ZA 4HNNA 4AWUA 4BR1A 4CCCA 4O52A 3EWYA 5LZLA 2V9DA 2H90A 4JEQA 1VS1A 3U2OA 5FESA 4M7SA 2YFNA 2WPBA 4UTTA 3NR0A 5BW6A 1YTKA 1B4EA 5FEWA 1LDCA 2O7SA 3TAKA 1FDYA 3W7EA 3P60A 1OFBA 4OU1A 5DXYA 3LHYA 3TA6A 3EXTA 2BXVA 2RH9A 4CNPA 3MI6A 2WNNA 2YYTA 1H7WA 3O1NA 3TC6A 4PL1A 2A6NA 3W1AA 4YCPA 3DGRA 4R7JA 2V5BA 3PB2A 3TU9A 4X9SA 3M5VA 3NQVA 3NL6A 5D32A 2QAPA 4OV4A 3UZ5A 4UNLA 3LV6A 4A29A 1VC4A 3TAOA 1K7FA 4LTSA 2A6LA 1JUKA 5CZSA 2B0MA 3MHFA 3E0IA 4O13A 3N2XA 4RZ5A 4XUGA 4JY9A 3VKJA 2PURA 1TTJA 3PG9A 2Z2UA 3HQ1A 1FQ0A 1JR1A 2ISSA 1K02A 4I7VA 4Q32A 4BI7A 4AXKA 3CWNA 2GVGA 1O5XA 2ZCGA 3QMSA 1N8FA 1OK6A 1HO4A 3LERA 3WJXA 3P82A 2Y61A 3W7RA 2P10A 2DU2A 1JULA 3OVRA 1XBVA 2HMCA 3CIWA 3E9AA 3Q58A 4JTUA 2C16A 3GB6A 3LXBA 3PBWA 3T44A 3NQCA 3KFTA 4ZQRA 2ZRUA 4ALDA 1GEQA 5AYYA 3NZ1A 1VYPX 1OFQA 4FO4A 2DZVA 5E93A 1K7XA 5TQLA 1GTEA 4UFKA 3LRKA 2GQ8A 4LW7A 1TPC1 1XBZA 3W7HA 5HUPA 4PH6A 3LHZA 2NX3A 3W85A 4LS2A 4YLWA 3N34A 3DFPA 4XQ6A 3FEMA 2Z1BA 5LHFA 1CW2A 1JCNA 3IVUA 1JCLA 3R13A 4RR4A 2ZRXA 2DZTA 1KLZA 3GNNA 1EP1A
chains in the Genus database with same CATH superfamily
5FL0A 1EC8A 1DTNA 2XPKA 1RJRA 3DFQA 3MI2A 1OC6A 4YVPA 3BC9A 4OQVA 3WQ4A 1Q6DA 2DVTA 5I06A 2O92A 2J8FA 2BTMA 3QJAA 3TJLA 5LNSA 2FVMA 3R8RA 5I0DA 4XAYA 2CHRA 4Q8UA 1D7KA 2EHHA 2GFTA 1J93A 3MBFA 2GGHA 4X0VA 1PBGA 2CLEA 3M0XA 3WLJA 4C1KA 3ZS4A 3U5UA 2OEMA 1W3IA 4ZQPA 3UXIA 2ZWYA 5A6BA 3LV5A 3E12A 1P0NA 2VCBA 4PRTA 3TZFA 2WSPA 3GZAA 3HPFA 1OGGA 2R1PA 1QI2A 3QGAC 4FAMA 2NUXA 4DJFC 2CZFA 3GRIA 3HQOA 3LCHA 1BAGA 2VX7A 2ZA3A 1JVNA 3SDOA 1PS9A 2PDPA 5LNWA 2PCEA 1LM1A 4FX6M 3DIPA 3P5ZA 3REQA 2NT1A 3CQIA 1OHLA 1RPXA 4G6CA 2A7RA 3M0IA 3V0SA 3NCOA 3PUDA 3OJGA 4JDBA 2WYSA 2HJPA 1VEPA 1C29A 1EHAA 1V8EA 1M7XA 5ENLA 4IT1A 4KPLA 2A79A 1LRTA 5I2UA 3B0XA 3STGA 3AZSA 2W6RA 1ZLPA 4RKAA 3RITA 2POTA 1GZ1A 3A5VA 3APTA 4QEEA 4HPHA 3W6LA 1TJ2A 2D0HA 5F1VA 4IPJA 1MW0A 2HK1A 3STPA 4B5VA 3PBVA 4UTUA 1EPVA 4C91A 4GYKA 2E09A 2Q02A 3UZZA 1QK2A 4N02A 2XJ7A 1E1CB 2Z29A 1F74A 4DZAA 3GR4A 3R10A 2QCGA 4E38A 2CNCA 3U2ZA 4EPBC 5B80A 4AMAA 2ZYFA 5DXXA 4MNLA 5G5IA 1A3XA 3KOXA 1B0IA 3URNA 1N7KA 1G7UA 3T55A 1RHCA 3TIMA 3TW7A 1JAKA 3ARPA 1I0DA 1CDGA 3GVRA 3H23A 1JRCA 3VM7A 4JIRA 1DJNA 2WBKA 5DFAA 1TPWA 3VX1A 3A6OA 2O4QA 4RPPA 1J11A 5ABGA 1HQTA 4OV9A 1MO0A 3T9PA 3MCMA 3BMVA 1M41A 4K1WA 3UESA 4LNCA 1IQ8A 3CUIA 3FN9A 4P8UA 1OT2A 1F3TA 4J7RA 2J88A 3EBVA 5HWJA 3IV3A 3UXKA 1R8LA 3ZVIA 3U4AA 5HJLA 5IFTA 3URBA 3T8QA 1WZKA 3LOTA 4LYKA 1H1YA 4C6IA 4H9XA 3RU6A 1Q7QA 4V27A 1HKVA 1RAKA 1SR0A 1DOSA 5D8WA 4ZSTA 3TE9A 4WY0B 3IARA 3FJNA 4GX9A 4NNCA 2NT0A 3ITLA 2AQVA 3IUIA 3THQA 3TXZA 3W86A 1LWJA 1OFEA 3IUDA 2YA1A 3HMCA 2PDHA 4GBDA 3M4HA 3W1XA 2OKTA 1KTBA 5A6KA 3AYSA 4B9ZA 4M5PA 2GQ3A 4PBFA 3DUGA 5DQPA 1AK5A 3BWWA 4JHOA 2PMQA 4JTSA 1LZOA 3NO5A 2A3AA 1CX9A 1HIZA 2ZUMA 3S9ZA 3HGRA 3L4XA 5KTLA 3P61A 5H8PA 4Q8OA 4O1BA 3WNKA 2YZ5A 1U5VA 1VEMA 4AQLA 1XH0A 4OUEA 4M81A 1LT7A 4P7LA 5C9ZA 2EQDA 3WLRA 3AS0A 1RBAA 4TXEA 4XG1A 1QATA 4HK5A 2WBGA 3VCNA 3QFEA 4POCA 4Y9MA 1DQWA 3G1YA 4DO4A 2VWTA 3V5OA 1LG2A 5CPMA 3H26A 1H7XA 2YA2A 4B3ZA 4GIYA 4H04A 4NKCA 3ZR4A 5XIAA 4ATDA 3UXLA 3N12A 4O15A 4CD5A 2PUZA 1M01A 2XH0A 3UERA 2DW6A 4JTFA 4JX5A 2GK1B 2Z2AA 2Z27A 1H7RA 2C1GA 2OLSA 3WYZA 4CQDA 1GW9A 2Q8ZA 2X1TA 1NWUA 3F4DA 3DN5A 4JTCA 5GQBA 4J3XA 4AZCA 3M0MA 1MW3A 2ZA1A 5U4NA 1LT8A 1EP3A 2FVKA 2PP1A 4MJZA 3B0YA 5C71A 3VMPA 1FWCC 1J0KA 4GI8A 2JEQA 3LB0A 4HNOA 4A21A 1OY0A 4US5D 