1IYGA

Solution structure of rsgi ruh-001, a fis1p-like and cgi-135 homologous domain from a mouse cdna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
b'GSSGSSGMEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein (2010003O14)
publication title Solution structure of RSGI RUH-001, a Fis1p-like and CGI-135 homologous domain from a mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 41
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1iygA00
4YVOA 3U3WA 4U04A 2E2EA 4GA1A 2NC9A 4BTBA 3MEKA 2BUGA 3CEQA 5A7DB 2FF4A 3S7BA 4N3AA 2QFCA 3U4TA 4I9CA 1HXIA 2HYZA 3AS4A 2KCLA 2KATA 2Y4UA 4ABNA 3FP3A 3ZGQA 2V5FA 3Q5MA 4U0ZA 5CCMA 1KT1A 5FZSA 3Q4AB 2KCVA 4Y6CA 5LCWC 3CV0A 4JHRA 4KYOB 5FTPA 4AM9A 5BW8C 4AIFA 1QQEA 4HORA 2Q7FA 2FBNA 3R9AB 4G2VA 5M72A 4I9EA 2WQHA 5G05C 4JA9A 4GZ3A 1IYGA 4I2ZA 3PDNA 3QDNA 3UUXA 4HOSA 4U0SA 3HYMB 3UPVA 4GA2A 2GW1A 4JA7A 2IFUA 3CVPA 1ZU2A 1FCHA 1HH8A 5DBKA 5KJKA 4CGWA 2XGSA 2I6HA 5EKQD 4N39A 3Q47B 2WPVA 2C0MA 1XNFA 3RKVA 2AVPA 4WUYA 4G24A 4N3CA 1NA0A 3GW4A 3EDTB 5KJMA 4UI9J 5FZQA 3OXGA 4XI9A 3KS2A 2XGOA 3CKCA 2VYIA 1ELRA 3O48A 2IF4A 4W9RA 3RO2A 2VGXA 2XCBA 4G26A 5KJNA 3UQ3A 4CDRA 3ASFA 4GPKA 1WM5A 4N2SA 4J8FA 2XEVA 3CVQA 3LPZA 4B94A 4A1SA 5C1DA 4WNEA 2J9QA 2P58C 2VQ2A 3SF4A 3QKYA 5G04C 3ZFWA 4GYOA 2VGXB 3ULQA 4AY5A 3QWWA 4NRHB 4GCNA 2OOEA 3CK7A 3IEGA 3WXXA 3RU0A 4BTAA 3LYAA 3LCAA 4J8EA 2L6JA 2PL2A 4EQFA 5ARFA 2JLBA 3AS8A 5D0OD 4H7YA 3Q49B 5HQ8A 3GYZA 3KD7A 1TJCA 2Y4TA 3CK9A 4UQZA 4APOA 4G1TA 4J0UA 2UWJG 3LY9A 2FEZA 1IHGA 2LNIA 3CKBA 5FZRA 3GZ2A 5ARGA 5BT1A 4F3VA 4BT9A 3LKUA 3MV2B 3ASGA 1KT0A 2FO7A 3S7DA 3QWVA 5JJ6A 2XCCA 4YNDA 3ZPJA 2C0LA 5CHEE 1B89A 3N71A 4GA0A 3CK8A 3FFLA 4GYWA 3ASHA 1WAO1 3ZHEA 4AY6A 2XPIA 2R5SA 2UY1B 3MA5A 3TG4A 2C2LA 4I2WA 4G25A 4XI0A 4ME2A 5DIZA 3KAEA 1ZBPA 3TAXA 5FJYA 2HO1A 4GCOA 5LCWJ 3S7JA 3RIBA 5CCLA 3ZN3A 3SZ7A 2XGMA 5HI7A 3GZ1A 4GYYA 3ZHEB 5BNWA 4O6FA 5KJLA 4KBQA 3TGOA 5G05J 4NQ0A 4WNFA 4KXKB 2HR2A 4WNDA 3VTXA 4UI9C 4UI9K 4WNGA 5A6CA 1W3BA 4H7XA 1QZ2A 3LY8A 1NZNA 5FT9A 4CGVA 4I1AA 3S7FA 1KLXA 3AS5A 4N2QA 1OUVA 4U0UA 4UQXA 3BEEA 2VSNA 1HZ4A 4IN3B 3OXLA 3NF1A 3JYSA 4GZ6A 4G23A 4N5CA 3PE4A 4N3BA 2PQRA 1ELWA 3ESKA 1NA3A 4JL0A 3ASDA 3K9IA 2KCKA 4RG9A 4UQYA 3CVNA 2VGYA 5JJTA 3RJVA 4J8DA 5AYWD 5EX3A 1YA0A 2ONDA 2MHKA 3E4BA 2UY1A 3TG5A 2YHCA 5EX0A 2DBAA 2VSYA 4Y6WA 3QWPA 3QOUA 2PZIA 2LSVA 3VTYA 3URZA 4LEUA 3FWVA 3LY7A 4GZ5A 1PC2A 3OXFA 1Y8MA 3PE3A 4XIFA 4HOQA 2KC7A 4RG6A 1E96B 4BWRA 4BT8A 3RO3A 2FI7A 4I17A 3Q15A 1P5QA 4YVQC 5G04J 2LSUA 4HOTA 4HOUA 3MKRA 4U07A 2YQ8A 2PQNA 3CVLA 5D0QD 1A17A 3MV3B 5JJ7A
chains in the Genus database with same CATH superfamily
4U04A 4C48B 4ANVA 3HXBA 3TWSA 2F0YA 1RZ4A 3P1UA 2J4BA 2FF4A 4GZCA 2DZNA 3U4TA 3APFA 4I9CA 5AN8A 2HYZA 2DIWA 3FTYA 3TL5A 4JXTA 1N95A 2KATA 2Y4UA 4A3VA 3ZGQA 1IXVA 4XZ4A 4U0ZA 4X8QA 2ETAA 5CCMA 4NIKA 1N54A 4Y6CA 1MZCA 3I3NA 3CV0A 3OAWA 3DWLG 4JHRA 1RW2A 5FTPA 4ILHB 5BW8C 4WWOA 2A4ZA 3DXKG 2Q7FA 4B8AA 3NB2A 1KZOA 2KZTB 1PY1A 3DEOA 3ML8A 1JCSA 4G2VA 2IONA 3SI5A 3FHEA 3L16A 5J08A 3BUAA 4GZ3A 2XS8A 3DEPA 3PDNA 5JHBA 4HFGA 4XEIG 3E37A 4U0SA 4G11A 4LCTA 1Y6IA 4OVUA 3AG4E 4JA7A 2WXKA 3CVPA 3R7QA 4MS6A 2WXQA 4JB8P 3TWTA 4F6RD 2I2OA 4CGWA 3CHSA 4F53A 4TXQA 3CHOA 5EKQD 2WXGA 2LXMA 5FQ4A 4N39A 3Q47B 3FUMA 1OT8A 1XNFA 2L6BA 3ESLA 2Y0BG 2AVPA 4N3CA 1O1RA 3GW4A 3I5PA 1N4RA 4DI3A 3IXEA 5J90A 4A55A 3CVWA 2CG3A 1X5BA 4HRMB 2ETBA 3UXGA 4UWGA 2XZTG 2XCBA 3CGHA 1X81A 5CRVA 2XPYA 3B7UX 3V30A 4FLBA 3DSSA 2L0IA 4J8FA 2X6IA 1IQRA 1N0QA 1U3CA 5LX8A 5C1DA 2I1JA 4DI4A 4WNEA 3Q7AA 5T8IA 3HVEA 3Q9UC 3QKYA 5G04C 2YHEA 2L0TB 3QWWA 4NRHB 4Q94A 2XZDG 2OOEA 3AG2E 1BI7B 3WXXA 2M63A 1YMPA 3QNKA 2LXLA 4BTAA 4JZYA 4GPMA 2R03A 3CSFA 3JUIA 3B95A 4LUNU 4AXHA 3FUIA 4EQFA 2JLBA 3AS8A 4C0MA 4H7YA 2B0OE 4Z68A 3MKQA 4JEHA 5G2NA 2AXZA 3PVLA 2QC9A 4G1TA 2MYOA 4YDEA 2VSOE 2UWJG 5FZRA 2CHZA 5CMWA 4ZFHA 5ARGA 4F3VA 4PUCA 2PNNA 4IRUA 4ZHBA 1DC2A 2GGFA 1NP7A 3D9NA 3CSTA 1KT0A 5JJ6A 5KNHD 3ZPJA 3CVYA 5JA4D 3G2SA 1U2VG 3LDZA 1B89A 3L08A 5E75A 4GA0A 3CK8A 5AQBA 3ASHA 4CRWA 4NACA 1IHBA 2Y3AA 5FQ8A 5CRUA 4GU5A 3MA5A 3QJZA 4M7CA 5CBOA 2WVIA 1Z3XA 2C2LA 2NXPA 4GTTA 4G25A 4RSYA 2BF0X 4ME2A 4FULA 4GTRA 3EUVA 5LCWJ 5CCLA 2E0IA 2IO3C 3FTWA 1Z5SC 3LVRE 4HQDA 3D9MA 5KJLA 1NL4A 1H2VC 1INZA 4KVOA 4NQ0A 5CBNA 3NOGD 2HR2A 2DVWA 2DCPA 4UI9K 4WNGA 1JUQA 2XHEA 5A6CA 1W3BA 1EYHA 1N52A 4NURA 4OYSA 5ENQD 3VLDA 2VJ8A 1SA4A 4N2QA 4I6JA 4UQXA 2VSNA 3V2OA 1HZ4A 4IN3B 4K5CA 2MRIA 5EYLA 3ABLE 4N5CA 3B7TA 3NZSA 4O1OA 1JWFA 1ELWA 3SFZA 5A23A 3FEXA 2P9IG 4KZ0A 4UQYA 3CVNA 4FHKA 2P9UG 3FU6A 2VGYA 3CR3A 5JJTA 1TYQG 4BERA 1HU3A 5EX3A 3V79K 2ONDA 2QYJA 5ENPD 1IQUA 2YHCA 4AVXA 2VTBB 5T3RA 2EINE 5AQAA 2H6IA 5ENOD 4EZLA 1OWOA 4LEUA 3SNXA 3LY7A 3FUEA 3CVVA 3IBEA 5ENRD 4F1SA 3PE3A 4XIFA 3T8KA 4J6IA 3ML9A 5IY5E 4HBDA 4BT8A 2FI7A 1OXJA 3ZYQA 1P5QA 1PAQA 2F37A 2AXUA 2XPZA 3FY4A 4KZCA 4Q96A 2J4DA 4U07A 2YQ8A 2PQNA 3ONLA 3ZYMA 3PEUB 1LTXA 2GRRB 4XKCA 1N9AA 3FH7A 3UM0A 3G2UA 4AJWA 2WXLA 1FPPA 3PUKA 3CEQA 3IV0A 5A7DB 4CCAA 4N3AA 1E7VA 2WQ6A 2QFCA 2LAIA 1E8WA 3ZKJA 3FU3A 1D8DA 1K1BA 4U8HA 3FU5A 5CEAA 4ABNA 3FP3A 3C3RA 2XEEA 1K1AA 2GRQB 3L82A 5FZSA 2WM9A 5HKPA 4GTQA 4EECA 4EBAA 4BX8A 5LCWC 2WXNA 1O1SA 4K5BA 5HS0A 4CDMA 3HXDA 4AM9A 1YYHA 2CHWA 2FBNA 3R9AB 2XRYA 5M72A 2EIJE 2OCCE 4U95D 2CG2A 4I2ZA 3QDNA 