1IYGA

Solution structure of rsgi ruh-001, a fis1p-like and cgi-135 homologous domain from a mouse cdna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
b'GSSGSSGMEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein (2010003O14)
publication title Solution structure of RSGI RUH-001, a Fis1p-like and CGI-135 homologous domain from a mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 41
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1iygA00
2LNIA 2V5FA 4U0ZA 3QKYA 5AYWD 1HXIA 1KLXA 5FZQA 3K9IA 3ZFWA 2UY1B 5JJ7A 2QFCA 3MA5A 3FFLA 4I17A 5FTPA 4HOQA 5DBKA 5C1DA 3QWPA 5JJTA 4AY5A 4N3AA 5KJLA 3VTYA 3LY9A 1HH8A 2NC9A 1OUVA 3ASGA 1KT0A 5HI7A 1WM5A 4U0UA 1KT1A 3ZPJA 2PZIA 3LPZA 3QOUA 4UQYA 4JL0A 2VGXA 3TG5A 3RU0A 2KCVA 5BNWA 4IN3B 3AS5A 3CK9A 4BT8A 5FZRA 4KXKB 5KJMA 3ASHA 2PQNA 4GYOA 5ARGA 5G05J 3S7JA 4YVQC 1Y8MA 1FCHA 4ME2A 4BT9A 2R5SA 2Y4TA 1NA3A 3UQ3A 4XIFA 4CDRA 3ZGQA 3O48A 4CGVA 4WNGA 2Q7FA 4EQFA 3AS8A 4H7XA 3MEKA 3TAXA 2UY1A 2IFUA 3GYZA 4NRHB 3Q15A 4J0UA 4Y6WA 4HORA 4I9CA 2JLBA 5EX3A 4WNFA 2HO1A 4N3BA 2UWJG 4G23A 4GCOA 1PC2A 1ELWA 4JHRA 4G1TA 4WNEA 3CVQA 2HYZA 4APOA 3UUXA 3CV0A 4XI0A 5A7DB 4Y6CA 2P58C 3U3WA 2E2EA 5LCWJ 5G05C 3ULQA 4BTBA 4I2ZA 1ZBPA 2KATA 1A17A 3NF1A 1QZ2A 4UI9K 3E4BA 4N2QA 1NZNA 3QDNA 3CEQA 3GZ1A 3TG4A 4N5CA 4GZ3A 4G24A 4GPKA 4YNDA 3N71A 2FBNA 3S7DA 2OOEA 3WXXA 1XNFA 2AVPA 2KC7A 5FJYA 2DBAA 2Y4UA 3CK7A 1IYGA 3Q47B 2I6HA 4JA9A 3LYAA 2LSUA 5A6CA 3KD7A 4UQXA 4B94A 4JA7A 5HQ8A 4WNDA 4AIFA 3CVPA 2XEVA 2C0MA 4G2VA 5CHEE 1QQEA 3AS4A 2FO7A 3KS2A 5D0QD 4HOSA 3VTXA 4J8DA 4RG6A 2J9QA 4U07A 3MV2B 1ELRA 2GW1A 3SF4A 2MHKA 4BTAA 4A1SA 4U0SA 1HZ4A 3S7BA 3Q5MA 5JJ6A 4GA1A 3GW4A 3RIBA 4HOUA 3CVLA 3QWWA 2VQ2A 2VSYA 3FWVA 3URZA 4ABNA 4F3VA 3IEGA 2L6JA 3CKCA 5D0OD 4LEUA 2C2LA 5DIZA 1P5QA 5G04J 3R9AB 2FI7A 4NQ0A 3TGOA 5CCMA 2XPIA 4GZ5A 3LCAA 4O6FA 4YVOA 5EX0A 3RJVA 3JYSA 3PE3A 3UPVA 2YHCA 4G25A 2XGOA 4CGWA 4KBQA 3S7FA 3ZHEB 2XGSA 3ZN3A 4I2WA 4J8FA 4RG9A 3MV3B 4H7YA 4KYOB 4UI9J 2XGMA 1E96B 2LSVA 3KAEA 2KCKA 2XCBA 3ASDA 5CCLA 1ZU2A 4GYYA 4GYWA 4BWRA 3RO3A 2FEZA 4U04A 4I1AA 2VYIA 4XI9A 4AY6A 4WUYA 1YA0A 5EKQD 5ARFA 2IF4A 1NA0A 2YQ8A 2BUGA 5FT9A 5KJKA 5LCWC 3Q4AB 2PL2A 3RO2A 3EDTB 2WPVA 4N3CA 3PE4A 4I9EA 5G04C 5BT1A 4GCNA 2XCCA 3MKRA 3Q49B 3LKUA 4HOTA 3U4TA 4J8EA 3BEEA 2FF4A 3ASFA 4G26A 3CK8A 2VGYA 2PQRA 3ESKA 3CKBA 4GZ6A 3RKVA 3PDNA 2ONDA 3CVNA 2VGXB 3LY8A 5FZSA 1IHGA 2KCLA 4UI9C 4GA2A 1WAO1 5BW8C 4N39A 4GA0A 3OXLA 2HR2A 1W3BA 3SZ7A 2VSNA 3ZHEA 1TJCA 3GZ2A 3FP3A 1B89A 4UQZA 5KJNA 3OXGA 2C0LA 4AM9A 4N2SA 3QWVA 3OXFA 2WQHA 5M72A 3LY7A 4W9RA 3HYMB
chains in the Genus database with same CATH superfamily
5JA4D 3K9IA 3ZFWA 4QQIA 5CECB 3IBEA 3TXNA 3V2XA 4BX9A 1HS6A 3FTYA 1JCSA 3B7SA 4K5BA 1UJKA 3SI5A 3P2BA 2CFZA 4AY5A 3AG1E 2X3MA 1V55E 4B8AA 1DVPA 3VLEA 3VTYA 1BD8A 3E37A 1HH8A 4U95D 5AQAA 5HI7A 4OVVA 4EZLA 5CRVA 4U0UA 3PZ4A 4CDMA 4MRUA 2IOSA 3ZPJA 4XKBA 1INZA 2DZNA 2F37A 3QJZA 3UT8A 5D2MC 2XZTG 4GTMA 3TG5A 3AS5A 3UTMA 2WXHA 5AN8A 4AVXA 1EYHA 2AXUA 5FZRA 1O1RA 1E90A 4PUCA 5KJMA 3VLFA 2PQNA 3HG0D 4DI4A 4GYOA 2IO3C 2I2OA 3ONKA 4A55A 4F1PA 1PAQA 4GMLA 3E33A 5EYLA 1NA3A 4CDRA 3EUVA 3NZUA 4WWOA 2LUHA 4CGVA 3UI2A 3D9MA 4WNGA 2Q7FA 2AJAA 3V30A 5EDSA 2WXOA 3GYZA 3LVRE 4Y6WA 3HXFA 3TWXA 2XS1A 4BX8A 2JLBA 4WNFA 2HO1A 2UWJG 1OT8A 2ZU6B 4HRNA 4UWHA 1SW6A 4FJZA 1ELWA 5KCMA 4OYSA 5ENRD 2L0TB 1SZAA 4UUCA 3UUXA 5HKPA 3VLDA 3W9GA 1ELKA 3ZIMA 5EILA 2P58C 4GZDA 3U3WA 2LXLA 3FUKA 5LCWJ 2FULA 4LCTA 3ZYQA 2V0PA 1OCZE 2XEHA 3I3NA 2R03A 5BV0A 3R7QA 1BI8B 2WXPA 3QDNA 3UX4A 3DSWA 4ILIA 3TG4A 4N5CA 4GZ3A 3X2QE 5CEDB 3N71A 4DLOA 3ML8A 1FVHA 2OOEA 2X6HA 3QARA 3CVYA 2Y4UA 4L2YA 3OTNA 3CK7A 3ASNE 4B0ZA 2R2LA 3GZSA 1TYQG 4GZCA 5A6CA 4BETA 4UQXA 3C5RA 4WNDA 2J4DA 4ANUA 4AIFA 2XEVA 4A3VA 4NURA 4E6HA 3AS4A 1MX2A 2FO7A 4FHKA 5D0QD 2E0IA 4FULA 2I9CA 1TN6A 5BV1A 3JQ0A 3CHPA 3SF4A 4HRLA 4HS2A 2EIJE 4A1SA 3Q7FA 1IHBA 1X5BA 5JJ6A 1Z3YA 4CRWA 1Z6TA 3LS8A 4LSZE 4LG6A 1BI7B 2PM7A 3ABKE 3D9PA 4Z68A 3FUDA 1HX8A 3O4ZA 2IQCA 1H19A 2EILE 3MYVA 2VSXE 3TXMA 2QY7A 3FDHA 3IEGA 1E7UA 4NACA 3MKQA 2XRYA 2GRLA 3B7UX 4LEUA 2GGFA 5DIZA 3CGHA 1XGWA 4V3IA 4NQ0A 3LCAA 1NL4A 2YHCA 4G25A 3S7FA 2XGSA 4E85A 4I2WA 4KZCA 1GW6A 4J8YA 3ZYMA 4UWFA 3MV3B 1E8ZA 4KYOB 4GTQA 2L9BA 3JUIA 3FTZA 3KAEA 3L82A 3HDXA 1ZU2A 1X81A 4HI8A 3FTXA 4BWRA 4TXRA 4U04A 2P9LG 2VYIA 2XEEA 4XI9A 2YQ8A 3V79K 3FEYA 4ILHB 4TXQA 3G2UA 2PNNA 3MX3A 4N3CA 2X6IA 2VJ8A 3MKRA 1A5EA 4DX2A 3T5XA 3LKUA 4EPZA 3UM0A 4J8EA 2FF4A 5HRYA 2VGYA 3DEPA 3CKBA 3SGHA 1HE8A 2WXJA 3LY8A 5FZSA 1IHGA 4AEZC 4DX6D 2WXIA 2I1JA 2LXMA 2WQ6A 5EIDA 3UT7A 3I5PA 4GA0A 3EIQC 2HR2A 2Y69E 1SQMA 2WVIA 4DRXE 1UG3A 4B93B 1TJCA 1B89A 4UQZA 4HLLA 3OXGA 3LJ3A 2BTDA 4U96D 4N2SA 2WQHA 2XHEA 3QKYA 1HXIA 5FZQA 5FINA 5JJ7A 1JUQA 5KNHD 4XX5A 4URKA 2V8SE 1TNUA 2KXPC 3FH7A 4N3AA 3DXMG 3D9JA 3MZLB 5A23A 1KT0A 5EN5D 1WM5A 2EIKE 2IJGX 4LERA 4GTOA 4LNUD 1KT1A 1UW4B 4PDXA 3ZYLA 3UIPC 2Y1LE 4YDOA 4UQYA 4BY6A 5FQ7A 2IOLA 3DSVA 4HQDA 4X8QA 4GB9A 4JL0A 3RU0A 3QK0A 3SBSA 1FPPA 3FUIA 4BT8A 3DBSA 4KXKB 1OCRE 3FEXA 3ZRHA 1HFAA 2VSOE 1S70B 5CBNA 1LD8A 1QNFA 3DSSA 5G05J 3S7JA 3CSTA 4YVQC 4GTVA 2NYJA 4RLYA 1L5JA 1JCRA 3PNLB 2R5SA 3SNXA 2Y4TA 5AJLA 3LEWA 4TUMA 3L08A 1KZOA 4EQFA 3ZVVA 1OY3D 3SBTB 2IFUA 1H2TC 3JCKC 3T5VA 3CHQA 2CHZA 1UOHA 1MX4A 4CYMD 4HFGA 4G23A 1S64A 