1IXVA

Crystal structure analysis of homolog of oncoprotein gankyrin, an interactor of rb and cdk4/6
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
229
structure length
229
Chain Sequence
NYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNVVDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Crystal structure of the homolog of the oncoprotein gankyrin, an interactor of Rb and CDK4/6
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 73
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ixvA00
4A63B 5HKPA 5KBAA 1DCQA 2ETBA 4K5AB 5HS0A 4C48B 3DEOA 2XEEA 4UUCA 5CBOA 3AJIA 1MX4A 3JXJA 4HRMB 5EILA 4U95D 3T8KA 4CYMD 1AWCB 1BI7B 3NOGD 3W9FA 3TWWA 2F8XK 4OAUC 1AP7A 1SW6A 1YCSB 4NIKA 2J8SD 4DX6D 2A5EA 4O1OA 4HRLA 5AQ9A 1IHBA 1BD8A 5AQAA 2F8YA 4OAVB 2XENA 3JXIA 2Y1LE 5EN5D 4DX2A 3NOCD 3LJNA 2RFAA 4F1PA 1TR4A 4DRXE 4DX7D 1N0QA 5ENTD 4J7WA 1S70B 2QYJA 3UTMA 1DC2A 5EYLA 4K5BA 2ZGDA 2BKKB 5JMND 2KXPC 1N0RA 3V31A 2DWZA 4BERA 5D66A 1IXVA 4G8LA 1K3ZD 5CERB 3ZUVB 5CEAA 3DEPA 5ENOD 5AQ7A 1G3NB 1N11A 1YMPA 5AAOA 3W9GA 5FINA 1A5EA 3J5QB 4TUMA 2AJAA 5AN8A 2ETAA 3UI2A 3T9KA 3SO8A 3TWQA 3UXGA 4Z68A 2DVWA 2XEHA 3B7BA 1OY3D 2HE0A 4O60A 3V79K 5ENPD 5ENSD 4O1PA 1K1AA 4K5CA 1MX2A 4RLYA 5EIBE 3HRAA 3TWUA 2QC9A 5FIOA 1OT8A 2DZOA 4F6RD 2PNNA 2V4HC 4HLLA 5ENQD 5AQBA 3TWXA 3ZU7B 5HRYA 2ZGGA 1MX6A 4DX5D 4LSZE 1MJ0A 1K1BA 4BETA 4HBDA 4HB5A 1SVXA 4CZ2D 2BKGA 2V5QC 5ENRD 1BU9A 2RFMA 3C5RA 2ETCA 4HNAD 3AAAC 3V2OA 4U8VD 5KWDA 2B0OE 3HG0D 4JB8P 2DZNA 2MYOA 3IXEA 2VGEA 4YDWA 2JABA 1NFIE 1IKND 3B95A 4HQDA 5BXOA 4U96D 1QYMA 5KNHD 3Q9UC 4ATZD 1MYOA 3NBNB 4LG6A 5AARA 4DUIA 5EYPF 2FO1E 5BXUA 2F37A 1YYHA 1BLXB 2P2CP 4GMRA 3V2XA 5CEDB 5EIDA 4HI9A 3D9HA 1WG0A 4LNUD 3TWVA 3F6QA 5KNGA 4HRNA 3TWTA 4J8YA 3V30A 5CBNA 5JA4D 5CECB 1UOHA 4GPMA 1WDYA 4U8YD 3J5PA 4DX1A 2XZDG 4G8KA 4BESA 4YDYA 3TWRA 4BEPA 1BI8B 2L6BA 4N5QA 3Q9NC 2Y0BG 4QFVA 4BSZB 4B93B 3TWSA 1D9SA 3ZKJA 3EHQA 3JUEA 2NYJA 3EHRA 3ZNGA 4ZFHA 5ITZF 2XZTG 4HI8A 3EU9A 2KBXA 4ZHBA 3KEAA 4QQIA
chains in the Genus database with same CATH superfamily
5HKPA 3DWLG 5HS0A 3JXJA 3ZEFA 3DPYA 4BT9A 2AW6A 5EN5D 4DX2A 1HS6A 1KPSB 3FFLA 4GU5A 5G04C 1GW6A 4HFGA 3CHRA 3X2QE 2BKKB 1IXVA 3P1UA 2LSUA 3ZUVB 1U2VG 4JVSA 4Q94A 3SI5A 3CKCA 3UM0A 1ELKA 3KS2A 2LXLA 5ENPD 3ZHEB 3HRAA 4MS6A 4O6FA 1NP7A 1N52A 4UQYA 3N71A 5ARGA 3TAXA 4MRUA 5T3RA 1MJ0A 4PS8A 2VGYA 3DXKG 2BUGA 2CG3A 3LY7A 5CRUA 3C72A 4U04A 3UM1A 3D9KA 2LO6A 1TYQG 2H6HA 1HFAA 5E75A 4J0UA 3APFA 4XI0A 2QY7A 3PE4A 3EDTB 2WMOA 5KNGA 4E85A 1BI8B 2CFUA 3PEVB 2B6CA 1TN8A 1EPUA 4E6HA 3MYVA 4J8EA 4OVUA 3T5XA 3KEAA 4ZHBA 1N9AA 4KT6B 4XKCA 3E34A 4FC8A 1JWFA 3U9WA 3APDA 3ML8A 2WMNA 3ESLA 3ZHEA 4B8CB 1X81A 5FZQA 2XPYA 3DSXA 4G26A 4J6IA 3AS4A 5A7DB 2VYIA 1TN6A 1TN7A 2AWIA 3MZLB 1N94A 2OV8A 2E0IA 2AVPA 4AVXA 3C3RA 3UMVA 2J9QA 3ZVVA 5EIBE 3TWUA 2IF4A 3CSFA 2GRLA 1FT1A 2PNNA 5A23A 2FEZA 2WQ7A 3MKRA 3PZDA 2R17C 2ZGGA 3UKUG 4LSZE 2H6FA 3RU0A 4HORA 1H2VC 4U8HA 3V2OA 2B0OE 2HR2A 4JD2G 3SBTB 2FO7A 3ASDA 2DYRE 3QC1A 4UWFA 5AARA 2GRQB 3C98A 1DVPA 1YYHA 4XIFA 2WQHA 5AIJA 2Q7FA 3LEWA 2EIKE 2DYSE 3FH8A 1ZU2A 3C3QA 2L6BA 3Q9NC 3G2VA 4BSZB 1HH8A 3TWSA 2R03A 3QDNA 3TG4A 5HQ8A 5CCMA 2QFCA 1OWMA 1SA5A 4CEMA 4WWPA 4GA0A 3BUAA 2WM9A 1BI7B 4TUUA 2V5FA 3ZGQA 5BV1A 3CEQA 1BD8A 5KJMA 4FA6A 2RFAA 4GA1A 1B89A 4HOSA 2KXPC 4BFRA 3PVLA 4WWOA 3CR3A 3LVRE 2GGFA 3ZYLA 4HVBA 4RG6A 4KBQA 5DBKA 1Z3YA 3DSTA 4Z68A 3B7BA 4J8FA 4O1PA 2KM4A 2QC9A 3ZYKA 4F6RD 5ARFA 5FQ4A 4ME2A 2ZIRA 1QNFA 3QNKA 2AXVA 1KT0A 3IBEA 2ZXWE 4AP2A 1VDYA 3QK0A 1O5MA 5BXOA 3MGBA 3CVYA 4U96D 3S7FA 1UJKA 3LCAA 4EPZA 1H6KA 2Y3AA 1FCHA 3URZA 1U3CA 3UPVA 2OOEA 3HXFA 1O1RA 3LY8A 4I6JA 3IV0A 2WXHA 4BTAA 3FTWA 1UOHA 3I3NA 1H6OA 3J5PA 4EZKA 4RQIA 1D9SA 4HLEA 2C0MA 4U0UA 