1IYGA

Solution structure of rsgi ruh-001, a fis1p-like and cgi-135 homologous domain from a mouse cdna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
GSSGSSGMEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-001, a Fis1p-like and CGI-135 homologous domain from a mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein (2010003O14)
total genus 41
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1iygA00
2ONDA 3SF4A 5FZQA 2FBNA 4GYOA 4RG6A 4G1TA 2C0MA 3KS2A 2QFCA 2UWJG 2KCVA 4J8EA 3S7FA 4GCNA 4U0SA 5CHEE 3ASFA 3N71A 3S7DA 4AIFA 2LNIA 3OXGA 4N5CA 3PE4A 2PL2A 1WAO1 4XI0A 2AVPA 3ULQA 3LY9A 2C2LA 3CK7A 3URZA 2C0LA 3MA5A 3AS5A 5EX0A 1QQEA 3MV3B 4AY6A 2FF4A 3AS8A 4XIFA 3OXLA 3ZHEA 2PZIA 2XCCA 3CK9A 3CVLA 3FP3A 3SZ7A 3CKCA 4JHRA 4BTAA 5LCWC 3CVPA 3LY8A 3LPZA 2LSVA 2KCKA 4APOA 2KATA 1OUVA 1QZ2A 2VSYA 4I9CA 4AY5A 4HOUA 3QDNA 3MKRA 3PDNA 3GW4A 3K9IA 4GZ6A 2NC9A 4UQYA 3RKVA 1FCHA 1WM5A 1KLXA 3GYZA 3ZGQA 2UY1B 5KJLA 2VGYA 4I17A 5EX3A 3PE3A 2V5FA 3IEGA 3KAEA 4AM9A 5FJYA 3ASHA 4BWRA 3Q4AB 3WXXA 4NRHB 1P5QA 1ELRA 4BT8A 2IFUA 3UUXA 5CCMA 4LEUA 2XGMA 3Q15A 5FZRA 2VGXA 3GZ2A 4J0UA 3TGOA 1HH8A 2LSUA 3UQ3A 2KC7A 4A1SA 3HYMB 4GZ5A 2YQ8A 4G24A 4Y6WA 3KD7A 1B89A 2XGOA 4I2WA 1KT0A 2HO1A 5AYWD 3U3WA 3JYSA 5DIZA 5JJ7A 4HORA 3CKBA 5G04J 1IYGA 5G05J 4CGWA 4H7YA 1YA0A 3EDTB 4JL0A 2VGXB 4J8FA 5G05C 1ELWA 5G04C 4EQFA 5A6CA 3QWWA 4G26A 4U0UA 4N3CA 2XCBA 3E4BA 4N2SA 3TAXA 3Q5MA 2E2EA 3QWPA 3RO2A 3ZN3A 2HYZA 3O48A 4WNGA 3Q47B 4WNFA 2WPVA 3QKYA 4JA7A 4GYWA 1NA3A 5KJMA 5FT9A 5BT1A 5LCWJ 3UPVA 1NA0A 3GZ1A 1HXIA 4B94A 3VTXA 5DBKA 4KXKB 2Y4TA 3CK8A 4GA2A 3LYAA 4GYYA 5C1DA 3Q49B 4U07A 1ZBPA 4GA1A 4UQZA 4G23A 4N2QA 4ABNA 3MV2B 5EKQD 1ZU2A 2I6HA 2YHCA 3LY7A 4W9RA 4HOQA 4H7XA 4YVQC 3ZHEB 3ZPJA 2XPIA 4IN3B 3LCAA 4O6FA 2P58C 4WUYA 3CEQA 2VYIA 4YNDA 1XNFA 2HR2A 2FEZA 4YVOA 4JA9A 2L6JA 4J8DA 3RIBA 4F3VA 4BTBA 1TJCA 3ASGA 3ASDA 4N3BA 5D0QD 5D0OD 3CVNA 2BUGA 5ARFA 2JLBA 2Y4UA 3FWVA 5FZSA 5JJ6A 2MHKA 1W3BA 2KCLA 4N3AA 5KJKA 2DBAA 2OOEA 3BEEA 2WQHA 2J9QA 3AS4A 4GA0A 3RJVA 4HOSA 2XEVA 3S7BA 4HOTA 3U4TA 5M72A 5A7DB 4BT9A 3S7JA 1A17A 1KT1A 4RG9A 3QOUA 4CDRA 2FO7A 3ESKA 1PC2A 2PQRA 2VSNA 3CVQA 4NQ0A 5CCLA 4G25A 5BNWA 5ARGA 4XI9A 3ZFWA 3QWVA 4I2ZA 4UQXA 2VQ2A 4UI9C 4UI9K 3RU0A 2XGSA 4GCOA 4WNEA 2R5SA 4U04A 4Y6CA 4ME2A 1E96B 5BW8C 4KBQA 4I1AA 1HZ4A 2Q7FA 1NZNA 4GZ3A 5FTPA 3TG5A 3FFLA 4CGVA 3RO3A 2IF4A 4I9EA 5HQ8A 4GPKA 4WNDA 5KJNA 2PQNA 1IHGA 3MEKA 5JJTA 3R9AB 3TG4A 3CV0A 2GW1A 4N39A 3NF1A 2UY1A 4G2VA 3VTYA 3LKUA 3OXFA 4U0ZA 4UI9J 5HI7A 2FI7A 4KYOB 1Y8MA
chains in the Genus database with same CATH superfamily
3MX3A 4KMOA 2A5UA 4I1OB 4RG6A 3SGHA 2KZTA 2Y69E 3N71A 2RKKA 2ZGGA 3ENEA 4U8HA 3V31A 3AG3E 3RRMB 4N5QA 4ATZD 1V55E 1XGWA 3AU5A 5FQ8A 2I1KA 4I9CA 4HOUA 2WQ6A 3NZUA 2VSXE 3UIPC 3L22A 2P9LG 2LUHA 1AP7A 5D66A 4LSZE 4F7AA 4U8VD 3KEAA 4MRUA 3FUNA 1B89A 3KD7A 4I2WA 5JJ7A 1SA4A 5DIZA 3JUIA 3TWSA 1UG3A 4LG6A 2XQ0A 2P9IG 2QC9A 2EINE 1HXIA 4B94A 3UM1A 3IKOB 5HS0A 3AJIA 3ABLE 1ZU2A 3L6AA 4L2LA 3R7RA 3GZSA 5LFAA 4XX5A 3RRUA 1BLXB 2H6GA 2P9PG 5EYLA 1RW2A 4YNDA 2AXZA 4DK5A 1HG2A 2ETAA 4GA0A 3UKRG 3DSVA 2ETBA 2WVIA 1PC2A 2PQRA 2GRRB 3C72A 3D9HA 4BESA 5T4YA 2HM8A 4WNDA 3CV0A 2GW1A 3DSWA 4G2VA 3LKUA 4UI9J 2WXLA 4EBAA 1WY6A 1N4SA 4PS8A 3V2XA 4AIFA 4N5CA 3LY9A 2C0LA 4GTQA 4GTMA 2OCCE 3FP3A 4BTAA 1D8DA 2PNNA 3JXIA 3MYVA 4QQIA 4PS3A 1MX4A 5BPPA 3QDNA 2QY7A 3NOGD 3OAWA 1FVHA 3RKVA 1FCHA 3IEGA 3EHNA 3WXXA 2A5EA 1H2VC 3EU9A 1ELKA 5FZRA 3TXNA 1K3ZD 2DZNA 3UQ3A 3U3WA 1GW6A 3ZYQA 2B0OE 4JL0A 3QC1A 3JQ1A 4N2SA 3TAXA 2NYJA 1DVPA 5AAOA 3SNXA 3CHOA 4UQZA 5AJLA 2BKKB 4AP2A 4WUYA 2V4HC 3SHFA 5C2YA 3FTUA 5JJ6A 2DCPA 3FWVA 3FUKA 4AVXA 1V54E 4U96D 5A7DB 4M3OA 5AENA 4OAUC 4Q94A 4U63A 1UN9A 1UJKA 3ABME 4WNEA 2MRIA 5BW8C 4FJZA 2Q7FA 5FTPA 5HQ8A 2IQCA 3CHQA 1RZ4A 4G11A 4K5AB 4LNBA 2QZAA 3ONKA 3LXUX 4GYOA 4JHKA 1N9AA 3ULQA 4LNGA 4A1GA 1O5MA 3QJZA 1WDYA 1S0PA 3OXLA 5T3RA 2ZIRA 5EIBE 4JHRA 4J7WA 1DNPA 2LAHA 1SQMA 2EIME 3FEXA 3MKRA 3MKQA 2NC9A 3TWWA 1H2UA 4UUCA 2VGYA 4I17A 3ZXPA 4NRHB 5CCMA 1OWPA 2RFMA 3GZ2A 1HH8A 3QARA 4GZ5A 1KT0A 2R17C 1N52A 2V4LA 2VGXB 2XPYA 3FTZA 4N3CA 1TYQG 1SW6A 3FUEA 1S63A 1DCQA 3RSEG 4KXKB 4GA1A 3B7UX 5B1BE 3CHPA 4XE0A 4URKA 5KNGA 1N95A 3ZPJA 4O6FA 4JVSA 4EBAG 3CVNA 3ZYMA 4ANWA 4NIKA 1A17A 3D9OA 2J08A 5EYPF 4ANXA 1LTXA 4Q69A 3ZRHA 5HKPA 4CGVA 5JHAA 4I1MA 3Q75A 2YNQA 3E33A 3ML8A 5JJTA 3QKYA 2BEDA 3I4GA 3PUJA 5KNHD 3ASFA 1KPSB 2AVPA 4XIFA 4YDOA 3LY8A 3E34A 2KATA 4AY5A 3V30A 4NURA 5BV1A 1NI1A 3LEWA 3PEUB 3LS8A 1G3NB 1OCCE 3UUXA 3D9KA 5ITZF 4Y6WA 4OVUA 1INZA 4H7YA 5G05C 5G04C 3E4BA 5B3SE 4WAFA 5FWQA 4GYWA 1E90A 3UPVA 3P2BA 3Q9UC 4UWLA 2I6HA 3Q7AA 3HXEA 2Y1LE 3SBTB 4H7XA 5CMYA 2WXGA 2BKGA 4IN3B 4OYSA 4B93B 2MOWA 1E8WA 5D0OD 3O4ZA 3JCKC 3IV0A 4NQ0A 1O1RA 2X6KA 4JW1A 3APDA 4KBQA 3ZIMA 3FH7A 4ACKA 2WQ7A 3WG7E 5DBKA 2FBNA 2KXPC 2AJAA 3CVXA 4G1TA 2CFUA 4EZJA 2HE0A 3TWXA 3CHSA 3DRAA 1NL4A 5AQ7A 1N54A 3CK9A 3L13A 4AXHA 2LSVA 2KCKA 1N11A 4APOA 2F37A 1WM5A 5ANLA 3P1UA 3KAEA 4GTSA 3U66A 3FY4A 1OY3D 4GTTA 1OWMA 2R03A 5KBAA 3FH8A 3APFA 3G2WA 1ELWA 4EQFA 3AG4E 3AG2E 2AXVA 1JWGA 3UX4A 2Y4TA 3DSTA 5C1DA 4F6RD 4KVOA 4YVQC 5EDSA 5ENQD 4E6HA 3ZHEB 1UN8A 2VGEA 5KJMA 2HR2A 4J8DA 4BTBA 5CBOA 1D9SA 3SFYA 1EPUA 2OOEA 4HQDA 1E8XA 3TWVA 1YCSB 4ACLA 1NFIE 3UI2A 1H0AA 3CVUA 4MLPA 