1IY6A

Solution structure of omsvp3 variant, p14c/n39c
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
AVSVDCSEYPKCACTMEYRPLCGSDNKTYGNKCNFCCAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OMSVP3
publication title Inhibitory Specificity Change of Ovomucoid Third Domain of the Silver Pheasant upon Introduction of an Engineered Cys14-Cys39 Bond
pubmed doi rcsb
source organism Lophura nycthemera
molecule tags Hydrolase
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2002-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1iy6A00
1CGJI 1CHOI 1OMTA 2OVOA 1FYBA 1Z7KB 2SGFI 3B4VC 3SGQI 1IY6A 2GKVA 2JZMA 1DS3I 1HDLA 1CT0I 1SGPI 1BUSA 2N71A 2SGQI 2SGPI 1OVOA 2F3CI 1CE3A 1PJUA 1PPFI 1TGSI 1UVGA 1CT2I 1Y1CA 2GKRI 3OVOA 2KMQA 2XRCA 2N52A 1TIHA 2QQCA 2SGEI 4SGBI 1UUCA 2V53A 1KMAA 1HJAI 5JHWC 2NU3I 3QTLD 1CSOI 1Y1BA 3HH2C 1M8CA 2ARPF 2QQDA 1LR7A 2P6AC 2M5XA 1IY5A 1YU6C 1UVFA 2KMPA 4OVOA 1IW4A 1SGYI 4HGUA 1NUBA 1DS2I 1OMUA 2KCXA 2NU4I 3SEKC 1H0ZA 2JXDA 1SGDI 1TURA 3SGBI 1TBQR 3TJQA 2N17A 1LR8A 1LR9A 2NU0I 1TUSA 1AN1I 2NU1I 1OYVI 2SGDI 2KMRA 1SGNI 1TBRR 2NU2I 1CGII 1R0RI 1MT1A 1YTPA 1N13A 2WCYA 1SGRI 1BMOA 1SGQI 1SGEI 2B0UC 2ERWA 1CT4I 1HPTA 2GKTI 2BUSA 1PCEA 4GI3C 2LEOA 1M8BA 5DAEA 2JYYA 2KMOA
chains in the Genus database with same CATH superfamily
1CGJI 1CHOI 1OMTA 3R5DA 2N1AB 3CXLA 2OVOA 1FYBA 1Z7KB 2SGFI 3B4VC 3SGQI 1V1HA 1IY6A 2GKVA 2JZMA 4UXHA 5E3RA 2WGCA 1KBFA 3TO9A 2E5RA 1MJBA 1K7VA 3OXLA 1DS3I 1HDLA 2QQ0A 1CT0I 1SGPI 7WGAA 2E73A 1BUSA 1NXUA 2OZUA 4E1PA 3UOEA 2ODDA 5CCMA 2N71A 3FSXA 2ROWA 2SGQI 2X3TA 3TO6A 4L9MA 3D00A 3VDUA 1W3SA 2SGPI 3VDPA 1WGTA 1OVOA 5J8CA 3TO7A 1VDDA 2F3CI 1R79A 1Z2IA 2LUYA 3PDNA 1PJUA 1PPFI 1TGSI 1CE3A 1UVGA 2JW6A 3UGLA 1CT2I 3MEKA 3UEJA 1KBEA 1Y1CA 1RFHA 2GIVA 1X74A 4JCVE 1W4RA 5FUYA 2ENZA 2GKRI 3R5AA 1K7UA 2DKVA 2L7XA 3OVOA 5E3QA 5CCLA 9WGAA 1S20A 2DB6A 3OXGA 2KMQA 2QPOA 2B8TA 2X52A 2GVIA 2N52A 2XRCA 1TIHA 2ORVA 2QQCA 5HQ8A 2SGEI 2RC4A 2WVJA 2Y0MA 4SGBI 4UXIA 3GOXA 1XA6A 3UFFA 1UUCA 3R5BA 5HI7A 1Y8FA 4AMLA 2V53A 1FY7A 