3DEOA 4ATGA 4U95D 4UQZA 2I9CA 3GZ2A 4NIKA 1TJCA 5BT1A 2P9SG 1MZCA 1Z5SC 2IJGX 5EYLA 3FU6A 2XRZA 3EIJA 2LAHA 3CLJA 5B3SE 3ABKE 1Z3XA 2ETAA 2V0PA 4JA7A 2IO2C 1OY3D 2WXIA 1SA4A 4FP7A 4GTQA 5FIOA 2J09A 3RRUA 2KATA 3R9AB 4GTTA 3GZ1A 1PAQA 4IN3B 3JQ0A 3UIOC 1IHGA 3Q47B 3KSQA 3L08A 4JB8P 2MYOA 2RG8A 2OEWA 3LKUA 3SNXA 3E30A 1MYOA 1OUVA 4EBAG 4EHMA 2NXPA 3V2XA 2UWJG 2P9UG 3HHMA 1SZAA 4LNUD 3TWTA 4KVMA 1HG2A 5CHEE 3CHSA 4HXIA 4BEPA 2P9LG 5JHBA 5H7PA 3PZ2A 5AYWD 2BEDA 2LUHA 4HI8A 3L6AA 2ZU6B 5T4YA 1TNBA 5KBAA 3T5VA 1UN8A 4B0ZA 3FDHA 2HYZA 2LNIA 4ACKA 2XPIA 4HOUA 3ULEG 3TG5A 1NA3A 1Z6TA 3CHPA 3KD7A 4A1SA 4F3VA 5KJNA 4PDXA 3LJNA 3RJVA 3QWVA 1TR4A 3UT8A 4DRXE 4FADA 3CVXA 3SHFA 5CEAA 3DPDA 5FINA 3J5QB 2WXLA 3TL5A 3E37A 1E96B 1H2UA 5EDSA 3AG2E 4LEUA 5LX8A 4GTSA 4JC8A 4B8AA 3ZU7B 5ENQD 4G2VA 3UT4A 3RK6A 1HO8A 5T8IA 3FU5A 4R7LA 3FH5A 3O4ZA 3AAAC 1OWPA 4F7AA 3HG0D 4PS3A 1Y8MA 3ZRHA 5KNHD 5KJLA 2FO1E 3MX3A 1RZ4A 4KXKB 3TWVA 3LVQE 4F53A 3RRNB 1HU3A 4W9RA 2LAIA 3LXUX 4GPMA 1MQSA 2JLBA 4YDYA 3HIZA 3FHEA 3HDXA 2IU1A 2J08A 4BX8A 1ZBPA 4N3CA 2DIWA 5G04J 2EQXA 4JXTA 5C1DA 2WVIA 1XNFA 4C48B 1TJFA 2WXFA 3TXNA 4F1SA 3W9FA 2F8XK 3MCXA 1NI1A 2YINA 4I1AA 2R02A 4HRLA 3DSVA 2XENA 4I2WA 4FJYA 5CMYA 4OYSA 3GZSA 2J07A 2GRPB 3DEPA 4ANUA 2CHXA 2AXZA 4A3TA 3GW4A 3UXGA 2EINE 4CGWA 2JEKA 4KYOB 2XS1A 3MKQB 4JHKA 4DPRA 1DCEA 2Y4UA 3EHNA 4N39A 4NURA 3ESKA 3P2BA 3SBSA 3IHVA 4C0MA 5KJKA 1NFIE 3PZ3A 2X6JA 2C2LA 4UWKA 2CFZA 3SF4A 2XEVA 4WNFA 2XRYA 3VLFA 1NA0A 3OXFA 3FUJA 2J4DA 4I1MA 3V30A 3MA5A 4LCTA 2BTDA 2IOSA 4NQ0A 3FUMA 4JA9A 3AS5A 3ASGA 3D9LA 3DSUA 2P9IG 4ZFHA 4QQIA 5JJ7A 1KZPA 1MHQA 4J8DA 1JCQA 4GYOA 1MX4A 4GTOA 4UI9K 4OAVB 5J08A 3WXXA 5LCWC 2A4ZA 3SZ7A 3MV2B 1S70B 2DCPA 2ZGDA 3MKQA 1N0RA 3PS6A 3FTZA 2WPVA 2FF4A 1BPOA 5D0OD 2QZAA 4PH4B 2R05A 5ENSD 3E32A 5HI7A 2GROB 1OT8A 2XS8A 5BUZA 3Q78A 5FT9A 1K1BA 5FZRA 3QOUA 4I1OB 4TRQA 3O48A 2V5QC 4LUNU 2ETCA 5FWQA 5ANRA 4CDMA 3G2TA 4M3OA 2JABA 3E4BA 3OXGA 4AIFA 4BT8A 4LG6A 5EIDA 2XHEA 1S64A 3D9OA 2RD0A 4WUYA 5CBNA 4G23A 3HXDA 1JWGA 3TJPA 4APOA 3HXBA 4FLBA 4WNEA 4YVOA 3EHRA 4AV7A 2DBAA 3D9MA 3SD5A 3DSSA 4A63B 3CK9A 4FLHA 3PRZA 4TXQA 4N5CA 4XEIG 3TWWA 1E8WA 1SW6A 2GRMA 2A5EA 1TNOA 4APFA 4YNDA 4WNDA 2WXMA 4EBAA 3ZW3A 5LFAA 3ML9A 1UN9A 4ILGA 2V8SE 3Q79A 4H7XA 3V31A 5AJDA 2XGSA 4M7CA 4G8LA 3QJZA 3FTYA 3Q49B 5AN8A 3UI2A 1L5JA 1OWOA 4WWNA 2DVWA 3B7UX 3HXCA 4DLQA 5BNWA 4K5CA 1PC2A 3EIQC 4LRZA 3ZXSA 3TWXA 2XQ0A 5E76A 3B7TA 4C0EA 4BETA 2CHWA 4G11A 1N4RA 4HBDA 4AOFA 1S63A 3R7RA 3RIBA 3OXLA 3BEEA 4UI9J 4A55A 4YDWA 1JUQA 3CHOA 3DSWA 1V55E 3SFXA 1EYHA 2J4BA 3JCKC 2F37A 3IKOB 5FQ6A 3EJNA 3UQ3A 3CKBA 4DJAA 4DI4A 2M63A 4DK5A 1KZOA 4AJWA 4IYPA 4JL0A 3L9TA 4ILIA 3JYSA 3U3WA 2CHZA 3CQGB 1K8KG 2VSYA 2R2LA 2ILRA 2LXMA 2J8SD 4UI9C 2VTBB 1OCCE 2GW1A 4BSXA 3UINC 3LY9A 4K5BA 3C3OA 1K3ZD 1LTXA 1G3NB 2R59A 4BX9A 3MEKA 1D8EA 2X38A 4YVQC 4CCAA 2WXQA 2XEHA 3MJWA 4RLYA 3ASNE 2FI7A 4JZYA 3CIAA 2XGOA 3NQPA 2RKKA 3SFYA 1OWLA 3ONKA 5ENRD 1LD7A 1BU9A 4JHRA 1FPPA 1P5QA 2PQRA 3D9PA 4IULA 3CVLA 3UT7A 4ATZD 4MBGA 3I5PA 4I6EA 4NRHB 1WG0A 2VTBA 1HX8A 1OCOE 5JA4D 1V54E 4YDEA 5BV0A 2XZDG 5CCLA 4N5QA 3EHQA 4RG9A 2L6JA 2X6FA 3QWPA 5A6CA 2VSNA 2X6KA 2OCCE 2XCBA 1U3DA 2XEEA 3AJIA 3S2AA 5EILA 3R7QA 2UY1B 4GTMA 1IHBA 2NC9A 3FUIA 2Y1LE 3L17A 1H2TC 4A1GA 3PEUB 4J7WA 2XCCA 3PZ4A 3FTXA 2NSZA 4V3IA 5ENOD 2WQ6A 3R9MA 4L1BA 5IY5E 1IQRA 4O60A 1OXJA 3UUXA 1K1AA 1N54A 5LP0A 4HOQA 4L9PA 1JPLA 4DX5D 4HB5A 2EIJE 3FU0A 4A3VA 1O1SA 3FUNA 3FULA 1UG3A 3NZSA 3CVQA 3I4RB 3ASFA 3UIPC 3B95A 5B1AE 4HS2A 4DLOA 2I6HA 5FQ8A 3FUKA 5EYPF 3ASHA 5CEDB 3RKVA 2X3MA 4Q96A 4D10C 3RSEG 4UWGA 2UY1A 3S7BA 1Q2ZA 4I6GA 4AEZC 4PUCA 2F0YA 3LPZA 4DX1A 3ONLA 3DXMG 4B93B 1IYGA 3PUJA 3KEZA 5LOZA 3CHMA 3JUEA 4GTVA 4KZCA 3ZNGA 5ITZF 2QYUA 