4TXRA 3FTXA 4RQIA 4HOSA 2J07A 3HYMB 2AW6A 3NAWA 4GAAA 1MX4A 3LJ3A 1HO8A 2GW1A 4HLEA 4GTOA 1VDYA 1ZU2A 1FCHA 1HH8A 2R05A 5DBKA 1MHQA 3RAUA 1BPOA 4PS3A 3D9IA 4DX5D 4Q69A 3ABKE 4JD2G 3QAQA 1NI1A 3RKVA 3UINC 3ULEG 3E32A 3PRZA 4JVSA 2F8XK 4UI9J 2V0PA 3TWRA 3AG3E 4GZDA 2XGOA 2KXPC 2VYIA 2ZISA 3O48A 4FADA 5JHAA 2IF4A 4BETA 3NQPA 3SO8A 4APFA 4J8SA 5KJNA 4K0RA 4I1MA 5CEDB 3ZIMA 2XEVA 4N5QA 3CVQA 3EIQC 2KZTA 3W9FA 3FH5A 3LPZA 3DRAA 2J9QA 4WAFA 2VQ2A 5ENTD 2WXRA 4GTMA 3U9WA 5B1BE 5BUZA 1N4QA 3RK6A 1JPLA 3PH0C 2XENA 3PREA 1KZPA 2IJGX 4GCNA 2HE0A 1HS6A 5EYPF 3ULYA 3RU0A 2V8SE 5CERB 3LYAA 4RVBA 2WXFA 2XRZA 2P9NG 3FUKA 1WDYA 5EIBE 2FO1E 4JHKA 4TRQA 5ARFA 1XGWA 3J5PA 3ZVVA 1QNFA 5HQ8A 3KD7A 2Y4TA 1H6PA 4LNGA 3EHRA 3CK9A 4APOA 4ACKA 3UM1A 2OEWA 4KMOA 3G2WA 2WXPA 1IHGA 2LNIA 4MLPA 5FQ6A 3CKBA 3L17A 4HB5A 4RLYA 4U8YD 4DX2A 1TNZA 5BXUA 4OAVB 3CQGB 3LKUA 1HF8A 1S64A 3T5VA 4M3OA 1OCOE 2C0LA 3CIAA 3DXMG 3KEZA 3ASOE 3PEVB 4L23A 5BV1A 1L5JA 3FFLA 2EQXA 1WAO1 2WXMA 3KSLA 3QARA 3ZHEA 4QFVA 3C3QA 1SW6A 2J8SD 3FTUA 5BPPA 4XI0A 2J08A 4ILGA 5FJYA 5AQ9A 3VLFA 4XE0A 3S7JA 1LF8A 3ISMC 3MJWA 2GROB 2XGMA 3SD5A 3WG7E 3ZHEB 4JW1A 2LO6A 1YCSB 2PM7A 3BG1B 4KBQA 2CFUA 4HVBA 5EN5D 4CEMA 2QYUA 4KXKB 4WNDA 3IKOB 3VTXA 4UI9C 2XQ0A 5EIDA 4H7XA 4ANWA 1E8XA 4EZJA 2H6HA 3PS6A 2A5UA 4CGVA 4I1AA 3AS5A 2IU1A 1OUVA 4PS8A 3ZNGA 3UTMA 3D9JA 2VGEA 3L6AA 4GTPA 4GZ6A 3HXCA 4MKTA 3UIOC 4GTVA 3ESKA 1NA3A 5G55A 1S0PA 3ASDA 4EZKA 2P9PG 5AYWD 1YA0A 5FINA 2MHKA 2X6JA 5AJLA 3E4BA 3Q75A 4PS7A 3ZYLA 4O60A 3TG5A 4Y6WA 2RKKA 4JEUA 2PZIA 4R7LA 3URZA 5AAOA 3FWVA 3SGHA 1UG3A 5ENSD 3MYVA 3EHQA 2QZAA 3Q7FA 1TNOA 2X38A 2DYRE 4IYPA 2J09A 4RG6A 2DWZA 1E96B 4V3IA 1AP7A 3RO3A 3DSVA 4UWLA 4EPZA 2WB2A 4I17A 3Q15A 3GZSA 3W9GA 1SZAA 4GMJA 2KM4A 4YVQC 4JC8A 2V5QC 2LSUA 5CECB 1BD8A 5D0QD 3R9MA 1TEZA 4UUCA 1S70B 3MV3B 5JJ7A 5LP0A 1ELKA 3Q73A 4YVOA 1UW4B 1EDUA 3SQVA 2OVBA 3RSEG 4BSZB 2ZIRA 1N4SA 2BUGA 3S7BA 2QY7A 2XEHA 3MGBA 1H2TC 5B1AE 3AS4A 3I4GA 1H0AA 1BI8B 3CQCB 4UWHA 4U8VD 4IULA 1FT2A 1LD7A 2RFMA 2RFAA 1UN8A 3ZW3A 3U64A 1MX2A 3Q4AB 2KCVA 3AG1E 4K03A 5KCMA 1SZ9A 4I6EA 2BEDA 4BFRA 2VTBA 4KYOB 1UJJA 2I1KA 4HORA 3HIZA 4FP7A 1GW6A 4F1PA 4FLHA 4B89A 4C9BB 4I9EA 2WQHA 4JA9A 2ETCA 3QC1A 3UUXA 4FA6A 2CHXA 3D9OA 3ZU7B 2Y69E 2YNQA 3UX4A 4GA2A 1O1TA 2IFUA 3JQ1A 5AIJA 5AARA 2WXIA 1DCEA 2Y1LE 3AU4A 5KJKA 4DJAA 4CDNA 2XGSA 1D8EA 2I6HA 4A3TA 1OWMA 2WPVA 3UKRG 4F7AA 4WUYA 1NA0A 2IOLA 3EDTB 4EHMA 5FZQA 3OXGA 3JQ0A 3SBTB 2EILE 3KS2A 1OWPA 1FVHA 1O5MA 2LUHA 4DRXE 3RO2A 2VGXA 5AJDA 4G26A 3UIPC 2IO2C 1AWCB 4GPKA 1WM5A 3B13A 3MX3A 3HDXA 3HRAA 3FUDA 3EHMA 2IQCA 4DPRA 3CLJA 3APDA 4A1SA 3C98A 4AOFA 4HRNA 3DPDA 4G8LA 5BV0A 2VGXB 1MQSA 3UM3A 3ZEFA 5FWQA 4DX6D 3DSUA 1TNYA 2EIME 2WMOA 3CK7A 3ONKA 2P9KG 3FUHA 1EF1C 3KSQA 2X6HA 5KBAA 3LCAA 2PL2A 3FH8A 3D9LA 4YDOA 5AQ7A 1OCCE 1SQMA 5EILA 3QK0A 3IHYA 1MX6A 3GYZA 2GRPB 4BESA 4FHJA 4UQZA 4MBGA 1MJ0A 4LNUD 3LY9A 3FUFA 4O1PA 4BY6A 3CHRA 4CT4A 3APCA 4L2YA 4ACLA 3LEWA 4GMLA 3MV2B 1OY3D 2AJAA 3ASGA 3BQOA 2FO7A 2V4LA 2XCCA 2V4HC 3J5QB 3O4ZA 5CHEE 1OCRE 2WXOA 1HX8A 2L9BA 3AU5A 4CT0A 4OVVA 4TUUA 3S2AA 3EIJA 1UN9A 4GYWA 4CYMD 1WY6A 3FUJA 3HG0D 4AY6A 4LSZE 4C0EA 3E34A 4LNBA 2R5SA 2UY1B 4I2WA 3UMVA 4ANXA 1TR4A 2ILRA 1TJFA 5DIZA 3KAEA 5C2YA 4EBAG 2NYJA 2HO1A 4GCOA 3HXEA 2IY0C 4L7TA 1E8ZA 3GZ1A 1S63A 3U66A 1TNBA 4GYYA 5BXOA 3EJNA 5HRYA 3FU0A 4ATZD 1E90A 1MYOA 4O6FA 3B7BA 5EDSA 5G05J 1OCZE 5FIOA 2WQ7A 3UT7A 4WWNA 5AENA 3LS8A 3FEYA 3UM2A 3IHVA 1QZ2A 3NBNB 1NZNA 1ZB1A 1TNUA 3L9TA 5FT9A 3S7FA 1KLXA 3V31A 3X2QE 3FDHA 3L22A 2XS1A 3BEEA 3OTNA 1OWLA 2RG8A 3JYSA 4G23A 4N3BA 3BG0B 4DUIA 2PQRA 2ZU6B 3R7RA 2KCKA 2MOWA 2RD0A 1K3ZD 1Z3YA 3CVXA 3L54A 4GTSA 1TN8A 2CFZA 1HFAA 2R02A 3TWWA 1H2UA 1N94A 5EX0A 3C5RA 2VSYA 3QWPA 4G8KA 3PNLB 3QOUA 4K5AB 1V55E 1JCQA 2LSVA 3ABME 1N0RA 4DX1A 3G2VA 4BEPA 1PC2A 3OXFA 1Y8MA 4HOQA 3I4RB 3D9KA 4B93B 4BWRA 1Z6TA 3KEAA 1H6KA 4DLOA 3PNTB 4D10C 2JEKA 3MKRA 2R59A 5D2MC 2ZGDA 1DVPA 1E8YA 3D9HA 3HHMA 5ITZF 3U3WA 2E2EA 3HXFA 4BX9A 4GA1A 3CVUA 3SFXA 4BSXA 2NC9A 4BTBA 3MEKA 3C3OA 4ANUA 1HXIA 2R2LA 1UJKA 2KCLA 2OV8A 4B0ZA 1LD8A 3TWQA 1TN7A 3LXUX 5ANRA 3AJIA 2V5FA 3Q5MA 2GRMA 1A5EA 3TWXA 1KT1A 3PZ4A 4KT6B 4DK5A 4I1OB 2OVFA 3E30A 5E76A 5JMND 2FULA 4TUMA 4AIFA 3E33A 3NOCD 1QQEA 3PUJA 4L2LA 4JPSA 4HLLA 2HM8A 1BLXB 1U3DA 3DSXA 1EPUA 3TWVA 3PZ2A 5G05C 3V2XA 4DLQA 1IYGA 3JXIA 3HVEB 2BKGA 1UOHA 3UPVA 2H6FA 3JXJA 4I6GA 4LERA 2YINA 1KPSB 3B7RL 2IEJA 4QQIA 1JCRA 3FUNA 5LFAA 2WXJA 4FJZA 2C0MA 3MKQB 4YDYA 3SY2A 4G24A 3UI2A 5T4YA 5KJMA 1NFIE 2X6KA 4XI9A 2JABA 3CKCA 4XKBA 2AWIA 1H19A 1DCQA 3C72A 1ELRA 4J8YA 2P9SG 3EU9A 3EU5A 2LAHA 4HXIA 4W9RA 4PH4B 5LOZA 4FJYA 3UQ3A 2EIKE 4CDRA 4P29A 3SBSA 3ASFA 4YDWA 1BU9A 5FQ7A 4N2SA 4U96D 3TXMA 3FTSA 4WWPA 1FT1A 4XX5A 2GRNB 3RRNB 3FULA 4B94A 4CZ2D 5KWDA 4GMRA 4LG6A 4AV7A 2P58C 3NZUA 3SF4A 4TXPA 3ZFWA 4GYOA 3ULQA 4AY5A 2B6CA 4HRLA 3IEGA 2OEVA 1OWNA 3LVQE 1DNPA 2IOSA 4UWFA 3UKUG 4J8EA 4U63A 2L6JA 1G3NB 4GB9A 4HI8A 4HNAD 5D0OD 3Q49B 2ZXWE 3JUEA 1TJCA 1QYMA 3D3MA 4L9PA 2PM6A 3Q79A 3EHNA 2P2CP 4J0UA 2FEZA 3TXNA 4LRZA 1N4PA 3Q78A 1TN6A 3GZ2A 5BT1A 4AEZC 3PZ3A 4BT9A 5B3SE 3ZRHA 3TJPA 3P2BA 2H6GA 3S7DA 3DBSA 4E85A 3QWVA 2BKKB 4YNDA 5CMYA 1D9SA 3N71A 1IKND 4A1GA 2XPIA 3T5XA 2DZOA 5KNGA 2I9CA 3T9KA 3TG4A 4OAUC 3CHPA 1Q2ZA 1ZBPA 3TAXA 1WG0A 3RIBA 2KBXA 3ZN3A 3ZYKA 4J7WA 3SZ7A 5HI7A 3ZXPA 2WMNA 1SVXA 2BTDA 3BU8A 3ENEA 3LJNA 1FVFA 2X3MA 5BNWA 4HS2A 3TGOA 4KVMA 3RRMB 3CHQA 4WNFA 2NSZA 4HI9A 1K8KG 4TV3A 3UT4A 2A5EA 4U7EB 2ZGGA 3QB2A 3LY8A 2AXVA 3ASNE 3AAAC 3B7SA 4FU3A 2X6FA 1V54E 5H7PA 3UT8A 3SFYA 3PZDA 4U0UA 5D66A 3ZUVB 3TWUA 3OXLA 4AP2A 3FTVA 3NF1A 3G2TA 4A63B 4JHJA 3PE4A 2F8YA 5ANLA 3FTZA 2R17C 3JCKC 3PZ1A 4L1BA 4I43A 4ATGA 2GRLA 3F6QA 4JL0A 1H6OA 1HE8A 3K9IA 4RG9A 1JWGA 3D9PA 2J49A 4UWKA 2VSXE 3RJVA 4J8DA 3T8MA 4PDXA 1HG2A 4B8CB 3Q9NC 2UY1A 3ZXSA 4FC8A 4URKA 3CHMA 3SHFA 1SA5A 2DBAA 4DX7D 3DSTA 3VTYA 4MRUA 3L13A 4GZ5A 1E7UA 1HG5A 3DSWA 4E6HA 2KC7A 1QBQA 2WXHA 2DYSE 3MZLB 2P9LG 3MCXA 1N11A 3VLEA 3DPYA 5G04J 4HOTA 4ILIA 4HOUA 5ENNA 3CVLA 3RRUA 1A17A