2ZISA 1AWCB 4BFRA 1E96B 2WXRA 4A3VA 3PUKA 4JEUA 2PQNA 4UWHA 1D8EA 4N39A 2GROB 2IY0C 3E37A 2I1JA 4PH4B 3HG0D 5A23A 4HB5A 4I6EA 2IO2C 1OCRE 2GRPB 2LNIA 3MA5A 4CT4A 3Q79A 5LOZA 4FLHA 5FQ6A 2IONA 3CVLA 3UIOC 1MZCA 3LPZA 3CHRA 1IXVA 2CHXA 1JCRA 4GMLA 3PDNA 1E8YA 4GZDA 4KT6B 2GRNB 2JEKA 4BWRA 4DX1A 4F1SA 1YYHA 4BT8A 4IULA 3TGOA 2LXMA 1TNOA 3D9NA 4GMRA 4HRMB 1U3CA 1KZPA 3SI5A 4G26A 3TL5A 1QBQA 3DPDA 2WPVA 2V5QC 1NA0A 2DIWA 1N0RA 2V0PA 2GRLA 3PZ3A 2CHWA 2GRMA 2XEEA 2XENA 1XNFA 2WQHA 1H6PA 3RRNB 1BI8B 4GPMA 4JC8A 1H6OA 2WXJA 2VTBB 3L16A 4PS7A 2WXHA 4MS6A 1H2TC 1S64A 2J49A 5ANRA 3SY2A 1U2VG 4TXPA 2X6HA 4B0ZA 1K1AA 4ZHBA 3IXEA 5AN8A 3DSUA 5CBNA 2R59A 3B7BA 4APFA 3DEPA 3SFZA 5ENRD 3TWUA 1TNUA 2BF0X 4CRWA 4ILHB 3G2SA 3E30A 4AM9A 2R05A 3B7TA 3Q4AB 5T8IA 2X38A 2LSUA 3ZU7B 2P9SG 1BU9A 3PZ2A 1FPPA 5G04J 1IQRA 4TRQA 3HDXA 1VDYA 4IYPA 1H6KA 2X3MA 3AU4A 4IRUA 3CSTA 3ASNE 2MYOA 4L9PA 4YVOA 3W9FA 4KZCA 1TJCA 4N3BA 3ZVVA 1BI7B 4WWOA 4B89A 3FTSA 5M72A 4N2QA 3IHYA 3QOUA 4PUCA 5ENSD 4XI9A 3ZFWA 4M7CA 4U04A 4Y6CA 3TG5A 4GPKA 1Z5SC 4I9EA 4FU3A 3NF1A 3VTYA 1WG0A 5FZQA 3UM3A 4CGWA 2KCVA 1MX6A 4BY6A 3PE4A 2AW6A 1HU3A 3URZA 3C3OA 1FVFA 2LO6A 1NP7A 3HXFA 4C48B 3RAUA 2ZXWE 3GYZA 2LAIA 4CDNA 3CLJA 5ENOD 2XS8A 1EF1C 1SZAA 4DLOA 3F6QA 3FH5A 4YDEA 3FUHA 3C3RA 4EPZA 2XCBA 1UOHA 2E2EA 4JA7A 3FDHA 3R7QA 1O1SA 1PY1A 3SO8A 3C98A 3GZ1A 1TNBA 2AWIA 5CEDB 2X6JA 1TEZA 2WXIA 3EU5A 4TUUA 2YHCA 4C0EA 4ABNA 4I6JA 2BUGA 2JLBA 2EQXA 1YMPA 3PRZA 4JD2G 4RQIA 2FO7A 5CCLA 2I2OA 5LP0A 5BNWA 3HXDA 2WMNA 4I2ZA 2XGSA 3TWRA 2PM6A 5JHBA 4ME2A 1NZNA 4GZ3A 2IF4A 2XZDG 3R9AB 3TG4A 5FIOA 1OWNA 1LD8A 3OXFA 3ZGQA 4O1PA 1DC2A 2C0MA 1BD8A 4U0SA 3OXGA 1WAO1 2R2LA 2C2LA 5EX0A 4AY6A 2YHEA 4EHMA 4OVVA 1E8ZA 3CVPA 3HIZA 5E75A 4FHKA 3EIJA 4UWKA 3K9IA 2UY1B 2EIKE 4OAVB 1BPOA 3E32A 3U9WA 4J0UA 3ZEFA 5J08A 4U95D 3HYMB 1TN8A 3Q78A 3QWWA 4U0UA 2OEVA 4I6GA 3RO2A 3LVQE 2P9NG 1NA3A 5LCWJ 4MBGA 3Q49B 3BQOA 3MV2B 5LX8A 3U64A 2J8SD 3L08A 2VYIA 3RIBA 1MX2A 2XEHA 3ZUVB 5ENTD 1W3BA 1O1TA 3L9TA 3I3NA 4C9BB 3T8MA 4BETA 5AQAA 4ATGA 3LDZA 3JXJA 1N0QA 2DYSE 1EYHA 3MEKA 4CDMA 4KYOB 2X6IA 4AEZC 3KS2A 3S7FA 4J8EA 2V8SE 4HLEA 4JXTA 3KSLA 2ZU6B 3PZ4A 3JUEA 2EILE 3ZHEA 3ZKJA 2QYUA 3SZ7A 2WMOA 5E76A 2F0YA 4RLYA 3UINC 3CVWA 1HFAA 4UQYA 3VLDA 4EECA 2QYJA 3T9KA 1HX8A 1P5QA 2L9BA 3BU8A 5AQBA 4LRZA 5AQ9A 3BG1B 4XKBA 3CIAA 3IHVA 5D2MC 5FQ4A 3QWPA 4DRXE 3VLFA 4LNUD 4TXQA 3ASOE 3LJ3A 3LYAA 3HHMA 4FHJA 5EKQD 4AOFA 3MGBA 5G55A 1OT8A 4GZCA 1H19A 1TN6A 4F3VA 3DPYA 3QK0A 3BG0B 3EHQA 2DBAA 2WXPA 3S7JA 2WM9A 5HRYA 3EJNA 4JEHA 2BTDA 5CMWA 3CVQA 2WXMA 1X5BA 2DWZA 2R5SA 2CG2A 2H6HA 5B1AE 1IHGA 3C5RA 2FO1E 3FUIA 2H6FA 2QFCA 4DPRA 2XPZA 1Z3YA 2PL2A 3AAAC 4K5CA 3APCA 3VLEA 1OXJA 3FU3A 3B13A 3PZ1A 1U3DA 4A3TA 3J5QB 1E7UA 3RO3A 3TXMA 3SD5A 3DXKG 1X81A 4JB8P 1LD7A 2IFUA 2Y3AA 3Q7FA 4FA6A 4LEUA 4F1PA 3Q15A 1MQSA 3HXCA 2H6IA 2J4BA 2HO1A 2IJGX 1FT1A 2GGFA 2M63A 3CKBA 3DXMG 5G05J 3EDTB 4YDWA 2P9KG 1OCOE 4V3IA 4JZYA 2OV8A 3I5PA 3ZN3A 3O48A 4WNFA 5FT9A 3OTNA 2LXLA 3ZXSA 5FINA 4FLBA 1Z3XA 2RFAA 2NSZA 3DSXA 4KVMA 3BUAA 3SQVA 2P58C 4F53A 3NBNB 1JUQA 5D0QD 3FTVA 3DWLG 5ARFA 4XEIG 2CG3A 1MYOA 4HOSA 4A55A 4BT9A 4CT0A 3PS6A 5EN5D 1DCEA 3SFXA 5ARGA 4HI9A 2J07A 3L82A 3QWVA 2CFZA 3FUJA 3QAQA 1QNFA 2A4ZA 1HZ4A 3LJNA 1E7VA 5KJNA 4ANUA 4BSXA 4TUMA 3CQGB 3CVYA 5HI7A 1SZ9A 3SF4A 2L6BA 2RD0A 5JMND 5ENPD 3D3MA 4GB9A 4UWFA 4O1OA 4BX9A 4RSYA 5LCWC 2XRZA 3AG1E 3PEVB 3NQPA 5CRVA 4MKTA 3CR3A 1QYMA 3ULEG 1IHBA 5BXOA 3TWQA 4L2YA 1HE8A 5EILA 2XGMA 2VGXA 2KC7A 4AJWA 1IYGA 2IO3C 5J90A 3HXBA 3W9GA 2PM7A 2X6FA 3Q47B 3NB2A 4GTPA 4GYYA 1ZBPA 3UXGA 4I43A 4HI8A 2E0IA 2VJ8A 4NACA 1HF8A 4HOQA 4FP7A 1JCQA 2ILRA 3CEQA 2XZTG 1SVXA 2Y4UA 4GTRA 2CHZA 4DX2A 3UTMA 4FULA 4RG9A 4Z68A 4AV7A 1TNZA 4LCTA 4UQXA 3PREA 3V79K 3HRAA 4FADA 4G8KA 3FFLA 4J6IA 3TJPA 2L0IA 3DBSA 2FI7A 2ONDA 4ILGA 1IKND 5BV0A 4ANVA 3EIQC 3CK7A 3AS5A 4E85A 1QQEA 4C0MA 4P29A 2P2CP 3CKCA 4JHJA 2VSYA 1QZ2A 4K03A 2WXNA 5CEAA 3FU0A 4GZ6A 2F8XK 5FJYA 3G2TA 1ELRA 4X8QA 2KBXA 5CECB 4GTVA 4G24A 5AYWD 1TNYA 4WWNA 2KM4A 3JYSA 1HO8A 3MZLB 4J8FA 3FTYA 4K0RA 3PNTB 3ZYKA 2L0TB 4GTOA 3V2OA 1IQUA 4K5BA 4XKCA 1HS6A 1LF8A 4G23A 3PNLB 4DJAA 4RVBA 3NOCD 3CQCB 3LY7A 3J5PA 2JABA 3RK6A 2XPIA 1N4RA 4DX5D 2FEZA 4FC8A 4JA9A 3ASDA 1TN7A 5FZSA 2KCLA 3BEEA 3RJVA 1PAQA 2VSNA 4G25A 1Y6IA 4UI9C 3KSQA 2I9CA 3UT4A 4G8LA 3DSSA 4U8YD 2RG8A 3QNKA 4GCNA 4TXRA 2WXFA 3CSFA 4FJYA 4L1BA 3AS8A 2WXOA 2XCCA 1S70B 2GRQB 5KJLA 4WWPA 3Q9NC 3FEYA 1TR4A 4QFVA 4HBDA 2XHEA 2DYRE 2OVBA 5JA4D 3B7SA 1A5EA 3UM2A 5A6CA 4LERA 1L5JA 3Q5MA 5IY5E 4WNGA 2IEJA 5BT1A 4GMJA 3T5VA 3VTXA 4GA2A 5KCMA 5AIJA 4GAAA 1K1BA 1UJJA 5CERB 1OWLA 3NAWA 3KEZA 3ESLA 3ZNGA 1UW4B 3I4RB 4DI4A 2KZTB 3UT7A 4CEMA 4HOTA 2XEVA 4O60A 2XRYA 1KT1A 3ESKA 3UKUG 3IBEA 3QB2A 3MCXA 4LUNU 4J8YA 3HVEB 3FUMA 4D10C 2VQ2A 2NXPA 2VSOE 3FUFA 4CZ2D 2EIJE 4EZKA 3UT8A 1JPLA 3D9MA 5AARA 4B8AA 2FULA 3RU0A 3DEOA 4DLQA 4BEPA 3CGHA 2WB2A 3D9JA 2UWJG 3D9LA 4HNAD 5CHEE 3S7DA 4CCAA 2YINA 4XI0A 2Y0BG 3FTWA 2XS1A 2FF4A 4KZ0A 3C3QA 1Z6TA 2J4DA 3FHEA 5ENNA 3LVRE 1K8KG 3GW4A 4HRLA 4HS2A 1KLXA 3ISMC 4R7LA 5FQ7A 3PE3A 3Q73A 2OEWA 1JCSA 4A63B 3TWTA 3ZW3A 4BX8A 3FTXA 4A1SA 3D9IA 4HORA 4BSZB 1YA0A 1N4QA 1SA5A 4BERA 3ABKE 2HYZA 3CHMA 3EHMA 5CRUA 3EHRA 4U07A 3CVVA 4PDXA 4HFGA 3EUVA 3B95A 5BUZA 1FT2A 4ILIA 1MHQA 2L6JA 4L23A 4HVBA 5KJKA 1Q2ZA 3HVEA 2J9QA 3ULYA 2VTBA 4CDRA 5KWDA 4YDYA 2DZOA 4XZ4A 4GCOA 2WXQA 4HLLA 4U7EB 3T8KA 4I1AA 4DX7D 2P9UG 1HG5A 5H7PA 4DUIA 5G2NA 4U0ZA 1TJFA 4Q96A 3PZDA 3FU6A 3PH0C 1OWOA 3FULA 2WXKA 3ZYLA 4B8CB 4J8SA 3MV3B 4HXIA 3UM0A 2PZIA 1OCZE 2IOLA 1OUVA 2ZGDA 4HRNA 2DVWA 1ZB1A 5BXUA 5EX3A 1N94A 2V5FA 5EIDA 3ASHA 3B7RL 4GU5A 3G2VA 3X2QE 2R02A 2YQ8A 2XGOA 2AXUA 2ETCA 3ML9A 2IOSA 3NZSA 2F8YA 2B6CA 2J09A 2OVFA 4L7TA 3L54A 3PVLA 3JQ0A 4UWGA 3T5XA 3CK8A 4EZLA 3G2UA 3MJWA 4W9RA 4DI3A 3LCAA 2IU1A 3FU5A 3SBSA 3ASGA 3FUDA 4ZFHA 1MJ0A 2MHKA 4N3AA 1KZOA 3AS4A 3S7BA 3U4TA 3D9PA 3ONLA 4JPSA 3S2AA 4TV3A 5AJDA 3R9MA 4UI9K 1JWFA 3L17A 1EDUA 1N4PA 4CYMD 4DX6D 3MKQB 2UY1A 3UMVA 1Y8MA