5FUVA 5J8FA 5FUWA 2YUUA 1KMAA 1HJAI 1X4SA 2OU2A 5FUXA 2YQPA 5JHWC 3VE5A 2NU3I 2LB7A 3QTLD 1CSOI 1Y1BA 3HH2C 3QWPA 1M8CA 1HEVA 4A24A 2ELIA 2RIJA 2ARPF 2QQDA 2JA1A 1TBOA 1LR7A 2J9RA 2P6AC 3RU0A 2J87A 2M5XA 1V1IA 2VRWB 1IY5A 1FAQA 1U5KA 2UZ3A 4B6DA 4FKDA 2CWHA 1YU6C 1UVFA 2KMPA 4OVOA 3TOAA 1IW4A 1SGYI 1WTJA 2PQ8A 3R5CA 4HGUA 1NUBA 3OXFA 2V1CC 1TOTA 1DS2I 2L8EA 1OMUA 2KCXA 2NU4I 3SEKC 5E3PA 1H0ZA 2JXDA 1SGDI 1TURA 3SGBI 2OD1A 1TBQR 1Q9BA 2N17A 3TJQA 1LR8A 3QAHA 1LR9A 2NU0I 2DIPA 3UGDA 1TUSA 1AN1I 1OYVI 2NU1I 2SGDI 1UHAA 3KY9A 2W0TA 1P9GA 1XX6A 2KMRA 5EX3A 1SGNI 2CWGA 3UGIA 2UVOA 1TBRR 4WP4A 2V1CA 1PTQA 2NU2I 3TOBA 1CGII 1WGCA 1ULNA 1R0RI 4DNCA 2K9HA 1MT1A 3UEYA 2CJSC 1WKXA 2QQEA 4E1RA 1TBNA 1YTPA 1PTRA 1K7TA 1N13A 5EX0A 1XBTA 2CWFA 2FNFX 3FC3A 2WCYA 1SGRI 1FARA 1MJ9A 1BMOA 1SGQI 1ULMA 3FSYA 1SGEI 2A20A 2B0UC 2ORWA 2ERWA 1ULKA 4MPIA 3OL0A 1CT4I 1HPTA 2GKTI 3E2IA 4UXJA 2BUSA 1PCEA 3E59A 4GI3C 3BJIA 2ENNA 2LEOA 1M8BA 5DAEA 1MJAA 2JYYA 1P9ZA 2KMOA
chains in the Genus database with same CATH topology
1CGJI 1CHOI 1OMTA 2N1AB 3CXLA 2OVOA 1FYBA 1Z7KB 2SGFI 3B4VC 3SGQI 1V1HA 1IY6A 2GKVA 2JZMA 4UXHA 1KBFA 2E5RA 3OXLA 1DS3I 1HDLA 2QQ0A 1CT0I 1SGPI 2E73A 1BUSA 4E1PA 2ODDA 5CCMA 2N71A 2ROWA 2SGQI 4L9MA 3D00A 3VDUA 1W3SA 2SGPI 3VDPA 1OVOA 1VDDA 2F3CI 1R79A 3PDNA 2LUYA 1CE3A 1PJUA 1PPFI 1TGSI 1UVGA 2JW6A 3UGLA 1CT2I 3MEKA 3UEJA 1KBEA 1Y1CA 1RFHA 1X74A 4JCVE 1W4RA 5FUYA 2ENZA 2GKRI 3OVOA 2L7XA 5CCLA 3OXGA 2DB6A 2KMQA 2QPOA 2B8TA 2XRCA 2GVIA 2N52A 1TIHA 2ORVA 2QQCA 5HQ8A 2SGEI 2WVJA 4SGBI 3GOXA 1XA6A 3UFFA 1UUCA 5HI7A 1Y8FA 2V53A 5FUVA 5FUWA 2YUUA 1KMAA 1HJAI 1X4SA 5FUXA 2YQPA 5JHWC 3VE5A 2NU3I 3QTLD 1CSOI 1Y1BA 3HH2C 3QWPA 1M8CA 4A24A 2ELIA 2ARPF 2QQDA 2JA1A 1TBOA 1LR7A 2J9RA 2P6AC 3RU0A 2J87A 2M5XA 1V1IA 2VRWB 1IY5A 1FAQA 1U5KA 2UZ3A 4B6DA 4FKDA 1YU6C 1UVFA 2KMPA 4OVOA 1IW4A 1SGYI 4HGUA 1NUBA 3OXFA 2V1CC 1TOTA 1DS2I 2L8EA 1OMUA 2KCXA 2NU4I 3SEKC 1H0ZA 2JXDA 1SGDI 1TURA 3SGBI 2OD1A 1TBQR 3TJQA 2N17A 1LR8A 1LR9A 2NU0I 2DIPA 3UGDA 1TUSA 1AN1I 1OYVI 2NU1I 2SGDI 3KY9A 2W0TA 1XX6A 