4LF1A 1T96A 4RDZA 4MWAB 3RIKA 5EMMA 1FP8A 3QEZA 2VJXA 3FX4A 4P61A 4P2VA 3DI0A 1N55A 2BODX 3T07A 3PUGA 4OKDA 1VGAA 2VQUA 4S3AA 2G96A 4IJRA 4Q7NA 3R8HA 4H9UA 1JUBA 1GKQA 3MHGA 4L61A 1FDJA 3DH7A 1ONRA 4IQDA 3NQ6A 3MI3A 4AB4A 3UA4A 4R9OA 1HVXA 4IXHA 1P1XA 4X0NA 2VX4A 3PPHA 3VIMA 4PUJA 4GH3A 2QKFA 4Q8NA 3UR8A 3QF0A 1T5AA 2XDFA 3GYEA 3EPNA 4TVDA 1M03A 2CFFA 2F84A 3M0JA 1TTQA 4C7DA 3I4EA 4MLRA 4ZODA 4C1LA 5TF0A 1KFBA 4UFLA 3WLIA 2Z25A 4MWAD 3CPGA 6REQB 4MPKA 2V5LA 1V7YA 3EB3A 3VIIA 2P1FA 1EL3A 2OJPA 5A69A 3BJTA 5AOUA 3GXTA 1O60A 3UBPC 3TLLA 3UNTA 2D0FA 4JHZA 4L4OA 2Z28A 4LCQA 1TA3B 2VUNA 2HS8A 4FPSA 5CKSA 1HO1A 2ALRA 5LGXA 1VCVA 2IKHA 4ZXOA 4K7VA 2VEIA 4MNKA 4W93A 3EOLA 1BGGA 1JCJA 1MZRA 1Z69A 2NV2A 3WK2A 3BVJA 1KRMA 1MWOA 2PF0A 4KS0A 4J3TA 1B3ZA 3QV8A 4UTKA 5A8OA 4GCXA 3M47A 1QI0A 2WVVB 5CZJA 3DZ1A 2E3ZA 1S2CA 2CITA 4HTBA 4JNYA 3PBYA 3A12A 1CLXA 4HK7A 4LCRA 5GVJA 2HPMA 1UR8A 1E9YB 1F2JA 4DNHA 2C1IA 1W5PA 2OQHA 4GH1A 5M1TA 4NAFA 4XAPA 2PTWA 4AMCA 1XR2A 4NYYA 3I3BA 2J27A 2BGQA 2NQJA 4XIMA 2YPIA 2VZVA 1K9EA 2C7FA 3W53A 3QW4B 1E6ZA 1QHPA 1XYLA 3PANA 3TP4A 5BWFA 3W6YA 2BOGX 4OHQA 2X2GA 4MLJA 4AIOA 3S8HA 3QXBA 3T2OA 3L5MA 1Z9AA 3GK0A 1US2A 3OLEA 4C6MA 1AQ0A 1DJXA 4CD6A 4ZB0A 1PHWA 1JCXA 4O4WA 4HKPA 2V8ZA 4QAWA 5EMKA 2ZZ1A 4L65A 3TROA 1LWHA 1VFMA 2QF8A 4LVBA 1YYAA 4P7RA 3LBCA 1L6WA 4MIMA 3RO8A 2Y7EA 3N1AA 3RN6A 2OO0A 4UXDA 3WK3A 2AAMA 2BHYA 4Q8QA 1SR9A 1FWWA 1AUSL 4DWSA 2FB3A 1WBJA 1Z3NA 4TIMA 2D3NA 2PLKA 4LVAA 1OK4A 3KVLA 1A50A 2AAAA 1G4EA 1H41A 4Q4OA 3ALFA 4BWLC 1E56A 4GNVA 4CEUC 1ZL1A 1U22A 1AH0A 1A49A 2W67A 1CCWB 2VTFA 1K77A 4RNFA 4RE3A 1MVYA 4XVDA 3L2LA 2B7QA 3CU2A 5FJTA 1W9PA 3LHWA 2DJLA 1W2VA 5BRBA 2YJQA 5I3HA 1K8ZA 2VFHA 4DYJA 1H5VA 4E3TA 4U28A 4HPJA 3VGGA 5LXXA 3LNMA 4FB7A 3KAOA 3LN3A 4XKYB 1XFCA 3HBLA 3NIYA 1A5KC 3UWVA 3WQ5A 2Y7GA 4FHAA 4F8XA 1CGYA 1Q8AA 1GWJA 2FZNA 3UGRA 4MB5A 3IPWA 1L6GA 2TSYA 3MKCA 1IXPA 4AXNA 5LYRA 2V2CA 3W38A 2ZZ4A 2YGYA 3BGAA 3GH7A 2JEPA 3ZQ9A 3BLOA 4Q4KA 3ARQA 1RD5A 2DIJA 1XUZA 4A35A 3I3DA 3GDMA 5E09A 3E02A 1JYWA 1MXGA 2XISA 4GI9A 1TVNA 3WMBA 4JXCA 3HM7A 1WDSA 3CHEA 3NOEA 2BVTA 3OW1A 5LNVA 3KOFA 3BV7A 2NV9A 4MKNA 4XSMA 1IZKA 2IPJA 2ZUVA 1R3VA 1G6CA 1MI3A 3UJ2A 4JYFA 2ZFAA 4JR5A 1P4CA 3T78A 1SMDA 4ATLA 2BGNE 2Q6ZA 3UJRA 5ABFB 3RCNA 2GGEA 4AZIA 1X97A 3VM5A 2QCDB 1QNOA 4G7EB 3IJDA 3EMCA 3NPUA 1I9CB 1VFLA 1EJ7L 3NSMA 1UWIA 4YYCA 1VB9A 1VAHA 5KZEA 3T0CA 5FKYA 1QOQA 3A9IA 7ENLA 4JL2A 3NDYA 1J0YA 1X39A 2ZICA 4IP7A 5CGTA 2G3JA 1SJAA 2CHOA 1OFOA 1B3YA 3MTWA 3TC7A 3WUFA 3A64A 4MPQA 3CBWA 3BMXA 2GLKA 1VFTA 3LXCA 3L5AA 3N04A 2D22A 3NQEA 2QAFA 3DC0A 2ZQ0A 1G67A 5C9XA 1JPIA 4AIBA 1C8QA 4XTIA 3PG8A 1VJSA 4ML9A 2NZLA 2QDDA 3TYAA 5EY5A 3J7HA 1FFQA 1RZMA 4R7OA 9XIAA 2BSLA 1DYSA 1WDPA 3UVAA 5A6TC 1S5MA 5CXPA 3WJYA 1WV2A 1GG0A 1SYTA 3AXMA 1MW1A 3RDKA 2X1UA 2NW0A 3S5OA 2VEPA 3HFYA 4V33A 3TKFA 3CHCA 4LV4A 4W86A 4CD7A 1JRBA 2JKAA 3RMJA 3BOXA 1HX0A 1IIGA 1SVDA 3K4DA 4QNEA 3VNYA 3FJLA 1UZDA 3QR1A 3LRLA 3ATZA 1UR0A 2HBVA 1MRQA 2HISA 1AZ1A 2UZ9A 4UQAA 5KINA 5CSUA 3T0TA 4ZGYA 4JEJA 1F76A 1EGVA 5HNRA 6TIMA 3T1GA 1A0EA 1XCWA 1OFPA 1KRCC 1XQKA 1YRRA 1Y7VA 3KTCA 4ROPA 2J7FA 4ZXLA 9RUBA 3OBKA 3CQKA 1DE6A 5AZ1A 1ZBVA 2WC7A 7XIMA 4AAJA 1F8MA 1LCOA 3L0GA 4IZGA 1J6OA 1KBJA 3VIHA 3CZEA 2L5HA 1BKSA 2J75A 3KRBA 1A5MC 1H3GA 4JX6A 5FJUA 2CLOA 2V5DA 3M7WA 3ZMRA 5FF7A 3H24A 3T2PA 4DIAA 1EWDA 3DYOA 3GNXA 1A3WA 2WQDA 3HPZA 2F38A 4Y9OA 3W7MA 4Q6JA 4KEVA 