1IYGA

Solution structure of rsgi ruh-001, a fis1p-like and cgi-135 homologous domain from a mouse cdna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
GSSGSSGMEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein (2010003O14)
publication title Solution structure of RSGI RUH-001, a Fis1p-like and CGI-135 homologous domain from a mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 41
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1iygA00
4N2QA 2P58C 3CVLA 4RG6A 4GA2A 2PZIA 3QWVA 1ZBPA 3S7FA 3Q5MA 4GCOA 3ZPJA 3RIBA 3TG5A 2WQHA 5KJLA 2YHCA 3QOUA 4KBQA 5FT9A 4EQFA 1QQEA 1W3BA 4H7YA 4G23A 4GPKA 3MV2B 3ZFWA 4GYWA 4XIFA 5G05J 3UQ3A 2LSUA 3RU0A 1KT0A 2XGMA 3Q49B 4U07A 1TJCA 3VTXA 1ELRA 4NQ0A 1E96B 5BNWA 3ULQA 5AYWD 4UQYA 5LCWJ 3AS5A 4HOUA 1WM5A 3LY9A 4GZ3A 1NZNA 3U4TA 2KCKA 5ARFA 3FP3A 5G05C 4N3AA 4AY5A 3S7DA 3LY8A 2NC9A 2OOEA 2KC7A 2Q7FA 4WNEA 4J8EA 3Q15A 2VSNA 5C1DA 4HORA 4GA1A 2LSVA 5FTPA 3K9IA 3S7BA 5LCWC 2LNIA 2IF4A 4I9CA 3FWVA 3PDNA 3LCAA 4G25A 3TAXA 2FI7A 5DBKA 3CK9A 3FFLA 5ARGA 2XPIA 2L6JA 2QFCA 1ELWA 1A17A 2XEVA 4UI9K 4G2VA 1HZ4A 2VGYA 2XGSA 3S7JA 1KT1A 2C2LA 3URZA 3VTYA 3E4BA 5EX3A 4IN3B 1NA0A 2VSYA 5DIZA 2JLBA 4B94A 3CVQA 5JJTA 3MA5A 2R5SA 3KAEA 2FF4A 2VGXB 3KS2A 4JA9A 3O48A 1HXIA 2MHKA 4N3CA 4G24A 1ZU2A 3LYAA 1FCHA 5HI7A 1QZ2A 3OXGA 2XCBA 2E2EA 2PL2A 2C0MA 4UQXA 4HOQA 4KYOB 3MEKA 3CVNA 4J0UA 4GYYA 3TGOA 3PE4A 4GZ6A 4N2SA 3ZGQA 4JHRA 4F3VA 3N71A 4U04A 3CV0A 1YA0A 4BTAA 3LPZA 3IEGA 4RG9A 4AM9A 2VGXA 3TG4A 2FEZA 2PQRA 5M72A 3Q47B 2Y4TA 1KLXA 3CKBA 4ABNA 4APOA 4NRHB 1NA3A 3QWWA 4UI9J 5KJMA 4U0SA 5G04J 2HYZA 2KATA 3KD7A 5EX0A 3ASDA 5JJ7A 1OUVA 2IFUA 3AS8A 3MKRA 