1HZ4A 5G55A 4YDOA 3SQVA 4JHJA 4HRMB 1AP7A 4GA2A 3AG1E 4UWLA 1X5BA 3FP3A 5G2NA 2IY0C 1N0QA 4AXHA 2KCVA 3K9IA 1OCZE 4L2LA 1H6PA 5KCMA 4JW1A 3JQ1A 5CERB 3BQOA 3FTVA 5AAOA 4HOTA 1A5EA 1FT2A 3CV0A 5CMWA 5FZSA 3EU5A 1E7UA 4U7EB 3CVPA 4EZLA 5EX0A 3NB2A 3I4GA 3AG4E 4HLLA 4GCNA 1UW4B 3PNTB 4UWHA 1E8ZA 2YQ8A 4I2ZA 2IFUA 4FHJA 3OTNA 1KT1A 5CRVA 3FH7A 4GZ5A 1N4QA 1IKND 3CVNA 4CDNA 4NACA 4N3AA 5FJYA 2PM6A 2P2CP 4HI9A 3OAWA 3Q7AA 3L82A 4FHKA 4TXPA 4J8YA 1S0PA 4ANWA 4CT0A 4CRWA 1FVFA 2MRIA 3FWVA 3ZKJA 3PNLB 5LCWJ 2A5UA 4ANVA 4I9CA 3G2WA 4K5AB 3FUEA 1AWCB 3T8KA 1TEZA 1ZB1A 4GMJA 2I1KA 3JXIA 1JCSA 4MKTA 2BF0X 4EECA 5ENTD 4J8SA 4FJZA 5JMND 3L13A 3ZYQA 5D66A 2KC7A 3B7SA 4GB9A 3CSTA 3LDZA 4U63A 4JEUA 1E90A 2DZOA 2WXOA 5D0QD 5JJTA 2GRRB 4OVVA 4XKBA 5AENA 1INZA 4U0SA 4ACLA 2HO1A 1H19A 5B1BE 3L54A 2H6IA 3AG3E 3UM3A 2VGXB 2L9BA 2VJ8A 4KVOA 4GCOA 3PUKA 3VLDA 1LF8A 4EQFA 3KSLA 4FULA 4XI9A 4I17A 3F6QA 3G2SA 4XE0A 5CECB 4U8YD 3VLEA 4Q69A 4BESA 2Y0BG 2OVFA 3IHYA 2VSXE 3PREA 4G25A 1OWNA 4Y6CA 2ETBA 2PL2A 2E2EA 4GTRA 3Q73A 3RRMB 5AQ9A 3D9JA 1QQEA 5AQAA 3FUFA 4F1PA 2IO3C 3FTUA 2YHEA 4CGVA 5ENNA 3CVUA 2C0LA 3ZFWA 3W9GA 4Y6WA 1RW2A 1TNUA 4H7YA 4AY5A 2AJAA 3Q15A 3SY2A 3ENEA 4B89A 4GYWA 2VQ2A 4DI3A 2HM8A 2VGXA 3AU4A 2OEVA 3TXMA 3Q4AB 3U4TA 3B7RL 1NL4A 2H6GA 2IEJA 5AQBA 5J90A 3B13A 4B94A 1TNYA 1SVXA 4L2YA 5C2YA 4CZ2D 2WXGA 5ANLA 2IOLA 2RFMA 2P9KG 4HNAD 4N2QA 3IEGA 3Q5MA 2VGEA 2YHCA 4HQDA 1QYMA 3Q9UC 3ABME 3LS8A 4DUIA 4I43A 1N4PA 1BLXB 2MOWA 1YA0A 2EIME 3CVWA 4WNGA 2WXNA 3DRAA 4XX5A 4RVBA 3DBSA 1N95A 2KCLA 3QARA 1TNZA 4K0RA 3PH0C 2WXJA 3EU9A 3PDNA 1EF1C 5AJLA 2XPZA 2PZIA 1DCQA 3RO3A 5CBOA 4LNBA 2P9NG 1YCSB 3FUHA 5G05J 2VSOE 2F8YA 1FVHA 1WY6A 4DX7D 3U64A 1A17A 2KCKA 2QYJA 4GZ3A 1DC2A 4BWRA 1QBQA 4BERA 2KZTB 3D3MA 4GZ6A 1OCRE 5D2MC 3Q7FA 3UX4A 4TUMA 3SO8A 3TWQA 3QWWA 1MX2A 1IQUA 2V4HC 3EHMA 4GAAA 4G1TA 5M72A 3CHQA 3CVVA 2FBNA 1KLXA 4AM9A 5G05C 5FTPA 4GPKA 4LERA 4N2SA 4CDRA 3FEXA 4BY6A 1E8XA 2V4LA 3L22A 3HXEA 5DIZA 5FQ7A 4JPSA 3S7JA 2OVBA 3L16A 3FTSA 2I2OA 1WAO1 4HRNA 4U07A 4ABNA 3S7DA 3CK7A 4G8KA 4CT4A 2EILE 3TWRA 3NAWA 1HF8A 2AXUA 4PS7A 1QZ2A 2KZTA 3AU5A 3QB2A 1E7VA 4XZ4A 3SFZA 1Y6IA 2ZISA 3G2UA 4UUCA 3NOGD 3T8MA 1HG5A 4JEHA 4URKA 3ZIMA 3ULQA 2WXKA 4KZ0A 2FULA 2LSVA 3SGHA 3NOCD 2ONDA 3UM2A 4K03A 3UTMA 5BW8C 3UKRG 4GZDA 4GZCA 4X8QA 2PM7A 1JCRA 3RAUA 1HXIA 4RSYA 5AQ7A 1N11A 1YMPA 3BG1B 3BG0B 3MV3B 2WB2A 3T9KA 3FY4A 1LD8A 3APCA 2HE0A 4AY6A 1D8DA 2GRNB 3NF1A 3ABLE 3WG7E 1SZ9A 3ISMC 3U66A 5EKQD 4UQXA 2YNQA 3D9NA 3ASOE 2BKGA 3C5RA 2L0IA 3RO2A 3ZXPA 3EUVA 3IXEA 3PZ1A 1W3BA 4G24A 5EX3A 2I1JA 1EDUA 3NBNB 1O1TA 3QAQA 5BXUA 5JJ6A 3HVEB 3NZUA 1WDYA 4BTBA 4GMLA 3KAEA 4EZJA 2IQCA 2J49A 2NYJA 2XZTG 3CQCB 4TV3A 1N4SA 2KBXA 1HE8A 3FU3A 3FUDA 4P29A 3ZYMA 3PE3A 3ULYA 4U0ZA 3CGHA 4LNGA 1PY1A 4L7TA 4CYMD 3Q75A 2P58C 4OAUC 4DX6D 3E33A 4O1OA 3ZN3A 2WXRA 1E8YA 1NZNA 2R5SA 4GYYA 2DWZA 3FEYA 3BU8A 4KMOA 4L23A 1WM5A 2XGMA 1UJJA 1DNPA 3V79K 4MLPA 2X6IA 3VTYA 4ILHB 4FU3A 2IONA 2X6HA 5HRYA 1MX6A 3HYMB 3AS8A 2MHKA 3HVEA 2CG2A 3JUIA 2L0TB 1XGWA 4TXRA 4U8VD 4C9BB 5KWDA 2WXPA 2Y4TA 2DZNA 3GYZA 1ELWA 5JHAA 5BPPA 3TGOA 1SQMA 3CK8A 3LYAA 4GMRA 4ANXA 3D9HA 4N3BA 4I9EA 2Y69E 4IRUA 3LJ3A 1H0AA 3ZPJA 2P9PG 2PQNA 4QFVA 3VTXA 3QKYA 4WAFA 4GTPA 3D9IA 1ELRA
chains in the Genus database with same CATH topology