4TXPA 4GCOA 3FTWA 3B7BA 3V31A 2P9KG 1Z5SC 3D9HA 3PVLA 3DSTA 3TWVA 1N4QA 3EHNA 2E2EA 3Q7AA 2Y3AA 5CMYA 3AG4E 2CFUA 3ULQA 3JQ1A 4ANVA 3FHEA 1TNBA 3CQGB 3CQCB 3Q75A 4EECA 4JXTA 2XPZA 4XEIG 3HXDA 2ETBA 4N2QA 4JC8A 4KMOA 4L2LA 5AQBA 1UJJA 3KSLA 4G24A 2R02A 4YNDA 3WG7E 2I1KA 1OWMA 3WXXA 1XNFA 3U9WA 1N4RA 1IYGA 4I43A 5ANRA 5JHAA 4HXIA 5BPPA 3SFYA 2WXRA 4J8SA 2L0IA 5HQ8A 2ZGGA 5JMND 2CHXA 1FT2A 1WG0A 2Y0BG 3CVPA 4DK5A 2C0MA 4G2VA 5CHEE 3ZEFA 1QQEA 2X38A 4DUIA 4HOSA 5KNGA 5JHBA 3FU5A 3BU8A 4RG6A 3I4RB 1H2UA 2WXLA 3NOCD 3UKRG 4HLEA 4QFVA 3FH5A 2X6JA 5CERB 2H6FA 4L1BA 2R17C 3CSFA 3S7BA 3HRAA 3Q5MA 2WXMA 5EIBE 3GW4A 2B0OE 2J49A 2VQ2A 2OVBA 3FWVA 1DCEA 5LP0A 4J7WA 3D9LA 1U2VG 2BKKB 4OAVB 3Q78A 1DC2A 4O1OA 3J5PA 4MKTA 4WWPA 2L6JA 3CKCA 3E34A 1V54E 3C3QA 5D0OD 3B7TA 1JPLA 3E32A 1P5QA 4BSXA 3UM3A 3APFA 3R9AB 2P9PG 4JHKA 4K03A 2FI7A 5KBAA 2JABA 4GZ5A 3T8KA 1QBQA 3JYSA 5H7PA 2XGOA 4KBQA 2H6GA 4KVMA 3MKQB 3SD5A 2X6FA 5CBOA 4AP2A 4UI9J 2XPYA 5CCLA 4K5AB 4GYWA 3C3OA 3EHMA 1SZ9A 2FEZA 2MOWA 3W9FA 4BEPA 4AY6A 1YA0A 5EKQD 2IF4A 2XS8A 2WXNA 5KWDA 3ZYKA 4FJYA 2NSZA 5KJKA 4GU5A 2XZDG 3IV0A 4WWNA 5ENSD 3EDTB 2ETCA 2AXZA 4I9EA 5G04C 2NXPA 1E8YA 4GCNA 4K5CA 2XCCA 3OAWA 5B1BE 3DEOA 4G11A 1U3CA 3BEEA 1TEZA 2PQRA 4YDYA 2RD0A 2FO1E 5B3SE 3G2WA 2V4LA 4EHMA 1TJFA 3PDNA 3CVNA 3RKVA 3UT4A 3CHMA 1N11A 1OXJA 4LNGA 4B8CB 4ILGA 5FQ4A 2R59A 4N39A 2GRMA 3D9IA 3EHQA 5FQ8A 1W3BA 3ULEG 1VDYA 5T4YA 4LRZA 3UIOC 3DWLG 3KSQA 4PS7A 5C2YA 4LUNU 4AM9A 3DXKG 3D9OA 3G2VA 3LY7A 2LNIA 5AYWD 1KLXA 2CG2A 2DIWA 5FTPA 2BEDA 3I4GA 3L9TA 2DYSE 3QWPA 3G2TA 4F6RD 3E30A 5LX8A 5KJLA 2DCPA 3TWQA 3LY9A 4CCAA 1TR4A 2NC9A 2GROB 1OUVA 3ASGA 3CHRA 3PZDA 3V2OA 3IHYA 1MX6A 3J5QB 5T3RA 3PRZA 1OWNA 3L6AA 4FC8A 4EZJA 1DCQA 4JVSA 3TWUA 5BUZA 3BG1B 4L7TA 2VGEA 4AV7A 1LF8A 5BNWA 4IN3B 4EBAG 4XZ4A 4P29A 3TWSA 3C72A 4I6EA 3ASHA 1E8WA 2J08A 4Q69A 1K8KG 1Y8MA 3SFZA 1MZCA 3EU5A 1FCHA 3C98A 4KVOA 2WMOA 3ASOE 4XIFA 3O48A 3NQPA 2WB2A 2QZAA 2QYJA 3AS8A 4JZYA 3TAXA 2BKGA 4DX7D 3HXBA 4NRHB 3BG0B 4J0UA 4B89A 4CT0A 1D8DA 4GMJA 4I9CA 5EX3A 4GPMA 4ZHBA 2EIME 3CR3A 1RW2A 2PM6A 3DRAA 4JHRA 4G1TA 4WNEA 3CVQA 4GTPA 2XQ0A 2DZOA 1BLXB 2GRQB 1FVFA 1JCQA 5BXOA 3FU0A 3QC1A 2A5UA 3ML9A 4CEMA 5B1AE 4JEUA 3CIAA 4MS6A 4BTBA 4I2ZA 1ZBPA 2RFMA 1A17A 4JW1A 3NF1A 5FQ6A 1MQSA 3FUFA 4U8HA 1NZNA 3R7RA 1G3NB 3FUMA 3FUJA 4IULA 3L13A 4DJAA 3BQOA 1S0PA 3DPYA 2AVPA 2ZIRA 2KC7A 3Q47B 4D10C 4UWKA 4U63A 4FA6A 3L22A 3TWRA 3LYAA 3D9NA 3MJWA 2KBXA 3CVXA 3ZXPA 5AENA 4F1SA 3EIJA 3PZ1A 3ZU7B 2JEKA 3CLJA 2RFAA 3KS2A 3VTXA 2OV8A 4J8DA 2MYOA 1TN7A 2WQ7A 2WXFA 4U07A 3MV2B 3HXEA 3RRMB 4DX1A 2MHKA 3NAWA 3PUJA 3L17A 1QYMA 1HZ4A 4U8YD 3PZ3A 4U8VD 1JWFA 1DNPA 1E8XA 4UWGA 4DLQA 5CRUA 1OCCE 2GRRB 3CVLA 1N0QA 4NIKA 2L6BA 5HS0A 3APDA 3AU5A 2BF0X 3FH8A 1TNYA 3RAUA 4GTRA 4ZFHA 2DWZA 3Q9UC 3TJPA 1N54A 4F3VA 4YDWA 3MCXA 4I1OB 3LDZA 3ESLA 2YHEA 4F7AA 3ZXSA 2C2LA 2VTBB 4HVBA 3Q79A 4GTTA 1IKND 1OWOA 1KPSB 3ZW3A 5ENNA 3F6QA 4Q94A 4MBGA 1O1TA 2HE0A 3FY4A 4DI3A 4YVOA 3PE3A 3UPVA 2ZISA 5J90A 5AAOA 4C0MA 4RG9A 3UM1A 3U66A 5J08A 3CVVA 4HB5A 1UN8A 4FHJA 4FADA 3KEAA 2LSVA 2KCKA 2OCCE 2XCBA 4HI9A 2QYUA 2F8XK 2WXGA 1H2VC 4RSYA 5AJDA 3ZNGA 3B13A 3BUAA 5AQ9A 4I1AA 4BESA 4TRQA 4ANXA 4RQIA 4WUYA 3QNKA 3CVWA 4J6IA 5ARFA 1NA0A 4C9BB 1JWGA 4O60A 3ISMC 4FLBA 4BSZB 5FT9A 4JEHA 4HRMB 1KZPA 2V4HC 1NFIE 4F53A 1YYHA 2R05A 4IRUA 2PL2A 1BU9A 3B95A 2WPVA 1N52A 4BFRA 1TNZA 2RG8A 1IQRA 3Q49B 3PEVB 2MRIA 3MGBA 4ACLA 4HOTA 4PS3A 5E75A 3U4TA 4G26A 3S2AA 2ETAA 1N94A 1TN8A 3ESKA 4FP7A 4EBAA 4GZ6A 2CG3A 3P1UA 3DSUA 5IY5E 1MJ0A 4FLHA 1MHQA 2VGXB 2VTBA 3EHRA 1H0AA 2KCLA 1AP7A 1ZB1A 2YNQA 5G55A 3ONLA 1HF8A 1OCOE 2DYRE 2KZTB 4MLPA 4M3OA 3OXLA 5ANLA 3SZ7A 3KEZA 2A4ZA 2VSNA 3EJNA 3GZ2A 3FP3A 5AIJA 5KJNA 4DX5D 4AXHA 2V5QC 1D9SA 1HO8A 3OXFA 5M72A 3IKOB 4KZ0A 2GRNB 2J8SD 2V5FA 4U0ZA 3FU6A 2UY1B 2WXQA 3IHVA 1IQUA 4DPRA 2QFCA 1NP7A 3DPDA 3FFLA 3MA5A 4I17A 3TWWA 4HOQA 5AARA 2AXVA 5DBKA 4CZ2D 4JB8P 1S63A 5C1DA 2EINE 5JJTA 4ATGA 4C48B 2J07A 4HNAD 5G2NA 4UWLA 1EPUA 1SA4A 3PS6A 2IY0C 3JUEA 4YDEA 3DSXA 5CEAA 3AU4A 4O1PA 1LD7A 5AQ7A 1PY1A 3HXCA 3SO8A 2M63A 2HM8A 2A5EA 2LO6A 3L16A 2CHWA 4M7CA 4LNBA 3JXIA 4L9PA 2PZIA 3LPZA 3RRUA 2LAHA 3QOUA 1TNOA 5E76A 3PREA 3QB2A 3FTVA 2VGXA 2KCVA 3FTUA 1WY6A 3CHSA 3CK9A 3UINC 2DVWA 1IXVA 2P9IG 2KZTA 4G8KA 5ARGA 3UMVA 4RVBA 4ME2A 3T8MA 4BT9A 1N95A 2KM4A 3LJNA 1O1SA 3UQ3A 3TL5A 3ZGQA 5CMWA 3ZKJA 4CDNA 4TV3A 1EF1C 3T9KA 2RKKA 4H7XA 4I6GA 3MEKA 2UY1A 4JPSA 1EDUA 3Q15A 4TUUA 1Y6IA 5ENQD 4HORA 1H6KA 1HG5A 4N3BA 4AJWA 4A1GA 1PC2A 3RRNB 4XKCA 1HU3A 2OEVA 2P2CP 2HYZA 4N5QA 4APOA 5FIOA 3CV0A 4XI0A 5A7DB 3PUKA 4Y6CA 2H6IA 2ZGDA 2F0YA 5G05C 2P9UG 2KATA 1BPOA 1HG2A 3HVEB 1D8EA 3CVUA 1QZ2A 4UI9K 2XENA 1SVXA 3E4BA 1YMPA 3G2SA 4ATZD 3CEQA 3GZ1A 2XRZA 4GPKA 2FBNA 3S7DA 4A3TA 4GMRA 5FJYA 2DBAA 2AWIA 4OAUC 4L23A 2I6HA 5LOZA 3PH0C 2OVFA 4JA9A 4APFA 2J4BA 2P9SG 4G8LA 2LSUA 1N9AA 1YCSB 3B7RL 4KT6B 3LXUX 3RSEG 3KD7A 3IXEA 4B94A 4JA7A 2GRPB 4ACKA 3LVQE 3UXGA 3TWTA 5FWQA 5T8IA 4K0RA 3ABME 1N4SA 2WXKA 1SA5A 3QAQA 1MYOA 1U3DA 3L54A 3AAAC 1AWCB 3NOGD 3FTSA 4OVUA 2J9QA 4I6JA 1H6OA 1ELRA 2GW1A 1N4PA 2IONA 2QC9A 3APCA 4BTAA 3ULYA 4CT4A 3SHFA 2B6CA 4U0SA 3PZ2A 3SY2A 1FT1A 5ENOD 4GA1A 3RIBA 4HOUA 3HVEA 3QWWA 2VSYA 3UM2A 5LFAA 2J09A 4PH4B 2YINA 1Z3XA 3SFXA 3URZA 4ABNA 4XE0A 2IEJA 4ANWA 2ZXWE 2LAIA 4JHJA 5ENTD 4WAFA 4GAAA 2EQXA 1N0RA 5G04J 3TGOA 3D9KA 3Q9NC 5CCMA 4A63B 2XPIA 5D66A 4O6FA 5EX0A 3RJVA 1WDYA 4CGWA 3NBNB 3ZHEB 4AOFA 3ZN3A 3NB2A 4J8FA 2WM9A 3FUNA 4H7YA 1NI1A 2F8YA 1UN9A 4U7EB 3FULA 2IU1A 2XGMA 3FUHA 1E96B 3SQVA 3ASDA 4GYYA 5EYPF 3ENEA 3RO3A 1O5MA 4I1MA 4C0EA 3UKUG 1OWPA 2OEWA 1K1AA 3EU9A 2BUGA 5LCWC 1OWLA 3Q4AB 2H6HA 5ENPD 3NZSA 3AJIA 3RO2A 1LTXA 4BERA 3PE4A 2IO2C 4PS8A 5BT1A 3RK6A 3PEUB 4Q96A 4HBDA 2ILRA 2WMNA 3R9MA 3AG2E 3FU3A 1E7VA 3HIZA 2AW6A 2P9NG 3ASFA 3FUEA 5BXUA 3CK8A 3D3MA 3CHOA 1K1BA 1K3ZD 3AG3E 4GTSA 1Q2ZA 3ABLE 2ONDA 4R7LA 4FU3A 4UI9C 1H6PA 4GA2A 4EZKA 1WAO1 5BW8C 3ZUVB 2X6KA 4IYPA 5ITZF 3Q73A 3ZHEA 4JD2G 3U64A 3HHMA 2C0LA 3C3RA 3PNTB 3QWVA 1RZ4A 4W9RA 3HYMB 3JXJA