chains in the Genus database with same CATH topology
3ZYMA 1ELKA 5LP0A 4YVOA 3PEUB 1UW4B 3HHMA 3U3WA 4U04A 1EDUA 2E2EA 2OVBA 4XKCA 3FH7A 4ANVA 4BX9A 3G2UA 4GA1A 4AJWA 3CVUA 2WXLA 3PUKA 4BSXA 2NC9A 3P1UA 4BTBA 3MEKA 2J4BA 2BUGA 3CEQA 3IV0A 5A7DB 2FF4A 3S7BA 2QY7A 4N3AA 4CCAA 1E7VA 2WQ6A 4GZCA 4ANUA 2QFCA 3MGBA 3U4TA 3APFA 4I9CA 1H2TC 1HXIA 2HYZA 2DIWA 3FTYA 1UJKA 3TL5A 2LAIA 1E8WA 2KCLA 2OV8A 3AS4A 3I4GA 4JXTA 4B0ZA 2KATA 3FU3A 1H0AA 2Y4UA 3CQCB 4U8HA 4UWHA 3FU5A 4A3VA 3FP3A 3LXUX 5ANRA 3ZGQA 4ABNA 4IULA 4XZ4A 2V5FA 3Q5MA 4U0ZA 2GRMA 5CCMA 1UN8A 3ZW3A 1KT1A 3U64A 5FZSA 4KT6B 2WM9A 4DK5A 1N54A 3Q4AB 2KCVA 4I1OB 4K03A 4Y6CA 5KCMA 2OVFA 4EECA 4EBAA 1SZ9A 4I6EA 5E76A 4BX8A 3I3NA 4BFRA 5LCWC 2WXNA 3CV0A 3OAWA 2VTBA 4JHRA 4KYOB 5FTPA 4CDMA 2FULA 4AM9A 4ILHB 5BW8C 4AIFA 4WWOA 1QQEA 1UJJA 2A4ZA 2I1KA 3PUJA 4L2LA 4HORA 4JPSA 2Q7FA 4B8AA 2CHWA 2FBNA 3HIZA 2KZTB 4FP7A 1PY1A 2HM8A 3ML8A 1GW6A 3R9AB 2XRYA 4FLHA 4B89A 1U3DA 4C9BB 4G2VA 2IONA 1EPUA 5M72A 4I9EA 3SI5A 2WQHA 3FHEA 3L16A 5G05C 5J08A 4JA9A 4DLQA 4GZ3A 1IYGA 2CG2A 4I2ZA 3QC1A 3PDNA 3HVEB 3QDNA 5JHBA 4HFGA 3UUXA 4FA6A 3FTXA 2CHXA 4HOSA 2J07A 4U0SA 3D9OA 3HYMB 4G11A 2AW6A 4LCTA 2YNQA 3UPVA 4GAAA 1Y6IA 3UX4A 3LJ3A 4GA2A 4OVUA 1HO8A 2GW1A 4JA7A 2IFUA 2WXKA 3CVPA 3JQ1A 3R7QA 5AIJA 4I6GA 4HLEA 4LERA 4MS6A 2YINA 2WXIA 2WXQA 1VDYA 1ZU2A 1FCHA 1HH8A 3AU4A 5DBKA 5KJKA 2I2OA 3B7RL 1MHQA 4DJAA 3CHSA 4CDNA 2XGSA 4CGWA 4F53A 1BPOA 3FUNA 3CHOA 5LFAA 2I6HA 5EKQD 2WXGA 4PS3A 5FQ4A 3D9IA 2WXJA 4N39A 3Q47B 4A3TA 1OWMA 2WPVA 4FJZA 3FUMA 4Q69A 2C0MA 3QAQA 1XNFA 3ESLA 3MKQB 3RKVA 4F7AA 2AVPA 4WUYA 4G24A 4N3CA 1NA0A 3GW4A 2IOLA 3EDTB 3PRZA 4JVSA 5T4YA 3I5PA 5KJMA 4UI9J 4DI3A 2V0PA 2X6KA 5FZQA 5J90A 3OXGA 3JQ0A 4GZDA 3SBTB 4A55A 4XI9A 3KS2A 2XGOA 3CKCA 3CVWA 2CG3A 2AWIA 4XKBA 1H19A 2VYIA 1X5BA 1OWPA 1FVHA 1ELRA 3O48A 4FADA 5JHAA 2IF4A 2LAHA 4HXIA 4W9RA 4PH4B 5LOZA 3RO2A 2VGXA 4UWGA 3NQPA 4APFA 4FJYA 4J8SA 5AJDA 2XCBA 4G26A 5KJNA 3CGHA 3UQ3A 4K0RA 2XPYA 4CDRA 3B7UX 4P29A 4I1MA 3SBSA 3ASFA 4FLBA 4GPKA 1WM5A 3B13A 3MX3A 3HDXA 5FQ7A 4N2SA 2L0IA 4J8FA 3ZIMA 2X6IA 2XEVA 3TXMA 1IQRA 3FUDA 3CVQA 3EIQC 3FTSA 2KZTA 4WWPA 4XX5A 3RRNB 1U3CA 3EHMA 2IQCA 3FH5A 3FULA 3LPZA 4B94A 4DPRA 3CLJA 3APDA 4A1SA 5LX8A 5C1DA 3C98A 2I1JA 4DI4A 4WNEA 2J9QA 4AV7A 5T8IA 4WAFA 2P58C 2VQ2A 3HVEA 3NZUA 3SF4A 3QKYA 4AOFA 5G04C 2YHEA 3DPDA 2L0TB 2WXRA 3U9WA 3ZFWA 5BV0A 4GYOA 2VGXB 5BUZA 1MQSA 3ULQA 3RK6A 1JPLA 4AY5A 3ZEFA 5FWQA 3PH0C 3QWWA 4NRHB 4Q94A 3PREA 2IJGX 4GCNA 2OOEA 2WMOA 3CK7A 3ONKA 3IEGA 1HS6A 3FUHA 1OWNA 2M63A 3WXXA 1EF1C 2X6HA 3QNKA 3LVQE 2V8SE 3RU0A 4BTAA 3LYAA 1DNPA 4JZYA 4RVBA 2IOSA 2WXFA 4UWFA 3LCAA 2XRZA 3CSFA 3JUIA 4J8EA 4LUNU 4U63A 2L6JA 3FUKA 2PL2A 4AXHA 3FH8A 3D9LA 4GB9A 3FUIA 4JHKA 1SQMA 4EQFA 4TRQA 5ARFA 2JLBA 1XGWA 3AS8A 4C0MA 3QK0A 4H7YA 5D0OD 3ZVVA 3Q49B 3IHYA 1QNFA 5HQ8A 3GYZA 3KD7A 3MKQA 1TJCA 4JEHA 2Y4TA 3D3MA 5G2NA 2PM6A 2AXZA 3PVLA 4FHJA 3CK9A 4UQZA 4APOA 3EHNA 4ACKA 4G1TA 2VSOE 4J0UA 2UWJG 3LY9A 4KMOA 2FEZA 3FUFA 3G2WA 3TXNA 2WXPA 4LRZA 1IHGA 2LNIA 4MLPA 5FQ6A 3CKBA 3L17A 5FZRA 2CHZA 5CMWA 3GZ2A 4BY6A 3CHRA 4CT4A 5ARGA 5BT1A 4F3VA 4PUCA 4AEZC 3APCA 4L2YA 3CQGB 4IRUA 4ACLA 4BT9A 3LEWA 4GMLA 3ZRHA 3LKUA 1HF8A 3MV2B 3TJPA 2GGFA 3P2BA 1NP7A 3ASGA 3D9NA 3CSTA 1KT0A 3T5VA 2FO7A 3S7DA 2V4LA 3DBSA 4E85A 4M3OA 3QWVA 5JJ6A 2XCCA 4YNDA 3ZPJA 3CVYA 3O4ZA 3G2SA 2C0LA 5CHEE 5CMYA 3CIAA 3LDZA 3KEZA 1B89A 3L08A 3PEVB 4L23A 2WXOA 1HX8A 2L9BA 3AU5A 5E75A 4CT0A 1L5JA 5BV1A 4OVVA 4TUUA 3S2AA 3N71A 4GA0A 3EIJA 3CK8A 3FFLA 2EQXA 1UN9A 4GYWA 1WY6A 3ASHA 3FUJA 1WAO1 2WXMA 4A1GA 4CRWA 4NACA 2Y3AA 3QARA 3ZHEA 5FQ8A 4AY6A 4C0EA 4GU5A 2XPIA 3T5XA 4QFVA 2R5SA 2UY1B 3MA5A 3QJZA 2I9CA 3FTUA 3TG4A 5BPPA 2WVIA 1Z3XA 2C2LA 2NXPA 4I2WA 3UMVA 3CHPA 4ANXA 4G25A 2ILRA 1TJFA 4RSYA 4XI0A 2BF0X 4ME2A 5DIZA 3KAEA 4FULA 5C2YA 4EBAG 1ZBPA 2J08A 4ILGA 3TAXA 5FJYA 3VLFA 2HO1A 4GCOA 4XE0A 3S7JA 3RIBA 5CCLA 5LCWJ 2E0IA 1LF8A 3ZN3A 3FTWA 3MJWA 3ZYKA 3SZ7A 2XGMA 4L7TA 5HI7A 3LVRE 1E8ZA 3GZ1A 3U66A 2WMNA 4GYYA 3D9MA 3EJNA 3FU0A 1E90A 2BTDA 3SD5A 3ENEA 3ZHEB 5BNWA 1FVFA 2X3MA 4JW1A 4O6FA 5EDSA 5KJLA 4HS2A 2LO6A 3BG1B 2PM7A 4KBQA 2CFUA 4HVBA 3TGOA 4KVMA 1H2VC 3RRMB 5G05J 4CEMA 1INZA 4KVOA 3CHQA 4NQ0A 4WNFA 4KXKB 2NSZA 2HR2A 2WQ7A 4WNDA 3IKOB 4TV3A 3UT4A 2DCPA 3UT7A 3VTXA 4UI9C 4UI9K 4WNGA 4WWNA 5AENA 2XQ0A 2XHEA 1JUQA 3FEYA 3LS8A 1W3BA 5A6CA 3IHVA 4H7XA 1EYHA 1QZ2A 1N52A 3QB2A 1E8XA 4ANWA 4EZJA 3LY8A 1NZNA 5FT9A 2AXVA 4NURA 3B7SA 3PS6A 4OYSA 4FU3A 2A5UA 4CGVA 3VLDA 2X6FA 2VJ8A 4I1AA 3S7FA 1KLXA 3AS5A 2IU1A 3UT8A 4N2QA 3PZDA 1OUVA 4U0UA 