chains in the Genus database with same CATH topology
2ONDA 3MX3A 4ILGA 4KMOA 2A5UA 2FBNA 4I1OB 4RG6A 4G1TA 2C0MA 2CFUA 4EZJA 3CVXA 5BV0A 3SGHA 4U0SA 4ANVA 2KZTA 3N71A 3OXGA 3CHSA 3EIQC 1WAO1 2C2LA 3CK7A 3ENEA 4U8HA 3AS5A 4E85A 5EX0A 1QQEA 4AY6A 4C0MA 2YHEA 1N54A 4P29A 3RRMB 3CK9A 3L13A 3CKCA 4OVVA 1E8ZA 3CVPA 3HIZA 5E75A 4AXHA 1XGWA 2LSVA 4FHKA 2KCKA 3AU5A 2I1KA 4JHJA 5FQ8A 2VSYA 1QZ2A 4K03A 2WXNA 4I9CA 4APOA 4HOUA 3EIJA 3NZUA 3FU0A 2WQ6A 4UWKA 3K9IA 4GZ6A 2VSXE 1WM5A 5ANLA 2UY1B 3P1UA 3L22A 3KAEA 5FJYA 3U66A 3FY4A 1BPOA 3U9WA 3G2TA 1ELRA 1OWMA 4J0UA 3ZEFA 5J08A 4F7AA 3FH8A 3APFA 3G2WA 3HYMB 4G24A 4MRUA 3FUNA 1B89A 3KD7A 4I2WA 4WWNA 5AYWD 2KM4A 3JYSA 5DIZA 5JJ7A 1HO8A 3JUIA 3MZLB 4J8FA 1ELWA 3FTYA 4K0RA 4EQFA 3QWWA 4U0UA 3PNTB 1UG3A 3ZYKA 4I6GA 2L0TB 2XQ0A 3RO2A 1IQUA 2AXVA 3LVQE 1JWGA 1NA3A 5LCWJ 3UX4A 1HXIA 4B94A 2Y4TA 4XKCA 1HS6A 5C1DA 3Q49B 1LF8A 3IKOB 4G23A 3PNLB 4DJAA 4KVOA 3MV2B 1ZU2A 3L6AA 4RVBA 4L2LA 3CQCB 3LY7A 3R7RA 3GZSA 4YVQC 5LX8A 5LFAA 5EDSA 4XX5A 4E6HA 3RK6A 3ZHEB 2XPIA 3RRUA 3U64A 1UN8A 3L08A 2VYIA 4YNDA 3RIBA 2HR2A 2FEZA 4FC8A 4JA9A 5KJMA 4J8DA 4BTBA 2AXZA 3ASDA 4DK5A 1HG2A 5FZSA 1W3BA 1EPUA 2KCLA 2OOEA 3BEEA 4GA0A 3RJVA 1E8XA 1PAQA 4ACLA 2WVIA 1PC2A 2PQRA 2VSNA 1H0AA 4G25A 3I3NA 3CVUA 4MLPA 4C9BB 1Y6IA 3T8MA 4UI9C 4BFRA 2I9CA 4ATGA 1E96B 3LDZA 5T4YA 2WXRA 4A3VA 3PUKA 3UT4A 4JEUA 1EYHA 2HM8A 4WNDA 2PQNA 4UWHA 3MEKA 3CV0A 2GW1A 4N39A 4CDMA 4G2VA 3LKUA 4UI9J 2WXLA 4KYOB 2X6IA 4AEZC 2I1JA 2RG8A 4PH4B 4EBAA 3KS2A 5A23A 4I6EA 1WY6A 3QNKA 4J8EA 3S7FA 2V8SE 4GCNA 4PS8A 4AIFA 2LNIA 2WXFA 4JXTA 4N5CA 4HLEA 2ZU6B 3CSFA 3LY9A 4FJYA 2C0LA 3MA5A 4L1BA 4CT4A 5LOZA 4FLHA 3AS8A 3ZHEA 2WXOA 2IONA 2XCCA 3CVLA 3FP3A 2WMOA 5FQ6A 3SZ7A 4BTAA 5E76A 3MYVA 3LPZA 4PS3A 3CHRA 2CHXA 5BPPA 3CVWA 1HFAA 3QDNA 2QY7A 4GMLA 3PDNA 3OAWA 4UQYA 1FVHA 3RKVA 1E8YA 1FCHA 4GZDA 3VLDA 4EECA 4WWPA 5KJLA 4KT6B 3IEGA 2JEKA 4BWRA 3FEYA 3EHNA 3WXXA 1HX8A 4F1SA 1P5QA 1H2VC 4BT8A 4IULA 4QFVA 2XHEA 1ELKA 2L9BA 5FZRA 3TXNA 3TGOA 3UQ3A 3D9NA 2OVBA 3U3WA 4LRZA 1GW6A 3B7SA 3ZYQA 3BG1B 4JL0A 3UMVA 4XKBA 3CIAA 1U3CA 5A6CA 4LERA 4G26A 3SI5A 3QC1A 1L5JA 3TL5A 3JQ1A 3IHVA 3TAXA 3Q5MA 5FQ4A 4N2SA 3DPDA 3QWPA 1DVPA 4WNGA 3VLFA 2WPVA 3SNXA 5BT1A 4GMJA 1NA0A 3T5VA 2DIWA 3VTXA 3LJ3A 4GA2A 3LYAA 5KCMA 3CHOA 3HHMA 4UQZA 5AJLA 2V0PA 2GRLA 4GAAA 5AIJA 1UJJA 2CHWA 4FHJA 5EKQD 4AOFA 1OWLA 2GRMA 3MGBA 5G55A 3KEZA 4AP2A 3ESLA 1H19A 4GZCA 4WUYA 1XNFA 1UW4B 3SHFA 4F3VA 3I4RB 5C2YA 4DI4A 3FTUA 2KZTB 3UT7A 5JJ6A 2DCPA 3FWVA 3QK0A 3FUKA 3BG0B 4CEMA 4AVXA 2DBAA 4HOTA 2WQHA 3RRNB 2XEVA 5A7DB 2XRYA 2WXPA 1KT1A 3S7JA 2WM9A 3EJNA 3ESKA 2BTDA 2WXJA 4JEHA 4JC8A 3IBEA 3CVQA 5CMWA 4M3OA 5AENA 3QB2A 2VTBB 3MCXA 4LUNU 4Q94A 3L16A 4U63A 3HVEB 3FUMA 4PS7A 1UN9A 4D10C 1UJKA 2VQ2A 2NXPA 2WXMA 2WXHA 4MS6A 2VSOE 1H2TC 1X5BA 4WNEA 2MRIA 2R5SA 3FUFA 5BW8C 4FJZA 2Q7FA 2J49A 2CG2A 5FTPA 5HQ8A 2IQCA 3CHQA 5ANRA 4EZKA 3UT8A 1IHGA 2X6HA 1JPLA 3D9MA 4B0ZA 4G11A 4B8AA 2FULA 3RU0A 4DLQA 3ONKA 3LXUX 3CGHA 3FUIA 4GYOA 2WB2A 3D9JA 2QFCA 2UWJG 3D9LA 4DPRA 2XPZA 5CHEE 3S7DA 4JHKA 4CCAA 1Z3YA 3ULQA 2PL2A 2YINA 4XI0A 3FTWA 4A1GA 2R59A 3QJZA 4APFA 2FF4A 3APCA 1S0PA 3VLEA 3FU3A 3OXLA 3B13A 4KZ0A 3SFZA 5T3RA 1Z6TA 4JHRA 1U3DA 4A3TA 2J4DA 1DNPA 2LAHA 3FHEA 1SQMA 2BF0X 5ENNA 3LVRE 1E7UA 3FEXA 3MKRA 3GW4A 3RO3A 3MKQA 2NC9A 3TXMA 4HS2A 4ILHB 1KLXA 1H2UA 3G2SA 4R7LA 3SD5A 4CRWA 2VGYA 4I17A 5FQ7A 3PE3A 4AM9A 3B7TA 3Q4AB 4NRHB 2IFUA 2Y3AA 5CCMA 4FA6A 4LEUA 3Q15A 1OWPA 3GZ2A 5T8IA 2X38A 1HH8A 1MQSA 2LSUA 3ZW3A 3QARA 4BX8A 3FTXA 4A1SA 2J4BA 4GZ5A 3D9IA 1KT0A 2HO1A 4HORA 2IJGX 2R17C 2GGFA 2M63A 3CKBA 5G04J 5G05J 1N52A 2V4LA 1YA0A 3EDTB 2VGXB 2XPYA 1IQRA 3FTZA 4V3IA 4TRQA 4JZYA 4N3CA 2OV8A 3I5PA 3ZN3A 2HYZA 3O48A 3HDXA 4WNFA 3CHMA 3EHMA 3FUEA 5FT9A 1VDYA 4IYPA 4KXKB 3OTNA 4U07A 4GA1A 3B7UX 1H6KA 4PDXA 3ZXSA 3CVVA 4HFGA 3CHPA 4FLBA 2X3MA 3AU4A 4XE0A 1Z3XA 4URKA 2NSZA 4IRUA 3CSTA 5BUZA 3ZPJA 4KVMA 4O6FA 4JVSA 2P58C 4ILIA 4EBAG 1MHQA 4YVOA 2L6JA 4L23A 4F53A 4KZCA 1TJCA 1JUQA 4N3BA 5D0QD 3CVNA 3FTVA 5ARFA 3ZVVA 4HVBA 3ZYMA 4ANWA 5KJKA 4WWOA 3HVEA 2CG3A 2J9QA 4HOSA 2VTBA 4B89A 4A55A 3FTSA 5M72A 4N2QA 4BT9A 1A17A 3IHYA 3QOUA 4CDRA 4CT0A 3PS6A 4PUCA 5ARGA 4XI9A 3ZFWA 2J07A 3D9OA 3QWVA 2J08A 2CFZA 3FUJA 3QAQA 4XZ4A 1QNFA 2WXQA 4GCOA 4U04A 4Y6CA 4ANXA 2A4ZA 1HZ4A 4I1AA 3ZRHA 4Q69A 3TG5A 1E7VA 5JHAA 4CGVA 4GPKA 4I1MA 4I9EA 5KJNA 2YNQA 1HG5A 3ML8A 4ANUA 5JJTA 4FU3A 4BSXA 5G2NA 3NF1A 3VTYA 3CVYA 3CQGB 3QKYA 4U0ZA 1TJFA 4Q96A 5HI7A 1SZ9A 3PZDA 5FZQA 3SF4A 3FU6A 3PH0C 1OWOA 2KCVA 2RD0A 3I4GA 3PUJA 4CGWA 3ASFA 3FULA 4BY6A 2WXKA 3PE4A 2AW6A 1HU3A 