chains in the Genus database with same CATH topology
2LNIA 2V5FA 4U0ZA 3QKYA 3FU6A 5AYWD 1HXIA 1KLXA 2CG2A 5FZQA 3K9IA 3ZFWA 2UY1B 3IBEA 2WXQA 3IHVA 1IQUA 5JJ7A 4DPRA 2QFCA 1NP7A 2DIWA 3DPDA 3FFLA 3MA5A 4I17A 1HS6A 5FTPA 3TXNA 4BX9A 1JUQA 3FTYA 4HOQA 4XX5A 4URKA 2AXVA 3B7SA 2V8SE 3I4GA 5DBKA 1UJKA 3SI5A 3P2BA 3QWPA 5C1DA 3G2TA 2CFZA 5JJTA 4ATGA 3FH7A 2J07A 4AY5A 5G2NA 5LX8A 4UWLA 4N3AA 1EPUA 3PS6A 2X3MA 5KJLA 2DCPA 4B8AA 3AU4A 1DVPA 3VLEA 3VTYA 3LY9A 1PY1A 3D9JA 4CCAA 1HH8A 2NC9A 2M63A 3MZLB 2HM8A 5A23A 1OUVA 3ASGA 3CHRA 1KT0A 5HI7A 4OVVA 1WM5A 3PZDA 4EZLA 3IHYA 2LO6A 3L16A 4U0UA 5T3RA 2IJGX 3PRZA 4LERA 1OWNA 4CDMA 4MRUA 2CHWA 3L6AA 1KT1A 4FC8A 4EZJA 1UW4B 2IOSA 4PDXA 3ZPJA 3ZYLA 2PZIA 3LPZA 4XKBA 3RRUA 1INZA 4JVSA 3QJZA 2LAHA 3QOUA 5BUZA 4BY6A 4UQYA 3BG1B 5E76A 5FQ7A 3PREA 2IOLA 3UT8A 4L7TA 4GB9A 3QB2A 4JL0A 3FTVA 2VGXA 4AV7A 3TG5A 3RU0A 2KCVA 1LF8A 3QK0A 3FTUA 4IN3B 3SBSA 1WY6A 4EBAG 5BNWA 3AS5A 4XZ4A 2WXHA 3FUIA 3CHSA 3CK9A 4P29A 4BT8A 4AVXA 1EYHA 2AXUA 5FZRA 3DBSA 4I6EA 1E90A 4KXKB 4PUCA 3ASHA 5KJMA 3FEXA 2PQNA 3VLFA 3ZRHA 1HFAA 2VSOE 2KZTA 1QNFA 4DI4A 1E8WA 4GYOA 5ARGA 5G05J 3S7JA 3CSTA 2J08A 4YVQC 4Q69A 2I2OA 3ONKA 1Y8MA 3SFZA 4A55A 1FCHA 4RVBA 3UMVA 1L5JA 1PAQA 3C98A 3PNLB 4ME2A 4KVOA 4GMLA 3T8MA 4BT9A 2R5SA 2WMOA 3SNXA 2Y4TA 1NA3A 2KM4A 5AJLA 3LEWA 3UQ3A 4XIFA 4CDRA 3TL5A 3ZGQA 5CMWA 3O48A 3NZUA 3NQPA 4WWOA 2WB2A 4CGVA 3L08A 3D9MA 4WNGA 2Q7FA 4CDNA 4TV3A 4EQFA 3AS8A 4JZYA 3ZVVA 1EF1C 5EDSA 4H7XA 4I6GA 3MEKA 3TAXA 3SBTB 2UY1A 2IFUA 2WXOA 3GYZA 4JPSA 1H2TC 1EDUA 3JCKC 3BG0B 4NRHB 3Q15A 4TUUA 4J0UA 3T5VA 3CHQA 1Y6IA 2CHZA 3LVRE 4B89A 4Y6WA 4CT0A 4HORA 4HFGA 4GMJA 4I9CA 2JLBA 4BX8A 5EX3A 4WNFA 2HO1A 1H6KA 1HG5A 2UWJG 4N3BA 2ZU6B 4AJWA 4G23A 4A1GA 4GCOA 1PC2A 3RRNB 3FTWA 3CR3A 2PM6A 4FJZA 4UWHA 4XKCA 1ELWA 1HU3A 4JHRA 5KCMA 4G1TA 4OYSA 3PVLA 2L0TB 4WNEA 3CVQA 2HYZA 2XQ0A 4APOA 1SZAA 3UUXA 3VLDA 1FVFA 1ELKA 3CV0A 4XI0A 3FU0A 3QC1A 5A7DB 3ZIMA 2A5UA 3PUKA 3ML9A 4Y6CA 2P58C 4CEMA 4GZDA 3U3WA 3EHNA 3FUKA 2E2EA 4JEUA 2Y3AA 5LCWJ 5CMYA 2FULA 3CIAA 2CFUA 5G05C 3ULQA 4MS6A 4BTBA 3JQ1A 4I2ZA 4ANVA 1ZBPA 4LCTA 3FHEA 2KATA 1BPOA 1HG2A 3CQGB 3ZYQA 2V0PA 1A17A 3CQCB 3HVEB 4JW1A 4EECA 4JXTA 2XPZA 3CVUA 3NF1A 5FQ6A 1QZ2A 1MQSA 4UI9K 3FUFA 3E4BA 3I3NA 4U8HA 4N2QA 3G2SA 5BV0A 4JC8A 1NZNA 3R7RA 2WXPA 4KMOA 3QDNA 3R7QA 3CEQA 4L2LA 3UX4A 3GZ1A 2XRZA 4ILIA 3TG4A 3FUMA 1UJJA 3FUJA 4IULA 4N5CA 4GZ3A 4G24A 3L13A 4GPKA 4YNDA 3N71A 4DLOA 3ML8A 4DJAA 2FBNA 2I1KA 3S7DA 4A3TA 1OWMA 1FVHA 2OOEA 3WXXA 1S0PA 1XNFA 3U9WA 2AVPA 2KC7A 5FJYA 2X6HA 3QARA 3CVYA 2DBAA 2AWIA 2Y4UA 4L2YA 3OTNA 3CK7A 1IYGA 3Q47B 4L23A 4D10C 4UWKA 2I6HA 4I43A 5LOZA 5ANRA 3PH0C 2OVFA 4B0ZA 3GZSA 4JA9A 5JHAA 4U63A 4FA6A 4APFA 3L22A 2J4BA 4GZCA 4HXIA 3LYAA 2LSUA 5A6CA 3B7RL 4KT6B 3D9NA 3LXUX 3MJWA 3KD7A 5BPPA 4UQXA 2WXRA 4B94A 4J8SA 4JA7A 3CVXA 3HYMB 2L0IA 5HQ8A 4WNDA 4ACKA 5AENA 2J4DA 3LVQE 4F1SA 4ANUA 3EIJA 2CHXA 5FWQA 5T8IA 3CVPA 2XEVA 4AIFA 4DK5A 4K0RA 2C0MA 2JEKA 4G2VA 4A3VA 4NURA 2WXKA 3CLJA 5CHEE 3ZEFA 4E6HA 1QQEA 3AS4A 2X38A 2FO7A 3KS2A 4FHKA 5D0QD 2E0IA 4HOSA 3QAQA 3VTXA 4FULA 2OV8A 4J8DA 1U3DA 3L54A 5JHBA 3FU5A 4RG6A 3I4RB 2I9CA 1H2UA 3FTSA 2WXLA 5BV1A 4OVUA 2WQ7A 3JQ0A 2J9QA 2WXFA 4I6JA 4U07A 3MV2B 3CHPA 1ELRA 2GW1A 2IONA 3SF4A 3APCA 3RRMB 4HLEA 2MHKA 4QFVA 4BTAA 3FH5A 3PUJA 2X6JA 3L17A 4HS2A 4CT4A 3SHFA 4A1SA 4U0SA 1HZ4A 4L1BA 2R17C 3CSFA 3S7BA 1X5BA 1JWFA 3Q5MA 1DNPA 5JJ6A 4GA1A 2WXMA 1E8XA 3GW4A 1Z3YA 4CRWA 4UWGA 3RIBA 1Z6TA 3LS8A 4DLQA 4HOUA 4W9RA 3CVLA 2J49A 3HVEA 3QWWA 2VQ2A 2VSYA 2OVBA 3APDA 3AU5A 3FWVA 5LFAA 5LP0A 2PM7A 3D9PA 2BF0X 3FH8A 3FUDA 2J09A 3D9LA 1HX8A 4PH4B 3O4ZA 2IQCA 1H19A 2YINA 1Z3XA 3TJPA 3MYVA 1N54A 2VSXE 4MKTA 3URZA 4ABNA 3TXMA 4F3VA 4XE0A 2QY7A 4WWPA 3FDHA 3IEGA 1E7UA 3MCXA 2L6JA 4I1OB 3CKCA 3LDZA 4NACA 3ESLA 4ANWA 3MKQA 5D0OD 2XRYA 3B7TA 2LAIA 2YHEA 2GRLA 3B7UX 4F7AA 4JHJA 4LEUA 3ZXSA 2GGFA 4WAFA 2C2LA 1JPLA 5DIZA 4GAAA 2EQXA 2VTBB 4HVBA 1P5QA 3CGHA 4BSXA 5G04J 3APFA 3R9AB 4JHKA 4K03A 2FI7A 1OWOA 1XGWA 4NQ0A 4Q96A 4V3IA 3D9KA 5CCMA 3TGOA 3ZW3A 2XPIA 4GZ5A 5ENNA 4Q94A 3LCAA 3FY4A 4O6FA 4DI3A 4YVOA 5EX0A 3RJVA 3JYSA 3PE3A 3UPVA 2YHCA 4G25A 2XGOA 4CGWA 4KBQA 5J90A 3S7FA 3ZHEB 4AOFA 2XGSA 4E85A 3ZN3A 4I2WA 4J8FA 4KZCA 4C0MA 4KVMA 1GW6A 3MKQB 3ZYMA 4RG9A 4UWFA 2WM9A 3SD5A 3U66A 3MV3B 3FUNA 5J08A 3CVVA 4H7YA 1E8ZA 1UN9A 2X6FA 1UN8A 4FHJA 4KYOB 4AP2A 4UI9J 3FULA 4FADA 2L9BA 2IU1A 2XGMA 3FUHA 3JUIA 1E96B 2LSVA 3FTZA 3KAEA 2KCKA 2XCBA 2XPYA 3ASDA 5CCLA 3HDXA 2WXGA 1ZU2A 4GYYA 1H2VC 4RSYA 5AJDA 3FTXA 4GYWA 3EHMA 3ENEA 3RO3A 3B13A 4BWRA 