3FDHA 3L22A 4I6JA 4UQXA 4PS8A 3BEEA 3OTNA 2VSNA 1HZ4A 4IN3B 1OWLA 3D9JA 3OXLA 4AP2A 3FTVA 3L6AA 2MRIA 3NF1A 3G2TA 2RG8A 3JYSA 4GZ6A 4G23A 4MKTA 4JHJA 3PE4A 3B7TA 3NZSA 4N3BA 4N5CA 5ANLA 3BG0B 2PQRA 2ZU6B 1JWFA 1ELWA 3FTZA 3SFZA 2R17C 3JCKC 3ESKA 4L1BA 4I43A 1NA3A 3R7RA 2GRLA 4JL0A 5G55A 4ATGA 5A23A 1S0PA 3ASDA 4EZKA 1HE8A 3K9IA 2KCKA 3FEXA 2MOWA 4RG9A 1JWGA 2RD0A 4KZ0A 3D9PA 4UQYA 3CVNA 2J49A 4FHKA 1Z3YA 3FU6A 2VGYA 3CR3A 4UWKA 2VSXE 5JJTA 3CVXA 3RJVA 4J8DA 3L54A 3T8MA 2CFZA 1HU3A 4PDXA 5AYWD 1HFAA 1HG2A 5EX3A 1YA0A 4B8CB 2ONDA 2MHKA 2X6JA 5AJLA 3E4BA 2UY1A 4PS7A 3ZYLA 3ZXSA 4FC8A 4URKA 1H2UA 1IQUA 3CHMA 2YHCA 3TG5A 3SHFA 5EX0A 4AVXA 2VTBB 2DBAA 2VSYA 4Y6WA 3QWPA 5T3RA 3PNLB 3QOUA 4JEUA 2PZIA 2LSVA 3VTYA 4R7LA 4MRUA 4EZLA 3URZA 1OWOA 4LEUA 3FWVA 3L13A 3SGHA 1UG3A 3G2VA 3LY7A 3SNXA 3FUEA 3MYVA 4GZ5A 3CVVA 1PC2A 3IBEA 3OXFA 1E7UA 1HG5A 4F1SA 1Y8MA 4E6HA 3PE3A 4XIFA 4HOQA 2X38A 2KC7A 3D9KA 3I4RB 4J6IA 4IYPA 2J09A 2WXHA 4RG6A 3ML9A 1E96B 4V3IA 4BT8A 1Z6TA 4BWRA 3MZLB 3RO3A 4UWLA 2FI7A 3MCXA 4EPZA 2WB2A 4I17A 3Q15A 3VLEA 3GZSA 1SZAA 4GMJA 3ZYQA 1H6KA 1P5QA 2KM4A 1PAQA 4YVQC 4JC8A 3PNTB 2LSUA 5G04J 4DLOA 4ILIA 2JEKA 4HOUA 4D10C 4HOTA 2AXUA 2XPZA 3FY4A 3MKRA 4KZCA 2R59A 4Q96A 2J4DA 4U07A 1DVPA 1E8YA 2PQNA 2YQ8A 3ONLA 5ENNA 3CVLA 5D0QD 3RRUA 1TEZA 1A17A 3MV3B 5JJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YVO A;  3U3W A;  4U04 A;  2E2E A;  4GA1 A;  2NC9 A;  4BTB A;  3MEK A;  2BUG A;  3CEQ A;  5A7D B;  2FF4 A;  3S7B A;  4N3A A;  2QFC A;  3U4T A;  4I9C A;  1HXI A;  2HYZ A;  3AS4 A;  2KCL A;  2KAT A;  2Y4U A;  4ABN A;  3FP3 A;  3ZGQ A;  2V5F A;  3Q5M A;  4U0Z A;  5CCM A;  1KT1 A;  5FZS A;  3Q4A B;  2KCV A;  4Y6C A;  5LCW C;  3CV0 A;  4JHR A;  4KYO B;  5FTP A;  4AM9 A;  5BW8 C;  4AIF A;  1QQE A;  4HOR A;  2Q7F A;  2FBN A;  3R9A B;  4G2V A;  5M72 A;  4I9E A;  2WQH A;  5G05 C;  4JA9 A;  4GZ3 A;  1IYG A;  4I2Z A;  3PDN A;  3QDN A;  3UUX A;  4HOS A;  4U0S A;  3HYM B;  3UPV A;  4GA2 A;  2GW1 A;  4JA7 A;  2IFU A;  3CVP A;  1ZU2 A;  1FCH A;  1HH8 A;  5DBK A;  5KJK A;  4CGW A;  2XGS A;  2I6H A;  5EKQ D;  4N39 A;  3Q47 B;  2WPV A;  2C0M A;  1XNF A;  3RKV A;  2AVP A;  4WUY A;  4G24 A;  4N3C A;  1NA0 A;  3GW4 A;  3EDT B;  5KJM A;  4UI9 J;  5FZQ A;  3OXG A;  4XI9 A;  3KS2 A;  2XGO A;  3CKC A;  2VYI A;  1ELR A;  3O48 A;  2IF4 A;  4W9R A;  3RO2 A;  2VGX A;  2XCB A;  4G26 A;  5KJN A;  3UQ3 A;  4CDR A;  3ASF A;  4GPK A;  1WM5 A;  4N2S A;  4J8F A;  2XEV A;  3CVQ A;  3LPZ A;  4B94 A;  4A1S A;  5C1D A;  4WNE A;  2J9Q A;  2P58 C;  2VQ2 A;  3SF4 A;  3QKY A;  5G04 C;  3ZFW A;  4GYO A;  2VGX B;  3ULQ A;  4AY5 A;  3QWW A;  4NRH B;  4GCN A;  2OOE A;  3CK7 A;  3IEG A;  3WXX A;  3RU0 A;  4BTA A;  3LYA A;  3LCA A;  4J8E A;  2L6J A;  2PL2 A;  4EQF A;  5ARF A;  2JLB A;  3AS8 A;  5D0O D;  4H7Y A;  3Q49 B;  5HQ8 A;  3GYZ A;  3KD7 A;  1TJC A;  2Y4T A;  3CK9 A;  4UQZ A;  4APO A;  4G1T A;  4J0U A;  2UWJ G;  3LY9 A;  2FEZ A;  1IHG A;  2LNI A;  3CKB A;  5FZR A;  3GZ2 A;  5ARG A;  5BT1 A;  4F3V A;  4BT9 A;  3LKU A;  3MV2 B;  3ASG A;  1KT0 A;  2FO7 A;  3S7D A;  3QWV A;  5JJ6 A;  2XCC A;  4YND A;  3ZPJ A;  2C0L A;  5CHE E;  1B89 A;  3N71 A;  4GA0 A;  3CK8 A;  3FFL A;  4GYW A;  3ASH A;  1WAO 1;  3ZHE A;  4AY6 A;  2XPI A;  2R5S A;  2UY1 B;  3MA5 A;  3TG4 A;  2C2L A;  4I2W A;  4G25 A;  4XI0 A;  4ME2 A;  5DIZ A;  3KAE A;  1ZBP A;  3TAX A;  5FJY A;  2HO1 A;  4GCO A;  5LCW J;  3S7J A;  3RIB A;  5CCL A;  3ZN3 A;  3SZ7 A;  2XGM A;  5HI7 A;  3GZ1 A;  4GYY A;  3ZHE B;  5BNW A;  4O6F A;  5KJL A;  4KBQ A;  3TGO A;  5G05 J;  4NQ0 A;  4WNF A;  4KXK B;  2HR2 A;  4WND A;  3VTX A;  4UI9 C;  4UI9 K;  4WNG A;  5A6C A;  1W3B A;  4H7X A;  1QZ2 A;  3LY8 A;  1NZN A;  5FT9 A;  4CGV A;  4I1A A;  3S7F A;  1KLX A;  3AS5 A;  4N2Q A;  1OUV A;  4U0U A;  4UQX A;  3BEE A;  2VSN A;  1HZ4 A;  4IN3 B;  3OXL A;  3NF1 A;  3JYS A;  4GZ6 A;  4G23 A;  4N5C A;  3PE4 A;  4N3B A;  2PQR A;  1ELW A;  3ESK A;  1NA3 A;  4JL0 A;  3ASD A;  3K9I A;  2KCK A;  4RG9 A;  4UQY A;  3CVN A;  2VGY A;  5JJT A;  3RJV A;  4J8D A;  5AYW D;  5EX3 A;  1YA0 A;  2OND A;  2MHK A;  3E4B A;  2UY1 A;  3TG5 A;  2YHC A;  5EX0 A;  2DBA A;  2VSY A;  4Y6W A;  3QWP A;  3QOU A;  2PZI A;  2LSV A;  3VTY A;  3URZ A;  4LEU A;  3FWV A;  3LY7 A;  4GZ5 A;  1PC2 A;  3OXF A;  1Y8M A;  3PE3 A;  4XIF A;  4HOQ A;  2KC7 A;  4RG6 A;  1E96 B;  4BWR A;  4BT8 A;  3RO3 A;  2FI7 A;  4I17 A;  3Q15 A;  1P5Q A;  4YVQ C;  5G04 J;  2LSU A;  4HOT A;  4HOU A;  3MKR A;  4U07 A;  2YQ8 A;  2PQN A;  3CVL A;  5D0Q D;  1A17 A;  3MV3 B;  5JJ7 A; 
#chains in the Genus database with same CATH topology