4A63B 5HKPA 5KBAA 1DCQA 2ETBA 4K5AB 5HS0A 4C48B 3DEOA 2XEEA 4UUCA 5CBOA 3AJIA 1MX4A 3JXJA 4HRMB 5EILA 4U95D 3T8KA 4CYMD 1AWCB 1BI7B 3NOGD 3W9FA 3TWWA 2F8XK 4OAUC 1AP7A 1SW6A 1YCSB 4NIKA 2J8SD 4DX6D 2A5EA 4O1OA 4HRLA 5AQ9A 1IHBA 1BD8A 5AQAA 2F8YA 4OAVB 2XENA 3JXIA 2Y1LE 5EN5D 4DX2A 3NOCD 3LJNA 2RFAA 4F1PA 1TR4A 4DRXE 4DX7D 1N0QA 5ENTD 4J7WA 1S70B 2QYJA 3UTMA 1DC2A 5EYLA 4K5BA 2ZGDA 2BKKB 5JMND 2KXPC 1N0RA 3V31A 2DWZA 4BERA 5D66A 1IXVA 4G8LA 1K3ZD 5CERB 3ZUVB 5CEAA 3DEPA 5ENOD 5AQ7A 1G3NB 1N11A 1YMPA 5AAOA 3W9GA 5FINA 1A5EA 3J5QB 4TUMA 2AJAA 5AN8A 2ETAA 3UI2A 3T9KA 3SO8A 3TWQA 3UXGA 4Z68A 2DVWA 2XEHA 3B7BA 1OY3D 2HE0A 4O60A 3V79K 5ENPD 5ENSD 4O1PA 1K1AA 4K5CA 1MX2A 4RLYA 5EIBE 3HRAA 3TWUA 2QC9A 5FIOA 1OT8A 2DZOA 4F6RD 2PNNA 2V4HC 4HLLA 5ENQD 5AQBA 3TWXA 3ZU7B 5HRYA 2ZGGA 1MX6A 4DX5D 4LSZE 1MJ0A 1K1BA 4BETA 4HBDA 4HB5A 1SVXA 4CZ2D 2BKGA 2V5QC 5ENRD 1BU9A 2RFMA 3C5RA 2ETCA 4HNAD 3AAAC 3V2OA 4U8VD 5KWDA 2B0OE 3HG0D 4JB8P 2DZNA 2MYOA 3IXEA 2VGEA 4YDWA 2JABA 1NFIE 1IKND 3B95A 4HQDA 5BXOA 4U96D 1QYMA 5KNHD 3Q9UC 4ATZD 1MYOA 3NBNB 4LG6A 5AARA 4DUIA 5EYPF 2FO1E 5BXUA 2F37A 1YYHA 1BLXB 2P2CP 4GMRA 3V2XA 5CEDB 5EIDA 4HI9A 3D9HA 1WG0A 4LNUD 3TWVA 3F6QA 5KNGA 4HRNA 3TWTA 4J8YA 3V30A 5CBNA 5JA4D 5CECB 1UOHA 4GPMA 1WDYA 4U8YD 3J5PA 4DX1A 2XZDG 4G8KA 4BESA 4YDYA 3TWRA 4BEPA 1BI8B 2L6BA 4N5QA 3Q9NC 2Y0BG 4QFVA 4BSZB 4B93B 3TWSA 1D9SA 3ZKJA 3EHQA 3JUEA 2NYJA 3EHRA 3ZNGA 4ZFHA 5ITZF 2XZTG 4HI8A 3EU9A 2KBXA 4ZHBA 3KEAA 4QQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A63 B;  5HKP A;  5KBA A;  1DCQ A;  2ETB A;  4K5A B;  5HS0 A;  4C48 B;  3DEO A;  2XEE A;  4UUC A;  5CBO A;  3AJI A;  1MX4 A;  3JXJ A;  4HRM B;  5EIL A;  4U95 D;  3T8K A;  4CYM D;  1AWC B;  1BI7 B;  3NOG D;  3W9F A;  3TWW A;  2F8X K;  4OAU C;  1AP7 A;  1SW6 A;  1YCS B;  4NIK A;  2J8S D;  4DX6 D;  2A5E A;  4O1O A;  4HRL A;  5AQ9 A;  1IHB A;  1BD8 A;  5AQA A;  2F8Y A;  4OAV B;  2XEN A;  3JXI A;  2Y1L E;  5EN5 D;  4DX2 A;  3NOC D;  3LJN A;  2RFA A;  4F1P A;  1TR4 A;  4DRX E;  4DX7 D;  1N0Q A;  5ENT D;  4J7W A;  1S70 B;  2QYJ A;  3UTM A;  1DC2 A;  5EYL A;  4K5B A;  2ZGD A;  2BKK B;  5JMN D;  2KXP C;  1N0R A;  3V31 A;  2DWZ A;  4BER A;  5D66 A;  1IXV A;  4G8L A;  1K3Z D;  5CER B;  3ZUV B;  5CEA A;  3DEP A;  5ENO D;  5AQ7 A;  1G3N B;  1N11 A;  1YMP A;  5AAO A;  3W9G A;  5FIN A;  1A5E A;  3J5Q B;  4TUM A;  2AJA A;  5AN8 A;  2ETA A;  3UI2 A;  3T9K A;  3SO8 A;  3TWQ A;  3UXG A;  4Z68 A;  2DVW A;  2XEH A;  3B7B A;  1OY3 D;  2HE0 A;  4O60 A;  3V79 K;  5ENP D;  5ENS D;  4O1P A;  1K1A A;  4K5C A;  1MX2 A;  4RLY A;  5EIB E;  3HRA A;  3TWU A;  2QC9 A;  5FIO A;  1OT8 A;  2DZO A;  4F6R D;  2PNN A;  2V4H C;  4HLL A;  5ENQ D;  5AQB A;  3TWX A;  3ZU7 B;  5HRY A;  2ZGG A;  1MX6 A;  4DX5 D;  4LSZ E;  1MJ0 A;  1K1B A;  4BET A;  4HBD A;  4HB5 A;  1SVX A;  4CZ2 D;  2BKG A;  2V5Q C;  5ENR D;  1BU9 A;  2RFM A;  3C5R A;  2ETC A;  4HNA D;  3AAA C;  3V2O A;  4U8V D;  5KWD A;  2B0O E;  3HG0 D;  4JB8 P;  2DZN A;  2MYO A;  3IXE A;  2VGE A;  4YDW A;  2JAB A;  1NFI E;  1IKN D;  3B95 A;  4HQD A;  5BXO A;  4U96 D;  1QYM A;  5KNH D;  3Q9U C;  4ATZ D;  1MYO A;  3NBN B;  4LG6 A;  5AAR A;  4DUI A;  5EYP F;  2FO1 E;  5BXU A;  2F37 A;  1YYH A;  1BLX B;  2P2C P;  4GMR A;  3V2X A;  5CED B;  5EID A;  4HI9 A;  3D9H A;  1WG0 A;  4LNU D;  3TWV A;  3F6Q A;  5KNG A;  4HRN A;  3TWT A;  4J8Y A;  3V30 A;  5CBN A;  5JA4 D;  5CEC B;  1UOH A;  4GPM A;  1WDY A;  4U8Y D;  3J5P A;  4DX1 A;  2XZD G;  4G8K A;  4BES A;  4YDY A;  3TWR A;  4BEP A;  1BI8 B;  2L6B A;  4N5Q A;  3Q9N C;  2Y0B G;  4QFV A;  4BSZ B;  4B93 B;  3TWS A;  1D9S A;  3ZKJ A;  3EHQ A;  3JUE A;  2NYJ A;  3EHR A;  3ZNG A;  4ZFH A;  5ITZ F;  2XZT G;  4HI8 A;  3EU9 A;  2KBX A;  4ZHB A;  3KEA A;  4QQI A; 
#chains in the Genus database with same CATH topology