1E6PA 4IPLA 3N25A 4GVIA 4JZ5A 2PDFA 4KCWA 2FB2A 5EU9A 1W56A 1F3XA 3B4YA 2X42A 4JICA 5DBUA 1OABA 1SFJA 4UWMA 3KLLA 1VFFA 2VYOA 2QNEA 3BOLA 3TOPA 4QSFA 3AIEA 2HWGA 2JALA 4QIUA 4J2PA 1Y5XA 1IHIA 1H1ZA 4LVGA 4Q22A 2VGIA 3W1MA 4Q4PA 1UROA 1C7TA 1YNPA 1VH7A 4PCSA 1XIGA 4RCXA 2Y5EA 3CQ0A 4GD0A 3VNKA 4GVFA 3V36A 1AD4A 3W6MA 4ACZB 3FA5A 4GFSA 2R1LA 3H55A 3B9EA 1FXPA 2YDQA 3C3UA 1VCGA 4DAFA 3WBAA 4E0CA 4L1WA 3I6EA 1Q66A 3MZNA 2DZXA 3PTDA 3M16A 4HNVA 3W25A 4FNUA 3C2FA 2EXOA 3TJIA 3ZFHA 3UNDA 3ZYZA 4QR6A 2ISWA 5E9AA 2X7VA 3CUGA 4MSSA 5A2CA 1XSKA 2DSWA 5FOOA 4PCFA 1VJIA 3GM8A 4M6VA 3N17A 4NG3A 3PWAA 3M5ZA 3SQMA 5T26A 1CENA 3P8JA 1GG1A 3BZGA 4DN1A 1XLBA 1HZYA 5K2ZA 3B8WA 1H63A 2C8NA 1XPYA 2EBNA 3ZO9A 3WLKX 3B97A 3SIZA 2CXEA 3RK8A 3ZJ7A 3VNZA 4DB7A 3D46A 3RFAA 3VOHA 1PCWA 3KBJA 3E0FA 1EUAA 3TYEA 3S2JA 4NHVA 1GCYA 4UTJA 3NVDA 2G5WA 3KDNA 2B7PA 4OGZA 4Z0JA 2BY2A 3WBEA 4GIEA 1GYLA 2FQIA 4A22A 4ILSA 1EUNA 1J0JA 4WJ8A 5AC8A 2G3IA 4TQTA 3S5YA 1R46A 4GNKB 2Y62A 3E2RA 4IOTA 2QUTA 3UYIA 3WLPA 1KGWA 3W83A 2J8TA 3C56A 1NM9A 3SGUA 4L1XA 4A6GA 4AX6A 3W4RA 2ZRYA 1GGOA 4GZIA 4XISA 4ADTA 3CM4A 4UCFA 4P7NA 1YE6A 2CC0A 3CHDA 1T8QA 2XUCA 3WK1A 4WKHA 2QHAA 3HFTA 3N2BA 3ZLFA 4GQ0A 4E4PA 3WQOA 4J3SA 3VZZA 3W02A 4C6OA 2O55A 3OP2A 4NI8A 3N6QA 5HOSA 3GG8A 4MB1A 3HQPA 4JTLA 5IM51 3REQB 4G2DA 1OD0A 3W37A 2JKPA 3CUHA 2VR5A 8TIMA 1BG9A 3W7NA 5C7HA 3L4UA 2ZX7A 2E1WA 1DORA 1OCBA 4LRSA 1XIDA 1XLAA 1QPRA 1AH4A 3OVGA 1G1YA 4IX0A 1ZUAX 4PR4A 4E8GA 4WCJA 1CNVA 1CWYA 4MNMA 2I14A 1Q2SA 3AIUA 5KEZA 2EGZA 5A6BD 2V3GA 3CNYA 2BG5A 5EYWA 1A4LA 3S6DA 2V3EA 2AOSA 3GWQA 3QM3A 1SZRA 3WLHA 3PZOA 2XGIA 5HR6A 3T09A 4UTIA 1H4PA 1UWSA 3AJXA 4GUIA 3WEZA 1R0MA 2ZXAA 3FVDA 4GVHA 4C6NA 3FKRA 3IV8A 1A0DA 4HK6A 3KTXA 5FD0A 4W7WA 1QI5A 4Q6XA 1HG3A 4PFHA 1FH9A 1XYFA 5FF3A 1E15A 1W3KA 1EEPA 3V1HA 1TB3A 4UIOA 3CL8A 1XW8A 1VBGA 2G3NA 4L1GA 4N0RA 4AFYA 3BQ6A 3AXIA 2WJZA 2C19A 1ZY9A 1NWSA 2J78A 1JDAA 3BGJA 4L7ZA 4R5EA 2Y4SA 2AKMA 4Y9NA 2W4XA 3CUXA 4GWEA 3CK5A 4I7WA 3SI9A 4LAKA 3TYUA 3IJLA 4GUHA 2A0NA 3L23A 4RZ4A 3QPZA 4IWWA 2XG9A 4BCEA 4D6CA 3EA1A 4JFTA 5M17A 5REQA 1G01A 1TYGA 3LMYA 4HCLA 4ZZ9A 3TNBA 1I60A 2R9RA 1F6KA 3MHUA 3BQ5A 1TZ9A 2DT1A 3S3GA 3NAVA 1SZGA 2A7NA 5DT5A 2GYIA 4WJEA 3LXAA 4IIDA 4DNMA 3TFXA 2ATSA 1GHRA 4PTNA 1C91A 5C9WA 4DPQA 2H3DA 3WF2A 3MO4A 3A24A 3GDKA 5CBIA 3N3MA 5K4ZA 1MYRA 3ALGA 1QI4A 3AIRA 3S2MA 3RM8A 1FVPA 3STEA 2P8CA 2F2KA 3SURA 3DYMA 3IVSA 1DWGM 1ZHAA 1YXYA 5BOFA 1ECQA 3UW6A 3CLWA 1R3QA 1XIIA 3QQ0A 4Z1CA 5M03A 3DC8A 1TIWA 3ITXA 1FCBA 1TR1A 3LTPA 1N8WA 4HYRA 2QVNA 1XBYA 3VNJA 2OT1A 5G4WA 1CXHA 1ZU8A 3CH0A 5KZ6A 5CZ0A 1EIBA 1YIXA 2VC5A 5B7ZA 1ICQA 3CV2A 1FWBC 3OA3A 3F4NA 1MDRA 3PR2A 1IZJA 2HVMA 2V82A 4A05A 3UA3A 3ZLGA 3D0CA 4QAIA 3VZXA 1LORA 3S6TA 4F0RA 4WZHA 3ZVHA 1UD4A 4O1CA 4U3CA 4XVEA 2X09A 4H6RA 4BHYA 1EP2A 1ZTVA 1CPUA 2I9EA 4PSPA 3GDBA 4KIRA 4M6QA 5C5YA 3WD4A 4LNYA 3L4YA 1CLKA 1DJGA 3A4AA 3BG9A 4AY7A 2WSQA 3HV8A 2VZOA 3CUJA 4H9ZA 3B8DA 4B5SA 4C6PA 1Y8BA 4AZCB 3IRDA 3I4KA 4Z0SA 2CZEA 2B4GA 3FXGA 3TJ4A 3W2LA 3BARA 3EAUA 4GBUA 1D9EA 1EJTC 1KR1A 1UIPA 5I07A 1HJXA 1ZZMA 2VKZG 4HZ7A 1XKYA 5AC5A 3EPMA 3TK7A 1F4AA 5D03A 5E0KA 3AIQA 3F4CA 1AL7A 5KZDA 1DEDA 1RD6A 2VC7A 3LBMA 3O3RA 3QTPA 4B2DD 2PWUA 5FJOA 3UR7A 3UCDA 1V0NA 2ZKMX 1C8YA 1XUUA 1AA1B 3R0UA 4D6DA 3CAWA 1YPFA 3G6MA 4Y90A 1F5ZA 3H7RA 5AC6A 4F0HA 1MEWA 1SFSA 3OIXA 4D2JA 2VDGA 4RPQA 2BASA 2FTYA 3DXIA 3AYVA 1UZ1A 3P74A 4GZEA 3WBWA 