 4U04 A;  4C48 B;  4ANV A;  3HXB A;  3TWS A;  2F0Y A;  1RZ4 A;  3P1U A;  2J4B A;  2FF4 A;  4GZC A;  2DZN A;  3U4T A;  3APF A;  4I9C A;  5AN8 A;  2HYZ A;  2DIW A;  3FTY A;  3TL5 A;  4JXT A;  1N95 A;  2KAT A;  2Y4U A;  4A3V A;  3ZGQ A;  1IXV A;  4XZ4 A;  4U0Z A;  4X8Q A;  2ETA A;  5CCM A;  4NIK A;  1N54 A;  4Y6C A;  1MZC A;  3I3N A;  3CV0 A;  3OAW A;  3DWL G;  4JHR A;  1RW2 A;  5FTP A;  4ILH B;  5BW8 C;  4WWO A;  2A4Z A;  3DXK G;  2Q7F A;  4B8A A;  3NB2 A;  1KZO A;  2KZT B;  1PY1 A;  3DEO A;  3ML8 A;  1JCS A;  4G2V A;  2ION A;  3SI5 A;  3FHE A;  3L16 A;  5J08 A;  3BUA A;  4GZ3 A;  2XS8 A;  3DEP A;  3PDN A;  5JHB A;  4HFG A;  4XEI G;  3E37 A;  4U0S A;  4G11 A;  4LCT A;  1Y6I A;  4OVU A;  3AG4 E;  4JA7 A;  2WXK A;  3CVP A;  3R7Q A;  4MS6 A;  2WXQ A;  4JB8 P;  3TWT A;  4F6R D;  2I2O A;  4CGW A;  3CHS A;  4F53 A;  4TXQ A;  3CHO A;  5EKQ D;  2WXG A;  2LXM A;  5FQ4 A;  4N39 A;  3Q47 B;  3FUM A;  1OT8 A;  1XNF A;  2L6B A;  3ESL A;  2Y0B G;  2AVP A;  4N3C A;  1O1R A;  3GW4 A;  3I5P A;  1N4R A;  4DI3 A;  3IXE A;  5J90 A;  4A55 A;  3CVW A;  2CG3 A;  1X5B A;  4HRM B;  2ETB A;  3UXG A;  4UWG A;  2XZT G;  2XCB A;  3CGH A;  1X81 A;  5CRV A;  2XPY A;  3B7U X;  3V30 A;  4FLB A;  3DSS A;  2L0I A;  4J8F A;  2X6I A;  1IQR A;  1N0Q A;  1U3C A;  5LX8 A;  5C1D A;  2I1J A;  4DI4 A;  4WNE A;  3Q7A A;  5T8I A;  3HVE A;  3Q9U C;  3QKY A;  5G04 C;  2YHE A;  2L0T B;  3QWW A;  4NRH B;  4Q94 A;  2XZD G;  2OOE A;  3AG2 E;  1BI7 B;  3WXX A;  2M63 A;  1YMP A;  3QNK A;  2LXL A;  4BTA A;  4JZY A;  4GPM A;  2R03 A;  3CSF A;  3JUI A;  3B95 A;  4LUN U;  4AXH A;  3FUI A;  4EQF A;  2JLB A;  3AS8 A;  4C0M A;  4H7Y A;  2B0O E;  4Z68 A;  3MKQ A;  4JEH A;  5G2N A;  2AXZ A;  3PVL A;  2QC9 A;  4G1T A;  2MYO A;  4YDE A;  2VSO E;  2UWJ G;  5FZR A;  2CHZ A;  5CMW A;  4ZFH A;  5ARG A;  4F3V A;  4PUC A;  2PNN A;  4IRU A;  4ZHB A;  1DC2 A;  2GGF A;  1NP7 A;  3D9N A;  3CST A;  1KT0 A;  5JJ6 A;  5KNH D;  3ZPJ A;  3CVY A;  5JA4 D;  3G2S A;  1U2V G;  3LDZ A;  1B89 A;  3L08 A;  5E75 A;  4GA0 A;  3CK8 A;  5AQB A;  3ASH A;  4CRW A;  4NAC A;  1IHB A;  2Y3A A;  5FQ8 A;  5CRU A;  4GU5 A;  3MA5 A;  3QJZ A;  4M7C A;  5CBO A;  2WVI A;  1Z3X A;  2C2L A;  2NXP A;  4GTT A;  4G25 A;  4RSY A;  2BF0 X;  4ME2 A;  4FUL A;  4GTR A;  3EUV A;  5LCW J;  5CCL A;  2E0I A;  2IO3 C;  3FTW A;  1Z5S C;  3LVR E;  4HQD A;  3D9M A;  5KJL A;  1NL4 A;  1H2V C;  1INZ A;  4KVO A;  4NQ0 A;  5CBN A;  3NOG D;  2HR2 A;  2DVW A;  2DCP A;  4UI9 K;  4WNG A;  1JUQ A;  2XHE A;  5A6C A;  1W3B A;  1EYH A;  1N52 A;  4NUR A;  4OYS A;  5ENQ D;  3VLD A;  2VJ8 A;  1SA4 A;  4N2Q A;  4I6J A;  4UQX A;  2VSN A;  3V2O A;  1HZ4 A;  4IN3 B;  4K5C A;  2MRI A;  5EYL A;  3ABL E;  4N5C A;  3B7T A;  3NZS A;  4O1O A;  1JWF A;  1ELW A;  3SFZ A;  5A23 A;  3FEX A;  2P9I G;  4KZ0 A;  4UQY A;  3CVN A;  4FHK A;  2P9U G;  3FU6 A;  2VGY A;  3CR3 A;  5JJT A;  1TYQ G;  4BER A;  1HU3 A;  5EX3 A;  3V79 K;  2OND A;  2QYJ A;  5ENP D;  1IQU A;  2YHC A;  4AVX A;  2VTB B;  5T3R A;  2EIN E;  5AQA A;  2H6I A;  5ENO D;  4EZL A;  1OWO A;  4LEU A;  3SNX A;  3LY7 A;  3FUE A;  3CVV A;  3IBE A;  5ENR D;  4F1S A;  3PE3 A;  4XIF A;  3T8K A;  4J6I A;  3ML9 A;  5IY5 E;  4HBD A;  4BT8 A;  2FI7 A;  1OXJ A;  3ZYQ A;  1P5Q A;  1PAQ A;  2F37 A;  2AXU A;  2XPZ A;  3FY4 A;  4KZC A;  4Q96 A;  2J4D A;  4U07 A;  2YQ8 A;  2PQN A;  3ONL A;  3ZYM A;  3PEU B;  1LTX A;  2GRR B;  4XKC A;  1N9A A;  3FH7 A;  3UM0 A;  3G2U A;  4AJW A;  2WXL A;  1FPP A;  3PUK A;  3CEQ A;  3IV0 A;  5A7D B;  4CCA A;  4N3A A;  1E7V A;  2WQ6 A;  2QFC A;  2LAI A;  1E8W A;  3ZKJ A;  3FU3 A;  1D8D A;  1K1B A;  4U8H A;  3FU5 A;  5CEA A;  4ABN A;  3FP3 A;  3C3R A;  2XEE A;  1K1A A;  2GRQ B;  3L82 A;  5FZS A;  2WM9 A;  5HKP A;  4GTQ A;  4EEC A;  4EBA A;  4BX8 A;  5LCW C;  2WXN A;  1O1S A;  4K5B A;  5HS0 A;  4CDM A;  3HXD A;  4AM9 A;  1YYH A;  2CHW A;  2FBN A;  3R9A B;  2XRY A;  5M72 A;  2EIJ E;  2OCC E;  4U95 D;  2CG2 A;  4I2Z A;  3QDN A;  4TXR A;  3FTX A;  4RQI A;  4HOS A;  2J07 A;  3HYM B;  2AW6 A;  3NAW A;  4GAA A;  1MX4 A;  3LJ3 A;  1HO8 A;  2GW1 A;  4HLE A;  4GTO A;  1VDY A;  1ZU2 A;  1FCH A;  1HH8 A;  2R05 A;  5DBK A;  1MHQ A;  3RAU A;  1BPO A;  4PS3 A;  3D9I A;  4DX5 D;  4Q69 A;  3ABK E;  4JD2 G;  3QAQ A;  1NI1 A;  3RKV A;  3UIN C;  3ULE G;  3E32 A;  3PRZ A;  4JVS A;  2F8X K;  4UI9 J;  2V0P A;  3TWR A;  3AG3 E;  4GZD A;  2XGO A;  2KXP C;  2VYI A;  2ZIS A;  3O48 A;  4FAD A;  5JHA A;  2IF4 A;  4BET A;  3NQP A;  3SO8 A;  4APF A;  4J8S A;  5KJN A;  4K0R A;  4I1M A;  5CED B;  3ZIM A;  2XEV A;  4N5Q A;  3CVQ A;  3EIQ C;  2KZT A;  3W9F A;  3FH5 A;  3LPZ A;  3DRA A;  2J9Q A;  4WAF A;  2VQ2 A;  5ENT D;  2WXR A;  4GTM A;  3U9W A;  5B1B E;  5BUZ A;  1N4Q A;  3RK6 A;  1JPL A;  3PH0 C;  2XEN A;  3PRE A;  1KZP A;  2IJG X;  4GCN A;  2HE0 A;  1HS6 A;  5EYP F;  3ULY A;  3RU0 A;  2V8S E;  5CER B;  3LYA A;  4RVB A;  2WXF A;  2XRZ A;  2P9N G;  3FUK A;  1WDY A;  5EIB E;  2FO1 E;  4JHK A;  4TRQ A;  5ARF A;  1XGW A;  3J5P A;  3ZVV A;  1QNF A;  5HQ8 A;  3KD7 A;  2Y4T A;  1H6P A;  4LNG A;  3EHR A;  3CK9 A;  4APO A;  4ACK A;  3UM1 A;  2OEW A;  4KMO A;  3G2W A;  2WXP A;  1IHG A;  2LNI A;  4MLP A;  5FQ6 A;  3CKB A;  3L17 A;  4HB5 A;  4RLY A;  4U8Y D;  4DX2 A;  1TNZ A;  5BXU A;  4OAV B;  3CQG B;  3LKU A;  1HF8 A;  1S64 A;  3T5V A;  4M3O A;  1OCO E;  2C0L A;  3CIA A;  3DXM G;  3KEZ A;  3ASO E;  3PEV B;  4L23 A;  5BV1 A;  1L5J A;  3FFL A;  2EQX A;  1WAO 1;  2WXM A;  3KSL A;  3QAR A;  3ZHE A;  4QFV A;  3C3Q A;  1SW6 A;  2J8S D;  3FTU A;  5BPP A;  4XI0 A;  2J08 A;  4ILG A;  5FJY A;  5AQ9 A;  3VLF A;  4XE0 A;  3S7J A;  1LF8 A;  3ISM C;  3MJW A;  2GRO B;  2XGM A;  3SD5 A;  3WG7 E;  3ZHE B;  4JW1 A;  2LO6 A;  1YCS B;  2PM7 A;  3BG1 B;  4KBQ A;  2CFU A;  4HVB A;  5EN5 D;  4CEM A;  2QYU A;  4KXK B;  4WND A;  3IKO B;  3VTX A;  4UI9 C;  2XQ0 A;  5EID A;  4H7X A;  4ANW A;  1E8X A;  4EZJ A;  2H6H A;  3PS6 A;  2A5U A;  4CGV A;  4I1A A;  3AS5 A;  2IU1 A;  1OUV A;  4PS8 A;  