3D3MA 2AVPA 3ZYLA 4B8CB 3URZA 4J8SA 4GB9A 3MV3B 4UWFA 4BX9A 4HXIA 4XIFA 2PZIA 4RSYA 5LCWC 2XRZA 3PEVB 3LY8A 1FVFA 2LO6A 1NP7A 3NQPA 2IOLA 2KATA 1OUVA 4MKTA 4AY5A 3CR3A 4NURA 5BV1A 3GYZA 2LAIA 4CDNA 3CLJA 5EX3A 3LEWA 2V5FA 3PEUB 1EF1C 3ASHA 3LS8A 3B7RL 4L2YA 4GU5A 1HE8A 3UUXA 1SZAA 2XGMA 3D9KA 2VGXA 4DLOA 3G2VA 2KC7A 4AJWA 2YQ8A 4Y6WA 2XGOA 3FH5A 2AXUA 4OVUA 1IYGA 1INZA 3ML9A 2IOSA 4H7YA 3FUHA 3NZSA 5G05C 5G04C 5J90A 4EPZA 2J09A 2XCBA 2OVFA 3E4BA 4L7TA 3L54A 2E2EA 3PVLA 2PM7A 2X6FA 4WAFA 3Q47B 5FWQA 4JA7A 3FDHA 3JQ0A 1E90A 4GYWA 3R7QA 1PY1A 4UWGA 3UPVA 3P2BA 3C98A 3GZ1A 3T5XA 3CK8A 4GYYA 2AWIA 4EZLA 1ZBPA 2X6JA 4I43A 1TEZA 2WXIA 3G2UA 2E0IA 3MJWA 2VJ8A 2I6HA 4UWLA 4TUUA 2YHCA 4NACA 4W9RA 4C0EA 1HF8A 4H7XA 4HOQA 5CMYA 2WXGA 3SBTB 4FP7A 4IN3B 4DI3A 4OYSA 3LCAA 2MOWA 2IU1A 2ILRA 3CEQA 4ABNA 3FU5A 3SBSA 3ASGA 3FUDA 4I6JA 1E8WA 5D0OD 2BUGA 2JLBA 2Y4UA 2MHKA 2CHZA 4N3AA 2EQXA 3AS4A 3O4ZA 3PRZA 3S7BA 3U4TA 3D9PA 4FULA 3ONLA 4RG9A 4AV7A 2FO7A 4JPSA 3JCKC 3IV0A 3S2AA 5CCLA 4NQ0A 2I2OA 5LP0A 5BNWA 4TV3A 2X6KA 4JW1A 4LCTA 2WMNA 3APDA 4I2ZA 4UQXA 5AJDA 3PREA 4UI9K 2XGSA 1JWFA 3L17A 1EDUA 2PM6A 5JHBA 4FADA 4ME2A 4KBQA 3MKQB 1NZNA 4GZ3A 3FFLA 2IF4A 4J6IA 3TJPA 3R9AB 3TG4A 3ZIMA 3FH7A 4ACKA 2UY1A 2WQ7A 1OWNA 2L0IA 5DBKA 3OXFA 3DBSA 2FI7A 3ZGQA 1Y8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OND A;  3SF4 A;  5FZQ A;  2FBN A;  4GYO A;  4RG6 A;  4G1T A;  2C0M A;  3KS2 A;  2QFC A;  2UWJ G;  2KCV A;  4J8E A;  3S7F A;  4GCN A;  4U0S A;  5CHE E;  3ASF A;  3N71 A;  3S7D A;  4AIF A;  2LNI A;  3OXG A;  4N5C A;  3PE4 A;  2PL2 A;  1WAO 1;  4XI0 A;  2AVP A;  3ULQ A;  3LY9 A;  2C2L A;  3CK7 A;  3URZ A;  2C0L A;  3MA5 A;  3AS5 A;  5EX0 A;  1QQE A;  3MV3 B;  4AY6 A;  2FF4 A;  3AS8 A;  4XIF A;  3OXL A;  3ZHE A;  2PZI A;  2XCC A;  3CK9 A;  3CVL A;  3FP3 A;  3SZ7 A;  3CKC A;  4JHR A;  4BTA A;  5LCW C;  3CVP A;  3LY8 A;  3LPZ A;  2LSV A;  2KCK A;  4APO A;  2KAT A;  1OUV A;  1QZ2 A;  2VSY A;  4I9C A;  4AY5 A;  4HOU A;  3QDN A;  3MKR A;  3PDN A;  3GW4 A;  3K9I A;  4GZ6 A;  2NC9 A;  4UQY A;  3RKV A;  1FCH A;  1WM5 A;  1KLX A;  3GYZ A;  3ZGQ A;  2UY1 B;  5KJL A;  2VGY A;  4I17 A;  5EX3 A;  3PE3 A;  2V5F A;  3IEG A;  3KAE A;  4AM9 A;  5FJY A;  3ASH A;  4BWR A;  3Q4A B;  3WXX A;  4NRH B;  1P5Q A;  1ELR A;  4BT8 A;  2IFU A;  3UUX A;  5CCM A;  4LEU A;  2XGM A;  3Q15 A;  5FZR A;  2VGX A;  3GZ2 A;  4J0U A;  3TGO A;  1HH8 A;  2LSU A;  3UQ3 A;  2KC7 A;  4A1S A;  3HYM B;  4GZ5 A;  2YQ8 A;  4G24 A;  4Y6W A;  3KD7 A;  1B89 A;  2XGO A;  4I2W A;  1KT0 A;  2HO1 A;  5AYW D;  3U3W A;  3JYS A;  5DIZ A;  5JJ7 A;  4HOR A;  3CKB A;  5G04 J;  1IYG A;  5G05 J;  4CGW A;  4H7Y A;  1YA0 A;  3EDT B;  4JL0 A;  2VGX B;  4J8F A;  5G05 C;  1ELW A;  5G04 C;  4EQF A;  5A6C A;  3QWW A;  4G26 A;  4U0U A;  4N3C A;  2XCB A;  3E4B A;  4N2S A;  3TAX A;  3Q5M A;  2E2E A;  3QWP A;  3RO2 A;  3ZN3 A;  2HYZ A;  3O48 A;  4WNG A;  3Q47 B;  4WNF A;  2WPV A;  3QKY A;  4JA7 A;  4GYW A;  1NA3 A;  5KJM A;  5FT9 A;  5BT1 A;  5LCW J;  3UPV A;  1NA0 A;  3GZ1 A;  1HXI A;  4B94 A;  3VTX A;  5DBK A;  4KXK B;  2Y4T A;  3CK8 A;  4GA2 A;  3LYA A;  4GYY A;  5C1D A;  3Q49 B;  4U07 A;  1ZBP A;  4GA1 A;  4UQZ A;  4G23 A;  4N2Q A;  4ABN A;  3MV2 B;  5EKQ D;  1ZU2 A;  2I6H A;  2YHC A;  3LY7 A;  4W9R A;  4HOQ A;  4H7X A;  4YVQ C;  3ZHE B;  3ZPJ A;  2XPI A;  4IN3 B;  3LCA A;  4O6F A;  2P58 C;  4WUY A;  3CEQ A;  2VYI A;  4YND A;  1XNF A;  2HR2 A;  2FEZ A;  4YVO A;  4JA9 A;  2L6J A;  4J8D A;  3RIB A;  4F3V A;  4BTB A;  1TJC A;  3ASG A;  3ASD A;  4N3B A;  5D0Q D;  5D0O D;  3CVN A;  2BUG A;  5ARF A;  2JLB A;  2Y4U A;  3FWV A;  5FZS A;  5JJ6 A;  2MHK A;  1W3B A;  2KCL A;  4N3A A;  5KJK A;  2DBA A;  2OOE A;  3BEE A;  2WQH A;  2J9Q A;  3AS4 A;  4GA0 A;  3RJV A;  4HOS A;  2XEV A;  3S7B A;  4HOT A;  3U4T A;  5M72 A;  5A7D B;  4BT9 A;  3S7J A;  1A17 A;  1KT1 A;  4RG9 A;  3QOU A;  4CDR A;  2FO7 A;  3ESK A;  1PC2 A;  2PQR A;  2VSN A;  3CVQ A;  4NQ0 A;  5CCL A;  4G25 A;  5BNW A;  5ARG A;  4XI9 A;  3ZFW A;  3QWV A;  4I2Z A;  4UQX A;  2VQ2 A;  4UI9 C;  4UI9 K;  3RU0 A;  2XGS A;  4GCO A;  4WNE A;  2R5S A;  4U04 A;  4Y6C A;  4ME2 A;  1E96 B;  5BW8 C;  4KBQ A;  4I1A A;  1HZ4 A;  2Q7F A;  1NZN A;  4GZ3 A;  5FTP A;  3TG5 A;  3FFL A;  4CGV A;  3RO3 A;  2IF4 A;  4I9E A;  5HQ8 A;  4GPK A;  4WND A;  5KJN A;  2PQN A;  1IHG A;  3MEK A;  5JJT A;  3R9A B;  3TG4 A;  3CV0 A;  2GW1 A;  4N39 A;  3NF1 A;  2UY1 A;  4G2V A;  3VTY A;  3LKU A;  3OXF A;  4U0Z A;  4UI9 J;  5HI7 A;  2FI7 A;  4KYO B;  1Y8M A; 
#chains in the Genus database with same CATH topology