2KMRA 5EX3A 1SGNI 3UGIA 1TBRR 2V1CA 1PTQA 2NU2I 1CGII 1R0RI 2K9HA 1MT1A 3UEYA 2CJSC 2QQEA 4E1RA 1TBNA 1YTPA 1PTRA 1N13A 5EX0A 1XBTA 2FNFX 3FC3A 2WCYA 1SGRI 1FARA 1BMOA 1SGQI 1SGEI 2A20A 2B0UC 2ORWA 2ERWA 3OL0A 1CT4I 1HPTA 2GKTI 3E2IA 4UXJA 2BUSA 1PCEA 3E59A 4GI3C 3BJIA 2ENNA 2LEOA 1M8BA 5DAEA 4UXIA 2JYYA 2KMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGJ I;  1CHO I;  1OMT A;  2OVO A;  1FYB A;  1Z7K B;  2SGF I;  3B4V C;  3SGQ I;  1IY6 A;  2GKV A;  2JZM A;  1DS3 I;  1HDL A;  1CT0 I;  1SGP I;  1BUS A;  2N71 A;  2SGQ I;  2SGP I;  1OVO A;  2F3C I;  1CE3 A;  1PJU A;  1PPF I;  1TGS I;  1UVG A;  1CT2 I;  1Y1C A;  2GKR I;  3OVO A;  2KMQ A;  2XRC A;  2N52 A;  1TIH A;  2QQC A;  2SGE I;  4SGB I;  1UUC A;  2V53 A;  1KMA A;  1HJA I;  5JHW C;  2NU3 I;  3QTL D;  1CSO I;  1Y1B A;  3HH2 C;  1M8C A;  2ARP F;  2QQD A;  1LR7 A;  2P6A C;  2M5X A;  1IY5 A;  1YU6 C;  1UVF A;  2KMP A;  4OVO A;  1IW4 A;  1SGY I;  4HGU A;  1NUB A;  1DS2 I;  1OMU A;  2KCX A;  2NU4 I;  3SEK C;  1H0Z A;  2JXD A;  1SGD I;  1TUR A;  3SGB I;  1TBQ R;  3TJQ A;  2N17 A;  1LR8 A;  1LR9 A;  2NU0 I;  1TUS A;  1AN1 I;  2NU1 I;  1OYV I;  2SGD I;  2KMR A;  1SGN I;  1TBR R;  2NU2 I;  1CGI I;  1R0R I;  1MT1 A;  1YTP A;  1N13 A;  2WCY A;  1SGR I;  1BMO A;  1SGQ I;  1SGE I;  2B0U C;  2ERW A;  1CT4 I;  1HPT A;  2GKT I;  2BUS A;  1PCE A;  4GI3 C;  2LEO A;  1M8B A;  5DAE A;  2JYY A;  2KMO A; 
#chains in the Genus database with same CATH topology
 1CGJ I;  1CHO I;  1OMT A;  3R5D A;  2N1A B;  3CXL A;  2OVO A;  1FYB A;  1Z7K B;  2SGF I;  3B4V C;  3SGQ I;  1V1H A;  1IY6 A;  2GKV A;  2JZM A;  4UXH A;  5E3R A;  2WGC A;  1KBF A;  3TO9 A;  2E5R A;  1MJB A;  1K7V A;  3OXL A;  1DS3 I;  1HDL A;  2QQ0 A;  1CT0 I;  1SGP I;  7WGA A;  2E73 A;  1BUS A;  1NXU A;  2OZU A;  4E1P A;  3UOE A;  2ODD A;  5CCM A;  2N71 A;  3FSX A;  2ROW A;  2SGQ I;  2X3T A;  3TO6 A;  4L9M A;  3D00 A;  3VDU A;  1W3S A;  2SGP I;  3VDP A;  1WGT A;  1OVO A;  5J8C A;  3TO7 A;  1VDD A;  2F3C I;  1R79 A;  1Z2I A;  2LUY A;  3PDN A;  1PJU A;  1PPF I;  1TGS I;  