3ZNG A;  3UTM A;  3D9J A;  2VGE A;  3L6A A;  4GTP A;  4GZ6 A;  3HXC A;  4MKT A;  3UIO C;  4GTV A;  3ESK A;  1NA3 A;  5G55 A;  1S0P A;  3ASD A;  4EZK A;  2P9P G;  5AYW D;  1YA0 A;  5FIN A;  2MHK A;  2X6J A;  5AJL A;  3E4B A;  3Q75 A;  4PS7 A;  3ZYL A;  4O60 A;  3TG5 A;  4Y6W A;  2RKK A;  4JEU A;  2PZI A;  4R7L A;  3URZ A;  5AAO A;  3FWV A;  3SGH A;  1UG3 A;  5ENS D;  3MYV A;  3EHQ A;  2QZA A;  3Q7F A;  1TNO A;  2X38 A;  2DYR E;  4IYP A;  2J09 A;  4RG6 A;  2DWZ A;  1E96 B;  4V3I A;  1AP7 A;  3RO3 A;  3DSV A;  4UWL A;  4EPZ A;  2WB2 A;  4I17 A;  3Q15 A;  3GZS A;  3W9G A;  1SZA A;  4GMJ A;  2KM4 A;  4YVQ C;  4JC8 A;  2V5Q C;  2LSU A;  5CEC B;  1BD8 A;  5D0Q D;  3R9M A;  1TEZ A;  4UUC A;  1S70 B;  3MV3 B;  5JJ7 A;  5LP0 A;  1ELK A;  3Q73 A;  4YVO A;  1UW4 B;  1EDU A;  3SQV A;  2OVB A;  3RSE G;  4BSZ B;  2ZIR A;  1N4S A;  2BUG A;  3S7B A;  2QY7 A;  2XEH A;  3MGB A;  1H2T C;  5B1A E;  3AS4 A;  3I4G A;  1H0A A;  1BI8 B;  3CQC B;  4UWH A;  4U8V D;  4IUL A;  1FT2 A;  1LD7 A;  2RFM A;  2RFA A;  1UN8 A;  3ZW3 A;  3U64 A;  1MX2 A;  3Q4A B;  2KCV A;  3AG1 E;  4K03 A;  5KCM A;  1SZ9 A;  4I6E A;  2BED A;  4BFR A;  2VTB A;  4KYO B;  1UJJ A;  2I1K A;  4HOR A;  3HIZ A;  4FP7 A;  1GW6 A;  4F1P A;  4FLH A;  4B89 A;  4C9B B;  4I9E A;  2WQH A;  4JA9 A;  2ETC A;  3QC1 A;  3UUX A;  4FA6 A;  2CHX A;  3D9O A;  3ZU7 B;  2Y69 E;  2YNQ A;  3UX4 A;  4GA2 A;  1O1T A;  2IFU A;  3JQ1 A;  5AIJ A;  5AAR A;  2WXI A;  1DCE A;  2Y1L E;  3AU4 A;  5KJK A;  4DJA A;  4CDN A;  2XGS A;  1D8E A;  2I6H A;  4A3T A;  1OWM A;  2WPV A;  3UKR G;  4F7A A;  4WUY A;  1NA0 A;  2IOL A;  3EDT B;  4EHM A;  5FZQ A;  3OXG A;  3JQ0 A;  3SBT B;  2EIL E;  3KS2 A;  1OWP A;  1FVH A;  1O5M A;  2LUH A;  4DRX E;  3RO2 A;  2VGX A;  5AJD A;  4G26 A;  3UIP C;  2IO2 C;  1AWC B;  4GPK A;  1WM5 A;  3B13 A;  3MX3 A;  3HDX A;  3HRA A;  3FUD A;  3EHM A;  2IQC A;  4DPR A;  3CLJ A;  3APD A;  4A1S A;  3C98 A;  4AOF A;  4HRN A;  3DPD A;  4G8L A;  5BV0 A;  2VGX B;  1MQS A;  3UM3 A;  3ZEF A;  5FWQ A;  4DX6 D;  3DSU A;  1TNY A;  2EIM E;  2WMO A;  3CK7 A;  3ONK A;  2P9K G;  3FUH A;  1EF1 C;  3KSQ A;  2X6H A;  5KBA A;  3LCA A;  2PL2 A;  3FH8 A;  3D9L A;  4YDO A;  5AQ7 A;  1OCC E;  1SQM A;  5EIL A;  3QK0 A;  3IHY A;  1MX6 A;  3GYZ A;  2GRP B;  4BES A;  4FHJ A;  4UQZ A;  4MBG A;  1MJ0 A;  4LNU D;  3LY9 A;  3FUF A;  4O1P A;  4BY6 A;  3CHR A;  4CT4 A;  3APC A;  4L2Y A;  4ACL A;  3LEW A;  4GML A;  3MV2 B;  1OY3 D;  2AJA A;  3ASG A;  3BQO A;  2FO7 A;  2V4L A;  2XCC A;  2V4H C;  3J5Q B;  3O4Z A;  5CHE E;  1OCR E;  2WXO A;  1HX8 A;  2L9B A;  3AU5 A;  4CT0 A;  4OVV A;  4TUU A;  3S2A A;  3EIJ A;  1UN9 A;  4GYW A;  4CYM D;  1WY6 A;  3FUJ A;  3HG0 D;  4AY6 A;  4LSZ E;  4C0E A;  3E34 A;  4LNB A;  2R5S A;  2UY1 B;  4I2W A;  3UMV A;  4ANX A;  1TR4 A;  2ILR A;  1TJF A;  5DIZ A;  3KAE A;  5C2Y A;  4EBA G;  2NYJ A;  2HO1 A;  4GCO A;  3HXE A;  2IY0 C;  4L7T A;  1E8Z A;  3GZ1 A;  1S63 A;  3U66 A;  1TNB A;  4GYY A;  5BXO A;  3EJN A;  5HRY A;  3FU0 A;  4ATZ D;  1E90 A;  1MYO A;  4O6F A;  3B7B A;  5EDS A;  5G05 J;  1OCZ E;  5FIO A;  2WQ7 A;  3UT7 A;  4WWN A;  5AEN A;  3LS8 A;  3FEY A;  3UM2 A;  3IHV A;  1QZ2 A;  3NBN B;  1NZN A;  1ZB1 A;  1TNU A;  3L9T A;  5FT9 A;  3S7F A;  1KLX A;  3V31 A;  3X2Q E;  3FDH A;  3L22 A;  2XS1 A;  3BEE A;  3OTN A;  1OWL A;  2RG8 A;  3JYS A;  4G23 A;  4N3B A;  3BG0 B;  4DUI A;  2PQR A;  2ZU6 B;  3R7R A;  2KCK A;  2MOW A;  2RD0 A;  1K3Z D;  1Z3Y A;  3CVX A;  3L54 A;  4GTS A;  1TN8 A;  2CFZ A;  1HFA A;  2R02 A;  3TWW A;  1H2U A;  1N94 A;  5EX0 A;  3C5R A;  2VSY A;  3QWP A;  4G8K A;  3PNL B;  3QOU A;  4K5A B;  1V55 E;  1JCQ A;  2LSV A;  3ABM E;  1N0R A;  4DX1 A;  3G2V A;  4BEP A;  1PC2 A;  3OXF A;  1Y8M A;  4HOQ A;  3I4R B;  3D9K A;  4B93 B;  4BWR A;  1Z6T A;  3KEA A;  1H6K A;  4DLO A;  3PNT B;  4D10 C;  2JEK A;  3MKR A;  2R59 A;  5D2M C;  2ZGD A;  1DVP A;  1E8Y A;  3D9H A;  3HHM A;  5ITZ F;  3U3W A;  2E2E A;  3HXF A;  4BX9 A;  4GA1 A;  3CVU A;  3SFX A;  4BSX A;  2NC9 A;  4BTB A;  3MEK A;  3C3O A;  4ANU A;  1HXI A;  2R2L A;  1UJK A;  2KCL A;  2OV8 A;  4B0Z A;  1LD8 A;  3TWQ A;  1TN7 A;  3LXU X;  5ANR A;  3AJI A;  2V5F A;  3Q5M A;  2GRM A;  1A5E A;  3TWX A;  1KT1 A;  3PZ4 A;  4KT6 B;  4DK5 A;  4I1O B;  2OVF A;  3E30 A;  5E76 A;  5JMN D;  2FUL A;  4TUM A;  4AIF A;  3E33 A;  3NOC D;  1QQE A;  3PUJ A;  4L2L A;  4JPS A;  4HLL A;  2HM8 A;  1BLX B;  1U3D A;  3DSX A;  1EPU A;  3TWV A;  3PZ2 A;  5G05 C;  3V2X A;  4DLQ A;  1IYG A;  3JXI A;  3HVE B;  2BKG A;  1UOH A;  3UPV A;  2H6F A;  3JXJ A;  4I6G A;  4LER A;  2YIN A;  1KPS B;  3B7R L;  2IEJ A;  4QQI A;  1JCR A;  3FUN A;  5LFA A;  2WXJ A;  4FJZ A;  2C0M A;  3MKQ B;  4YDY A;  3SY2 A;  4G24 A;  3UI2 A;  5T4Y A;  5KJM A;  1NFI E;  2X6K A;  4XI9 A;  2JAB A;  3CKC A;  4XKB A;  2AWI A;  1H19 A;  1DCQ A;  3C72 A;  1ELR A;  4J8Y A;  2P9S G;  3EU9 A;  3EU5 A;  2LAH A;  4HXI A;  4W9R A;  4PH4 B;  5LOZ A;  4FJY A;  3UQ3 A;  2EIK E;  4CDR A;  4P29 A;  3SBS A;  3ASF A;  4YDW A;  1BU9 A;  5FQ7 A;  4N2S A;  4U96 D;  3TXM A;  3FTS A;  4WWP A;  1FT1 A;  4XX5 A;  2GRN B;  3RRN B;  3FUL A;  4B94 A;  4CZ2 D;  5KWD A;  4GMR A;  4LG6 A;  4AV7 A;  2P58 C;  3NZU A;  3SF4 A;  4TXP A;  3ZFW A;  4GYO A;  3ULQ A;  4AY5 A;  2B6C A;  4HRL A;  3IEG A;  2OEV A;  1OWN A;  