1SZ9A 2FEZA 4U04A 4I1MA 2MOWA 4I1AA 4TRQA 4ANXA 2VYIA 4C0EA 4XI9A 4AY6A 4WUYA 3QNKA 1YA0A 4J8EA 1OWPA 5EKQD 4J6IA 5ARFA 3CVWA 2IF4A 1NA0A 2WXNA 2YQ8A 3ZYKA 4FJYA 4C9BB 1JWGA 2NSZA 4FLBA 2BUGA 5FT9A 5KJKA 4JEHA 5LCWC 4GU5A 4F53A 1OWLA 3FEYA 3Q4AB 4ILHB 4IRUA 3NZSA 2PL2A 3G2UA 3RO2A 3IV0A 4WWNA 3EDTB 2WPVA 3MX3A 4N3CA 2AXZA 3PE4A 4I9EA 1N52A 5G04C 4BFRA 4PS8A 2X6IA 5BT1A 2RG8A 1E8YA 4GCNA 3RK6A 3PEUB 1IQRA 2XCCA 2VJ8A 2ILRA 2MRIA 3MKRA 3PEVB 2WMNA 3OAWA 3Q49B 3MGBA 3T5XA 4ACLA 4G11A 3LKUA 4EPZA 4HOTA 4PS3A 5E75A 3U4TA 3FU3A 1E7VA 1U3CA 3BEEA 3HIZA 2FF4A 2AW6A 3ASFA 3FUEA 4G26A 1TEZA 3CK8A 2VGYA 3S2AA 2PQRA 3D3MA 3CHOA 3ESKA 4FP7A 3CKBA 4EBAA 2RD0A 4GZ6A 3SGHA 2CG3A 3P1UA 3G2WA 2V4LA 1TJFA 3PDNA 1HE8A 2ONDA 3CVNA 3RKVA 2WXJA 4FLHA 1MHQA 2VGXB 3LY8A 5FZSA 4R7LA 3CHMA 1IHGA 3UT4A 4AEZC 1H0AA 2KCLA 2VTBA 4FU3A 4UI9C 2WXIA 2I1JA 4GA2A 4B8CB 2YNQA 5G55A 1WAO1 3ONLA 4EZKA 4ILGA 1HF8A 2WQ6A 5FQ4A 3UT7A 2KZTB 5BW8C 2R59A 4N39A 2GRMA 2X6KA 3I5PA 4GA0A 4M3OA 3EIQC 3D9IA 4IYPA 4MLPA 3OXLA 2HR2A 1W3BA 5ANLA 5FQ8A 3SZ7A 1SQMA 3KEZA 2A4ZA 2VSNA 1UG3A 2WVIA 1TJCA 1VDYA 3EJNA 3FP3A 3GZ2A 1B89A 3ZHEA 5AIJA 4UQZA 5KJNA 3U64A 5T4YA 3OXGA 4LRZA 3HHMA 4AXHA 4PS7A 2C0LA 3LJ3A 5C2YA 2BTDA 4LUNU 3PNTB 4AM9A 1HO8A 3QWVA 4N2SA 3OXFA 2WQHA 3D9OA 5M72A 3IKOB 3G2VA 3LY7A 2NXPA 2XHEA 4KZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNI A;  2V5F A;  4U0Z A;  3QKY A;  5AYW D;  1HXI A;  1KLX A;  5FZQ A;  3K9I A;  3ZFW A;  2UY1 B;  5JJ7 A;  2QFC A;  3MA5 A;  3FFL A;  4I17 A;  5FTP A;  4HOQ A;  5DBK A;  5C1D A;  3QWP A;  5JJT A;  4AY5 A;  4N3A A;  5KJL A;  3VTY A;  3LY9 A;  1HH8 A;  2NC9 A;  1OUV A;  3ASG A;  1KT0 A;  5HI7 A;  1WM5 A;  4U0U A;  1KT1 A;  3ZPJ A;  2PZI A;  3LPZ A;  3QOU A;  4UQY A;  4JL0 A;  2VGX A;  3TG5 A;  3RU0 A;  2KCV A;  5BNW A;  4IN3 B;  3AS5 A;  3CK9 A;  4BT8 A;  5FZR A;  4KXK B;  5KJM A;  3ASH A;  2PQN A;  4GYO A;  5ARG A;  5G05 J;  3S7J A;  4YVQ C;  1Y8M A;  1FCH A;  4ME2 A;  4BT9 A;  2R5S A;  2Y4T A;  1NA3 A;  3UQ3 A;  4XIF A;  4CDR A;  3ZGQ A;  3O48 A;  4CGV A;  4WNG A;  2Q7F A;  4EQF A;  3AS8 A;  4H7X A;  3MEK A;  3TAX A;  2UY1 A;  2IFU A;  3GYZ A;  4NRH B;  3Q15 A;  4J0U A;  4Y6W A;  4HOR A;  4I9C A;  2JLB A;  5EX3 A;  4WNF A;  2HO1 A;  4N3B A;  2UWJ G;  4G23 A;  4GCO A;  1PC2 A;  1ELW A;  4JHR A;  4G1T A;  4WNE A;  3CVQ A;  2HYZ A;  4APO A;  3UUX A;  3CV0 A;  4XI0 A;  5A7D B;  4Y6C A;  2P58 C;  3U3W A;  2E2E A;  5LCW J;  5G05 C;  3ULQ A;  4BTB A;  4I2Z A;  1ZBP A;  2KAT A;  1A17 A;  3NF1 A;  1QZ2 A;  4UI9 K;  3E4B A;  4N2Q A;  1NZN A;  3QDN A;  3CEQ A;  3GZ1 A;  3TG4 A;  4N5C A;  4GZ3 A;  4G24 A;  4GPK A;  4YND A;  3N71 A;  2FBN A;  3S7D A;  2OOE A;  3WXX A;  1XNF A;  2AVP A;  2KC7 A;  5FJY A;  2DBA A;  2Y4U A;  3CK7 A;  1IYG A;  3Q47 B;  2I6H A;  4JA9 A;  3LYA A;  2LSU A;  5A6C A;  3KD7 A;  4UQX A;  4B94 A;  4JA7 A;  5HQ8 A;  4WND A;  4AIF A;  3CVP A;  2XEV A;  2C0M A;  4G2V A;  5CHE E;  1QQE A;  3AS4 A;  2FO7 A;  3KS2 A;  5D0Q D;  4HOS A;  3VTX A;  4J8D A;  4RG6 A;  2J9Q A;  4U07 A;  3MV2 B;  1ELR A;  2GW1 A;  3SF4 A;  2MHK A;  4BTA A;  4A1S A;  4U0S A;  1HZ4 A;  3S7B A;  3Q5M A;  5JJ6 A;  4GA1 A;  3GW4 A;  3RIB A;  4HOU A;  3CVL A;  3QWW A;  2VQ2 A;  2VSY A;  3FWV A;  3URZ A;  4ABN A;  4F3V A;  3IEG A;  2L6J A;  3CKC A;  5D0O D;  4LEU A;  2C2L A;  5DIZ A;  1P5Q A;  5G04 J;  3R9A B;  2FI7 A;  4NQ0 A;  3TGO A;  5CCM A;  2XPI A;  4GZ5 A;  3LCA A;  4O6F A;  4YVO A;  5EX0 A;  3RJV A;  3JYS A;  3PE3 A;  3UPV A;  2YHC A;  4G25 A;  2XGO A;  4CGW A;  4KBQ A;  3S7F A;  3ZHE B;  2XGS A;  3ZN3 A;  4I2W A;  4J8F A;  4RG9 A;  3MV3 B;  4H7Y A;  4KYO B;  4UI9 J;  2XGM A;  1E96 B;  2LSV A;  3KAE A;  2KCK A;  2XCB A;  3ASD A;  5CCL A;  1ZU2 A;  4GYY A;  4GYW A;  4BWR A;  3RO3 A;  2FEZ A;  4U04 A;  4I1A A;  2VYI A;  4XI9 A;  4AY6 A;  4WUY A;  1YA0 A;  5EKQ D;  5ARF A;  2IF4 A;  1NA0 A;  2YQ8 A;  2BUG A;  5FT9 A;  5KJK A;  5LCW C;  3Q4A B;  2PL2 A;  3RO2 A;  3EDT B;  2WPV A;  4N3C A;  3PE4 A;  4I9E A;  5G04 C;  5BT1 A;  4GCN A;  2XCC A;  3MKR A;  3Q49 B;  3LKU A;  4HOT A;  3U4T A;  4J8E A;  3BEE A;  2FF4 A;  3ASF A;  4G26 A;  3CK8 A;  2VGY A;  2PQR A;  3ESK A;  3CKB A;  4GZ6 A;  3RKV A;  3PDN A;  2OND A;  3CVN A;  2VGX B;  3LY8 A;  5FZS A;  1IHG A;  2KCL A;  4UI9 C;  4GA2 A;  1WAO 1;  5BW8 C;  4N39 A;  4GA0 A;  3OXL A;  2HR2 A;  1W3B A;  3SZ7 A;  2VSN A;  3ZHE A;  1TJC A;  3GZ2 A;  3FP3 A;  1B89 A;  4UQZ A;  5KJN A;  3OXG A;  2C0L A;  4AM9 A;  4N2S A;  3QWV A;  3OXF A;  2WQH A;  5M72 A;  3LY7 A;  4W9R A;  3HYM B; 
#chains in the Genus database with same CATH topology