 5HKP A;  3DWL G;  5HS0 A;  3JXJ A;  3ZEF A;  3DPY A;  4BT9 A;  2AW6 A;  5EN5 D;  4DX2 A;  1HS6 A;  1KPS B;  3FFL A;  4GU5 A;  5G04 C;  1GW6 A;  4HFG A;  3CHR A;  3X2Q E;  2BKK B;  1IXV A;  3P1U A;  2LSU A;  3ZUV B;  1U2V G;  4JVS A;  4Q94 A;  3SI5 A;  3CKC A;  3UM0 A;  1ELK A;  3KS2 A;  2LXL A;  5ENP D;  3ZHE B;  3HRA A;  4MS6 A;  4O6F A;  1NP7 A;  1N52 A;  4UQY A;  3N71 A;  5ARG A;  3TAX A;  4MRU A;  5T3R A;  1MJ0 A;  4PS8 A;  2VGY A;  3DXK G;  2BUG A;  2CG3 A;  3LY7 A;  5CRU A;  3C72 A;  4U04 A;  3UM1 A;  3D9K A;  2LO6 A;  1TYQ G;  2H6H A;  1HFA A;  5E75 A;  4J0U A;  3APF A;  4XI0 A;  2QY7 A;  3PE4 A;  3EDT B;  2WMO A;  5KNG A;  4E85 A;  1BI8 B;  2CFU A;  3PEV B;  2B6C A;  1TN8 A;  1EPU A;  4E6H A;  3MYV A;  4J8E A;  4OVU A;  3T5X A;  3KEA A;  4ZHB A;  1N9A A;  4KT6 B;  4XKC A;  3E34 A;  4FC8 A;  1JWF A;  3U9W A;  3APD A;  3ML8 A;  2WMN A;  3ESL A;  3ZHE A;  4B8C B;  1X81 A;  5FZQ A;  2XPY A;  3DSX A;  4G26 A;  4J6I A;  3AS4 A;  5A7D B;  2VYI A;  1TN6 A;  1TN7 A;  2AWI A;  3MZL B;  1N94 A;  2OV8 A;  2E0I A;  2AVP A;  4AVX A;  3C3R A;  3UMV A;  2J9Q A;  3ZVV A;  5EIB E;  3TWU A;  2IF4 A;  3CSF A;  2GRL A;  1FT1 A;  2PNN A;  5A23 A;  2FEZ A;  2WQ7 A;  3MKR A;  3PZD A;  2R17 C;  2ZGG A;  3UKU G;  4LSZ E;  2H6F A;  3RU0 A;  4HOR A;  1H2V C;  4U8H A;  3V2O A;  2B0O E;  2HR2 A;  4JD2 G;  3SBT B;  2FO7 A;  3ASD A;  2DYR E;  3QC1 A;  4UWF A;  5AAR A;  2GRQ B;  3C98 A;  1DVP A;  1YYH A;  4XIF A;  2WQH A;  5AIJ A;  2Q7F A;  3LEW A;  2EIK E;  2DYS E;  3FH8 A;  1ZU2 A;  3C3Q A;  2L6B A;  3Q9N C;  3G2V A;  4BSZ B;  1HH8 A;  3TWS A;  2R03 A;  3QDN A;  3TG4 A;  5HQ8 A;  5CCM A;  2QFC A;  1OWM A;  1SA5 A;  4CEM A;  4WWP A;  4GA0 A;  3BUA A;  2WM9 A;  1BI7 B;  4TUU A;  2V5F A;  3ZGQ A;  5BV1 A;  3CEQ A;  1BD8 A;  5KJM A;  4FA6 A;  2RFA A;  4GA1 A;  1B89 A;  4HOS A;  2KXP C;  4BFR A;  3PVL A;  4WWO A;  3CR3 A;  3LVR E;  2GGF A;  3ZYL A;  4HVB A;  4RG6 A;  4KBQ A;  5DBK A;  1Z3Y A;  3DST A;  4Z68 A;  3B7B A;  4J8F A;  4O1P A;  2KM4 A;  2QC9 A;  3ZYK A;  4F6R D;  5ARF A;  5FQ4 A;  4ME2 A;  2ZIR A;  1QNF A;  3QNK A;  2AXV A;  1KT0 A;  3IBE A;  2ZXW E;  4AP2 A;  1VDY A;  3QK0 A;  1O5M A;  5BXO A;  3MGB A;  3CVY A;  4U96 D;  3S7F A;  1UJK A;  3LCA A;  4EPZ A;  1H6K A;  2Y3A A;  1FCH A;  3URZ A;  1U3C A;  3UPV A;  2OOE A;  3HXF A;  1O1R A;  3LY8 A;  4I6J A;  3IV0 A;  2WXH A;  4BTA A;  3FTW A;  1UOH A;  3I3N A;  1H6O A;  3J5P A;  4EZK A;  4RQI A;  1D9S A;  4HLE A;  2C0M A;  4U0U A;  3DEO A;  4ATG A;  4U95 D;  4UQZ A;  2I9C A;  3GZ2 A;  4NIK A;  1TJC A;  5BT1 A;  2P9S G;  1MZC A;  1Z5S C;  2IJG X;  5EYL A;  3FU6 A;  2XRZ A;  3EIJ A;  2LAH A;  3CLJ A;  5B3S E;  3ABK E;  1Z3X A;  2ETA A;  2V0P A;  4JA7 A;  2IO2 C;  1OY3 D;  2WXI A;  1SA4 A;  4FP7 A;  4GTQ A;  5FIO A;  2J09 A;  3RRU A;  2KAT A;  3R9A B;  4GTT A;  3GZ1 A;  1PAQ A;  4IN3 B;  3JQ0 A;  3UIO C;  1IHG A;  3Q47 B;  3KSQ A;  3L08 A;  4JB8 P;  2MYO A;  2RG8 A;  2OEW A;  3LKU A;  3SNX A;  3E30 A;  1MYO A;  1OUV A;  4EBA G;  4EHM A;  2NXP A;  3V2X A;  2UWJ G;  2P9U G;  3HHM A;  1SZA A;  4LNU D;  3TWT A;  4KVM A;  1HG2 A;  5CHE E;  3CHS A;  4HXI A;  4BEP A;  2P9L G;  5JHB A;  5H7P A;  3PZ2 A;  5AYW D;  2BED A;  2LUH A;  4HI8 A;  3L6A A;  2ZU6 B;  5T4Y A;  1TNB A;  5KBA A;  3T5V A;  1UN8 A;  4B0Z A;  3FDH A;  2HYZ A;  2LNI A;  4ACK A;  2XPI A;  4HOU A;  3ULE G;  3TG5 A;  1NA3 A;  1Z6T A;  3CHP A;  3KD7 A;  4A1S A;  4F3V A;  5KJN A;  4PDX A;  3LJN A;  3RJV A;  3QWV A;  1TR4 A;  3UT8 A;  4DRX E;  4FAD A;  3CVX A;  3SHF A;  5CEA A;  3DPD A;  5FIN A;  3J5Q B;  2WXL A;  3TL5 A;  3E37 A;  1E96 B;  1H2U A;  5EDS A;  3AG2 E;  4LEU A;  5LX8 A;  4GTS A;  4JC8 A;  4B8A A;  3ZU7 B;  5ENQ D;  4G2V A;  3UT4 A;  3RK6 A;  1HO8 A;  5T8I A;  3FU5 A;  4R7L A;  3FH5 A;  3O4Z A;  3AAA C;  1OWP A;  4F7A A;  3HG0 D;  4PS3 A;  1Y8M A;  3ZRH A;  5KNH D;  5KJL A;  2FO1 E;  3MX3 A;  1RZ4 A;  4KXK B;  3TWV A;  3LVQ E;  4F53 A;  3RRN B;  1HU3 A;  4W9R A;  2LAI A;  3LXU X;  4GPM A;  1MQS A;  2JLB A;  4YDY A;  3HIZ A;  3FHE A;  3HDX A;  2IU1 A;  2J08 A;  4BX8 A;  1ZBP A;  4N3C