 3MX3 A;  4KMO A;  2A5U A;  4I1O B;  4RG6 A;  3SGH A;  2KZT A;  2Y69 E;  3N71 A;  2RKK A;  2ZGG A;  3ENE A;  4U8H A;  3V31 A;  3AG3 E;  3RRM B;  4N5Q A;  4ATZ D;  1V55 E;  1XGW A;  3AU5 A;  5FQ8 A;  2I1K A;  4I9C A;  4HOU A;  2WQ6 A;  3NZU A;  2VSX E;  3UIP C;  3L22 A;  2P9L G;  2LUH A;  1AP7 A;  5D66 A;  4LSZ E;  4F7A A;  4U8V D;  3KEA A;  4MRU A;  3FUN A;  1B89 A;  3KD7 A;  4I2W A;  5JJ7 A;  1SA4 A;  5DIZ A;  3JUI A;  3TWS A;  1UG3 A;  4LG6 A;  2XQ0 A;  2P9I G;  2QC9 A;  2EIN E;  1HXI A;  4B94 A;  3UM1 A;  3IKO B;  5HS0 A;  3AJI A;  3ABL E;  1ZU2 A;  3L6A A;  4L2L A;  3R7R A;  3GZS A;  5LFA A;  4XX5 A;  3RRU A;  1BLX B;  2H6G A;  2P9P G;  5EYL A;  1RW2 A;  4YND A;  2AXZ A;  4DK5 A;  1HG2 A;  2ETA A;  4GA0 A;  3UKR G;  3DSV A;  2ETB A;  2WVI A;  1PC2 A;  2PQR A;  2GRR B;  3C72 A;  3D9H A;  4BES A;  5T4Y A;  2HM8 A;  4WND A;  3CV0 A;  2GW1 A;  3DSW A;  4G2V A;  3LKU A;  4UI9 J;  2WXL A;  4EBA A;  1WY6 A;  1N4S A;  4PS8 A;  3V2X A;  4AIF A;  4N5C A;  3LY9 A;  2C0L A;  4GTQ A;  4GTM A;  2OCC E;  3FP3 A;  4BTA A;  1D8D A;  2PNN A;  3JXI A;  3MYV A;  4QQI A;  4PS3 A;  1MX4 A;  5BPP A;  3QDN A;  2QY7 A;  3NOG D;  3OAW A;  1FVH A;  3RKV A;  1FCH A;  3IEG A;  3EHN A;  3WXX A;  2A5E A;  1H2V C;  3EU9 A;  1ELK A;  5FZR A;  3TXN A;  1K3Z D;  2DZN A;  3UQ3 A;  3U3W A;  1GW6 A;  3ZYQ A;  2B0O E;  4JL0 A;  3QC1 A;  3JQ1 A;  4N2S A;  3TAX A;  2NYJ A;  1DVP A;  5AAO A;  3SNX A;  3CHO A;  4UQZ A;  5AJL A;  2BKK B;  4AP2 A;  4WUY A;  2V4H C;  3SHF A;  5C2Y A;  3FTU A;  5JJ6 A;  2DCP A;  3FWV A;  3FUK A;  4AVX A;  1V54 E;  4U96 D;  5A7D B;  4M3O A;  5AEN A;  4OAU C;  4Q94 A;  4U63 A;  1UN9 A;  1UJK A;  3ABM E;  4WNE A;  2MRI A;  5BW8 C;  4FJZ A;  2Q7F A;  5FTP A;  5HQ8 A;  2IQC A;  3CHQ A;  1RZ4 A;  4G11 A;  4K5A B;  4LNB A;  2QZA A;  3ONK A;  3LXU X;  4GYO A;  4JHK A;  1N9A A;  3ULQ A;  4LNG A;  4A1G A;  1O5M A;  3QJZ A;  1WDY A;  1S0P A;  3OXL A;  5T3R A;  2ZIR A;  5EIB E;  4JHR A;  4J7W A;  1DNP A;  2LAH A;  1SQM A;  2EIM E;  3FEX A;  3MKR A;  3MKQ A;  2NC9 A;  3TWW A;  1H2U A;  4UUC A;  2VGY A;  4I17 A;  3ZXP A;  4NRH B;  5CCM A;  1OWP A;  2RFM A;  3GZ2 A;  1HH8 A;  3QAR A;  4GZ5 A;  1KT0 A;  2R17 C;  1N52 A;  2V4L A;  2VGX B;  2XPY A;  3FTZ A;  4N3C A;  1TYQ G;  1SW6 A;  3FUE A;  1S63 A;  1DCQ A;  3RSE G;  4KXK B;  4GA1 A;  3B7U X;  5B1B E;  3CHP A;  4XE0 A;  4URK A;  5KNG A;  1N95 A;  3ZPJ A;  4O6F A;  4JVS A;  4EBA G;  3CVN A;  3ZYM A;  4ANW A;  4NIK A;  1A17 A;  3D9O A;  2J08 A;  5EYP F;  4ANX A;  1LTX A;  4Q69 A;  3ZRH A;  5HKP A;  4CGV A;  5JHA A;  4I1M A;  3Q75 A;  2YNQ A;  3E33 A;  3ML8 A;  5JJT A;  3QKY A;  2BED A;  3I4G A;  3PUJ A;  5KNH D;  3ASF A;  1KPS B;  2AVP A;  4XIF A;  4YDO A;  3LY8 A;  3E34 A;  2KAT A;  4AY5 A;  3V30 A;  4NUR A;  5BV1 A;  1NI1 A;  3LEW A;  3PEU B;  3LS8 A;  1G3N B;  1OCC E;  3UUX A;  3D9K A;  5ITZ F;  4Y6W A;  4OVU A;  1INZ A;  4H7Y A;  5G05 C;  5G04 C;  3E4B A;  5B3S E;  4WAF A;  5FWQ A;  4GYW A;  1E90 A;  3UPV A;  3P2B A;  3Q9U C;  4UWL A;  2I6H A;  3Q7A A;  3HXE A;  2Y1L E;  3SBT B;  4H7X A;  5CMY A;  2WXG A;  2BKG A;  4IN3 B;  4OYS A;  4B93 B;  2MOW A;  1E8W A;  5D0O D;  3O4Z A;  3JCK C;  3IV0 A;  4NQ0 A;  1O1R A;  2X6K A;  4JW1 A;  3APD A;  4KBQ A;  3ZIM A;  3FH7 A;  4ACK A;  2WQ7 A;  3WG7 E;  5DBK A;  2FBN A;  2KXP C;  2AJA A;  3CVX A;  4G1T A;  2CFU A;  4EZJ A;  2HE0 A;  3TWX A;  3CHS A;  3DRA A;  1NL4 A;  5AQ7 A;  1N54 A;  3CK9 A;  3L13 A;  4AXH A;  2LSV A;  2KCK A;  1N11 A;  4APO A;  2F37 A;  1WM5 A;  5ANL A;  3P1U A;  3KAE A;  4GTS A;  3U66 A;  3FY4 A;  1OY3 D;  4GTT A;  1OWM A;  2R03 A;  5KBA A;  3FH8 A;  3APF A;  3G2W A;  1ELW A;  4EQF A;  3AG4 E;  3AG2 E;  2AXV A;  1JWG A;  3UX4 A;  2Y4T A;  3DST A;  5C1D A;  4F6R D;  4KVO A;  4YVQ C;  5EDS A;  5ENQ D;  4E6H A;  3ZHE B;  1UN8 A;  2VGE A;  5KJM A;  2HR2 A;  4J8D A;  4BTB A;  5CBO A;  1D9S A;  3SFY A;  1EPU A;  2OOE A;  4HQD A;  1E8X A;  3TWV A;  1YCS B;  4ACL A;  1NFI E;  3UI2 A;  1H0A A;  3CVU A;  4MLP A;  2ZIS A;  1AWC B;  4BFR A;  1E96 B;  2WXR A;  4A3V A;  3PUK A;  4JEU A;  2PQN A;  4UWH A;  1D8E A;  4N39 A;  2GRO B;  2IY0 C;  3E37 A;  2I1J A;  4PH4 B;  3HG0 D;  5A23 A;  4HB5 A;  4I6E A;  2IO2 C;  1OCR E;  2GRP B;  2LNI A;  3MA5 A;  4CT4 A;  3Q79 A;  5LOZ A;  4FLH A;  5FQ6 A;  2ION A;  3CVL A;  3UIO C;  1MZC A;  3LPZ A;  3CHR A;  1IXV A;  2CHX A;  1JCR A;  4GML A;  3PDN A;  1E8Y A;  4GZD A;  4KT6 B;  2GRN B;  2JEK A;  4BWR A;  4DX1 A;  4F1S A;  1YYH A;  4BT8 A;  4IUL A;  3TGO A;  2LXM A;  1TNO A;  3D9N A;  4GMR A;  4HRM B;  1U3C A;  1KZP A;  3SI5 A;  4G26 A;  3TL5 A;  1QBQ A;  3DPD A;  2WPV A;  2V5Q C;  1NA0 A;  2DIW A;  1N0R A;  2V0P A;  2GRL A;  3PZ3 A;  2CHW A;  2GRM A;  2XEE A;  2XEN A;  1XNF A;  2WQH A;  1H6P A;  3RRN B;  1BI8 B;  4GPM A;  4JC8 A;  1H6O A;  2WXJ A;  2VTB B;  3L16 A;  4PS7 A;  2WXH A;  4MS6 A;  1H2T C;  1S64 A;  2J49 A;  5ANR A;  3SY2 A;  1U2V G;  4TXP A;  2X6H A;  4B0Z A;  1K1A A;  4ZHB A;  3IXE A;  5AN8 A;  3DSU A;  5CBN A;  2R59 A;  3B7B A;  4APF A;  3DEP A;  3SFZ A;  5ENR D;  3TWU A;  1TNU A;  2BF0 X;  4CRW A;  4ILH B;  3G2S A;  3E30 A;  4AM9 A;  2R05 A;  3B7T A;  3Q4A B;  5T8I A;  2X38 A;  2LSU A;  3ZU7 B;  2P9S G;  1BU9 A;  3PZ2 A;  1FPP A;  5G04 J;  1IQR A;  4TRQ A;  3HDX A;  1VDY A;  4IYP A;  1H6K A;  2X3M A;  3AU4 A;  4IRU A;  3CST A;  3ASN E;  2MYO A;  4L9P A;  4YVO A;  3W9F A;  4KZC A;  1TJC A;  4N3B A;  3ZVV A;  1BI7 B;  4WWO A;  4B89 A;  3FTS A;  5M72 A;  4N2Q A;  3IHY A;  3QOU A;  4PUC A;  5ENS D;  4XI9 A;  3ZFW A;  4M7C A;  4U04 A;  4Y6C A;  3TG5 A;  4GPK A;  1Z5S C;  4I9E A;  4FU3 A;  3NF1 A;  3VTY A;  1WG0 A;  5FZQ A;  3UM3 A;  4CGW A;  2KCV A;  1MX6 A;  4BY6 A;  3PE4 A;  2AW6 A;  1HU3 A;  3URZ A;  3C3O A;  1FVF A;  2LO6 A;  1NP7 A;  3HXF A;  4C48 B;  3RAU A;  2ZXW E;  3GYZ A;  2LAI A;  4CDN A;  3CLJ A;  5ENO D;  2XS8 A;  1EF1 C;  1SZA A;  4DLO A;  3F6Q A;  3FH5 A;  4YDE A;  3FUH A;  3C3R A;  4EPZ A;  2XCB A;  1UOH A;  2E2E A;  4JA7 A;  