 5JA4 D;  3K9I A;  3ZFW A;  4QQI A;  5CEC B;  3IBE A;  3TXN A;  3V2X A;  4BX9 A;  1HS6 A;  3FTY A;  1JCS A;  3B7S A;  4K5B A;  1UJK A;  3SI5 A;  3P2B A;  2CFZ A;  4AY5 A;  3AG1 E;  2X3M A;  1V55 E;  4B8A A;  1DVP A;  3VLE A;  3VTY A;  1BD8 A;  3E37 A;  1HH8 A;  4U95 D;  5AQA A;  5HI7 A;  4OVV A;  4EZL A;  5CRV A;  4U0U A;  3PZ4 A;  4CDM A;  4MRU A;  2IOS A;  3ZPJ A;  4XKB A;  1INZ A;  2DZN A;  2F37 A;  3QJZ A;  3UT8 A;  5D2M C;  2XZT G;  4GTM A;  3TG5 A;  3AS5 A;  3UTM A;  2WXH A;  5AN8 A;  4AVX A;  1EYH A;  2AXU A;  5FZR A;  1O1R A;  1E90 A;  4PUC A;  5KJM A;  3VLF A;  2PQN A;  3HG0 D;  4DI4 A;  4GYO A;  2IO3 C;  2I2O A;  3ONK A;  4A55 A;  4F1P A;  1PAQ A;  4GML A;  3E33 A;  5EYL A;  1NA3 A;  4CDR A;  3EUV A;  3NZU A;  4WWO A;  2LUH A;  4CGV A;  3UI2 A;  3D9M A;  4WNG A;  2Q7F A;  2AJA A;  3V30 A;  5EDS A;  2WXO A;  3GYZ A;  3LVR E;  4Y6W A;  3HXF A;  3TWX A;  2XS1 A;  4BX8 A;  2JLB A;  4WNF A;  2HO1 A;  2UWJ G;  1OT8 A;  2ZU6 B;  4HRN A;  4UWH A;  1SW6 A;  4FJZ A;  1ELW A;  5KCM A;  4OYS A;  5ENR D;  2L0T B;  1SZA A;  4UUC A;  3UUX A;  5HKP A;  3VLD A;  3W9G A;  1ELK A;  3ZIM A;  5EIL A;  2P58 C;  4GZD A;  3U3W A;  2LXL A;  3FUK A;  5LCW J;  2FUL A;  4LCT A;  3ZYQ A;  2V0P A;  1OCZ E;  2XEH A;  3I3N A;  2R03 A;  5BV0 A;  3R7Q A;  1BI8 B;  2WXP A;  3QDN A;  3UX4 A;  3DSW A;  4ILI A;  3TG4 A;  4N5C A;  4GZ3 A;  3X2Q E;  5CED B;  3N71 A;  4DLO A;  3ML8 A;  1FVH A;  2OOE A;  2X6H A;  3QAR A;  3CVY A;  2Y4U A;  4L2Y A;  3OTN A;  3CK7 A;  3ASN E;  4B0Z A;  2R2L A;  3GZS A;  1TYQ G;  4GZC A;  5A6C A;  4BET A;  4UQX A;  3C5R A;  4WND A;  2J4D A;  4ANU A;  4AIF A;  2XEV A;  4A3V A;  4NUR A;  4E6H A;  3AS4 A;  1MX2 A;  2FO7 A;  4FHK A;  5D0Q D;  2E0I A;  4FUL A;  2I9C A;  1TN6 A;  5BV1 A;  3JQ0 A;  3CHP A;  3SF4 A;  4HRL A;  4HS2 A;  2EIJ E;  4A1S A;  3Q7F A;  1IHB A;  1X5B A;  5JJ6 A;  1Z3Y A;  4CRW A;  1Z6T A;  3LS8 A;  4LSZ E;  4LG6 A;  1BI7 B;  2PM7 A;  3ABK E;  3D9P A;  4Z68 A;  3FUD A;  1HX8 A;  3O4Z A;  2IQC A;  1H19 A;  2EIL E;  3MYV A;  2VSX E;  3TXM A;  2QY7 A;  3FDH A;  3IEG A;  1E7U A;  4NAC A;  3MKQ A;  2XRY A;  2GRL A;  3B7U X;  4LEU A;  2GGF A;  5DIZ A;  3CGH A;  1XGW A;  4V3I A;  4NQ0 A;  3LCA A;  1NL4 A;  2YHC A;  4G25 A;  3S7F A;  2XGS A;  4E85 A;  4I2W A;  4KZC A;  1GW6 A;  4J8Y A;  3ZYM A;  4UWF A;  3MV3 B;  1E8Z A;  4KYO B;  4GTQ A;  2L9B A;  3JUI A;  3FTZ A;  3KAE A;  3L82 A;  3HDX A;  1ZU2 A;  1X81 A;  4HI8 A;  3FTX A;  4BWR A;  4TXR A;  4U04 A;  2P9L G;  2VYI A;  2XEE A;  4XI9 A;  2YQ8 A;  3V79 K;  3FEY A;  4ILH B;  4TXQ A;  3G2U A;  2PNN A;  3MX3 A;  4N3C A;  2X6I A;  2VJ8 A;  3MKR A;  1A5E A;  4DX2 A;  3T5X A;  3LKU A;  4EPZ A;  3UM0 A;  4J8E A;  2FF4 A;  5HRY A;  2VGY A;  3DEP A;  3CKB A;  3SGH A;  1HE8 A;  2WXJ A;  3LY8 A;  5FZS A;  1IHG A;  4AEZ C;  4DX6 D;  2WXI A;  2I1J A;  2LXM A;  2WQ6 A;  5EID A;  3UT7 A;  3I5P A;  4GA0 A;  3EIQ C;  2HR2 A;  2Y69 E;  1SQM A;  2WVI A;  4DRX E;  1UG3 A;  4B93 B;  1TJC A;  1B89 A;  4UQZ A;  4HLL A;  3OXG A;  3LJ3 A;  2BTD A;  4U96 D;  4N2S A;  2WQH A;  2XHE A;  3QKY A;  1HXI A;  5FZQ A;  5FIN A;  5JJ7 A;  1JUQ A;  5KNH D;  4XX5 A;  4URK A;  2V8S E;  1TNU A;  2KXP C;  3FH7 A;  4N3A A;  3DXM G;  3D9J A;  3MZL B;  5A23 A;  1KT0 A;  5EN5 D;  1WM5 A;  2EIK E;  2IJG X;  4LER A;  4GTO A;  4LNU D;  1KT1 A;  1UW4 B;  4PDX A;  3ZYL A;  3UIP C;  2Y1L E;  4YDO A;  4UQY A;  4BY6 A;  5FQ7 A;  2IOL A;  3DSV A;  4HQD A;  4X8Q A;  4GB9 A;  4JL0 A;  3RU0 A;  3QK0 A;  3SBS A;  1FPP A;  3FUI A;  4BT8 A;  3DBS A;  4KXK B;  1OCR E;  3FEX A;  3ZRH A;  1HFA A;  2VSO E;  1S70 B;  5CBN A;  1LD8 A;  1QNF A;  3DSS A;  5G05 J;  3S7J A;  3CST A;  4YVQ C;  4GTV A;  2NYJ A;  4RLY A;  1L5J A;  1JCR A;  3PNL B;  2R5S A;  3SNX A;  2Y4T A;  5AJL A;  3LEW A;  4TUM A;  3L08 A;  1KZO A;  4EQF A;  3ZVV A;  1OY3 D;  3SBT B;  2IFU A;  1H2T C;  3JCK C;  3T5V A;  3CHQ A;  2CHZ A;  1UOH A;  1MX4 A;  4CYM D;  4HFG A;  4G23 A;  1S64 A;  4TXP A;  4GCO A;  3FTW A;  3B7B A;  3V31 A;  2P9K G;  1Z5S C;  3D9H A;  3PVL A;  3DST A;  3TWV A;  1N4Q A;  3EHN A;  2E2E A;  3Q7A A;  2Y3A A;  5CMY A;  3AG4 E;  2CFU A;  3ULQ A;  3JQ1 A;  4ANV A;  3FHE A;  1TNB A;  3CQG B;  3CQC B;  3Q75 A;  4EEC A;  4JXT A;  2XPZ A;  4XEI G;  3HXD A;  2ETB A;  4N2Q A;  4JC8 A;  4KMO A;  4L2L A;  5AQB A;  1UJJ A;  3KSL A;  4G24 A;  2R02 A;  4YND A;  3WG7 E;  2I1K A;  1OWM A;  3WXX A;  1XNF A;  3U9W A;  1N4R A;  1IYG A;  4I43 A;  5ANR A;  5JHA A;  4HXI A;  5BPP A;  3SFY A;  2WXR A;  4J8S A;  2L0I A;  5HQ8 A;  2ZGG A;  5JMN D;  2CHX A;  1FT2 A;  1WG0 A;  2Y0B G;  3CVP A;  4DK5 A;  2C0M A;  4G2V A;  5CHE E;  3ZEF A;  1QQE A;  2X38 A;  4DUI A;  4HOS A;  5KNG A;  5JHB A;  3FU5 A;  3BU8 A;  4RG6 A;  3I4R B;  1H2U A;  2WXL A;  3NOC D;  3UKR G;  4HLE A;  4QFV A;  3FH5 A;  2X6J A;  5CER B;  2H6F A;  4L1B A;  2R17 C;  3CSF A;  3S7B A;  3HRA A;  3Q5M A;  2WXM A;  5EIB E;  3GW4 A;  2B0O E;  2J49 A;  2VQ2 A;  2OVB A;  3FWV A;  1DCE A;  5LP0 A;  4J7W A;  3D9L A;  1U2V G;  2BKK B;  4OAV B;  3Q78 A;  1DC2 A;  4O1O A;  3J5P A;  4MKT A;  4WWP A;  2L6J A;  3CKC A;  3E34 A;  1V54 E;  3C3Q A;  5D0O D;  3B7T A;  1JPL A;  3E32 A;  1P5Q A;  4BSX A;  3UM3 A;  3APF A;  3R9A B;  2P9P G;  4JHK A;  4K03 A;  2FI7 A;  5KBA A;  2JAB A;  4GZ5 A;  3T8K A;  1QBQ A;  3JYS A;  5H7P A;  2XGO A;  4KBQ A;  2H6G A;  4KVM A;  3MKQ B;  3SD5 A;  2X6F A;  5CBO A;  4AP2 A;  4UI9 J;  2XPY A;  5CCL A;  4K5A B;  4GYW A;  3C3O A;  3EHM A;  1SZ9 A;  2FEZ A;  2MOW A;  3W9F A;  4BEP A;  4AY6 A;  1YA0 A;  5EKQ D;  2IF4 A;  2XS8 A;  2WXN A;  5KWD A;  3ZYK A;  4FJY A;  2NSZ A;  5KJK A;  4GU5 A;  2XZD G;  3IV0 A;  4WWN A;  5ENS D;  3EDT B;  2ETC A;  2AXZ A;  4I9E A;  5G04 C;  2NXP A;  1E8Y A;  4GCN A;  4K5C A;  2XCC A;  3OAW A;  5B1B E;  3DEO A;  4G11 A;  1U3C A;  3BEE A;  1TEZ A;  2PQR A;  4YDY A;  2RD0 A;  2FO1 E;  5B3S E;  3G2W A;  2V4L A;  4EHM A;  1TJF A;  3PDN A;  3CVN A;  3RKV A;  3UT4 A;  3CHM A;  1N11 A;  1OXJ A;  