2XGOA 4J8DA 2VYIA 1P5QA 3LKUA 2DBAA 3GW4A 4WNGA 3AS4A 5HQ8A 3RJVA 3RKVA 5FJYA 2VQ2A 4UI9C 3ASGA 2FO7A 3ASHA 5FZQA 4GZ5A 1B89A 4N39A 5G04C 5JJ6A 4W9RA 1XNFA 3ESKA 4GCNA 5D0OD 4BT9A 3HYMB 3SF4A 4WNDA 4I2WA 4GYOA 4XI0A 3GZ2A 5CHEE 3RO2A 4UQZA 4Y6WA 5KJKA 3UUXA 3UPVA 1HH8A 3OXLA 3QDNA 4WUYA 5BT1A 2XCCA 2I6HA 2YQ8A 4CDRA 2KCLA 2BUGA 3GYZA 4U0UA 3JYSA 2AVPA 1WAO1 3OXFA 2PQNA 3U3WA 3SZ7A 3ZN3A 4BWRA 4YNDA 5D0QD 4G1TA 2KCVA 4BTBA 1Y8MA 5A7DB 3ZHEB 2UY1B 3RO3A 3MV3B 4N5CA 5CCMA 2ONDA 5KJNA 4U0ZA 3PE3A 3CEQA 4Y6CA 4I9EA 2Y4UA 5FZSA 2WPVA 3CK7A 3ASFA 4XI9A 4YVQC 2V5FA 3R9AB 5A6CA 4I17A 2C0LA 3CK8A 3QWPA 3WXXA 4WNFA 4BT8A 4I1AA 3BEEA 5FZRA 4G26A 4CGVA 3Q4AB 5EKQD 4GA0A 2FBNA 3NF1A 3EDTB 4H7XA 5BW8C 3CVPA 5CCLA 1IYGA 4HOTA 2UWJG 4ME2A 1IHGA 3GZ1A 2GW1A 3LY7A 4YVOA 3ZHEA 2UY1A 4CGWA 3QKYA 2HO1A 4KXKB 4N3BA 4JL0A 4O6FA 2J9QA 3CKCA 4J8FA 1PC2A 4AIFA 4I2ZA 4AY6A 4A1SA 4HOSA 4LEUA 4JA7A 2HR2A
chains in the Genus database with same CATH superfamily
4N2QA 4RG6A 4RSYA 3U9WA 4BSXA 3UKRG 3V30A 3B95A 4TUMA 3ZU7B 3FUJA 2AXUA 5FT9A 2CG2A 2XENA 2GRQB 3FTYA 1H6KA 4GTVA 3BG0B 1NP7A 2A4ZA 4FLBA 4O1PA 5C2YA 3MV2B 3ZFWA 3DXKG 3FH8A 3U66A 4XIFA 3PZ1A 3HHMA 3PVLA 3RU0A 3Q49B 2XEEA 3HXBA 4XEIG 4RLYA 1AWCB 3UT4A 4ACLA 3ULQA 4UQYA 4YDWA 4GZ3A 1NZNA 2KCKA 2RG8A 5AN8A 5G05C 3SQVA 4ATZD 4AY5A 3S7DA 5J08A 2OV8A 3UTMA 3LY8A 1HG2A 2CFUA 3Q15A 4FHKA 3F6QA 4FADA 1NL4A 4HORA 1S70B 4WWOA 4FULA 3NOCD 1BU9A 3I3NA 3FUHA 4GA1A 1OWPA 2XPZA 4LSZE 3D9HA 1TNYA 5CBNA 2A5UA 4FC8A 3TAXA 1D8EA 2FI7A 1JUQA 4OVVA 4F7AA 2YNQA 3NZSA 3TL5A 1LD7A 3ZW3A 3ZYLA 2IONA 4QQIA 1ELWA 1N52A 1S0PA 1UOHA 1L5JA 2WXLA 3C72A 2AXVA 2XGSA 1EDUA 3CVXA 