3FDH A;  3R7Q A;  1O1S A;  1PY1 A;  3SO8 A;  3C98 A;  3GZ1 A;  1TNB A;  2AWI A;  5CED B;  2X6J A;  1TEZ A;  2WXI A;  3EU5 A;  4TUU A;  2YHC A;  4C0E A;  4ABN A;  4I6J A;  2BUG A;  2JLB A;  2EQX A;  1YMP A;  3PRZ A;  4JD2 G;  4RQI A;  2FO7 A;  5CCL A;  2I2O A;  5LP0 A;  5BNW A;  3HXD A;  2WMN A;  4I2Z A;  2XGS A;  3TWR A;  2PM6 A;  5JHB A;  4ME2 A;  1NZN A;  4GZ3 A;  2IF4 A;  2XZD G;  3R9A B;  3TG4 A;  5FIO A;  1OWN A;  1LD8 A;  3OXF A;  3ZGQ A;  4O1P A;  1DC2 A;  2C0M A;  1BD8 A;  4U0S A;  3OXG A;  1WAO 1;  2R2L A;  2C2L A;  5EX0 A;  4AY6 A;  2YHE A;  4EHM A;  4OVV A;  1E8Z A;  3CVP A;  3HIZ A;  5E75 A;  4FHK A;  3EIJ A;  4UWK A;  3K9I A;  2UY1 B;  2EIK E;  4OAV B;  1BPO A;  3E32 A;  3U9W A;  4J0U A;  3ZEF A;  5J08 A;  4U95 D;  3HYM B;  1TN8 A;  3Q78 A;  3QWW A;  4U0U A;  2OEV A;  4I6G A;  3RO2 A;  3LVQ E;  2P9N G;  1NA3 A;  5LCW J;  4MBG A;  3Q49 B;  3BQO A;  3MV2 B;  5LX8 A;  3U64 A;  2J8S D;  3L08 A;  2VYI A;  3RIB A;  1MX2 A;  2XEH A;  3ZUV B;  5ENT D;  1W3B A;  1O1T A;  3L9T A;  3I3N A;  4C9B B;  3T8M A;  4BET A;  5AQA A;  4ATG A;  3LDZ A;  3JXJ A;  1N0Q A;  2DYS E;  1EYH A;  3MEK A;  4CDM A;  4KYO B;  2X6I A;  4AEZ C;  3KS2 A;  3S7F A;  4J8E A;  2V8S E;  4HLE A;  4JXT A;  3KSL A;  2ZU6 B;  3PZ4 A;  3JUE A;  2EIL E;  3ZHE A;  3ZKJ A;  2QYU A;  3SZ7 A;  2WMO A;  5E76 A;  2F0Y A;  4RLY A;  3UIN C;  3CVW A;  1HFA A;  4UQY A;  3VLD A;  4EEC A;  2QYJ A;  3T9K A;  1HX8 A;  1P5Q A;  2L9B A;  3BU8 A;  5AQB A;  4LRZ A;  5AQ9 A;  3BG1 B;  4XKB A;  3CIA A;  3IHV A;  5D2M C;  5FQ4 A;  3QWP A;  4DRX E;  3VLF A;  4LNU D;  4TXQ A;  3ASO E;  3LJ3 A;  3LYA A;  3HHM A;  4FHJ A;  5EKQ D;  4AOF A;  3MGB A;  5G55 A;  1OT8 A;  4GZC A;  1H19 A;  1TN6 A;  4F3V A;  3DPY A;  3QK0 A;  3BG0 B;  3EHQ A;  2DBA A;  2WXP A;  3S7J A;  2WM9 A;  5HRY A;  3EJN A;  4JEH A;  2BTD A;  5CMW A;  3CVQ A;  2WXM A;  1X5B A;  2DWZ A;  2R5S A;  2CG2 A;  2H6H A;  5B1A E;  1IHG A;  3C5R A;  2FO1 E;  3FUI A;  2H6F A;  2QFC A;  4DPR A;  2XPZ A;  1Z3Y A;  2PL2 A;  3AAA C;  4K5C A;  3APC A;  3VLE A;  1OXJ A;  3FU3 A;  3B13 A;  3PZ1 A;  1U3D A;  4A3T A;  3J5Q B;  1E7U A;  3RO3 A;  3TXM A;  3SD5 A;  3DXK G;  1X81 A;  4JB8 P;  1LD7 A;  2IFU A;  2Y3A A;  3Q7F A;  4FA6 A;  4LEU A;  4F1P A;  3Q15 A;  1MQS A;  3HXC A;  2H6I A;  2J4B A;  2HO1 A;  2IJG X;  1FT1 A;  2GGF A;  2M63 A;  3CKB A;  3DXM G;  5G05 J;  3EDT B;  4YDW A;  2P9K G;  1OCO E;  4V3I A;  4JZY A;  2OV8 A;  3I5P A;  3ZN3 A;  3O48 A;  4WNF A;  5FT9 A;  3OTN A;  2LXL A;  3ZXS A;  5FIN A;  4FLB A;  1Z3X A;  2RFA A;  2NSZ A;  3DSX A;  4KVM A;  3BUA A;  3SQV A;  2P58 C;  4F53 A;  3NBN B;  1JUQ A;  5D0Q D;  3FTV A;  3DWL G;  5ARF A;  4XEI G;  2CG3 A;  1MYO A;  4HOS A;  4A55 A;  4BT9 A;  4CT0 A;  3PS6 A;  5EN5 D;  1DCE A;  3SFX A;  5ARG A;  4HI9 A;  2J07 A;  3L82 A;  3QWV A;  2CFZ A;  3FUJ A;  3QAQ A;  1QNF A;  2A4Z A;  1HZ4 A;  3LJN A;  1E7V A;  5KJN A;  4ANU A;  4BSX A;  4TUM A;  3CQG B;  3CVY A;  5HI7 A;  1SZ9 A;  3SF4 A;  2L6B A;  2RD0 A;  5JMN D;  5ENP D;  3D3M A;  4GB9 A;  4UWF A;  4O1O A;  4BX9 A;  4RSY A;  5LCW C;  2XRZ A;  3AG1 E;  3PEV B;  3NQP A;  5CRV A;  4MKT A;  3CR3 A;  1QYM A;  3ULE G;  1IHB A;  5BXO A;  3TWQ A;  4L2Y A;  1HE8 A;  5EIL A;  2XGM A;  2VGX A;  2KC7 A;  4AJW A;  1IYG A;  2IO3 C;  5J90 A;  3HXB A;  3W9G A;  2PM7 A;  2X6F A;  3Q47 B;  3NB2 A;  4GTP A;  4GYY A;  1ZBP A;  3UXG A;  4I43 A;  4HI8 A;  2E0I A;  2VJ8 A;  4NAC A;  1HF8 A;  4HOQ A;  4FP7 A;  1JCQ A;  2ILR A;  3CEQ A;  2XZT G;  1SVX A;  2Y4U A;  4GTR A;  2CHZ A;  4DX2 A;  3UTM A;  4FUL A;  4RG9 A;  4Z68 A;  4AV7 A;  1TNZ A;  4LCT A;  4UQX A;  3PRE A;  3V79 K;  3HRA A;  4FAD A;  4G8K A;  3FFL A;  4J6I A;  3TJP A;  2L0I A;  3DBS A;  2FI7 A;  2OND A;  4ILG A;  1IKN D;  5BV0 A;  4ANV A;  3EIQ C;  3CK7 A;  3AS5 A;  4E85 A;  1QQE A;  4C0M A;  4P29 A;  2P2C P;  3CKC A;  4JHJ A;  2VSY A;  1QZ2 A;  4K03 A;  2WXN A;  5CEA A;  3FU0 A;  4GZ6 A;  2F8X K;  5FJY A;  3G2T A;  1ELR A;  4X8Q A;  2KBX A;  5CEC B;  4GTV A;  4G24 A;  5AYW D;  1TNY A;  4WWN A;  2KM4 A;  3JYS A;  1HO8 A;  3MZL B;  4J8F A;  3FTY A;  4K0R A;  3PNT B;  3ZYK A;  2L0T B;  4GTO A;  3V2O A;  1IQU A;  4K5B A;  4XKC A;  1HS6 A;  1LF8 A;  4G23 A;  3PNL B;  4DJA A;  4RVB A;  3NOC D;  3CQC B;  3LY7 A;  3J5P A;  2JAB A;  3RK6 A;  2XPI A;  1N4R A;  4DX5 D;  2FEZ A;  4FC8 A;  4JA9 A;  3ASD A;  1TN7 A;  5FZS A;  2KCL A;  3BEE A;  3RJV A;  1PAQ A;  2VSN A;  4G25 A;  1Y6I A;  4UI9 C;  3KSQ A;  2I9C A;  3UT4 A;  4G8L A;  3DSS A;  4U8Y D;  2RG8 A;  3QNK A;  4GCN A;  4TXR A;  2WXF A;  3CSF A;  4FJY A;  4L1B A;  3AS8 A;  2WXO A;  2XCC A;  1S70 B;  2GRQ B;  5KJL A;  4WWP A;  3Q9N C;  3FEY A;  1TR4 A;  4QFV A;  4HBD A;  2XHE A;  2DYR E;  2OVB A;  5JA4 D;  3B7S A;  1A5E A;  3UM2 A;  5A6C A;  4LER A;  1L5J A;  3Q5M A;  5IY5 E;  4WNG A;  2IEJ A;  5BT1 A;  4GMJ A;  3T5V A;  3VTX A;  4GA2 A;  5KCM A;  5AIJ A;  4GAA A;  1K1B A;  1UJJ A;  5CER B;  1OWL A;  3NAW A;  3KEZ A;  3ESL A;  3ZNG A;  1UW4 B;  3I4R B;  4DI4 A;  2KZT B;  3UT7 A;  4CEM A;  4HOT A;  2XEV A;  4O60 A;  2XRY A;  1KT1 A;  3ESK A;  3UKU G;  3IBE A;  3QB2 A;  3MCX A;  4LUN U;  4J8Y A;  3HVE B;  3FUM A;  4D10 C;  2VQ2 A;  2NXP A;  2VSO E;  3FUF A;  4CZ2 D;  2EIJ E;  4EZK A;  3UT8 A;  1JPL A;  3D9M A;  5AAR A;  