1CE3 A;  1UVG A;  2JW6 A;  3UGL A;  1CT2 I;  3MEK A;  3UEJ A;  1KBE A;  1Y1C A;  1RFH A;  2GIV A;  1X74 A;  4JCV E;  1W4R A;  5FUY A;  2ENZ A;  2GKR I;  3R5A A;  1K7U A;  2DKV A;  2L7X A;  3OVO A;  5E3Q A;  5CCL A;  9WGA A;  1S20 A;  2DB6 A;  3OXG A;  2KMQ A;  2QPO A;  2B8T A;  2X52 A;  2GVI A;  2N52 A;  2XRC A;  1TIH A;  2ORV A;  2QQC A;  5HQ8 A;  2SGE I;  2RC4 A;  2WVJ A;  2Y0M A;  4SGB I;  4UXI A;  3GOX A;  1XA6 A;  3UFF A;  1UUC A;  3R5B A;  5HI7 A;  1Y8F A;  4AML A;  2V53 A;  1FY7 A;  5FUV A;  5J8F A;  5FUW A;  2YUU A;  1KMA A;  1HJA I;  1X4S A;  2OU2 A;  5FUX A;  2YQP A;  5JHW C;  3VE5 A;  2NU3 I;  2LB7 A;  3QTL D;  1CSO I;  1Y1B A;  3HH2 C;  3QWP A;  1M8C A;  1HEV A;  4A24 A;  2ELI A;  2RIJ A;  2ARP F;  2QQD A;  2JA1 A;  1TBO A;  1LR7 A;  2J9R A;  2P6A C;  3RU0 A;  2J87 A;  2M5X A;  1V1I A;  2VRW B;  1IY5 A;  1FAQ A;  1U5K A;  2UZ3 A;  4B6D A;  4FKD A;  2CWH A;  1YU6 C;  1UVF A;  2KMP A;  4OVO A;  3TOA A;  1IW4 A;  1SGY I;  1WTJ A;  2PQ8 A;  3R5C A;  4HGU A;  1NUB A;  3OXF A;  2V1C C;  1TOT A;  1DS2 I;  2L8E A;  1OMU A;  2KCX A;  2NU4 I;  3SEK C;  5E3P A;  1H0Z A;  2JXD A;  1SGD I;  1TUR A;  3SGB I;  2OD1 A;  1TBQ R;  1Q9B A;  2N17 A;  3TJQ A;  1LR8 A;  3QAH A;  1LR9 A;  2NU0 I;  2DIP A;  3UGD A;  1TUS A;  1AN1 I;  1OYV I;  2NU1 I;  2SGD I;  1UHA A;  3KY9 A;  2W0T A;  1P9G A;  1XX6 A;  2KMR A;  5EX3 A;  1SGN I;  2CWG A;  3UGI A;  2UVO A;  1TBR R;  4WP4 A;  2V1C A;  1PTQ A;  2NU2 I;  3TOB A;  1CGI I;  1WGC A;  1ULN A;  1R0R I;  4DNC A;  2K9H A;  1MT1 A;  3UEY A;  2CJS C;  1WKX A;  2QQE A;  4E1R A;  1TBN A;  1YTP A;  1PTR A;  1K7T A;  1N13 A;  5EX0 A;  1XBT A;  2CWF A;  2FNF X;  3FC3 A;  2WCY A;  1SGR I;  1FAR A;  1MJ9 A;  1BMO A;  1SGQ I;  1ULM A;  3FSY A;  1SGE I;  2A20 A;  2B0U C;  2ORW A;  2ERW A;  1ULK A;  4MPI A;  3OL0 A;  1CT4 I;  1HPT A;  2GKT I;  3E2I A;  4UXJ A;  2BUS A;  1PCE A;  3E59 A;  4GI3 C;  3BJI A;  2ENN A;  2LEO A;  1M8B A;  5DAE A;  1MJA A;  2JYY A;  1P9Z A;  2KMO A; 
#chains in the Genus database with same CATH homology