A;  2DIW A;  5G04 J;  2EQX A;  4JXT A;  5C1D A;  2WVI A;  1XNF A;  4C48 B;  1TJF A;  2WXF A;  3TXN A;  4F1S A;  3W9F A;  2F8X K;  3MCX A;  1NI1 A;  2YIN A;  4I1A A;  2R02 A;  4HRL A;  3DSV A;  2XEN A;  4I2W A;  4FJY A;  5CMY A;  4OYS A;  3GZS A;  2J07 A;  2GRP B;  3DEP A;  4ANU A;  2CHX A;  2AXZ A;  4A3T A;  3GW4 A;  3UXG A;  2EIN E;  4CGW A;  2JEK A;  4KYO B;  2XS1 A;  3MKQ B;  4JHK A;  4DPR A;  1DCE A;  2Y4U A;  3EHN A;  4N39 A;  4NUR A;  3ESK A;  3P2B A;  3SBS A;  3IHV A;  4C0M A;  5KJK A;  1NFI E;  3PZ3 A;  2X6J A;  2C2L A;  4UWK A;  2CFZ A;  3SF4 A;  2XEV A;  4WNF A;  2XRY A;  3VLF A;  1NA0 A;  3OXF A;  3FUJ A;  2J4D A;  4I1M A;  3V30 A;  3MA5 A;  4LCT A;  2BTD A;  2IOS A;  4NQ0 A;  3FUM A;  4JA9 A;  3AS5 A;  3ASG A;  3D9L A;  3DSU A;  2P9I G;  4ZFH A;  4QQI A;  5JJ7 A;  1KZP A;  1MHQ A;  4J8D A;  1JCQ A;  4GYO A;  1MX4 A;  4GTO A;  4UI9 K;  4OAV B;  5J08 A;  3WXX A;  5LCW C;  2A4Z A;  3SZ7 A;  3MV2 B;  1S70 B;  2DCP A;  2ZGD A;  3MKQ A;  1N0R A;  3PS6 A;  3FTZ A;  2WPV A;  2FF4 A;  1BPO A;  5D0O D;  2QZA A;  4PH4 B;  2R05 A;  5ENS D;  3E32 A;  5HI7 A;  2GRO B;  1OT8 A;  2XS8 A;  5BUZ A;  3Q78 A;  5FT9 A;  1K1B A;  5FZR A;  3QOU A;  4I1O B;  4TRQ A;  3O48 A;  2V5Q C;  4LUN U;  2ETC A;  5FWQ A;  5ANR A;  4CDM A;  3G2T A;  4M3O A;  2JAB A;  3E4B A;  3OXG A;  4AIF A;  4BT8 A;  4LG6 A;  5EID A;  2XHE A;  1S64 A;  3D9O A;  2RD0 A;  4WUY A;  5CBN A;  4G23 A;  3HXD A;  1JWG A;  3TJP A;  4APO A;  3HXB A;  4FLB A;  4WNE A;  4YVO A;  3EHR A;  4AV7 A;  2DBA A;  3D9M A;  3SD5 A;  3DSS A;  4A63 B;  3CK9 A;  4FLH A;  3PRZ A;  4TXQ A;  4N5C A;  4XEI G;  3TWW A;  1E8W A;  1SW6 A;  2GRM A;  2A5E A;  1TNO A;  4APF A;  4YND A;  4WND A;  2WXM A;  4EBA A;  3ZW3 A;  5LFA A;  3ML9 A;  1UN9 A;  4ILG A;  2V8S E;  3Q79 A;  4H7X A;  3V31 A;  5AJD A;  2XGS A;  4M7C A;  4G8L A;  3QJZ A;  3FTY A;  3Q49 B;  5AN8 A;  3UI2 A;  1L5J A;  1OWO A;  4WWN A;  2DVW A;  3B7U X;  3HXC A;  4DLQ A;  5BNW A;  4K5C A;  1PC2 A;  3EIQ C;  4LRZ A;  3ZXS A;  3TWX A;  2XQ0 A;  5E76 A;  3B7T A;  4C0E A;  4BET A;  2CHW A;  4G11 A;  1N4R A;  4HBD A;  4AOF A;  1S63 A;  3R7R A;  3RIB A;  3OXL A;  3BEE A;  4UI9 J;  4A55 A;  4YDW A;  1JUQ A;  3CHO A;  3DSW A;  1V55 E;  3SFX A;  1EYH A;  2J4B A;  3JCK C;  2F37 A;  3IKO B;  5FQ6 A;  3EJN A;  3UQ3 A;  3CKB A;  4DJA A;  4DI4 A;  2M63 A;  4DK5 A;  1KZO A;  4AJW A;  4IYP A;  4JL0 A;  3L9T A;  4ILI A;  3JYS A;  3U3W A;  2CHZ A;  3CQG B;  1K8K G;  2VSY A;  2R2L A;  2ILR A;  2LXM A;  2J8S D;  4UI9 C;  2VTB B;  1OCC E;  2GW1 A;  4BSX A;  3UIN C;  3LY9 A;  4K5B A;  3C3O A;  1K3Z D;  1LTX A;  1G3N B;  2R59 A;  4BX9 A;  3MEK A;  1D8E A;  2X38 A;  4YVQ C;  4CCA A;  2WXQ A;  2XEH A;  3MJW A;  4RLY A;  3ASN E;  2FI7 A;  4JZY A;  3CIA A;  2XGO A;  3NQP A;  2RKK A;  3SFY A;  1OWL A;  3ONK A;  5ENR D;  1LD7 A;  1BU9 A;  4JHR A;  1FPP A;  1P5Q A;  2PQR A;  3D9P A;  4IUL A;  3CVL A;  3UT7 A;  4ATZ D;  4MBG A;  3I5P A;  4I6E A;  4NRH B;  1WG0 A;  2VTB A;  1HX8 A;  1OCO E;  5JA4 D;  1V54 E;  4YDE A;  5BV0 A;  2XZD G;  5CCL A;  4N5Q A;  3EHQ A;  4RG9 A;  2L6J A;  2X6F A;  3QWP A;  5A6C A;  2VSN A;  2X6K A;  2OCC E;  2XCB A;  1U3D A;  2XEE A;  3AJI A;  3S2A A;  5EIL A;  3R7Q A;  2UY1 B;  4GTM A;  1IHB A;  2NC9 A;  3FUI A;  2Y1L E;  3L17 A;  1H2T C;  4A1G A;  3PEU B;  4J7W A;  2XCC A;  3PZ4 A;  3FTX A;  2NSZ A;  4V3I A;  5ENO D;  2WQ6 A;  3R9M A;  4L1B A;  5IY5 E;  1IQR A;  4O60 A;  1OXJ A;  3UUX A;  1K1A A;  1N54 A;  5LP0 A;  4HOQ A;  4L9P A;  1JPL A;  4DX5 D;  4HB5 A;  2EIJ E;  3FU0 A;  4A3V A;  1O1S A;  3FUN A;  3FUL A;  1UG3 A;  3NZS A;  3CVQ A;  3I4R B;  3ASF A;  3UIP C;  3B95 A;  5B1A E;  4HS2 A;  4DLO A;  2I6H A;  5FQ8 A;  3FUK A;  5EYP F;  3ASH A;  5CED B;  