4B8A A;  2FUL A;  3RU0 A;  3DEO A;  4DLQ A;  4BEP A;  3CGH A;  2WB2 A;  3D9J A;  2UWJ G;  3D9L A;  4HNA D;  5CHE E;  3S7D A;  4CCA A;  2YIN A;  4XI0 A;  2Y0B G;  3FTW A;  2XS1 A;  2FF4 A;  4KZ0 A;  3C3Q A;  1Z6T A;  2J4D A;  3FHE A;  5ENN A;  3LVR E;  1K8K G;  3GW4 A;  4HRL A;  4HS2 A;  1KLX A;  3ISM C;  4R7L A;  5FQ7 A;  3PE3 A;  3Q73 A;  2OEW A;  1JCS A;  4A63 B;  3TWT A;  3ZW3 A;  4BX8 A;  3FTX A;  4A1S A;  3D9I A;  4HOR A;  4BSZ B;  1YA0 A;  1N4Q A;  1SA5 A;  4BER A;  3ABK E;  2HYZ A;  3CHM A;  3EHM A;  5CRU A;  3EHR A;  4U07 A;  3CVV A;  4PDX A;  4HFG A;  3EUV A;  3B95 A;  5BUZ A;  1FT2 A;  4ILI A;  1MHQ A;  2L6J A;  4L23 A;  4HVB A;  5KJK A;  1Q2Z A;  3HVE A;  2J9Q A;  3ULY A;  2VTB A;  4CDR A;  5KWD A;  4YDY A;  2DZO A;  4XZ4 A;  4GCO A;  2WXQ A;  4HLL A;  4U7E B;  3T8K A;  4I1A A;  4DX7 D;  2P9U G;  1HG5 A;  5H7P A;  4DUI A;  5G2N A;  4U0Z A;  1TJF A;  4Q96 A;  3PZD A;  3FU6 A;  3PH0 C;  1OWO A;  3FUL A;  2WXK A;  3ZYL A;  4B8C B;  4J8S A;  3MV3 B;  4HXI A;  3UM0 A;  2PZI A;  1OCZ E;  2IOL A;  1OUV A;  2ZGD A;  4HRN A;  2DVW A;  1ZB1 A;  5BXU A;  5EX3 A;  1N94 A;  2V5F A;  5EID A;  3ASH A;  3B7R L;  4GU5 A;  3G2V A;  3X2Q E;  2R02 A;  2YQ8 A;  2XGO A;  2AXU A;  2ETC A;  3ML9 A;  2IOS A;  3NZS A;  2F8Y A;  2B6C A;  2J09 A;  2OVF A;  4L7T A;  3L54 A;  3PVL A;  3JQ0 A;  4UWG A;  3T5X A;  3CK8 A;  4EZL A;  3G2U A;  3MJW A;  4W9R A;  4DI3 A;  3LCA A;  2IU1 A;  3FU5 A;  3SBS A;  3ASG A;  3FUD A;  4ZFH A;  1MJ0 A;  2MHK A;  4N3A A;  1KZO A;  3AS4 A;  3S7B A;  3U4T A;  3D9P A;  3ONL A;  4JPS A;  3S2A A;  4TV3 A;  5AJD A;  3R9M A;  4UI9 K;  1JWF A;  3L17 A;  1EDU A;  1N4P A;  4CYM D;  4DX6 D;  3MKQ B;  2UY1 A;  3UMV A;  1Y8M A; 
#chains in the Genus database with same CATH homology
 2OND A;  3MX3 A;  4ILG A;  4KMO A;  2A5U A;  2FBN A;  4I1O B;  4RG6 A;  4G1T A;  2C0M A;  2CFU A;  4EZJ A;  3CVX A;  5BV0 A;  3SGH A;  4U0S A;  4ANV A;  2KZT A;  3N71 A;  3OXG A;  3CHS A;  3EIQ C;  1WAO 1;  2C2L A;  3CK7 A;  3ENE A;  4U8H A;  3AS5 A;  4E85 A;  5EX0 A;  1QQE A;  4AY6 A;  4C0M A;  2YHE A;  1N54 A;  4P29 A;  3RRM B;  3CK9 A;  3L13 A;  3CKC A;  4OVV A;  1E8Z A;  3CVP A;  3HIZ A;  5E75 A;  4AXH A;  1XGW A;  2LSV A;  4FHK A;  2KCK A;  3AU5 A;  2I1K A;  4JHJ A;  5FQ8 A;  2VSY A;  1QZ2 A;  4K03 A;  2WXN A;  4I9C A;  4APO A;  4HOU A;  3EIJ A;  3NZU A;  3FU0 A;  2WQ6 A;  4UWK A;  3K9I A;  4GZ6 A;  2VSX E;  1WM5 A;  5ANL A;  2UY1 B;  3P1U A;  3L22 A;  3KAE A;  5FJY A;  3U66 A;  3FY4 A;  1BPO A;  3U9W A;  3G2T A;  1ELR A;  1OWM A;  4J0U A;  3ZEF A;  5J08 A;  4F7A A;  3FH8 A;  3APF A;  3G2W A;  3HYM B;  4G24 A;  4MRU A;  3FUN A;  1B89 A;  3KD7 A;  4I2W A;  4WWN A;  5AYW D;  2KM4 A;  3JYS A;  5DIZ A;  5JJ7 A;  1HO8 A;  3JUI A;  3MZL B;  4J8F A;  1ELW A;  3FTY A;  4K0R A;  4EQF A;  3QWW A;  4U0U A;  3PNT B;  1UG3 A;  3ZYK A;  4I6G A;  2L0T B;  2XQ0 A;  3RO2 A;  1IQU A;  2AXV A;  3LVQ E;  1JWG A;  1NA3 A;  5LCW J;  3UX4 A;  1HXI A;  4B94 A;  2Y4T A;  4XKC A;  1HS6 A;  5C1D A;  3Q49 B;  1LF8 A;  3IKO B;  4G23 A;  3PNL B;  4DJA A;  4KVO A;  3MV2 B;  1ZU2 A;  3L6A A;  4RVB A;  4L2L A;  3CQC B;  3LY7 A;  3R7R A;  3GZS A;  4YVQ C;  5LX8 A;  5LFA A;  5EDS A;  4XX5 A;  4E6H A;  3RK6 A;  3ZHE B;  2XPI A;  3RRU A;  3U64 A;  1UN8 A;  3L08 A;  2VYI A;  4YND A;  3RIB A;  2HR2 A;  2FEZ A;  4FC8 A;  4JA9 A;  5KJM A;  4J8D A;  4BTB A;  2AXZ A;  3ASD A;  4DK5 A;  1HG2 A;  5FZS A;  1W3B A;  1EPU A;  2KCL A;  2OOE A;  3BEE A;  4GA0 A;  3RJV A;  1E8X A;  1PAQ A;  4ACL A;  2WVI A;  1PC2 A;  2PQR A;  2VSN A;  1H0A A;  4G25 A;  3I3N A;  3CVU A;  4MLP A;  4C9B B;  1Y6I A;  3T8M A;  4UI9 C;  4BFR A;  2I9C A;  4ATG A;  1E96 B;  3LDZ A;  5T4Y A;  2WXR A;  4A3V A;  3PUK A;  3UT4 A;  4JEU A;  1EYH A;  2HM8 A;  4WND A;  2PQN A;  4UWH A;  3MEK A;  3CV0 A;  2GW1 A;  4N39 A;  4CDM A;  4G2V A;  3LKU A;  4UI9 J;  2WXL A;  4KYO B;  2X6I A;  4AEZ C;  2I1J A;  2RG8 A;  4PH4 B;  4EBA A;  3KS2 A;  5A23 A;  4I6E A;  1WY6 A;  3QNK A;  4J8E A;  3S7F A;  2V8S E;  4GCN A;  4PS8 A;  4AIF A;  2LNI A;  2WXF A;  4JXT A;  4N5C A;  4HLE A;  2ZU6 B;  3CSF A;  3LY9 A;  4FJY A;  2C0L A;  3MA5 A;  4L1B A;  4CT4 A;  5LOZ A;  4FLH A;  3AS8 A;  3ZHE A;  2WXO A;  2ION A;  2XCC A;  3CVL A;  3FP3 A;  2WMO A;  5FQ6 A;  3SZ7 A;  4BTA A;  5E76 A;  3MYV A;  3LPZ A;  4PS3 A;  3CHR A;  2CHX A;  5BPP A;  3CVW A;  1HFA A;  3QDN A;  2QY7 A;  4GML A;  3PDN A;  3OAW A;  4UQY A;  1FVH A;  3RKV A;  1E8Y A;  1FCH A;  4GZD A;  3VLD A;  4EEC A;  4WWP A;  5KJL A;  4KT6 B;  3IEG A;  2JEK A;  4BWR A;  3FEY A;  3EHN A;  3WXX A;  1HX8 A;  4F1S A;  1P5Q A;  1H2V C;  4BT8 A;  4IUL A;  4QFV A;  2XHE A;  1ELK A;  2L9B A;  5FZR A;  3TXN A;  3TGO A;  3UQ3 A;  3D9N A;  2OVB A;  3U3W A;  4LRZ A;  1GW6 A;  3B7S A;  3ZYQ A;  3BG1 B;  4JL0 A;  3UMV A;  4XKB A;  3CIA A;  1U3C A;  5A6C A;  4LER A;  4G26 A;  3SI5 A;  3QC1 A;  1L5J A;  3TL5 A;  3JQ1 A;  3IHV A;  3TAX A;  3Q5M A;  5FQ4 A;  4N2S A;  3DPD A;  3QWP A;  1DVP A;  4WNG A;  3VLF A;  2WPV A;  3SNX A;  5BT1 A;  4GMJ A;  1NA0 A;  3T5V A;  2DIW A;  3VTX A;  3LJ3 A;  4GA2 A;  3LYA A;  5KCM A;  3CHO A;  3HHM A;  4UQZ A;  5AJL A;  2V0P A;  2GRL A;  4GAA A;  5AIJ A;  1UJJ A;  2CHW A;  4FHJ A;  5EKQ D;  4AOF A;  1OWL A;  2GRM A;  3MGB A;  5G55 A;  3KEZ A;  