4LNG A;  4B8C B;  4ILG A;  5FQ4 A;  2R59 A;  4N39 A;  2GRM A;  3D9I A;  3EHQ A;  5FQ8 A;  1W3B A;  3ULE G;  1VDY A;  5T4Y A;  4LRZ A;  3UIO C;  3DWL G;  3KSQ A;  4PS7 A;  5C2Y A;  4LUN U;  4AM9 A;  3DXK G;  3D9O A;  3G2V A;  3LY7 A;  2LNI A;  5AYW D;  1KLX A;  2CG2 A;  2DIW A;  5FTP A;  2BED A;  3I4G A;  3L9T A;  2DYS E;  3QWP A;  3G2T A;  4F6R D;  3E30 A;  5LX8 A;  5KJL A;  2DCP A;  3TWQ A;  3LY9 A;  4CCA A;  1TR4 A;  2NC9 A;  2GRO B;  1OUV A;  3ASG A;  3CHR A;  3PZD A;  3V2O A;  3IHY A;  1MX6 A;  3J5Q B;  5T3R A;  3PRZ A;  1OWN A;  3L6A A;  4FC8 A;  4EZJ A;  1DCQ A;  4JVS A;  3TWU A;  5BUZ A;  3BG1 B;  4L7T A;  2VGE A;  4AV7 A;  1LF8 A;  5BNW A;  4IN3 B;  4EBA G;  4XZ4 A;  4P29 A;  3TWS A;  3C72 A;  4I6E A;  3ASH A;  1E8W A;  2J08 A;  4Q69 A;  1K8K G;  1Y8M A;  3SFZ A;  1MZC A;  3EU5 A;  1FCH A;  3C98 A;  4KVO A;  2WMO A;  3ASO E;  4XIF A;  3O48 A;  3NQP A;  2WB2 A;  2QZA A;  2QYJ A;  3AS8 A;  4JZY A;  3TAX A;  2BKG A;  4DX7 D;  3HXB A;  4NRH B;  3BG0 B;  4J0U A;  4B89 A;  4CT0 A;  1D8D A;  4GMJ A;  4I9C A;  5EX3 A;  4GPM A;  4ZHB A;  2EIM E;  3CR3 A;  1RW2 A;  2PM6 A;  3DRA A;  4JHR A;  4G1T A;  4WNE A;  3CVQ A;  4GTP A;  2XQ0 A;  2DZO A;  1BLX B;  2GRQ B;  1FVF A;  1JCQ A;  5BXO A;  3FU0 A;  3QC1 A;  2A5U A;  3ML9 A;  4CEM A;  5B1A E;  4JEU A;  3CIA A;  4MS6 A;  4BTB A;  4I2Z A;  1ZBP A;  2RFM A;  1A17 A;  4JW1 A;  3NF1 A;  5FQ6 A;  1MQS A;  3FUF A;  4U8H A;  1NZN A;  3R7R A;  1G3N B;  3FUM A;  3FUJ A;  4IUL A;  3L13 A;  4DJA A;  3BQO A;  1S0P A;  3DPY A;  2AVP A;  2ZIR A;  2KC7 A;  3Q47 B;  4D10 C;  4UWK A;  4U63 A;  4FA6 A;  3L22 A;  3TWR A;  3LYA A;  3D9N A;  3MJW A;  2KBX A;  3CVX A;  3ZXP A;  5AEN A;  4F1S A;  3EIJ A;  3PZ1 A;  3ZU7 B;  2JEK A;  3CLJ A;  2RFA A;  3KS2 A;  3VTX A;  2OV8 A;  4J8D A;  2MYO A;  1TN7 A;  2WQ7 A;  2WXF A;  4U07 A;  3MV2 B;  3HXE A;  3RRM B;  4DX1 A;  2MHK A;  3NAW A;  3PUJ A;  3L17 A;  1QYM A;  1HZ4 A;  4U8Y D;  3PZ3 A;  4U8V D;  1JWF A;  1DNP A;  1E8X A;  4UWG A;  4DLQ A;  5CRU A;  1OCC E;  2GRR B;  3CVL A;  1N0Q A;  4NIK A;  2L6B A;  5HS0 A;  3APD A;  3AU5 A;  2BF0 X;  3FH8 A;  1TNY A;  3RAU A;  4GTR A;  4ZFH A;  2DWZ A;  3Q9U C;  3TJP A;  1N54 A;  4F3V A;  4YDW A;  3MCX A;  4I1O B;  3LDZ A;  3ESL A;  2YHE A;  4F7A A;  3ZXS A;  2C2L A;  2VTB B;  4HVB A;  3Q79 A;  4GTT A;  1IKN D;  1OWO A;  1KPS B;  3ZW3 A;  5ENN A;  3F6Q A;  4Q94 A;  4MBG A;  1O1T A;  2HE0 A;  3FY4 A;  4DI3 A;  4YVO A;  3PE3 A;  3UPV A;  2ZIS A;  5J90 A;  5AAO A;  4C0M A;  4RG9 A;  3UM1 A;  3U66 A;  5J08 A;  3CVV A;  4HB5 A;  1UN8 A;  4FHJ A;  4FAD A;  3KEA A;  2LSV A;  2KCK A;  2OCC E;  2XCB A;  4HI9 A;  2QYU A;  2F8X K;  2WXG A;  1H2V C;  4RSY A;  5AJD A;  3ZNG A;  3B13 A;  3BUA A;  5AQ9 A;  4I1A A;  4BES A;  4TRQ A;  4ANX A;  4RQI A;  4WUY A;  3QNK A;  3CVW A;  4J6I A;  5ARF A;  1NA0 A;  4C9B B;  1JWG A;  4O60 A;  3ISM C;  4FLB A;  4BSZ B;  5FT9 A;  4JEH A;  4HRM B;  1KZP A;  2V4H C;  1NFI E;  4F53 A;  1YYH A;  2R05 A;  4IRU A;  2PL2 A;  1BU9 A;  3B95 A;  2WPV A;  1N52 A;  4BFR A;  1TNZ A;  2RG8 A;  1IQR A;  3Q49 B;  3PEV B;  2MRI A;  3MGB A;  4ACL A;  4HOT A;  4PS3 A;  5E75 A;  3U4T A;  4G26 A;  3S2A A;  2ETA A;  1N94 A;  1TN8 A;  3ESK A;  4FP7 A;  4EBA A;  4GZ6 A;  2CG3 A;  3P1U A;  3DSU A;  5IY5 E;  1MJ0 A;  4FLH A;  1MHQ A;  2VGX B;  2VTB A;  3EHR A;  1H0A A;  2KCL A;  1AP7 A;  1ZB1 A;  2YNQ A;  5G55 A;  3ONL A;  1HF8 A;  1OCO E;  2DYR E;  2KZT B;  4MLP A;  4M3O A;  3OXL A;  5ANL A;  3SZ7 A;  3KEZ A;  2A4Z A;  2VSN A;  3EJN A;  3GZ2 A;  3FP3 A;  5AIJ A;  5KJN A;  4DX5 D;  4AXH A;  2V5Q C;  1D9S A;  1HO8 A;  3OXF A;  5M72 A;  3IKO B;  4KZ0 A;  2GRN B;  2J8S D;  2V5F A;  4U0Z A;  3FU6 A;  2UY1 B;  2WXQ A;  3IHV A;  1IQU A;  4DPR A;  2QFC A;  1NP7 A;  3DPD A;  3FFL A;  3MA5 A;  4I17 A;  3TWW A;  4HOQ A;  5AAR A;  2AXV A;  5DBK A;  4CZ2 D;  4JB8 P;  1S63 A;  5C1D A;  2EIN E;  5JJT A;  4ATG A;  4C48 B;  2J07 A;  4HNA D;  5G2N A;  4UWL A;  1EPU A;  1SA4 A;  3PS6 A;  2IY0 C;  3JUE A;  4YDE A;  3DSX A;  5CEA A;  3AU4 A;  4O1P A;  1LD7 A;  5AQ7 A;  1PY1 A;  3HXC A;  3SO8 A;  2M63 A;  2HM8 A;  2A5E A;  2LO6 A;  3L16 A;  2CHW A;  4M7C A;  4LNB A;  3JXI A;  4L9P A;  2PZI A;  3LPZ A;  3RRU A;  2LAH A;  3QOU A;  1TNO A;  5E76 A;  3PRE A;  3QB2 A;  3FTV A;  2VGX A;  2KCV A;  3FTU A;  1WY6 A;  3CHS A;  3CK9 A;  3UIN C;  2DVW A;  1IXV A;  2P9I G;  2KZT A;  4G8K A;  5ARG A;  3UMV A;  4RVB A;  4ME2 A;  3T8M A;  4BT9 A;  1N95 A;  2KM4 A;  3LJN A;  1O1S A;  3UQ3 A;  3TL5 A;  3ZGQ A;  5CMW A;  3ZKJ A;  4CDN A;  4TV3 A;  1EF1 C;  3T9K A;  2RKK A;  4H7X A;  4I6G A;  3MEK A;  2UY1 A;  4JPS A;  1EDU A;  3Q15 A;  4TUU A;  1Y6I A;  5ENQ D;  4HOR A;  1H6K A;  1HG5 A;  4N3B A;  4AJW A;  4A1G A;  1PC2 A;  3RRN B;  4XKC A;  1HU3 A;  2OEV A;  2P2C P;  2HYZ A;  4N5Q A;  4APO A;  5FIO A;  3CV0 A;  4XI0 A;  5A7D B;  3PUK A;  4Y6C A;  2H6I A;  2ZGD A;  2F0Y A;  5G05 C;  2P9U G;  2KAT A;  1BPO A;  1HG2 A;  3HVE B;  1D8E A;  3CVU A;  1QZ2 A;  4UI9 K;  2XEN A;  1SVX A;  3E4B A;  1YMP A;  3G2S A;  4ATZ D;  3CEQ A;  3GZ1 A;  2XRZ A;  4GPK A;  2FBN A;  3S7D A;  4A3T A;  4GMR A;  5FJY A;  2DBA A;  2AWI A;  4OAU C;  4L23 A;  2I6H A;  5LOZ A;  3PH0 C;  2OVF A;  4JA9 A;  4APF A;  2J4B A;  2P9S G;  4G8L A;  2LSU A;  1N9A A;  1YCS B;  