 1CGJ I;  1CHO I;  1OMT A;  2N1A B;  3CXL A;  2OVO A;  1FYB A;  1Z7K B;  2SGF I;  3B4V C;  3SGQ I;  1V1H A;  1IY6 A;  2GKV A;  2JZM A;  4UXH A;  1KBF A;  2E5R A;  3OXL A;  1DS3 I;  1HDL A;  2QQ0 A;  1CT0 I;  1SGP I;  2E73 A;  1BUS A;  4E1P A;  2ODD A;  5CCM A;  2N71 A;  2ROW A;  2SGQ I;  4L9M A;  3D00 A;  3VDU A;  1W3S A;  2SGP I;  3VDP A;  1OVO A;  1VDD A;  2F3C I;  1R79 A;  3PDN A;  2LUY A;  1CE3 A;  1PJU A;  1PPF I;  1TGS I;  1UVG A;  2JW6 A;  3UGL A;  1CT2 I;  3MEK A;  3UEJ A;  1KBE A;  1Y1C A;  1RFH A;  1X74 A;  4JCV E;  1W4R A;  5FUY A;  2ENZ A;  2GKR I;  3OVO A;  2L7X A;  5CCL A;  3OXG A;  2DB6 A;  2KMQ A;  2QPO A;  2B8T A;  2XRC A;  2GVI A;  2N52 A;  1TIH A;  2ORV A;  2QQC A;  5HQ8 A;  2SGE I;  2WVJ A;  4SGB I;  3GOX A;  1XA6 A;  3UFF A;  1UUC A;  5HI7 A;  1Y8F A;  2V53 A;  5FUV A;  5FUW A;  2YUU A;  1KMA A;  1HJA I;  1X4S A;  5FUX A;  2YQP A;  5JHW C;  3VE5 A;  2NU3 I;  3QTL D;  1CSO I;  1Y1B A;  3HH2 C;  3QWP A;  1M8C A;  4A24 A;  2ELI A;  2ARP F;  2QQD A;  2JA1 A;  1TBO A;  1LR7 A;  2J9R A;  2P6A C;  3RU0 A;  2J87 A;  2M5X A;  1V1I A;  2VRW B;  1IY5 A;  1FAQ A;  1U5K A;  2UZ3 A;  4B6D A;  4FKD A;  1YU6 C;  1UVF A;  2KMP A;  4OVO A;  1IW4 A;  1SGY I;  4HGU A;  1NUB A;  3OXF A;  2V1C C;  1TOT A;  1DS2 I;  2L8E A;  1OMU A;  2KCX A;  2NU4 I;  3SEK C;  1H0Z A;  2JXD A;  1SGD I;  1TUR A;  3SGB I;  2OD1 A;  1TBQ R;  3TJQ A;  2N17 A;  1LR8 A;  1LR9 A;  2NU0 I;  2DIP A;  3UGD A;  1TUS A;  1AN1 I;  1OYV I;  2NU1 I;  2SGD I;  3KY9 A;  2W0T A;  1XX6 A;  2KMR A;  5EX3 A;  1SGN I;  3UGI A;  1TBR R;  2V1C A;  1PTQ A;  2NU2 I;  1CGI I;  1R0R I;  2K9H A;  1MT1 A;  3UEY A;  2CJS C;  2QQE A;  4E1R A;  1TBN A;  1YTP A;  1PTR A;  1N13 A;  5EX0 A;  1XBT A;  2FNF X;  3FC3 A;  2WCY A;  1SGR I;  1FAR A;  1BMO A;  1SGQ I;  1SGE I;  2A20 A;  2B0U C;  2ORW A;  2ERW A;  3OL0 A;  1CT4 I;  1HPT A;  2GKT I;  3E2I A;  4UXJ A;  2BUS A;  1PCE A;  3E59 A;  4GI3 C;  3BJI A;  2ENN A;  2LEO A;  1M8B A;  5DAE A;  4UXI A;  2JYY A;  2KMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...