2XQ0A 1KT1A 2ZGDA 2C2LA 4JEUA 4DPRA 4GB9A 5ITZF 4PUCA 3HXFA 4IN3B 4XZ4A 2PM6A 2VSOE 4K0RA 1BLXB 4CZ2D 2VGEA 5KWDA 3CSTA 3TJPA 3EJNA 3V2OA 4R7LA 4BX9A 2VGXB 3PZDA 3DEOA 4I1OB 2DZOA 3L08A 2NSZA 4J8YA 1ZU2A 3LYAA 1FCHA 2MYOA 2XPYA 3OXGA 4ANVA 2E2EA 1N0RA 4UQXA 2LO6A 3CHOA 4KYOB 2F8XK 3T5VA 5CRUA 3KEZA 1TN7A 3FU3A 4GZ6A 3C98A 4N2SA 3ZGQA 1YCSB 4F3VA 4URKA 3N71A 3CV0A 1H2VC 5AQ7A 2LXMA 1V55E 4RG9A 2VGXA 2CHWA 3AG1E 2E0IA 2GRMA 2FEZA 3V2XA 2WMNA 3FEYA 4CDNA 3G2WA 4K5BA 5HS0A 1Z5SC 1S63A 2KXPC 5ANLA 3UKUG 1KLXA 2F37A 3L6AA 3PUKA 1E8ZA 4TXPA 4L2LA 1UJKA 1SQMA 3D9NA 1X5BA 3E30A 5KJMA 4C9BB 3HXCA 2ZU6B 2KATA 3KD7A 2IFUA 1JWGA 1PY1A 2XGOA 4XKCA 2VYIA 5ENTD 3QK0A 4JVSA 1H2TC 4I6EA 3RKVA 4P29A 1TNUA 3OAWA 3ASOE 3NOGD 4UI9C 3HDXA 3ASGA 5LOZA 3ASHA 5FZQA 2IO2C 2VJ8A 1B89A 4WWNA 5G04C 2WVIA 1Z3YA 3UXGA 5D0OD 4BT9A 5BXUA 3SF4A 2BF0X 2PNNA 5FQ6A 1E7UA 5JHAA 1TN8A 4GU5A 5KJKA 1OWMA 2CHXA 2WXFA 3SFZA 2DIWA 2WMOA 2XCCA 4U95D 2P9NG 2GRPB 2BUGA 2BKGA 3JYSA 1K8KG 3MJWA 1WAO1 2V4LA 3FTXA 3FTWA 4GZDA 3U3WA 4GTRA 4LNGA 3ONLA 4G1TA 3T8MA 3RO3A 4MLPA 4GMLA 2LAHA 3RRMB 5CCMA 1DCEA 4U0ZA 3IHVA 3NAWA 3PE3A 5A23A 4Y6CA 4DI3A 4PS7A 2WQ7A 3ASFA 4HLEA 3CK8A 4WNFA 3D9LA 5T3RA 3Q4AB 3ISMC 5AARA 1GW6A 4F6RD 2ETCA 3FTSA 3EDTB 4JW1A 3B7SA 4H7XA 4PDXA 2VTBB 4TRQA 3EIJA 4BX8A 1VDYA 2UWJG 4ME2A 5BV0A 2WM9A 2H6HA 1HO8A 2L0IA 3TWWA 2GW1A 3LJ3A 3FUMA 4G8LA 4J6IA 2EIKE 4OAVB 4KXKB 1OWLA 3W9GA 4N3BA 3SO8A 4JL0A 1YMPA 1LF8A 4J7WA 3EUVA 3FUEA 3FUNA 3E34A 2FO1E 3FU6A 3RRNB 3EU9A 3WG7E 4UWHA 5ENOD 4GMRA 1FVFA 4LG6A 2VTBA 5AJLA 2IQCA 3FUFA 1QYMA 2MRIA 2GROB 2ZXWE 3FHEA 4HI8A 3RIBA 2YHCA 3QOUA 3OTNA 1XGWA 2X6IA 4H7YA 4FJZA 4ILIA 4D10C 3KEAA 5EDSA 4GTSA 3CHRA 5G05J 3UQ3A 2LSUA 3ABME 3FY4A 4GTMA 3PZ2A 3KSLA 3FTUA 1JCRA 2XGMA 3G2VA 4BSZB 1TNZA 4FJYA 3J5PA 4HQDA 1ELRA 3I4RB 1E96B 1E8YA 4ACKA 2I2OA 5BNWA 4AVXA 5BV1A 5AYWD 3AS5A 4HOUA 1K1BA 1WM5A 1O1TA 4LCTA 4N3AA 2Y3AA 3UM2A 3ZXSA 2KC7A 3PREA 5G2NA 4J8EA 2R17C 2IY0C 1BD8A 4DX5D 4DUIA 5C1DA 4ANXA 3UIPC 3K9IA 1E8WA 3S7BA 2F0YA 1H6OA 1EF1C 4I9CA 2JEKA 3FWVA 2IU1A 2H6FA 5DBKA 4Q94A 3CK9A 3DSWA 1N0QA 3D9OA 2EINE 2XZTG 4L1BA 3MX3A 3IHYA 1U3DA 4DRXE 1JCQA 2XEVA 3HXDA 3BUAA 4G2VA 1HZ4A 2VGYA 3MYVA 3FDHA 3E4BA 5EX3A 1HE8A 2OVBA 1NA0A 2JLBA 4B94A 5AQ9A 3CVQA 2BTDA 5JJTA 4MRUA 3AU4A 3IBEA 3NZUA 3RK6A 1DCQA 3O48A 1HXIA 3Q79A 2MHKA 3APCA 4C48B 3UT8A 4EZJA 3FH7A 4C0MA 3TXMA 4J0UA 4GYYA 1OWNA 4FA6A 4DI4A 3UIOC 2X6JA 4JHRA 1YA0A 3FUDA 4MKTA 3PRZA 1HU3A 3HIZA 4AM9A 3NBNB 5ENQD 2PQRA 5M72A 2WXIA 3PZ4A 1N54A 2XHEA 3LVRE 3QJZA 4BERA 4UWGA 2IOSA 1OCCE 2DYSE 4UI9J 3QARA 2WXRA 1DVPA 4I43A 1RZ4A 5G04J 5LFAA 2LXLA 2V4HC 2DVWA 3CLJA 3JCKC 1JPLA 1OUVA 3ZRHA 3AS8A 5AJDA 2XEHA 4J8DA 4A3VA 4WNGA 5HQ8A 1MX4A 2J8SD 2EIME 3BG1B 3ABKE 4E6HA 5FJYA 2V8SE 3J5QB 2VQ2A 1KZPA 2BKKB 2FO7A 4TV3A 4B8AA 5KNHD 1XNFA 4BFRA 4WNDA 2XRYA 4LRZA 4OVUA 4I2WA 4PH4B 4XI0A 3FUKA 3GZ2A 3RO2A 4UUCA 3UPVA 3DWLG 5LP0A 3DRAA 1EYHA 1OCZE 3QDNA 2J08A 3RRUA 1AP7A 1MJ0A 1UN9A 3JQ1A 4CDRA 4GAAA 2KCLA 2J07A 3B7RL 3CR3A 2WXHA 2WB2A 3GYZA 2AVPA 2H6IA 4G8KA 4CRWA 3OXFA 1BI8B 4N5QA 1S64A 4BWRA 4U96D 4CT4A 2KCVA 3E33A 2R59A 1UJJA 4EECA 3MV3B 1D8DA 2NXPA 2ONDA 2AW6A 4LNUD 3CVVA 5HKPA 4L2YA 5D66A 2A5EA 3CEQA 4WAFA 5ENNA 2WQ6A 4XI9A 3R9AB 1INZA 4I17A 2C0LA 5CBOA 5ENPD 4DJAA 2IOLA 3D9MA 4GA0A 1WG0A 3SY2A 4CT0A 3D9IA 5BW8C 2VSXE 4KZ0A 