4AP2 A;  3ESL A;  1H19 A;  4GZC A;  4WUY A;  1XNF A;  1UW4 B;  3SHF A;  4F3V A;  3I4R B;  5C2Y A;  4DI4 A;  3FTU A;  2KZT B;  3UT7 A;  5JJ6 A;  2DCP A;  3FWV A;  3QK0 A;  3FUK A;  3BG0 B;  4CEM A;  4AVX A;  2DBA A;  4HOT A;  2WQH A;  3RRN B;  2XEV A;  5A7D B;  2XRY A;  2WXP A;  1KT1 A;  3S7J A;  2WM9 A;  3EJN A;  3ESK A;  2BTD A;  2WXJ A;  4JEH A;  4JC8 A;  3IBE A;  3CVQ A;  5CMW A;  4M3O A;  5AEN A;  3QB2 A;  2VTB B;  3MCX A;  4LUN U;  4Q94 A;  3L16 A;  4U63 A;  3HVE B;  3FUM A;  4PS7 A;  1UN9 A;  4D10 C;  1UJK A;  2VQ2 A;  2NXP A;  2WXM A;  2WXH A;  4MS6 A;  2VSO E;  1H2T C;  1X5B A;  4WNE A;  2MRI A;  2R5S A;  3FUF A;  5BW8 C;  4FJZ A;  2Q7F A;  2J49 A;  2CG2 A;  5FTP A;  5HQ8 A;  2IQC A;  3CHQ A;  5ANR A;  4EZK A;  3UT8 A;  1IHG A;  2X6H A;  1JPL A;  3D9M A;  4B0Z A;  4G11 A;  4B8A A;  2FUL A;  3RU0 A;  4DLQ A;  3ONK A;  3LXU X;  3CGH A;  3FUI A;  4GYO A;  2WB2 A;  3D9J A;  2QFC A;  2UWJ G;  3D9L A;  4DPR A;  2XPZ A;  5CHE E;  3S7D A;  4JHK A;  4CCA A;  1Z3Y A;  3ULQ A;  2PL2 A;  2YIN A;  4XI0 A;  3FTW A;  4A1G A;  2R59 A;  3QJZ A;  4APF A;  2FF4 A;  3APC A;  1S0P A;  3VLE A;  3FU3 A;  3OXL A;  3B13 A;  4KZ0 A;  3SFZ A;  5T3R A;  1Z6T A;  4JHR A;  1U3D A;  4A3T A;  2J4D A;  1DNP A;  2LAH A;  3FHE A;  1SQM A;  2BF0 X;  5ENN A;  3LVR E;  1E7U A;  3FEX A;  3MKR A;  3GW4 A;  3RO3 A;  3MKQ A;  2NC9 A;  3TXM A;  4HS2 A;  4ILH B;  1KLX A;  1H2U A;  3G2S A;  4R7L A;  3SD5 A;  4CRW A;  2VGY A;  4I17 A;  5FQ7 A;  3PE3 A;  4AM9 A;  3B7T A;  3Q4A B;  4NRH B;  2IFU A;  2Y3A A;  5CCM A;  4FA6 A;  4LEU A;  3Q15 A;  1OWP A;  3GZ2 A;  5T8I A;  2X38 A;  1HH8 A;  1MQS A;  2LSU A;  3ZW3 A;  3QAR A;  4BX8 A;  3FTX A;  4A1S A;  2J4B A;  4GZ5 A;  3D9I A;  1KT0 A;  2HO1 A;  4HOR A;  2IJG X;  2R17 C;  2GGF A;  2M63 A;  3CKB A;  5G04 J;  5G05 J;  1N52 A;  2V4L A;  1YA0 A;  3EDT B;  2VGX B;  2XPY A;  1IQR A;  3FTZ A;  4V3I A;  4TRQ A;  4JZY A;  4N3C A;  2OV8 A;  3I5P A;  3ZN3 A;  2HYZ A;  3O48 A;  3HDX A;  4WNF A;  3CHM A;  3EHM A;  3FUE A;  5FT9 A;  1VDY A;  4IYP A;  4KXK B;  3OTN A;  4U07 A;  4GA1 A;  3B7U X;  1H6K A;  4PDX A;  3ZXS A;  3CVV A;  4HFG A;  3CHP A;  4FLB A;  2X3M A;  3AU4 A;  4XE0 A;  1Z3X A;  4URK A;  2NSZ A;  4IRU A;  3CST A;  5BUZ A;  3ZPJ A;  4KVM A;  4O6F A;  4JVS A;  2P58 C;  4ILI A;  4EBA G;  1MHQ A;  4YVO A;  2L6J A;  4L23 A;  4F53 A;  4KZC A;  1TJC A;  1JUQ A;  4N3B A;  5D0Q D;  3CVN A;  3FTV A;  5ARF A;  3ZVV A;  4HVB A;  3ZYM A;  4ANW A;  5KJK A;  4WWO A;  3HVE A;  2CG3 A;  2J9Q A;  4HOS A;  2VTB A;  4B89 A;  4A55 A;  3FTS A;  5M72 A;  4N2Q A;  4BT9 A;  1A17 A;  3IHY A;  3QOU A;  4CDR A;  4CT0 A;  3PS6 A;  4PUC A;  5ARG A;  4XI9 A;  3ZFW A;  2J07 A;  3D9O A;  3QWV A;  2J08 A;  2CFZ A;  3FUJ A;  3QAQ A;  4XZ4 A;  1QNF A;  2WXQ A;  4GCO A;  4U04 A;  4Y6C A;  4ANX A;  2A4Z A;  1HZ4 A;  4I1A A;  3ZRH A;  4Q69 A;  3TG5 A;  1E7V A;  5JHA A;  4CGV A;  4GPK A;  4I1M A;  4I9E A;  5KJN A;  2YNQ A;  1HG5 A;  3ML8 A;  4ANU A;  5JJT A;  4FU3 A;  4BSX A;  5G2N A;  3NF1 A;  3VTY A;  3CVY A;  3CQG B;  3QKY A;  4U0Z A;  1TJF A;  4Q96 A;  5HI7 A;  1SZ9 A;  3PZD A;  5FZQ A;  3SF4 A;  3FU6 A;  3PH0 C;  1OWO A;  2KCV A;  2RD0 A;  3I4G A;  3PUJ A;  4CGW A;  3ASF A;  3FUL A;  4BY6 A;  2WXK A;  3PE4 A;  2AW6 A;  1HU3 A;  3D3M A;  2AVP A;  3ZYL A;  4B8C B;  3URZ A;  4J8S A;  4GB9 A;  3MV3 B;  4UWF A;  4BX9 A;  4HXI A;  4XIF A;  2PZI A;  4RSY A;  5LCW C;  2XRZ A;  3PEV B;  3LY8 A;  1FVF A;  2LO6 A;  1NP7 A;  3NQP A;  2IOL A;  2KAT A;  1OUV A;  4MKT A;  4AY5 A;  3CR3 A;  4NUR A;  5BV1 A;  3GYZ A;  2LAI A;  4CDN A;  3CLJ A;  5EX3 A;  3LEW A;  2V5F A;  3PEU B;  1EF1 C;  3ASH A;  3LS8 A;  3B7R L;  4L2Y A;  4GU5 A;  1HE8 A;  3UUX A;  1SZA A;  2XGM A;  3D9K A;  2VGX A;  4DLO A;  3G2V A;  2KC7 A;  4AJW A;  2YQ8 A;  4Y6W A;  2XGO A;  3FH5 A;  2AXU A;  4OVU A;  1IYG A;  1INZ A;  3ML9 A;  2IOS A;  4H7Y A;  3FUH A;  3NZS A;  5G05 C;  5G04 C;  5J90 A;  4EPZ A;  2J09 A;  2XCB A;  2OVF A;  3E4B A;  4L7T A;  3L54 A;  2E2E A;  3PVL A;  2PM7 A;  2X6F A;  4WAF A;  3Q47 B;  5FWQ A;  4JA7 A;  3FDH A;  3JQ0 A;  1E90 A;  4GYW A;  3R7Q A;  1PY1 A;  4UWG A;  3UPV A;  3P2B A;  3C98 A;  3GZ1 A;  3T5X A;  3CK8 A;  4GYY A;  2AWI A;  4EZL A;  1ZBP A;  2X6J A;  4I43 A;  1TEZ A;  2WXI A;  3G2U A;  2E0I A;  3MJW A;  2VJ8 A;  2I6H A;  4UWL A;  4TUU A;  2YHC A;  4NAC A;  4W9R A;  4C0E A;  1HF8 A;  4H7X A;  4HOQ A;  5CMY A;  2WXG A;  3SBT B;  4FP7 A;  4IN3 B;  4DI3 A;  4OYS A;  3LCA A;  2MOW A;  2IU1 A;  2ILR A;  3CEQ A;  4ABN A;  3FU5 A;  3SBS A;  3ASG A;  3FUD A;  4I6J A;  1E8W A;  5D0O D;  2BUG A;  2JLB A;  2Y4U A;  2MHK A;  2CHZ A;  4N3A A;  2EQX A;  3AS4 A;  3O4Z A;  3PRZ A;  3S7B A;  3U4T A;  3D9P A;  4FUL A;  3ONL A;  4RG9 A;  4AV7 A;  2FO7 A;  4JPS A;  3JCK C;  3IV0 A;  3S2A A;  5CCL A;  4NQ0 A;  2I2O A;  5LP0 A;  5BNW A;  4TV3 A;  2X6K A;  4JW1 A;  4LCT A;  2WMN A;  3APD A;  4I2Z A;  4UQX A;  5AJD A;  3PRE A;  4UI9 K;  2XGS A;  1JWF A;  3L17 A;  1EDU A;  2PM6 A;  5JHB A;  4FAD A;  4ME2 A;  4KBQ A;  3MKQ B;  1NZN A;  4GZ3 A;  3FFL A;  2IF4 A;  4J6I A;  3TJP A;  3R9A B;  3TG4 A;  3ZIM A;  3FH7 A;  4ACK A;  2UY1 A;  2WQ7 A;  1OWN A;  2L0I A;  5DBK A;  3OXF A;  3DBS A;  2FI7 A;  3ZGQ A;  1Y8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...