1JJKA 4Y9AA 3TWBA 2V81A 5BRQA 2DZAA 3VKDA 4OVXA 4DJDC 5T91A 3LGDA 2WNZA 1VBHA 1V02A 3K4AA 1JGIA 4Q33A 1HKJA 4KRTA 1I2OA 3VO0A 2R1MA 2PTYA 1N82A 1V4YA 4R88A 4WRHA 2E8ZA 1W3NA 2V30A 4H8VA 2FYMA 4JDYA 4JKMA 1UKOA 2V63A 2O9RA 4CNUA 4N4QA 4Q3MA 3LD5A 5KSWA 1ZNNA 3GFZA 4F0LA 1XDLA 2IKGA 4JTKA 2WV8A 4FNSA 4UQCA 2Y88A 4DXXA 2V2HA 1NIUA 1R9XA 2TPSA 2ACQA 1GVQA 4RXGA 1SM9A 2PDXA 1H09A 3AU2A 1MW2A 4KH2A 4MY8A 3BANA 4H83A 3U0HA 4QROA 4K68A 2F6XA 1D8CA 2NQZA 4BEUA 2DT3A 1G0CA 3GHUA 2ZA2A 1WUFA 3FJ6A 1EQCA 3GFYA 1E55A 1AMYA 4AWUA 4CCCA 1LQAA 4O52A 1XIBA 2V9DA 4AVOA 2H90A 1VS1A 1XIJA 5EMYA 1NP2A 3NTYA 2WC4A 4UTTA 3NR0A 1B4EA 1U1HA 3TAKA 4H8NA 4BF5A 4OU1A 4NAFB 4IUGA 3EXTA 4GJIA 1XD1A 3O1NA 1JPHA 4WDTA 3W1AA 4LEFA 4R7JA 2V5BA 4C90A 1S2WA 3U2EA 4OV4A 4DBUA 1XIFA 1YBQB 4H41A 2Y24A 1KBLA 2B0MA 1E6NA 3VKJA 1TTJA 1BLIA 3XINA 1S2AA 2Z2UA 4ERAA 1FQ0A 4Q32A 4Z2LA 4KESA 2CKRA 1HJQA 2PA6A 4IGMA 5I77A 3SN4A 3N6JA 1OK6A 4JN8A 4CQCA 2VURA 1ISWA 3MDWA 3OVRA 3G77A 1XBVA 3F2CA 3Q58A 2J7CA 2I57A 3XIMA 1ISXA 4MB3A 3LXBA 5CBJA 2Y8KA 4WLCA 3T44A 2J47A 3NQCA 1K9DA 4ZQRA 1VYPX 4FO4A 4QXIA 1K7XA 3UZWA 1EA9C 5LA2A 1XBZA 4PH6A 1T41A 4CN6A 4YLWA 3N34A 4XQ6A 3FEMA 5CGMA 1JCNA 1JCLA 3R13A 4AZBA 4GY0A 1DXEA 2ZRXA 3QVQA 3KL0A 2DZTA 4NAEB 2J7BA 3GNNA 3VCCA 4HIBA 5LKYA 3NYZA 1QNPA 1PO9A 3W7LA 2C15A 3GX9A 1UD3A 2DEPA 1R9YA 4ZO7A 3C5QA 1M9HA 3QPEA 1FH8A 2XINA 3HG2A 3N9KA 4IGNA 3USBA 2FZMA 5AYXA 1HKWA 2WMGA 1GYMA 1XSIA 4ZO9A 3TA9A 2W91A 4EF9A 2DUAA 4UTHA 1K8CA 4QJ1A 1B31A 3QMRA 2XU2A 1QVBA 2D2JA 2Y63A 1T0OA 4CCZA 2NUYA 1UCWA 4RE4A 1DHKA 2VP8A 2VC9A 1NTHA 5HAOA 2PZNA 2DQXA 2G3MA 3T6CA 2BVYA 3SUTA 4UTMA 4NXSA 4Z1DA 5HMFA 3OODA 4G8TA 3EB2A 1SQ7A 1I2NA 3WDIA 3GKFA 5C9RA 3F5KA 1PZ3A 4IPNB 2ZUWA 4N6EA 1BXCA 1VBJA 4JS3A 2INEA 1Y0EA 2A3HA 3C61A 4DY1A 3NDZA 4IMEA 2E67A 1MUWA 2ACRA 2QPSA 3D6NA 3S4TA 5BMXA 3STCA 4GC4A 1UH3A 3TVAA 2YYUA 1FKWA 4JPGA 4IFOA 1GKPA 2WB5A 3WH7A 2WANA 3APYA 1RXOB 2OMAA 2OZ8A 2FHFA 4AD5A 1V08A 3GG7A 4E4UA 1NEYA 3ARYA 3LCXA 3MP3A 3NQMA 1IXNA 2OXNA 3C0QA 3P6LA 3S5NA 3UWUA 5DO8A 1XCFA 3V16A 1WDQA 4I5XA 1ONXA 2DW7A 2O56A 1V93A 1JG9A 3CZGA 4DJDD 4NRRA 4GYPA 3QMTA 3O9NA 1KFCA 3EPOA 2BS9A 1L6SA 3LSCA 3B3DA 1R7OA 2GDVA 2XFWA 3KZSA 1HF6A 1W9BM 3GO2A 4HMEA 2OSXA 1UKPA 3HTWA 4YU1A 4C5YA 1KFEA 3PM6A 3CB8A 2HRWA 5DN1A 2PDWA 4PULA 1UBSA 1S5VA 4TO8A 2YW3A 2GOKA 1XWYA 4UFMA 4W87A 4R33A 4AZ7A 5AY7A 4ZA0A 4M51A 3P0XA 4JFVA 4EXQA 3ANVA 4H1ZA 3CUFA 4YHGA 3AXXA 3Q2DA 4GGBA 4XWUA 3VYLA 4O10A 3ITGA 3UZXA 1AW1A 1XLHA 1UWRA 1ADOA 5E1QA 2P3ZA 2EG6A 2A2IA 4WXYA 1GOIA 1KCXA 3QGKC 3SUVA 1C90A 4XZLX 1JDFA 5G4HC 4TVCA 4O1FA 2J6VA 1KTNA 1RH9A 3CWHA 2IKJA 4BA0A 3OTRA 2Y1HA 1ZAJA 1VRXA 3QZ6A 2WMKA 1VBRA 1TWSA 4XO7A 4I6KA 5JMUA 3A5FA 1G7VA 1GOWA 4IG2B 5C7VA 3MSGA 4LALA 2MANA 1R87A 1YXCA 5LGZA 5DMMA 1TR9A 2I5QA 2XVGA 4H4IA 2FFCA 4DJEC 4ZO6A 4CQ9A 1CTNA 3P93A 2NVAA 1X7IA 3S9IA 1E0WA 5JUVA 2WWCA 4AF0A 3O6AA 2QCNA 4XZMX 3UEQA 3T4WA 3S9YA 4LYRA 3DU0A 2OR2A 3EDDA 1GVEA 3A23A 3ZT5A 2AMXA 2I9UA 1EA0A 2ZVRA 4DI9A 1VENA 1R85A 2WHJA 2PDYA 4UTWA 1JQVA 3PPFA 1KFJA 1UZ4A 3M44A 2H3BA 4PMDA 3R89A 1M04A 1MQRA 3CB3A 3KTSA 1TKKA 1BD0A 2Z26A 3HPSA 1RJQA 4TTUA 2O7QA 3UY8A 2MNRA 4JQ2A 1UR4A 2IXUA 3WQDA 2ZBTA 5BXPA 4FR6A 4W8LA 1WXJA 1S1PA 2Y85A 4O50A 5AHLA 2B7OA 2Y8VA 5AECA 1XRFA 3A22A 3ARSA 3JW7A 4I5UA 1DJWA 1EJWC 2C0AA 1DJHA 2VWSA 3KRZA 1L2UA 3PULA 3MUXA 3TCEA 4EX4A 1D8WA 2QGYA 4D8AA 2ZX6A 1HXJA 4CCDA 1WYIA 3BV4A 4PSRA 