3LVQ E;  1DNP A;  2IOS A;  4UWF A;  3UKU G;  4J8E A;  4U63 A;  2L6J A;  1G3N B;  4GB9 A;  4HI8 A;  4HNA D;  5D0O D;  3Q49 B;  2ZXW E;  3JUE A;  1TJC A;  1QYM A;  3D3M A;  4L9P A;  2PM6 A;  3Q79 A;  3EHN A;  2P2C P;  4J0U A;  2FEZ A;  3TXN A;  4LRZ A;  1N4P A;  3Q78 A;  1TN6 A;  3GZ2 A;  5BT1 A;  4AEZ C;  3PZ3 A;  4BT9 A;  5B3S E;  3ZRH A;  3TJP A;  3P2B A;  2H6G A;  3S7D A;  3DBS A;  4E85 A;  3QWV A;  2BKK B;  4YND A;  5CMY A;  1D9S A;  3N71 A;  1IKN D;  4A1G A;  2XPI A;  3T5X A;  2DZO A;  5KNG A;  2I9C A;  3T9K A;  3TG4 A;  4OAU C;  3CHP A;  1Q2Z A;  1ZBP A;  3TAX A;  1WG0 A;  3RIB A;  2KBX A;  3ZN3 A;  3ZYK A;  4J7W A;  3SZ7 A;  5HI7 A;  3ZXP A;  2WMN A;  1SVX A;  2BTD A;  3BU8 A;  3ENE A;  3LJN A;  1FVF A;  2X3M A;  5BNW A;  4HS2 A;  3TGO A;  4KVM A;  3RRM B;  3CHQ A;  4WNF A;  2NSZ A;  4HI9 A;  1K8K G;  4TV3 A;  3UT4 A;  2A5E A;  4U7E B;  2ZGG A;  3QB2 A;  3LY8 A;  2AXV A;  3ASN E;  3AAA C;  3B7S A;  4FU3 A;  2X6F A;  1V54 E;  5H7P A;  3UT8 A;  3SFY A;  3PZD A;  4U0U A;  5D66 A;  3ZUV B;  3TWU A;  3OXL A;  4AP2 A;  3FTV A;  3NF1 A;  3G2T A;  4A63 B;  4JHJ A;  3PE4 A;  2F8Y A;  5ANL A;  3FTZ A;  2R17 C;  3JCK C;  3PZ1 A;  4L1B A;  4I43 A;  4ATG A;  2GRL A;  3F6Q A;  4JL0 A;  1H6O A;  1HE8 A;  3K9I A;  4RG9 A;  1JWG A;  3D9P A;  2J49 A;  4UWK A;  2VSX E;  3RJV A;  4J8D A;  3T8M A;  4PDX A;  1HG2 A;  4B8C B;  3Q9N C;  2UY1 A;  3ZXS A;  4FC8 A;  4URK A;  3CHM A;  3SHF A;  1SA5 A;  2DBA A;  4DX7 D;  3DST A;  3VTY A;  4MRU A;  3L13 A;  4GZ5 A;  1E7U A;  1HG5 A;  3DSW A;  4E6H A;  2KC7 A;  1QBQ A;  2WXH A;  2DYS E;  3MZL B;  2P9L G;  3MCX A;  1N11 A;  3VLE A;  3DPY A;  5G04 J;  4HOT A;  4ILI A;  4HOU A;  5ENN A;  3CVL A;  3RRU A;  1A17 A; 
#chains in the Genus database with same CATH homology
 3ZYM A;  1ELK A;  5LP0 A;  4YVO A;  3PEU B;  1UW4 B;  3HHM A;  3U3W A;  4U04 A;  1EDU A;  2E2E A;  2OVB A;  4XKC A;  3FH7 A;  4ANV A;  4BX9 A;  3G2U A;  4GA1 A;  4AJW A;  3CVU A;  2WXL A;  3PUK A;  4BSX A;  2NC9 A;  3P1U A;  4BTB A;  3MEK A;  2J4B A;  2BUG A;  3CEQ A;  3IV0 A;  5A7D B;  2FF4 A;  3S7B A;  2QY7 A;  4N3A A;  4CCA A;  1E7V A;  2WQ6 A;  4GZC A;  4ANU A;  2QFC A;  3MGB A;  3U4T A;  3APF A;  4I9C A;  1H2T C;  1HXI A;  2HYZ A;  2DIW A;  3FTY A;  1UJK A;  3TL5 A;  2LAI A;  1E8W A;  2KCL A;  2OV8 A;  3AS4 A;  3I4G A;  4JXT A;  4B0Z A;  2KAT A;  3FU3 A;  1H0A A;  2Y4U A;  3CQC B;  4U8H A;  4UWH A;  3FU5 A;  4A3V A;  3FP3 A;  3LXU X;  5ANR A;  3ZGQ A;  4ABN A;  4IUL A;  4XZ4 A;  2V5F A;  3Q5M A;  4U0Z A;  2GRM A;  5CCM A;  1UN8 A;  3ZW3 A;  1KT1 A;  3U64 A;  5FZS A;  4KT6 B;  2WM9 A;  4DK5 A;  1N54 A;  3Q4A B;  2KCV A;  4I1O B;  4K03 A;  4Y6C A;  5KCM A;  2OVF A;  4EEC A;  4EBA A;  1SZ9 A;  4I6E A;  5E76 A;  4BX8 A;  3I3N A;  4BFR A;  5LCW C;  2WXN A;  3CV0 A;  3OAW A;  2VTB A;  4JHR A;  4KYO B;  5FTP A;  4CDM A;  2FUL A;  4AM9 A;  4ILH B;  5BW8 C;  4AIF A;  4WWO A;  1QQE A;  1UJJ A;  2A4Z A;  2I1K A;  3PUJ A;  4L2L A;  4HOR A;  4JPS A;  2Q7F A;  4B8A A;  2CHW A;  2FBN A;  3HIZ A;  2KZT B;  4FP7 A;  1PY1 A;  2HM8 A;  3ML8 A;  1GW6 A;  3R9A B;  2XRY A;  4FLH A;  4B89 A;  1U3D A;  4C9B B;  4G2V A;  2ION A;  1EPU A;  5M72 A;  4I9E A;  3SI5 A;  2WQH A;  3FHE A;  3L16 A;  5G05 C;  5J08 A;  4JA9 A;  4DLQ A;  4GZ3 A;  1IYG A;  2CG2 A;  4I2Z A;  3QC1 A;  3PDN A;  3HVE B;  3QDN A;  5JHB A;  4HFG A;  3UUX A;  4FA6 A;  3FTX A;  2CHX A;  4HOS A;  2J07 A;  4U0S A;  3D9O A;  3HYM B;  4G11 A;  2AW6 A;  4LCT A;  2YNQ A;  3UPV A;  4GAA A;  1Y6I A;  3UX4 A;  3LJ3 A;  4GA2 A;  4OVU A;  1HO8 A;  2GW1 A;  4JA7 A;  2IFU A;  2WXK A;  3CVP A;  3JQ1 A;  3R7Q A;  5AIJ A;  4I6G A;  4HLE A;  4LER A;  4MS6 A;  2YIN A;  2WXI A;  2WXQ A;  1VDY A;  1ZU2 A;  1FCH A;  1HH8 A;  3AU4 A;  5DBK A;  5KJK A;  2I2O A;  3B7R L;  1MHQ A;  4DJA A;  3CHS A;  4CDN A;  2XGS A;  4CGW A;  4F53 A;  1BPO A;  3FUN A;  3CHO A;  5LFA A;  2I6H A;  5EKQ D;  2WXG A;  4PS3 A;  5FQ4 A;  3D9I A;  2WXJ A;  4N39 A;  3Q47 B;  4A3T A;  1OWM A;  2WPV A;  4FJZ A;  3FUM A;  4Q69 A;  2C0M A;  3QAQ A;  1XNF A;  3ESL A;  3MKQ B;  3RKV A;  4F7A A;  2AVP A;  4WUY A;  4G24 A;  4N3C A;  1NA0 A;  3GW4 A;  2IOL A;  3EDT B;  3PRZ A;  4JVS A;  5T4Y A;  3I5P A;  5KJM A;  4UI9 J;  4DI3 A;  2V0P A;  2X6K A;  5FZQ A;  5J90 A;  3OXG A;  3JQ0 A;  4GZD A;  3SBT B;  4A55 A;  4XI9 A;  3KS2 A;  2XGO A;  3CKC A;  3CVW A;  2CG3 A;  2AWI A;  4XKB A;  1H19 A;  2VYI A;  1X5B A;  1OWP A;  1FVH A;  1ELR A;  3O48 A;  4FAD A;  5JHA A;  2IF4 A;  2LAH A;  4HXI A;  4W9R A;  4PH4 B;  5LOZ A;  3RO2 A;  2VGX A;  4UWG A;  3NQP A;  4APF A;  4FJY A;  4J8S A;  5AJD A;  2XCB A;  4G26 A;  5KJN A;  3CGH A;  3UQ3 A;  4K0R A;  2XPY A;  4CDR A;  3B7U X;  4P29 A;  4I1M A;  3SBS A;  3ASF A;  4FLB A;  4GPK A;  1WM5 A;  3B13 A;  3MX3 A;  3HDX A;  5FQ7 A;  4N2S A;  2L0I A;  4J8F A;  3ZIM A;  2X6I A;  2XEV A;  3TXM A;  1IQR A;  3FUD A;  3CVQ A;  3EIQ C;  3FTS A;  2KZT A;  4WWP A;  4XX5 A;  3RRN B;  1U3C A;  3EHM A;  2IQC A;  3FH5 A;  3FUL A;  3LPZ A;  4B94 A;  4DPR A;  3CLJ A;  3APD A;  4A1S A;  5LX8 A;  5C1D A;  3C98 A;  2I1J A;  4DI4 A;  4WNE A;  2J9Q A;  4AV7 A;  5T8I A;  4WAF A;  2P58 C;  2VQ2 A;  3HVE A;  3NZU A;  3SF4 A;  3QKY A;  4AOF A;  5G04 C;  2YHE A;  3DPD A;  2L0T B;  2WXR A;  3U9W A;  3ZFW A;  5BV0 A;  4GYO