3RKV A;  2X3M A;  4Q96 A;  4D10 C;  3RSE G;  4UWG A;  2UY1 A;  3S7B A;  1Q2Z A;  4I6G A;  4AEZ C;  4PUC A;  2F0Y A;  3LPZ A;  4DX1 A;  3ONL A;  3DXM G;  4B93 B;  1IYG A;  3PUJ A;  3KEZ A;  5LOZ A;  3CHM A;  3JUE A;  4GTV A;  4KZC A;  3ZNG A;  5ITZ F;  2QYU A;  1HZ4 A;  5G55 A;  4YDO A;  3SQV A;  4JHJ A;  4HRM B;  1AP7 A;  4GA2 A;  3AG1 E;  4UWL A;  1X5B A;  3FP3 A;  5G2N A;  2IY0 C;  1N0Q A;  4AXH A;  2KCV A;  3K9I A;  1OCZ E;  4L2L A;  1H6P A;  5KCM A;  4JW1 A;  3JQ1 A;  5CER B;  3BQO A;  3FTV A;  5AAO A;  4HOT A;  1A5E A;  1FT2 A;  3CV0 A;  5CMW A;  5FZS A;  3EU5 A;  1E7U A;  4U7E B;  3CVP A;  4EZL A;  5EX0 A;  3NB2 A;  3I4G A;  3AG4 E;  4HLL A;  4GCN A;  1UW4 B;  3PNT B;  4UWH A;  1E8Z A;  2YQ8 A;  4I2Z A;  2IFU A;  4FHJ A;  3OTN A;  1KT1 A;  5CRV A;  3FH7 A;  4GZ5 A;  1N4Q A;  1IKN D;  3CVN A;  4CDN A;  4NAC A;  4N3A A;  5FJY A;  2PM6 A;  2P2C P;  4HI9 A;  3OAW A;  3Q7A A;  3L82 A;  4FHK A;  4TXP A;  4J8Y A;  1S0P A;  4ANW A;  4CT0 A;  4CRW A;  1FVF A;  2MRI A;  3FWV A;  3ZKJ A;  3PNL B;  5LCW J;  2A5U A;  4ANV A;  4I9C A;  3G2W A;  4K5A B;  3FUE A;  1AWC B;  3T8K A;  1TEZ A;  1ZB1 A;  4GMJ A;  2I1K A;  3JXI A;  1JCS A;  4MKT A;  2BF0 X;  4EEC A;  5ENT D;  4J8S A;  4FJZ A;  5JMN D;  3L13 A;  3ZYQ A;  5D66 A;  2KC7 A;  3B7S A;  4GB9 A;  3CST A;  3LDZ A;  4U63 A;  4JEU A;  1E90 A;  2DZO A;  2WXO A;  5D0Q D;  5JJT A;  2GRR B;  4OVV A;  4XKB A;  5AEN A;  1INZ A;  4U0S A;  4ACL A;  2HO1 A;  1H19 A;  5B1B E;  3L54 A;  2H6I A;  3AG3 E;  3UM3 A;  2VGX B;  2L9B A;  2VJ8 A;  4KVO A;  4GCO A;  3PUK A;  3VLD A;  1LF8 A;  4EQF A;  3KSL A;  4FUL A;  4XI9 A;  4I17 A;  3F6Q A;  3G2S A;  4XE0 A;  5CEC B;  4U8Y D;  3VLE A;  4Q69 A;  4BES A;  2Y0B G;  2OVF A;  3IHY A;  2VSX E;  3PRE A;  4G25 A;  1OWN A;  4Y6C A;  2ETB A;  2PL2 A;  2E2E A;  4GTR A;  3Q73 A;  3RRM B;  5AQ9 A;  3D9J A;  1QQE A;  5AQA A;  3FUF A;  4F1P A;  2IO3 C;  3FTU A;  2YHE A;  4CGV A;  5ENN A;  3CVU A;  2C0L A;  3ZFW A;  3W9G A;  4Y6W A;  1RW2 A;  1TNU A;  4H7Y A;  4AY5 A;  2AJA A;  3Q15 A;  3SY2 A;  3ENE A;  4B89 A;  4GYW A;  2VQ2 A;  4DI3 A;  2HM8 A;  2VGX A;  3AU4 A;  2OEV A;  3TXM A;  3Q4A B;  3U4T A;  3B7R L;  1NL4 A;  2H6G A;  2IEJ A;  5AQB A;  5J90 A;  3B13 A;  4B94 A;  1TNY A;  1SVX A;  4L2Y A;  5C2Y A;  4CZ2 D;  2WXG A;  5ANL A;  2IOL A;  2RFM A;  2P9K G;  4HNA D;  4N2Q A;  3IEG A;  3Q5M A;  2VGE A;  2YHC A;  4HQD A;  1QYM A;  3Q9U C;  3ABM E;  3LS8 A;  4DUI A;  4I43 A;  1N4P A;  1BLX B;  2MOW A;  1YA0 A;  2EIM E;  3CVW A;  4WNG A;  2WXN A;  3DRA A;  4XX5 A;  4RVB A;  3DBS A;  1N95 A;  2KCL A;  3QAR A;  1TNZ A;  4K0R A;  3PH0 C;  2WXJ A;  3EU9 A;  3PDN A;  1EF1 C;  5AJL A;  2XPZ A;  2PZI A;  1DCQ A;  3RO3 A;  5CBO A;  4LNB A;  2P9N G;  1YCS B;  3FUH A;  5G05 J;  2VSO E;  2F8Y A;  1FVH A;  1WY6 A;  4DX7 D;  3U64 A;  1A17 A;  2KCK A;  2QYJ A;  4GZ3 A;  1DC2 A;  4BWR A;  1QBQ A;  4BER A;  2KZT B;  3D3M A;  4GZ6 A;  1OCR E;  5D2M C;  3Q7F A;  3UX4 A;  4TUM A;  3SO8 A;  3TWQ A;  3QWW A;  1MX2 A;  1IQU A;  2V4H C;  3EHM A;  4GAA A;  4G1T A;  5M72 A;  3CHQ A;  3CVV A;  2FBN A;  1KLX A;  4AM9 A;  5G05 C;  5FTP A;  4GPK A;  4LER A;  4N2S A;  4CDR A;  3FEX A;  4BY6 A;  1E8X A;  2V4L A;  3L22 A;  3HXE A;  5DIZ A;  5FQ7 A;  4JPS A;  3S7J A;  2OVB A;  3L16 A;  3FTS A;  2I2O A;  1WAO 1;  4HRN A;  4U07 A;  4ABN A;  3S7D A;  3CK7 A;  4G8K A;  4CT4 A;  2EIL E;  3TWR A;  3NAW A;  1HF8 A;  2AXU A;  4PS7 A;  1QZ2 A;  2KZT A;  3AU5 A;  3QB2 A;  1E7V A;  4XZ4 A;  3SFZ A;  1Y6I A;  2ZIS A;  3G2U A;  4UUC A;  3NOG D;  3T8M A;  1HG5 A;  4JEH A;  4URK A;  3ZIM A;  3ULQ A;  2WXK A;  4KZ0 A;  2FUL A;  2LSV A;  3SGH A;  3NOC D;  2OND A;  3UM2 A;  4K03 A;  3UTM A;  5BW8 C;  3UKR G;  4GZD A;  4GZC A;  4X8Q