1KXVA 1OADA 1OGSA 2VL4A 3EWWA 3TTEA 2PDGA 5HNTA 3MSDA 1EXBA 1TPDA 2PRLA 2Y7DA 5F7UA 2E77A 3A21A 3GUGA 5J5RA 2RJHA 3NUKA 1QNSA 4QP0A 1HKKA 2QZRA 4ZO8A 3W75A 4ZE4A 5HULA 1PX8A 5AB3A 3WF1A 4D1IA 1XPGA 2J77A 2W79A 4WSJA 3CZKA 3QR3A 4IIEA 2WLYA 3G18A 1U33A 1J6PA 3A4XA 3OPSA 5CEWA 4D8ZA 1S38A 2GGGA 2X2YA 1QUMA 2VX5A 2V38A 1GPWA 4IJCA 4FXFA 2D20A 3O6YX 3NDOA 2OG9A 5CAHA 3W2UA 1CXEA 1CECA 4UZSA 3RM4A 1K7EA 3RLHA 1E70M 1B3XA 3EWCA 5E5CA 4DPPA 3PPCA 4U5KA 1MFVA 3N9SA 3NZRA 3M0YA 3GNPA 3VE9A 3LPGA 3W2MA 4G5DA 2VEGA 5AYBA 4DXVA 4IL0A 2VC6A 2QIIA 1GJUA 1PDYA 3EDJA 4HPXA 3POCA 4YPJA 3BOFA 2DV0A 4DO5A 4R7WA 5DMNA 1P1MA 2WK2A 4YTUA 1E4NA 2X41A 2AGKA 1PKNA 1DJYA 3UZYA 1F73A 4NY2A 2FMNA 1OFRA 5MHBA 5LIUX 1UIOA 3CYJA 1EEXA 4E8CA 1L8PA 2Y0FA 4IGSA 4JGDA 3GIPA 1NY1A 3ORWA 1GTHA 2WAGA 2ZE3A 3ABSA 1IWPA 3O6DA 1K6AA 1KCKA 3V75A 3QGVA 3AS1A 3MCOA 5KMYA 2YCIX 4FALA 1X8FA 3G5EA 2CWNA 3VNMA 2Y7FA 4FX8A 2HQAA 4IISA 3MV01 3RU8X 2G50A 2NLYA 1EBGA 3IJIA 4FEZA 3ZJ8A 1B30A 3R8GA 1KC7A 3OHMB 3S0CA 1NOWA 3H2CA 1AD1A 3WLSA 5K9CA 4M29A 3PAJA 4GY1A 4JX4A 4UQEA 2HCVA 4B5UA 2VDIA 3CT7A 1RY0A 4ONVA 5HWMA 3NM3A 3AIVA 1SW3A 4TMCA 4GLEA 1W6TA 4LB3A 5IHSA 2WZMA 1TPFA 4O53A 4FZIA 2F8QA 4V1YA 4OOZA 1PYFA 1YLVA 1O5QA 3W2KA 4WGHA 2OCZA 3WLQA 3PAOA 2YIHA 2R14A 2DGAA 2X0SA 2JGYA 4HNLA 3V5FA 1ML1A 4UNKA 3WNPA 1DXFA 2D2HA 1KBBA 3L66A 1OBAA 1OYCA 5CPQA 3M41A 3L12A 4I5RA 1W3JA 2ZVIA 3WSUA 4F48A 1L6FA 3CQJA 5TIMA 5EL1A 1I2QA 5EPDA 2BX7A 4RDWA 3GZ3A 2OPJA 4QISA 2TODA 2ZZ2A 1DJQA 1Q6EA 3LENA 3QHNA 3AJ7A 3DG3A 4A2RA 3KP1A 2PRHA 1FWIC 4CQAA 1OGBA 4DZIA 4IPIA 3EMZA 4AISA 1RQEA 2GL5A 3C4UA 3UWZA 1JF5A 2XVLA 1NAL1 2X40A 4FA3A 3BW4A 1NDZA 4EKJA 2DPEA 1FBAA 1X6LA 3VOFA 3M46A 4FNPA 1GOXA 3TN6A 3BCDA 1F61A 2WJEA 2INFA 1KW1A 3QLLA 4IMDA 5FEPA 4YXGA 1Q2RA 4U5IA 3SJ3A 4RUBA 4UTTC 4PCTA 4H9YA 5J8LA 1F3WA 5CH9A 3PZMA 4RNIA 3UPWA 5A8NA 3P80A 4GUJA 1P6BA 1ZCOA 4JYDA 3WJZA 4U10A 1YMYA 4IJBA 4AEOA 4KEMA 4O18A 4P8XA 1GOKA 3GE7A 1BVNP 4YL2A 3WQWA 3W23A 2WCAA 3QH2A 4HA3A 1JIBA 4HD5A 4GKTA 1QPKA 3HGSA 4HNTA 2CLHA 2EJ1A 5DT7A 3OQ8A 4GOAA 1E71M 3LG3A 2PGEA 2J24A 3H2MA 1CBGA 2PLJA 1E0XA 3PTQA 4W5UA 3EMQA 2J9YA 4LS0A 5JBFA 1JUEA 2ZE0A 4NYUA 3SJNA 3ZVHB 1W9VA 3SCSA 3TQKA 4IP4A 1RP8A 5BXRA 1V3LA 3NA8A 3N6HA 7PTDA 3F2DA 4N7QA 3UU0A 3M9YA 4K2SA 3MMWA 5CZKA 5JBDA 3M6DA 4JNMA 1KWKA 2QCFA 1EZ2A 1IT8A 3H21A 1MXSA 1J8VA 2PODA 4KCVA 1QW8A 3DFNA 4L6OA 4C6LA 3SCUA 1HL2A 4HPGA 3RLUA 3NJ3A 2KX9A 2BMBA 3FIGA 4H9VA 1XLEA 3T2QA 4ERIA 3MMTA 1FCUA 2HK0A 3DG7A 1OEPA 3TYZA 3MYOA 3BG3A 4BI5A 1F9CA 4CD8A 4ZB2A 4N6FA 1NOFA 4JIPA 4HJWA 2A5HA 3NPXA 2QIWA 3LZ5A 3E96A 4HHLA 1X96A 4MTVA 1YQ2A 4J35A 1XLJA 3OZYA 2YZRA 1U2YA 3FHAA 5BWAA 5FSDC 3K1DA 1W5OA 4MZ8A 1M53A 1NU5A 3ZLHA 3PPGA 2A1YA 2V3DA 4FF5A 1ZAIA 2Z1XA 3E2VA 1XISA 2OELA 5CSYA 3SUSA 4LYQA 2E6FA 2ZUNA 3VI2A 4QDWA 2NUWA 5AHEA 3VOGA 4TR9A 4HVXA 3NOYA 3CV1A 2OGYA 4GIAA 2WZIA 4H9MA 1OC5A 4LUYA 4Q4SA 1G5AA 2ANUA 2IPGA 4RW3A 4MYXA 3B8SA 4HHMA 3KEHA 1LL4A 2DZPA 5AHMA 3SRDA 2ZRVA 2VENA 2PBOA 1OIFA 3WFZA 3WZ0E 4W7UA 3I68A 1VLIA 2GJRA 3S1UA 2WHLA 3KL3A 4XUYA 3URQA 2IMRA 2ZZ7A 3P14A 4JTDA 2NWSA 3HZ3A 4B5XA 1NJJA 3P7YA 4TX6A 3KCLA 3C2VA 4FOKA 3SBFA 4I90A 3O7UA 2VR2A 3GAYA 5A6JA 3OZMA 1PWMA 4AHOA 3DFTA 1VFOA 1KB3A 2AL1A 1VZWA 2C18A 4P7QA 3NFUA 2X16A 4GRSA 1H5YA 1KM4A 3WBYA 4A8IA 4A2SA 4M7TA 5G1MA 3SN1A 2DSZA 5BMWA 4R27A 3TZNA 4BF9A 4JTQA 3AISA 1QO2A 1NDYA 4U31A 4AD4A 1AG1O 2F9RA 2YBUA 2IUZA 4I9MA 