A;  2VGX B;  5BUZ A;  1MQS A;  3ULQ A;  3RK6 A;  1JPL A;  4AY5 A;  3ZEF A;  5FWQ A;  3PH0 C;  3QWW A;  4NRH B;  4Q94 A;  3PRE A;  2IJG X;  4GCN A;  2OOE A;  2WMO A;  3CK7 A;  3ONK A;  3IEG A;  1HS6 A;  3FUH A;  1OWN A;  2M63 A;  3WXX A;  1EF1 C;  2X6H A;  3QNK A;  3LVQ E;  2V8S E;  3RU0 A;  4BTA A;  3LYA A;  1DNP A;  4JZY A;  4RVB A;  2IOS A;  2WXF A;  4UWF A;  3LCA A;  2XRZ A;  3CSF A;  3JUI A;  4J8E A;  4LUN U;  4U63 A;  2L6J A;  3FUK A;  2PL2 A;  4AXH A;  3FH8 A;  3D9L A;  4GB9 A;  3FUI A;  4JHK A;  1SQM A;  4EQF A;  4TRQ A;  5ARF A;  2JLB A;  1XGW A;  3AS8 A;  4C0M A;  3QK0 A;  4H7Y A;  5D0O D;  3ZVV A;  3Q49 B;  3IHY A;  1QNF A;  5HQ8 A;  3GYZ A;  3KD7 A;  3MKQ A;  1TJC A;  4JEH A;  2Y4T A;  3D3M A;  5G2N A;  2PM6 A;  2AXZ A;  3PVL A;  4FHJ A;  3CK9 A;  4UQZ A;  4APO A;  3EHN A;  4ACK A;  4G1T A;  2VSO E;  4J0U A;  2UWJ G;  3LY9 A;  4KMO A;  2FEZ A;  3FUF A;  3G2W A;  3TXN A;  2WXP A;  4LRZ A;  1IHG A;  2LNI A;  4MLP A;  5FQ6 A;  3CKB A;  3L17 A;  5FZR A;  2CHZ A;  5CMW A;  3GZ2 A;  4BY6 A;  3CHR A;  4CT4 A;  5ARG A;  5BT1 A;  4F3V A;  4PUC A;  4AEZ C;  3APC A;  4L2Y A;  3CQG B;  4IRU A;  4ACL A;  4BT9 A;  3LEW A;  4GML A;  3ZRH A;  3LKU A;  1HF8 A;  3MV2 B;  3TJP A;  2GGF A;  3P2B A;  1NP7 A;  3ASG A;  3D9N A;  3CST A;  1KT0 A;  3T5V A;  2FO7 A;  3S7D A;  2V4L A;  3DBS A;  4E85 A;  4M3O A;  3QWV A;  5JJ6 A;  2XCC A;  4YND A;  3ZPJ A;  3CVY A;  3O4Z A;  3G2S A;  2C0L A;  5CHE E;  5CMY A;  3CIA A;  3LDZ A;  3KEZ A;  1B89 A;  3L08 A;  3PEV B;  4L23 A;  2WXO A;  1HX8 A;  2L9B A;  3AU5 A;  5E75 A;  4CT0 A;  1L5J A;  5BV1 A;  4OVV A;  4TUU A;  3S2A A;  3N71 A;  4GA0 A;  3EIJ A;  3CK8 A;  3FFL A;  2EQX A;  1UN9 A;  4GYW A;  1WY6 A;  3ASH A;  3FUJ A;  1WAO 1;  2WXM A;  4A1G A;  4CRW A;  4NAC A;  2Y3A A;  3QAR A;  3ZHE A;  5FQ8 A;  4AY6 A;  4C0E A;  4GU5 A;  2XPI A;  3T5X A;  4QFV A;  2R5S A;  2UY1 B;  3MA5 A;  3QJZ A;  2I9C A;  3FTU A;  3TG4 A;  5BPP A;  2WVI A;  1Z3X A;  2C2L A;  2NXP A;  4I2W A;  3UMV A;  3CHP A;  4ANX A;  4G25 A;  2ILR A;  1TJF A;  4RSY A;  4XI0 A;  2BF0 X;  4ME2 A;  5DIZ A;  3KAE A;  4FUL A;  5C2Y A;  4EBA G;  1ZBP A;  2J08 A;  4ILG A;  3TAX A;  5FJY A;  3VLF A;  2HO1 A;  4GCO A;  4XE0 A;  3S7J A;  3RIB A;  5CCL A;  5LCW J;  2E0I A;  1LF8 A;  3ZN3 A;  3FTW A;  3MJW A;  3ZYK A;  3SZ7 A;  2XGM A;  4L7T A;  5HI7 A;  3LVR E;  1E8Z A;  3GZ1 A;  3U66 A;  2WMN A;  4GYY A;  3D9M A;  3EJN A;  3FU0 A;  1E90 A;  2BTD A;  3SD5 A;  3ENE A;  3ZHE B;  5BNW A;  1FVF A;  2X3M A;  4JW1 A;  4O6F A;  5EDS A;  5KJL A;  4HS2 A;  2LO6 A;  3BG1 B;  2PM7 A;  4KBQ A;  2CFU A;  4HVB A;  3TGO A;  4KVM A;  1H2V C;  3RRM B;  5G05 J;  4CEM A;  1INZ A;  4KVO A;  3CHQ A;  4NQ0 A;  4WNF A;  4KXK B;  2NSZ A;  2HR2 A;  2WQ7 A;  4WND A;  3IKO B;  4TV3 A;  3UT4 A;  2DCP A;  3UT7 A;  3VTX A;  4UI9 C;  4UI9 K;  4WNG A;  4WWN A;  5AEN A;  2XQ0 A;  2XHE A;  1JUQ A;  3FEY A;  3LS8 A;  1W3B A;  5A6C A;  3IHV A;  4H7X A;  1EYH A;  1QZ2 A;  1N52 A;  3QB2 A;  1E8X A;  4ANW A;  4EZJ A;  3LY8 A;  1NZN A;  5FT9 A;  2AXV A;  4NUR A;  3B7S A;  3PS6 A;  4OYS A;  4FU3 A;  2A5U A;  4CGV A;  3VLD A;  2X6F A;  2VJ8 A;  4I1A A;  3S7F A;  1KLX A;  3AS5 A;  2IU1 A;  3UT8 A;  4N2Q A;  3PZD A;  1OUV A;  4U0U A;  3FDH A;  3L22 A;  4I6J A;  4UQX A;  4PS8 A;  3BEE A;  3OTN A;  2VSN A;  1HZ4 A;  4IN3 B;  1OWL A;  3D9J A;  3OXL A;  4AP2 A;  3FTV A;  3L6A A;  2MRI A;  3NF1 A;  3G2T A;  2RG8 A;  3JYS A;  4GZ6 A;  4G23 A;  4MKT A;  4JHJ A;  3PE4 A;  3B7T A;  3NZS A;  4N3B A;  4N5C A;  5ANL A;  3BG0 B;  2PQR A;  2ZU6 B;  1JWF A;  1ELW A;  3FTZ A;  3SFZ A;  2R17 C;  3JCK C;  3ESK A;  4L1B A;  4I43 A;  1NA3 A;  3R7R A;  2GRL A;  4JL0 A;  5G55 A;  4ATG A;  5A23 A;  1S0P A;  3ASD A;  4EZK A;  1HE8 A;  3K9I A;  2KCK A;  3FEX A;  2MOW A;  4RG9 A;  1JWG A;  2RD0 A;  4KZ0 A;  3D9P A;  4UQY A;  3CVN A;  2J49 A;  4FHK A;  1Z3Y A;  3FU6 A;  2VGY A;  3CR3 A;  4UWK A;  2VSX E;  5JJT A;  3CVX A;  3RJV A;  4J8D A;  3L54 A;  3T8M A;  2CFZ A;  1HU3 A;  4PDX A;  5AYW D;  1HFA A;  1HG2 A;  5EX3 A;  1YA0 A;  4B8C B;  2OND A;  2MHK A;  2X6J A;  5AJL A;  3E4B A;  2UY1 A;  4PS7 A;  3ZYL A;  3ZXS A;  4FC8 A;  4URK A;  1H2U A;  1IQU A;  3CHM A;  2YHC A;  3TG5 A;  3SHF A;  5EX0 A;  4AVX A;  2VTB B;  2DBA A;  2VSY A;  4Y6W A;  3QWP A;  5T3R A;  3PNL B;  3QOU A;  4JEU A;  2PZI A;  2LSV A;  3VTY A;  4R7L A;  4MRU A;  4EZL A;  3URZ A;  1OWO A;  4LEU A;  3FWV A;  3L13 A;  3SGH A;  1UG3 A;  3G2V A;  3LY7 A;  3SNX A;  3FUE A;  3MYV A;  4GZ5 A;  3CVV A;  1PC2 A;  3IBE A;  3OXF A;  1E7U A;  1HG5 A;  4F1S A;  1Y8M A;  4E6H A;  3PE3 A;  4XIF A;  4HOQ A;  2X38 A;  2KC7 A;  3D9K A;  3I4R B;  4J6I A;  4IYP A;  2J09 A;  2WXH A;  4RG6 A;  3ML9 A;  1E96 B;  4V3I A;  4BT8 A;  1Z6T A;  4BWR A;  3MZL B;  3RO3 A;  4UWL A;  2FI7 A;  3MCX A;  4EPZ A;  2WB2 A;  4I17 A;  3Q15 A;  3VLE A;  3GZS A;  1SZA A;  4GMJ A;  3ZYQ A;  1H6K A;  1P5Q A;  2KM4 A;  1PAQ A;  4YVQ C;  4JC8 A;  3PNT B;  2LSU A;  5G04 J;  4DLO A;  4ILI A;  2JEK A;  4HOU A;  4D10 C;  4HOT A;  2AXU A;  2XPZ A;  3FY4 A;  3MKR A;  4KZC A;  2R59 A;  4Q96 A;  2J4D A;  4U07 A;  1DVP A;  1E8Y A;  2PQN A;  2YQ8 A;  3ONL A;  5ENN A;  3CVL A;  5D0Q D;  3RRU A;  1TEZ A;  1A17 A;  3MV3 B;  5JJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...