1WDYA 3FU5A 1IYGA 3B7UX 3FUIA 3SI5A 1IHGA 4L9PA 4LERA 4JHKA 4JXTA 3HRAA 4X8QA 3ML9A 2Y1LE 3DPDA 3L9TA 3ZXPA 4B0ZA 1FT1A 1LTXA 3BQOA 3R7QA 2HO1A 3IV0A 1N95A 4Z68A 2L0TB 4KT6B 2J9QA 3SGHA 1E90A 2DWZA 3ZNGA 1KPSB 5ENRD 2CFZA 3CVWA 1X81A 3CQGB 2L6BA 4HRLA 1O1SA 4JA7A 4DX2A 1JWFA 2P58C 2P9SG 2QZAA 3Q7FA 3L13A 1HF8A 1ZBPA 3S7FA 1G3NB 4LNBA 3Q5MA 2WQHA 4YDOA 5KNGA 2V0PA 3D3MA 1SA5A 5T4YA 2EQXA 2R2LA 3DXMG 1Q2ZA 1QQEA 3TXNA 2GRNB 3QB2A 4G23A 4GTPA 4GPKA 5CERB 4GYWA 2EIJE 3MCXA 3TWRA 2J09A 3CVUA 2XS8A 2DZNA 1D9SA 4DX6D 4B8CB 1TEZA 4Q96A 3ESLA 1IHBA 2R05A 1YYHA 3DSXA 4U07A 5CMYA 1RW2A 1OWOA 4NQ0A 1QBQA 4CDMA 3AG2E 4PS3A 2XRZA 3PEUB 3EHMA 3EHNA 3LY9A 4DLQA 3U4TA 5ARFA 4CEMA 4GTOA 5FQ8A 1HFAA 3Q78A 5AENA 2NC9A 2MOWA 3UX4A 1N4QA 4EBAG 2OVFA 2VSNA 2Y0BG 2HM8A 4JC8A 4IYPA 1MYOA 2DYRE 3C3RA 4APFA 5LCWC 2IF4A 3SNXA 3LEWA 3LCAA 4FU3A 3VLFA 2IEJA 2I1KA 3QAQA 4G25A 4ILHB 3TWVA 1DNPA 4L23A 3P1UA 3FFLA 5AAOA 3ZVVA 5ARGA 2XPIA 2L6JA 2WXKA 4BETA 2H6GA 4OAUC 2I9CA 3S7JA 4HRNA 1QNFA 4UWKA 3URZA 3SFXA 3NB2A 3W9FA 3HVEA 5ENSD 2VSYA 1OXJA 4TUUA 3MA5A 3MGBA 2ETAA 2FF4A 2LAIA 3HXEA 3KS2A 3E37A 4JA9A 4N3CA 4G24A 4KVMA 4UWFA 5IY5E 2P9IG 5CEDB 4HOQA 4HB5A 3UM0A 4LUNU 5FINA 3ULEG 2QC9A 4HLLA 3PE4A 3ZYMA 4AP2A 5J90A 1MQSA 1BPOA 1BI7B 2X6FA 4AJWA 4IRUA 2GRRB 4U04A 4BTAA 3ZYKA 3IEGA 1N94A 4NURA 3TG4A 5AQBA 2PM7A 1ZB1A 2P9PG 3CVYA 4U8YD 4EBAA 4ANUA 1FVHA 2KBXA 2KM4A 3TWTA 1N4PA 2Y4TA 3LVQE 4ABNA 1N4SA 4HS2A 1UW4B 3TWUA 3IKOB 1NA3A 5D2MC 1OY3D 4HBDA 2L9BA 2X6KA 1K1AA 2GRLA 3RSEG 1SA4A 1EPUA 2HYZA 3ASDA 3DSTA 3SBTB 5LX8A 3FTZA 2QYJA 3MKRA 2OEWA 3KSQA 2WXPA 1MX2A 3LKUA 3RJVA 1N11A 3UI2A 3Q75A 2WXJA 5FIOA 4JPSA 4G11A 