3WL1A 1MNZA 1RK5A 4BQ5A 1JZ3A 4YJ5A 2OODA 4G1KA 2PP0A 4NJHA 3U3HA 2BB0A 3HOJA 1JPMA 3WLTA 3DKLA 3U8GA 2ZRWA 1KBIA 4JIHA 3PY2A 4J4KA 1V6TA 5MKGA 3AFBA 3W7OA 4EE9A 3U7VA 1BWVA 1TJRA 1Q7ZA 2YFOA 3H4XA 3TMLA 1JZ7A 3FA4A 1RUSA 3WH6A 2JF6A 4CLMA 2XZ9A 3VNDA 1WKDA 4H6EA 4AUBA 1YHTA 5I3DA 3MUZ1 4JBRA 4JFUA 1OX6A 2PSNA 5F2LA 3KL5A 2Y5JA 3E38A 3WLMA 5C2CA 4U33A 3PZUA 3HB9A 2RDUA 1Q7MA 3S1XA 1UJPA 5BYWA 2V5JA 1L0PA 3MVIA 3GBEA 3VC6A 4W7VA 1UP3A 3PJXA 5G2WA 1LLWA 2X7WA 4B5NA 4LC6A 1SJCA 3BLLA 3NNTA 1CXIA 3LBOA 3VC5A 2QUVA 4H2HA 5LHEA 3GS6A 2DZSA 1XGDA 3UWWA 1XJBA 1LP6A 4BQ2A 4N9EA 2ON3A 1CXLA 2PWDA 2GVYA 1GVRA 1XF0A 4PGLA 1VFUA 4J9JA 2PEVA 4Y7EA 3FOKA 1A4MA 3H7UA 1W17A 4FXRA 3IIPA 1CXKA 2QUNA 2X0YA 4QJ4B 3QRHA 4W85A 4BQ3A 2VGFA 4XBSA 6ALDA 4JQ3A 4QX4A 4JQ1A 4KEZA 3N19B 4H7VA 3EA3A 3WCZA 1FX6A 5D2WA 3I6TA 4W8BA 3I7RA 1IR1A 4HZMA 3MS8A 5EMJA 5FIPA 1KM0A 1EJSC 4NSBA 4PEKA 2PE4A 4EVZA 4YCOA 3N13A 4GKLA 5D9MA 3AUJA 1XG3A 3UPMA 1S5NA 2RGLA 4XAFA 4HMNA 2NXIA 5AYIA 3S46A 3NXLA 3OEXA 4BS0A 2HNHA 1BVZA 1QT1A 9CGTA 2HV5A 5JBEA 4NZCA 8XIMA 4KT2A 3RLGA 3ABRA 1W1PA 4UC5A 4TU1A 4Y2WA 2X1SA 2A21A 4LUTA 1LOLA 3N4AA 3QN3A 2OX4A 1J0IA 4NZ1A 4FLSA 1OM0A 4R85A 4DM1A 1WE5A 3E3HA 2YBVA 3AQUA 1VP5A 3HPAA 3GDTA 3UWYA 3F4WA 4FLQA 1WPCA 3W7JA 4WEVX 2BBFA 1E0VA 4I6VA 1LYXA 4HZ8A 3NL5A 1AMKA 3RUBL 4MUZA 3GUWA 3TFCA 1MXDA 1EJXC 1UP2A 2CESA 3VKBA 4ZR8A 1TFVA 3LEPA 4UQBA 1KGXA 4DELA 4DO7A 1UOKA 2ESCA 4HU8A 4HOZA 5CJNA 3FK4A 4ZTYA 1E6QM 4KBXA 3EDFA 2VQTA 1YKWA 3LHVA 5CPLA 4KRUA 3ICJA 1KV5A 4XZHA 3H54A 5AFDA 1F6PA 3ZR5A 3RF9A 4IHCA 3BE7A 3CWOX 1Q65A 1PKYA 3G1XA 2CYGA 3IUHA 5KETA 1V3MA 3KP0A 7TIMA 4FIRA 3A3XA 3MSYA 3TN4A 3PZIA 2FTPA 4JTTA 3PP7A 2EAWA 3FYPA 1KFLA 2OX1A 3AALA 3PBGA 2O4MA 1FRBA 4LT9A 1D3GA 5EMUA 4KWSA 4UUIA 4B90A 3TV8A 4HA1A 3UXAA 4F66A 3W1TA 4BF7A 4AW7A 4P8VA 4MWAC 3GH4A 4DRSA 1ZP3A 3APGA 3Q67A 4NI3A 1JCYA 4FOUA 1RCQA 2ATMA 1J96A 3ZSSA 2X8RA 4HB7A 3QYSA 1UMLA 3ZSTA 1AQHA 3T8LA 2OT0A 3DECA 2P50A 1Z6KA 3P3BA 4LB4A 5IBXC 4PTVA 3FNDA 2RDTA 1FH7A 2OO6A 2ZUTA 5EBAA 1F05A 3N2OA 4ZE5A 3KWSA 1UR3M 3SRFA 1SU5A 1YDVA 1VQTA 2EKCA 4MJMA 1TQJA 1WXYA 4IICA 4OJYA 1H7PA 1PZ2A 3W3OA 3B8VA 3PJUA 3TW6A 6TAAA 2P88A 4GZJA 5TD4A 4UB9A 3MWCA 4K38A 5AN7A 2Y2WA 3FXYA 1P7TA 3FSUA 1KM5A 3UD6A 3KOWA 2XZ7A 2GOUA 1EKOA 3IRSA 3AU6A 1DQUA 4JOMA 3CGTA 4DAIA 1BEUA 2LLEA 3VMNA 5TNVA 4AF0B 1J9YA 3KVKA 4M3PA 1ZJBA 4D72A 1O4UA 3B03A 3LS9A 3GXNA 3OQEA 5FJJA 5D38A 1XBXA 2UBPC 1R2SA 5GNZA 3AMKA 4U2YA 5I7GA 4S3EA 2PCQA 3INPA 4PBEA 5CC5A 3SCOA 3W07A 4X2PA 4L6DA 4I7UA 2DSKA 2YL5A 4KF1A 8A3HA 1YXDA 4UZUA 1KFKA 4XKMA 4ZQNA 4O57A 3C86A 3WLNA 5EA9A 3G1HA 1AJZA 2PD5A 4WY0F 2Q01A 1DV7A 3IAPA 4A3HA 2PDKA 5HANA 4QLLA 3OLIA 2WMJA 5HQEA 1KRAC 1DXIA 1LQ2A 2IQDA 1BPLB 5AYZA 5GPRA 4NJIA 1KCLA 1EOKA 3MY9A 4YWSA 3CHFA 1EX5A 1IYXA 1KTCA 4GG9A 3HGJA 3S42A 1IXQA 4NJKA 3LQLA 3CMJA 3F4VA 3HURA 4YTRA 3VOCA 3SY5A 1QOPA 3KM8A 2ZTJA 1LBFA 3WH8A 3BUVA 3XISA 1KR0A 3FS2A 3VDCA 4RK8A 3OO2A 3KDOA 4A3YA 1TPEA 1HGWA 1O95A 4QQUA 4Y6GA 2WO5A 4WXZA 4IUOA 4NILA 4KQNA 3EKGA 4J3VA 4O12A 1TPH1 3QHOA 1E4LA 3TN3A 2E28A 5ABTA 4JTJA 3G1DA 4ICMA 4RW5A 5CQ1A 3QFWA 3ES8A 1PV8A 3OLDA 1TCDA 5U7SA 3E49A 4QG9A 3BO9A 1HKIA 2H8XA 3LHTA 3DESA 4RNJA 3VUPA 2WW5A 4F2TA 4IPPA 1XCXA 5F2GA 1UR9A 1RVGA 2JIWA 3E6EA 2W3ZA 4EANA 4C65A 3RMEA 5CSSA 1IE7C 1QI3A 3Q37A 1WB0A 3S47A 3ZXWA 3NL2A 4K8EA 4AY1A 3ARVA 1GOQA 3AMDA 3CUZA 1Q45A 2C0HA 1KM1A 1BF6A 3WLOA 1O68A 1EQPA 