A;  2PM7 A;  1JCR A;  3RAU A;  1HXI A;  4RSY A;  5AQ7 A;  1N11 A;  1YMP A;  3BG1 B;  3BG0 B;  3MV3 B;  2WB2 A;  3T9K A;  3FY4 A;  1LD8 A;  3APC A;  2HE0 A;  4AY6 A;  1D8D A;  2GRN B;  3NF1 A;  3ABL E;  3WG7 E;  1SZ9 A;  3ISM C;  3U66 A;  5EKQ D;  4UQX A;  2YNQ A;  3D9N A;  3ASO E;  2BKG A;  3C5R A;  2L0I A;  3RO2 A;  3ZXP A;  3EUV A;  3IXE A;  3PZ1 A;  1W3B A;  4G24 A;  5EX3 A;  2I1J A;  1EDU A;  3NBN B;  1O1T A;  3QAQ A;  5BXU A;  5JJ6 A;  3HVE B;  3NZU A;  1WDY A;  4BTB A;  4GML A;  3KAE A;  4EZJ A;  2IQC A;  2J49 A;  2NYJ A;  2XZT G;  3CQC B;  4TV3 A;  1N4S A;  2KBX A;  1HE8 A;  3FU3 A;  3FUD A;  4P29 A;  3ZYM A;  3PE3 A;  3ULY A;  4U0Z A;  3CGH A;  4LNG A;  1PY1 A;  4L7T A;  4CYM D;  3Q75 A;  2P58 C;  4OAU C;  4DX6 D;  3E33 A;  4O1O A;  3ZN3 A;  2WXR A;  1E8Y A;  1NZN A;  2R5S A;  4GYY A;  2DWZ A;  3FEY A;  3BU8 A;  4KMO A;  4L23 A;  1WM5 A;  2XGM A;  1UJJ A;  1DNP A;  3V79 K;  4MLP A;  2X6I A;  3VTY A;  4ILH B;  4FU3 A;  2ION A;  2X6H A;  5HRY A;  1MX6 A;  3HYM B;  3AS8 A;  2MHK A;  3HVE A;  2CG2 A;  3JUI A;  2L0T B;  1XGW A;  4TXR A;  4U8V D;  4C9B B;  5KWD A;  2WXP A;  2Y4T A;  2DZN A;  3GYZ A;  1ELW A;  5JHA A;  5BPP A;  3TGO A;  1SQM A;  3CK8 A;  3LYA A;  4GMR A;  4ANX A;  3D9H A;  4N3B A;  4I9E A;  2Y69 E;  4IRU A;  3LJ3 A;  1H0A A;  3ZPJ A;  2P9P G;  2PQN A;  4QFV A;  3VTX A;  3QKY A;  4WAF A;  4GTP A;  3D9I A;  1ELR A; 
#chains in the Genus database with same CATH homology
 4A63 B;  5HKP A;  5KBA A;  1DCQ A;  2ETB A;  4K5A B;  5HS0 A;  4C48 B;  3DEO A;  2XEE A;  4UUC A;  5CBO A;  3AJI A;  1MX4 A;  3JXJ A;  4HRM B;  5EIL A;  4U95 D;  3T8K A;  4CYM D;  1AWC B;  1BI7 B;  3NOG D;  3W9F A;  3TWW A;  2F8X K;  4OAU C;  1AP7 A;  1SW6 A;  1YCS B;  4NIK A;  2J8S D;  4DX6 D;  2A5E A;  4O1O A;  4HRL A;  5AQ9 A;  1IHB A;  1BD8 A;  5AQA A;  2F8Y A;  4OAV B;  2XEN A;  3JXI A;  2Y1L E;  5EN5 D;  4DX2 A;  3NOC D;  3LJN A;  2RFA A;  4F1P A;  1TR4 A;  4DRX E;  4DX7 D;  1N0Q A;  5ENT D;  4J7W A;  1S70 B;  2QYJ A;  3UTM A;  1DC2 A;  5EYL A;  4K5B A;  2ZGD A;  2BKK B;  5JMN D;  2KXP C;  1N0R A;  3V31 A;  2DWZ A;  4BER A;  5D66 A;  1IXV A;  4G8L A;  1K3Z D;  5CER B;  3ZUV B;  5CEA A;  3DEP A;  5ENO D;  5AQ7 A;  1G3N B;  1N11 A;  1YMP A;  5AAO A;  3W9G A;  5FIN A;  1A5E A;  3J5Q B;  4TUM A;  2AJA A;  5AN8 A;  2ETA A;  3UI2 A;  3T9K A;  3SO8 A;  3TWQ A;  3UXG A;  4Z68 A;  2DVW A;  2XEH A;  3B7B A;  1OY3 D;  2HE0 A;  4O60 A;  3V79 K;  5ENP D;  5ENS D;  4O1P A;  1K1A A;  4K5C A;  1MX2 A;  4RLY A;  5EIB E;  3HRA A;  3TWU A;  2QC9 A;  5FIO A;  1OT8 A;  2DZO A;  4F6R D;  2PNN A;  2V4H C;  4HLL A;  5ENQ D;  5AQB A;  3TWX A;  3ZU7 B;  5HRY A;  2ZGG A;  1MX6 A;  4DX5 D;  4LSZ E;  1MJ0 A;  1K1B A;  4BET A;  4HBD A;  4HB5 A;  1SVX A;  4CZ2 D;  2BKG A;  2V5Q C;  5ENR D;  1BU9 A;  2RFM A;  3C5R A;  2ETC A;  4HNA D;  3AAA C;  3V2O A;  4U8V D;  5KWD A;  2B0O E;  3HG0 D;  4JB8 P;  2DZN A;  2MYO A;  3IXE A;  2VGE A;  4YDW A;  2JAB A;  1NFI E;  1IKN D;  3B95 A;  4HQD A;  5BXO A;  4U96 D;  1QYM A;  5KNH D;  3Q9U C;  4ATZ D;  1MYO A;  3NBN B;  4LG6 A;  5AAR A;  4DUI A;  5EYP F;  2FO1 E;  5BXU A;  2F37 A;  1YYH A;  1BLX B;  2P2C P;  4GMR A;  3V2X A;  5CED B;  5EID A;  4HI9 A;  3D9H A;  1WG0 A;  4LNU D;  3TWV A;  3F6Q A;  5KNG A;  4HRN A;  3TWT A;  4J8Y A;  3V30 A;  5CBN A;  5JA4 D;  5CEC B;  1UOH A;  4GPM A;  1WDY A;  4U8Y D;  3J5P A;  4DX1 A;  2XZD G;  4G8K A;  4BES A;  4YDY A;  3TWR A;  4BEP A;  1BI8 B;  2L6B A;  4N5Q A;  3Q9N C;  2Y0B G;  4QFV A;  4BSZ B;  4B93 B;  3TWS A;  1D9S A;  3ZKJ A;  3EHQ A;  3JUE A;  2NYJ A;  3EHR A;  3ZNG A;  4ZFH A;  5ITZ F;  2XZT G;  4HI8 A;  3EU9 A;  2KBX A;  4ZHB A;  3KEA A;  4QQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...