3B7R L;  4KT6 B;  3LXU X;  3RSE G;  3KD7 A;  3IXE A;  4B94 A;  4JA7 A;  2GRP B;  4ACK A;  3LVQ E;  3UXG A;  3TWT A;  5FWQ A;  5T8I A;  4K0R A;  3ABM E;  1N4S A;  2WXK A;  1SA5 A;  3QAQ A;  1MYO A;  1U3D A;  3L54 A;  3AAA C;  1AWC B;  3NOG D;  3FTS A;  4OVU A;  2J9Q A;  4I6J A;  1H6O A;  1ELR A;  2GW1 A;  1N4P A;  2ION A;  2QC9 A;  3APC A;  4BTA A;  3ULY A;  4CT4 A;  3SHF A;  2B6C A;  4U0S A;  3PZ2 A;  3SY2 A;  1FT1 A;  5ENO D;  4GA1 A;  3RIB A;  4HOU A;  3HVE A;  3QWW A;  2VSY A;  3UM2 A;  5LFA A;  2J09 A;  4PH4 B;  2YIN A;  1Z3X A;  3SFX A;  3URZ A;  4ABN A;  4XE0 A;  2IEJ A;  4ANW A;  2ZXW E;  2LAI A;  4JHJ A;  5ENT D;  4WAF A;  4GAA A;  2EQX A;  1N0R A;  5G04 J;  3TGO A;  3D9K A;  3Q9N C;  5CCM A;  4A63 B;  2XPI A;  5D66 A;  4O6F A;  5EX0 A;  3RJV A;  1WDY A;  4CGW A;  3NBN B;  3ZHE B;  4AOF A;  3ZN3 A;  3NB2 A;  4J8F A;  2WM9 A;  3FUN A;  4H7Y A;  1NI1 A;  2F8Y A;  1UN9 A;  4U7E B;  3FUL A;  2IU1 A;  2XGM A;  3FUH A;  1E96 B;  3SQV A;  3ASD A;  4GYY A;  5EYP F;  3ENE A;  3RO3 A;  1O5M A;  4I1M A;  4C0E A;  3UKU G;  1OWP A;  2OEW A;  1K1A A;  3EU9 A;  2BUG A;  5LCW C;  1OWL A;  3Q4A B;  2H6H A;  5ENP D;  3NZS A;  3AJI A;  3RO2 A;  1LTX A;  4BER A;  3PE4 A;  2IO2 C;  4PS8 A;  5BT1 A;  3RK6 A;  3PEU B;  4Q96 A;  4HBD A;  2ILR A;  2WMN A;  3R9M A;  3AG2 E;  3FU3 A;  1E7V A;  3HIZ A;  2AW6 A;  2P9N G;  3ASF A;  3FUE A;  5BXU A;  3CK8 A;  3D3M A;  3CHO A;  1K1B A;  1K3Z D;  3AG3 E;  4GTS A;  1Q2Z A;  3ABL E;  2OND A;  4R7L A;  4FU3 A;  4UI9 C;  1H6P A;  4GA2 A;  4EZK A;  1WAO 1;  5BW8 C;  3ZUV B;  2X6K A;  4IYP A;  5ITZ F;  3Q73 A;  3ZHE A;  4JD2 G;  3U64 A;  3HHM A;  2C0L A;  3C3R A;  3PNT B;  3QWV A;  1RZ4 A;  4W9R A;  3HYM B;  3JXJ A; 
#chains in the Genus database with same CATH homology
 2LNI A;  2V5F A;  4U0Z A;  3QKY A;  3FU6 A;  5AYW D;  1HXI A;  1KLX A;  2CG2 A;  5FZQ A;  3K9I A;  3ZFW A;  2UY1 B;  3IBE A;  2WXQ A;  3IHV A;  1IQU A;  5JJ7 A;  4DPR A;  2QFC A;  1NP7 A;  2DIW A;  3DPD A;  3FFL A;  3MA5 A;  4I17 A;  1HS6 A;  5FTP A;  3TXN A;  4BX9 A;  1JUQ A;  3FTY A;  4HOQ A;  4XX5 A;  4URK A;  2AXV A;  3B7S A;  2V8S E;  3I4G A;  5DBK A;  1UJK A;  3SI5 A;  3P2B A;  3QWP A;  5C1D A;  3G2T A;  2CFZ A;  5JJT A;  4ATG A;  3FH7 A;  2J07 A;  4AY5 A;  5G2N A;  5LX8 A;  4UWL A;  4N3A A;  1EPU A;  3PS6 A;  2X3M A;  5KJL A;  2DCP A;  4B8A A;  3AU4 A;  1DVP A;  3VLE A;  3VTY A;  3LY9 A;  1PY1 A;  3D9J A;  4CCA A;  1HH8 A;  2NC9 A;  2M63 A;  3MZL B;  2HM8 A;  5A23 A;  1OUV A;  3ASG A;  3CHR A;  1KT0 A;  5HI7 A;  4OVV A;  1WM5 A;  3PZD A;  4EZL A;  3IHY A;  2LO6 A;  3L16 A;  4U0U A;  5T3R A;  2IJG X;  3PRZ A;  4LER A;  1OWN A;  4CDM A;  4MRU A;  2CHW A;  3L6A A;  1KT1 A;  4FC8 A;  4EZJ A;  1UW4 B;  2IOS A;  4PDX A;  3ZPJ A;  3ZYL A;  2PZI A;  3LPZ A;  4XKB A;  3RRU A;  1INZ A;  4JVS A;  3QJZ A;  2LAH A;  3QOU A;  5BUZ A;  4BY6 A;  4UQY A;  3BG1 B;  5E76 A;  5FQ7 A;  3PRE A;  2IOL A;  3UT8 A;  4L7T A;  4GB9 A;  3QB2 A;  4JL0 A;  3FTV A;  2VGX A;  4AV7 A;  3TG5 A;  3RU0 A;  2KCV A;  1LF8 A;  3QK0 A;  3FTU A;  4IN3 B;  3SBS A;  1WY6 A;  4EBA G;  5BNW A;  3AS5 A;  4XZ4 A;  2WXH A;  3FUI A;  3CHS A;  3CK9 A;  4P29 A;  4BT8 A;  4AVX A;  1EYH A;  2AXU A;  5FZR A;  3DBS A;  4I6E A;  1E90 A;  4KXK B;  4PUC A;  3ASH A;  5KJM A;  3FEX A;  2PQN A;  3VLF A;  3ZRH A;  1HFA A;  2VSO E;  2KZT A;  1QNF A;  4DI4 A;  1E8W A;  4GYO A;  5ARG A;  5G05 J;  3S7J A;  3CST A;  2J08 A;  4YVQ C;  4Q69 A;  2I2O A;  3ONK A;  1Y8M A;  3SFZ A;  4A55 A;  1FCH A;  4RVB A;  3UMV A;  1L5J A;  1PAQ A;  3C98 A;  3PNL B;  4ME2 A;  4KVO A;  4GML A;  3T8M A;  4BT9 A;  2R5S A;  2WMO A;  3SNX A;  2Y4T A;  1NA3 A;  2KM4 A;  5AJL A;  3LEW A;  3UQ3 A;  4XIF A;  4CDR A;  3TL5 A;  3ZGQ A;  5CMW A;  3O48 A;  3NZU A;  3NQP A;  4WWO A;  2WB2 A;  4CGV A;  3L08 A;  3D9M A;  4WNG A;  2Q7F A;  4CDN A;  4TV3 A;  4EQF A;  3AS8 A;  4JZY A;  3ZVV A;  1EF1 C;  5EDS A;  4H7X A;  4I6G A;  3MEK A;  3TAX A;  3SBT B;  2UY1 A;  2IFU A;  2WXO A;  3GYZ A;  4JPS A;  1H2T C;  1EDU A;  3JCK C;  3BG0 B;  4NRH B;  3Q15 A;  4TUU A;  4J0U A;  3T5V A;  3CHQ A;  1Y6I A;  2CHZ A;  3LVR E;  4B89 A;  4Y6W A;  4CT0 A;  4HOR A;  4HFG A;  4GMJ A;  4I9C A;  2JLB A;  4BX8 A;  5EX3 A;  4WNF A;  2HO1 A;  1H6K A;  1HG5 A;  2UWJ G;  4N3B A;  2ZU6 B;  4AJW A;  4G23 A;  4A1G A;  4GCO A;  1PC2 A;  3RRN B;  3FTW A;  3CR3 A;  2PM6 A;  4FJZ A;  4UWH A;  4XKC A;  1ELW A;  1HU3 A;  4JHR A;  5KCM A;  4G1T A;  4OYS A;  3PVL A;  2L0T B;  4WNE A;  3CVQ A;  2HYZ A;  2XQ0 A;  4APO A;  1SZA A;  3UUX A;  3VLD A;  1FVF A;  1ELK A;  3CV0 A;  4XI0 A;  3FU0 A;  3QC1 A;  5A7D B;  3ZIM A;  2A5U A;  3PUK A;  3ML9 A;  4Y6C A;  2P58 C;  4CEM A;  4GZD A;  3U3W A;  3EHN A;  3FUK A;  2E2E A;  4JEU A;  2Y3A A;  5LCW J;  5CMY A;  2FUL A;  3CIA A;  2CFU A;  5G05 C;  3ULQ A;  4MS6 A;  4BTB A;  3JQ1 A;  4I2Z A;  4ANV A;  1ZBP A;  4LCT A;  3FHE A;  2KAT A;  1BPO A;  1HG2 A;  3CQG B;  3ZYQ A;  2V0P A;  1A17 A;  3CQC B;  3HVE B;  4JW1 A;  4EEC A;  4JXT A;  2XPZ A;  3CVU A;  3NF1 A;  5FQ6 A;  1QZ2 A;  1MQS A;  4UI9 K;  3FUF A;  3E4B A;  3I3N A;  4U8H A;  4N2Q A;  3G2S A;  5BV0 A;  4JC8 A;  1NZN A;  3R7R A;  2WXP A;  4KMO A;  3QDN A;  3R7Q A;  3CEQ A;  4L2L A;  3UX4 A;  3GZ1 A;  2XRZ A;  4ILI A;  3TG4 A;  3FUM A;  1UJJ A;  3FUJ A;  4IUL A;  4N5C A;  4GZ3 A;  4G24 A;  3L13 A;  4GPK A;  4YND A;  3N71 A;  4DLO A;  3ML8 A;  4DJA A;  2FBN A;  2I1K A;  3S7D A;  4A3T A;  1OWM A;  1FVH A;  2OOE A;  3WXX A;  1S0P A;  1XNF A;  3U9W A;  2AVP A;  2KC7 A;  5FJY A;  2X6H A;  3QAR A;  3CVY A;  2DBA A;  2AWI A;  2Y4U A;  4L2Y A;  3OTN A;  3CK7 A;  1IYG A;  3Q47 B;  4L23 A;  4D10 C;  4UWK A;  2I6H A;  4I43 A;  5LOZ A;  5ANR A;  3PH0 C;  2OVF A;  4B0Z A;  3GZS A;  4JA9 A;  5JHA A;  4U63 A;  4FA6 A;  4APF A;  3L22 A;  2J4B A;  4GZC A;  4HXI A;  3LYA A;  2LSU A;  5A6C A;  3B7R L;  4KT6 B;  3D9N A;  3LXU X;  3MJW A;  3KD7 A;  5BPP A;  4UQX A;  2WXR A;  4B94 A;  4J8S A;  4JA7 A;  3CVX A;  3HYM B;  2L0I A;  5HQ8 A;  4WND A;  4ACK A;  5AEN A;  2J4D A;  3LVQ E;  4F1S A;  4ANU A;  3EIJ A;  2CHX A;  5FWQ A;  5T8I A;  3CVP A;  2XEV A;  4AIF A;  4DK5 A;  4K0R A;  2C0M A;  2JEK A;  4G2V A;  4A3V A;  4NUR A;  2WXK A;  3CLJ A;  5CHE E;  3ZEF A;  4E6H A;  1QQE A;  3AS4 A;  2X38 A;  2FO7 A;  3KS2 A;  4FHK A;  5D0Q D;  2E0I A;  4HOS A;  3QAQ A;  3VTX A;  4FUL A;  2OV8 A;  4J8D A;  1U3D A;  3L54 A;  5JHB A;  3FU5 A;  4RG6 A;  3I4R B;  2I9C A;  1H2U A;  3FTS A;  2WXL A;  5BV1 A;  4OVU A;  2WQ7 A;  3JQ0 A;  2J9Q A;  2WXF A;  4I6J A;  4U07 A;  3MV2 B;  3CHP A;  1ELR A;  2GW1 A;  2ION A;  3SF4 A;  3APC A;  3RRM B;  4HLE A;  2MHK A;  4QFV A;  4BTA A;  3FH5 A;  3PUJ A;  2X6J A;  3L17 A;  4HS2 A;  4CT4 A;  3SHF A;  4A1S A;  4U0S A;  1HZ4 A;  4L1B A;  2R17 C;  3CSF A;  3S7B A;  1X5B A;  1JWF A;  3Q5M A;  1DNP A;  5JJ6 A;  4GA1 A;  2WXM A;  1E8X A;  3GW4 A;  1Z3Y A;  4CRW A;  4UWG A;  3RIB A;  1Z6T A;  3LS8 A;  4DLQ A;  4HOU A;  4W9R A;  3CVL A;  2J49 A;  3HVE A;  3QWW A;  2VQ2 A;  2VSY A;  2OVB A;  3APD A;  3AU5 A;  3FWV A;  5LFA A;  5LP0 A;  2PM7 A;  3D9P A;  2BF0 X;  3FH8 A;  3FUD A;  2J09 A;  3D9L A;  1HX8 A;  4PH4 B;  3O4Z A;  2IQC A;  1H19 A;  2YIN A;  1Z3X A;  3TJP A;  3MYV A;  1N54 A;  2VSX E;  4MKT A;  3URZ A;  4ABN A;  3TXM A;  4F3V A;  4XE0 A;  2QY7 A;  4WWP A;  3FDH A;  3IEG A;  1E7U A;  3MCX A;  2L6J A;  4I1O B;  3CKC A;  3LDZ A;  4NAC A;  3ESL A;  4ANW A;  3MKQ A;  5D0O D;  2XRY A;  3B7T A;  2LAI A;  2YHE A;  2GRL A;  3B7U X;  4F7A A;  4JHJ A;  4LEU A;  3ZXS A;  2GGF A;  4WAF A;  2C2L A;  1JPL A;  5DIZ A;  4GAA A;  2EQX A;  2VTB B;  4HVB A;  1P5Q A;  3CGH A;  4BSX A;  5G04 J;  3APF A;  3R9A B;  4JHK A;  4K03 A;  2FI7 A;  1OWO A;  1XGW A;  4NQ0 A;  4Q96 A;  4V3I A;  3D9K A;  5CCM A;  3TGO A;  3ZW3 A;  2XPI A;  4GZ5 A;  5ENN A;  4Q94 A;  3LCA A;  3FY4 A;  4O6F A;  4DI3 A;  4YVO A;  5EX0 A;  3RJV A;  3JYS A;  3PE3 A;  3UPV A;  2YHC A;  4G25 A;  2XGO A;  4CGW A;  4KBQ A;  5J90 A;  3S7F A;  3ZHE B;  4AOF A;  2XGS A;  4E85 A;  3ZN3 A;  4I2W A;  4J8F A;  4KZC A;  4C0M A;  4KVM A;  1GW6 A;  3MKQ B;  3ZYM A;  4RG9 A;  4UWF A;  2WM9 A;  3SD5 A;  3U66 A;  3MV3 B;  3FUN A;  5J08 A;  3CVV A;  4H7Y A;  1E8Z A;  1UN9 A;  2X6F A;  1UN8 A;  4FHJ A;  4KYO B;  4AP2 A;  4UI9 J;  3FUL A;  4FAD A;  2L9B A;  2IU1 A;  2XGM A;  3FUH A;  3JUI A;  1E96 B;  2LSV A;  3FTZ A;  3KAE A;  2KCK A;  2XCB A;  2XPY A;  3ASD A;  5CCL A;  3HDX A;  2WXG A;  1ZU2 A;  4GYY A;  1H2V C;  4RSY A;  5AJD A;  3FTX A;  4GYW A;  3EHM A;  3ENE A;  3RO3 A;  3B13 A;  4BWR A;  1SZ9 A;  2FEZ A;  4U04 A;  4I1M A;  2MOW A;  4I1A A;  4TRQ A;  4ANX A;  2VYI A;  4C0E A;  4XI9 A;  4AY6 A;  4WUY A;  3QNK A;  1YA0 A;  4J8E A;  1OWP A;  5EKQ D;  4J6I A;  5ARF A;  3CVW A;  2IF4 A;  1NA0 A;  2WXN A;  2YQ8 A;  3ZYK A;  4FJY A;  4C9B B;  1JWG A;  2NSZ A;  4FLB A;  2BUG A;  5FT9 A;  5KJK A;  4JEH A;  5LCW C;  4GU5 A;  4F53 A;  1OWL A;  3FEY A;  3Q4A B;  4ILH B;  4IRU A;  3NZS A;  2PL2 A;  3G2U A;  3RO2 A;  3IV0 A;  4WWN A;  3EDT B;  2WPV A;  3MX3 A;  4N3C A;  2AXZ A;  3PE4 A;  4I9E A;  1N52 A;  5G04 C;  4BFR A;  4PS8 A;  2X6I A;  5BT1 A;  2RG8 A;  1E8Y A;  4GCN A;  3RK6 A;  3PEU B;  1IQR A;  2XCC A;  2VJ8 A;  2ILR A;  2MRI A;  3MKR A;  3PEV B;  2WMN A;  3OAW A;  3Q49 B;  3MGB A;  3T5X A;  4ACL A;  4G11 A;  3LKU A;  4EPZ A;  4HOT A;  4PS3 A;  5E75 A;  3U4T A;  3FU3 A;  1E7V A;  1U3C A;  3BEE A;  3HIZ A;  2FF4 A;  2AW6 A;  3ASF A;  3FUE A;  4G26 A;  1TEZ A;  3CK8 A;  2VGY A;  3S2A A;  2PQR A;  3D3M A;  3CHO A;  3ESK A;  4FP7 A;  3CKB A;  4EBA A;  2RD0 A;  4GZ6 A;  3SGH A;  2CG3 A;  3P1U A;  3G2W A;  2V4L A;  1TJF A;  3PDN A;  1HE8 A;  2OND A;  3CVN A;  3RKV A;  2WXJ A;  4FLH A;  1MHQ A;  2VGX B;  3LY8 A;  5FZS A;  4R7L A;  3CHM A;  1IHG A;  3UT4 A;  4AEZ C;  1H0A A;  2KCL A;  2VTB A;  4FU3 A;  4UI9 C;  2WXI A;  2I1J A;  4GA2 A;  4B8C B;  2YNQ A;  5G55 A;  1WAO 1;  3ONL A;  4EZK A;  4ILG A;  1HF8 A;  2WQ6 A;  5FQ4 A;  3UT7 A;  2KZT B;  5BW8 C;  2R59 A;  4N39 A;  2GRM A;  2X6K A;  3I5P A;  4GA0 A;  4M3O A;  3EIQ C;  3D9I A;  4IYP A;  4MLP A;  3OXL A;  2HR2 A;  1W3B A;  5ANL A;  5FQ8 A;  3SZ7 A;  1SQM A;  3KEZ A;  2A4Z A;  2VSN A;  1UG3 A;  2WVI A;  1TJC A;  1VDY A;  3EJN A;  3FP3 A;  3GZ2 A;  1B89 A;  3ZHE A;  5AIJ A;  4UQZ A;  5KJN A;  3U64 A;  5T4Y A;  3OXG A;  4LRZ A;  3HHM A;  4AXH A;  4PS7 A;  2C0L A;  3LJ3 A;  5C2Y A;  2BTD A;  4LUN U;  3PNT B;  4AM9 A;  1HO8 A;  3QWV A;  4N2S A;  3OXF A;  2WQH A;  3D9O A;  5M72 A;  3IKO B;  3G2V A;  3LY7 A;  2NXP A;  2XHE A;  4KZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...