3QSTA 3RAOA 1UWQA 3DGBA 4Q8WA 1VFHA 4LAMA 1XYCA 3W1NA 3KHDA 5CZTA 1H7NA 4CKQA 2ZX8A 4QJ3B 3NSXA 1XL9A 7CGTA 1QASA 5IDIA 1E1EA 3RCMA 1PE1A 1A5NC 1PL9A 1W37A 4KMQA 3P8IA 3QKZA 1W9DM 1M7JA 4LGXA 1H0GA 4HN8A 3BSHA 4HJFA 1WOBA 1E0TA 3RX2A 4HT3A 3TDFA 4ACYA 4QDMA 3MJYA 2BY3A 3MU7A 3BURA 2NSXA 2C71A 2GGJA 3VILA 4CU8A 3SFKA 2C3ZA 1E5NA 4MF4A 4Y96A 3DG6A 1U5HA 2DP3A 4U3AA 4DJFA 2QGHA 1MSSA 3NQAA 3SY1A 1SFLA 1T99A 4EPEC 4GO9A 4K8GA 1PUDA 3SO7A 4DBSA 1K03A 3SIMA 3CL7A 2WSKA 3BICA 2HEJA 1OIMA 5I23A 1VPYA 1KO0A 1OCJA 3M64A 2EG8A 1VPQA 2WZHA 3F5JA 5FESA 3U2OA 2PGWA 3T08A 4ECLA 1W1VA 2WPBA 3WF3A 3VDAA 4HZ6A 2ISDA 4G56A 1LDCA 2O7SA 2ZXBA 3KWXA 3W7EA 2W92A 1Z89A 1OFBA 5A95A 1TUXA 5I24A 1BXNA 2YYTA 4Q8PA 1H7WA 1EHNA 3DBNA 4PL1A 4ZFMA 3OGVA 3K2GA 3MJMA 3PB2A 1HP4A 3TU9A 4X9SA 2D2OA 2P5NA 4AD1A 4UNLA 3LV6A 4A29A 3TAOA 1K7FA 3BJSA 1JDEA 4Q4QA 4O13A 4B91A 2IKIA 2A3BA 3WNOA 3HQ1A 4DI8A 5CPSA 1K02A 4AXKA 3V7PA 1UKSA 4HBKA 1O5XA 4UTFA 3LERA 3WJXA 3N15A 6REQA 3L2MA 3W28A 2HMCA 4JTUA 1YW1A 5BXSA 3R1ZA 2ZRUA 3QLDA 3NZ1A 2DZVA 1KKRA 4KCUA 3LRKA 2OLHA 2OTDA 1TPC1 4M1BA 5BRPA 5HUPA 4MADA 3LHZA 4GZ7A 3WH9A 1NOUA 4URIA 1QW9A 1ZCCA 4QCFA 3DFPA 5LHFA 3Q45A 3GNRA 1CW2A 4F4RA 1C7SA 2Y5SA 3ZT6A 4FP1A 3CV6A 4A8RA 4ASTA 2DT0A 3EOUA 1TCMA 1QPQA 4N9DA 4W89A 3W7GA 2VFIA 3C8FA 1IF2A 5AC4A 3IAQA 4NX0A 4CNOA 4L4MA 3G8EA 4DUWA 3QZAA 4X3ZA 3DENA 2VCAA 1JAEA 2GWGA 2FZBA 3FYOA 3BXWA 1DJZA 2JQXA 2VM8A 4E2VA 4UMCA 3RHGA 3RYSA 3SUUA 3RILA 2OSWA 3P2VA 3IJ8A 1EYWA 3R11A 3CAQA 1OSEA 1A5LC 4WHBA 3FHQA 3AMGA 4BEQA 3WDQA 3URAA 4GJJA 3T0DA 3B40A 1Y5WA 4QFUA 3PZQA 1IXOA 2VCCA 5KITA 1NWTA 1TV7A 1DP0A 1BSIA 4I8DA 1ZENA 3QZEA 5I03A 3I6RA 1QK0A 1BSLA 1AW2A 3TSBA 3T0BA 2BGSA 2ONEA 5F1UA 4LQ1A 1S46A 2Z4GA 1BRLA 1NVMA 4MVAA 8CGTA 4X63A 1UH4A 4UBPC 5I79A 3BH4A 4LVDA 4MJ2A 4JL1A 4P5UA 5CGQA 4HU4A 3RCYA 4NNAA 3L0NA 3OYZA 4NJJA 1AQFA 2XIMA 3WDHA 1W32A 2OQYA 3ZM8A 3SGZA 1S2TA 4MY9A 1YX1A 1R38A 1MRAA 4OOUA 4BKNA 3DBPA 1QU4A 1A5BA 3V1PA 3H22A 5CPNA 4AEEA 5HQLA 4JTEA 3EX3A 1SO6A 1FWSA 4C6KA 6CGTA 4HN4A 2QDHA 2V68A 4NXKA 5DY2A 4AD0A 1TJPA 4ZL1A 5TAOA 3U7BA 2Y6ZA 4AD2A 4IMAA 3MT1A 2DVXA 1OB0A 4O8AA 3NWRA 2FTWA 1FOBA 3ZT7A 1E4MM 3ES7A 1ZFJA 1PYMA 1UD6A 3QW3A 4PTMA 4L80A 1FWFC 1S3TC 2O9OA 4H7ZA 3CPRA 1MQQA 4PBGA 4PMYA 3K8LA 4XV0A 4EWND 2O9TA 1GQLA 1RY8A 5AHIA 2QCHA 1KWGA 3A4WA 3GU2A 3VDHA 2QLYA 5LIWX 2TMDA 4X22A 5DANA 1HP5A 3TTYA 4Q7BA 3M0KA 3ONCA 4PUDA 5E0FA 2QW5A 2WNWA 4C6FA 4UOJA 1JFXA 3A3WA 3SW6A 1K8XA 3RPMA 5I3KA 3TW9A 2TRSA 4ZTXA 1DIDA 2C6QA 3BLPX 1AODA 3SCQA 3AYTA 1Q6RA 5F2IA 3AHTA 2QQ6A 3AYRA 2Z6JA 4QNWA 2YXGA 4E4FA 4E2DA 4PMVA 1XD0A 1X7FA 4CVUA 3QOMA 4LSBA 4AC7C 4M6UA 1IEWA 4S3FA 4NRSA 1FWRA 4AZ6A 2CHNA 4AWTA 2FVLA 3WD1A 1EO5A 5DX7A 4IP5A 1V77A 3LLXA 3VD3A 3W7CA 1ZBCA 2NQ5A 3TUUA 1XP3A 2Q8XA 2E40A 4MNJA 3GQYA 1RCOB 3LCIA 1LLZA 5BOEA 3EWXA 4UTLA 5D9NA 4WOZA 3USZA 2XWDA 1AL8A 1EC9A 4XAZA 1V6UA 1A5CA 3G0SA 4QJ5B 4JFSA 4C6EA 3RJXA 3L4TA 4ZOBA 4ZBCA 1FTXA 3R7MA 3TLQA 1BYAA 2H8ZA 1TWWA 1ADSA 3R0DA 1PIGA 1OD8A 1W9UA 3VZYA 2GVEA 3TYCA 4LJ3A 4W84A 2YCJA 2OGJA 2A3EA 3GYCA 4XZ9A 5K3VA 2Z7GA 5CAKA 2ZC8A 3BW2A 5IXEA 5AZ0A 1JF6A 4UNIA 2J7EA 1CGUA 1UC4A 1CYGA 3IJ9A 1O66A 1PSCA 1Z42A 2VFDA 1MFUA 3ISIX 3O0FA 2VD8A 1R7AA 2XFFA 4AZHA 1IT7A 4PUEA 4LY8A 3GTFA 5A3HA 2QJJA 3LSBA 3H6OA 1Q4NX 1NDWA 3EYPA 1S1RA 2WM0A 2PTZA 4PUKA 1R3RA 2I17A 4A3UA 3BSMA 3A3HA 1X1NA 2QDGA 3HF3A 3VA8A 1XDMA 1G4PA 4DUVA 1PB0A 4PZVA 1OWQA 4J3WA 4GQRA 2I56A 3AMCA 1IWAA 4RE0A 4D6JA 1RK6A 2GVLA 2HDJA 1SUXA 3R94A 1H11A 2QR6A 8RUCA 1LQ0A 1M6JA 3N3TA 4CU7A 3RNDA 3IJ7A 4PCNA 2WKGA 4B4FA 2C14A 5C2XA 1PIIA 1V3JA 4IIBA 5JH1A 1GJWA 1TTIA 3ABZA 1R3YA 4IQJA 3CEUA 3OIHA 3W84A 4DVOA 1MUCA 3NPVA 2XSAA 1O6IA 1XQLA 3PJWA 3VKCA 3I7QA 1SZEA 3PC0A 4XO6A 5D04C 1XS2A 1IEVA 3AXKA 3KBWA 2I16A 2Y70A 1ECEA 3FSTA 3HPXA 1XLDA 3GW0A 1TX2A 2WWDA 2QPUA 1TE6A 1TRDA 2DIEA 4XB3A 4HQVA 1ISYA 1FHLA 7REQB 1TPVA 5DCEA 3H2FA 2JK2A 2DSUA 4JD4A 1ISZA 1Q13A 3IGUA 1TSIA 3ABQA 3H4WA 4GNJA 5JIPA 1LF1A 1QHOA 4K3ZA 4OE7A 1JZ4A 3OGRA 3IWPA 2G95A 1F7BA 1JPDX 5DLCA 1Q6CA 3LM7A 2A7PA 1O5KA 3G3DA 5JIWA 2OZTA 4IH3A 5ECUA 1TVLA 4GFIA 4UFHA 4B15A 2AMGA 5G1YA 4J2MA 4NZFA 4WF7A 2Z1VA 1H0IA 4PA8A 3VE7A 2QJMA 4JAWA 5GJNA 4HOXA 6A3HA 1PHQA 4O16A 4F9DA 3MWAA 3W87A 4BWLA 2PLMA 3W88A 1TRIA 1WDWA 5DEZA 3NQGA 4MZ1A 5HUOA 4IFKA 3UZJA 3EWUA 5CG7A 2FIQA 2WJFA 1H62A 1C93A 3SSJA 2W62A 4G1NA 5C54A 2OSYA 1P5BA 1B9ZA 5CJMA 1S2VA 3WQVA 1TQXA 1A5AA 1VKFA 2XM1A 3BJFA 3SCTA 4JYEA 1NDVA 1ZAHA 4IIGA 1RPKA 3V5CA 4HU0A 2GPTA 2EJAA 3QYQA 2RDXA 1B90A 3SSZA 3W76A 4ATWA 3DHPA 4ROQA 3UF9A 3QTGA 4LFYA 4MMWA 1P0EA 3WX7A 1I75A 1B3OA 1QRQA 4LUTB 2E68A 2YKKA 5LXEA 3RRXA 2D23A 4NZ4A 5DELA 3BGGA 4TOQA 2YR1A 3S5ZA 4PEEA 4LAZA 2RFGA 1VBUA 3EWZA 1KM3A 6XIMA 1AH3A 3SCPA 2B31A 3BLEA 4GXWA 3F03K 3TTQA 5AKQA 4CUCA 5A6LA 2BNJA 1MZHA 2EO7A 4K1GA 1OX5A 3W01A 4S3KA 3U57A 2D2GA 4L5ZA 4U4MA 3MP5A 5RUBA 1XIHA 3DYPA 3KXQA 1EOMA 1LRQA 2HROA 4HCDA 4RZBA 4O17A 3TYBA 4GA8A 3Q94A 3GVWA 4ES4A 2QUUA 4XD4A 2YDRA 2ABAA 2BY0A 4EACA 1KD0A 5F4XA 4Z2HA 4N9BA 3PZTA 2QUMA 1WBHA 2E5BA 4LAOA 2J62A 5KZMA 4UQDA 3VTRA 2V69A 1VLWA 1KGUA 4PN2A 5BNKA 2Z6IA 3BLDA 3IJQA 4HGXA 4CNSA 4QG8A 1H1NA 2XTKA 4AIUA 2QDEA 3P0WA 1E40A 4UQ9A 3V4BA 1WDDA 4F2UA 4AU0A 2VMFA 2FZ9A 2PDNA 1H2JA 3ARTA 4AEFA 3VKAA 1B5TA 4EAMA 4XD5A 4OECA 2YLLA 1MNSA 4IMCA 5A6MA 4P7OA 2JE8A 3LI0A 3W29A 1R3WA 4N42A 3I10A 4DF1A 2BZNA 1GK8A 2DORA 3GVGA 5BCAA 1W91A 4XIAA 3VFLA 1ZPTA 3EKZA 1HJSA 5CBBA 4W4QA 3W2JA 3H53A 3IK4A 2QT3A 4JTAA 1BKHA 4D1JA 2F61A 3AI0A 4FF7A 4GGHA 4AYSA 3KVJA 3LM3A 2XH4A 2FPYA 1YTEA 1B54A 3AC0A 3BPWA 1UPMB 3ECQA 4FNQA 3QQ1A 1TG7A 2VZSA 1W2PA 3UETA 2V6AA 1RALA 2YLAA 1D7FA 3NSNA 2MUCA 2R24A 3WQGA 3CMFA 1B2YA 3M6YA 2G4FA 3GFXA 3PTMA 4JIIX 4HCHA 3VPLA 5FJIA 1C9WA 2ZRZA 3KBMA 5AVNA 1SSGA 3WMLA 1X38A 2PDQA 2XN1A 4QTGA 2CW6A 1FDZA 5FCZA 4GUFA 1Q6OA 4FIQA 4YTSA 1H61A 1LBMA 2QCMA 2RJGA 1P7TB 1DJIA 4REQA 4EXBA 3N4FA 2OYKA 3QHMA 1T7LA 2JKEA 4AZ5A 4F3HA 4LYPA 2CBJA 1UKTA 4GK8A 1R2RA 5XIMA 3NQDA 4C6BA 3FY1A 3LPOA 3MMUA 1YADA 1H60A 2W63A 3F7JA 4RNHA 3IACA 3KOZA 2OU4A 1P43A 4O0ZA 2ZXQA 3R12A 2CIPA 1KXTA 5CSRA 2GJLA 3CO4A 4J1OA 3RX4A 2QYGA 4K36A 4WQ6A 1KM6A 3IVTA 1A53A 1E1FA 2H9AA 2BVWA 2GJXA 1H51A 1HFBA 1K9FA 1EBHA 1QXLA 3CZ8A 4RV3A 3O8AA 1JGMA 2GQAA 3DOPA 1IIHA 2F7FA 4GYFA 5G2HA 3WEMA 1S39A 3B05A 2CBIA 2V3FA 3OOQA 2D69A 4DLMA 3GVQA 3CTLA 3CAKA 4AVNA 4WSKA 1W1IE 2DSVA 1NSJA 3N18A 4OWGA 3W22A 2YXXA 1IEIA 3N29A 2I5GA 3G24A 3BG5A 3SR7A 4M24A 5GJMA 4NUWA 1THFD 2OKOA 3TONA 4J28A 2FKPA 4LXFA 2XN2A 3PNZA 2ISVA 1TTPA 1F3EA 1J10A 1YDOA 4LF2A 3VVGA 4DX3A 2YW4A 2GZXA 5CPOA 2VEFA 4D6HA 2ACSA 3K13A 3BTNA 3CXOA 3NQ2A 3BAKA 3GY1A 1QWKA 3IEBA 2CERA 4PMXA 1O94A 5CLWA 1V0LA 3MQTA 1E0UA 1TX0A 1EPXA 3EX1A 4W5ZA 7TAAA 3W00A 3L21A 1UHVA 4G9PA 1E9IA 2FFIA 1G9HA 3OA5A 1GJPA 2XIBA 4TX9A 1JZ2A 4O0QA 3QR0A 4LUSA 1I8JA 3GR7A 3FV9A 5H6HA 2WM1A 3JR2A 4PB4A </