3ONKA 4KVOA 5CEAA 4N39A 2WXGA 1NI1A 2OEVA 4GMJA 5JJ6A 4F1SA 3B7BA 4GCNA 3V79K 3HYMB 1MHQA 2WXMA 5E76A 5CHEE 3FULA 3AU5A 3CQCB 3UUXA 3FTVA 4O1OA 1HH8A 1SW6A 5BT1A 3FU0A 3PZ3A 2WXNA 3EIQC 2ZIRA 1UG3A 3GZSA 2CG3A 4KMOA 1TYQG 4U0UA 1IXVA 3L54A 3L16A 4B89A 1WY6A 5EIBE 2PQNA 2EILE 3SZ7A 4EZKA 3D9KA 3CHMA 4YNDA 4HFGA 4M3OA 5D0QD 5JMND 4ATGA 4Q69A 2UY1B 3CIAA 1SZ9A 3DSSA 4BESA 2KZTB 3JUEA 3L82A 4YDYA 4FLHA 4NACA 3DBSA 4XKBA 4I9EA 2Y4UA 3D9JA 2RD0A 5BPPA 4MS6A 3ABLE 1K3ZD 5FZRA 1OCOE 4CGVA 5EKQD 3O4ZA 3CHPA 5EIDA 2NYJA 1JCSA 3GZ1A 3DPYA 4YVOA 4BY6A 2UY1A 4CGWA 1O5MA 1H2UA 2KZTA 5AIJA 3QNKA 2YHEA 2ZISA 3T8KA 3I4GA 3QKYA 3DSVA 2ZGGA 3DSUA 5FQ4A 3UT7A 5G55A 4O6FA 4TXQA 4J8FA 4I2ZA 5FQ7A 4A1SA 3HG0D 3ZKJA 4HOSA 4JEHA 2X6HA 3Q9UC 2HR2A 1E8XA 3CVLA 4GA2A 2JABA 4A63B 2PZIA 3C3QA 3QWVA 4EHMA 4GCOA 5BUZA 3LDZA 3ZPJA 3TG5A 3T5XA 5KJLA 4KBQA 4EQFA 1MZCA 1W3BA 2X38A 3I5PA 3B13A 2B0OE 2AXZA 2I1JA 4EZLA 3TWSA 3C5RA 3UMVA 5B1BE 1KT0A 1TJCA 2RKKA 4JHJA 3C3OA 2RFMA 3VTXA 1Y6IA 3TWXA 2OCCE 4J8SA 3S2AA 3AG3E 1HS6A 5B1AE 3CHQA 5LCWJ 2F8YA 3TWQA 2B6CA 3EHRA 3FP3A 5BXOA 1H6PA 1Z6TA 3EU5A 3ZEFA 2OOEA 4B93B 3T9KA 2Q7FA 4WNEA 1N9AA 1SZAA 4CCAA 4K5CA 3G2SA 2ETBA 1LD8A 4U7EB 4U8HA 2LSVA 5FTPA 3ZUVB 4MBGA 4ZHBA 2LNIA 4IULA 3PDNA 3LXUX 3D9PA 1Z3XA 4BEPA 5FWQA 3SBSA 3VLDA 1IKND 4A55A 2BEDA 1H19A 5T8IA 1O1RA 2HE0A 3QC1A 2XZDG 2P9LG 2QFCA 3PH0C 1A17A 4UI9K 5JA4D 5CRVA 4F1PA 4WWPA 3SD5A 1KZOA 3SFYA 2FULA 1ELKA 3CGHA 4U8VD 2LUHA 3VTYA 5EYLA 1NFIE 3ZIMA 3U64A 5DIZA 3NQPA 2R5SA 3KAEA 1FPPA 3VLEA 3SHFA 3FH5A 2GGFA 2CHZA 4I6JA 5KCMA 4I6GA 3APFA 2P2CP 3AG4E 4A3TA 3BU8A 5HI7A 1QZ2A 3MZLB 3Q7AA 2XCBA 3PUJA 2PL2A 2C0MA 4ANWA 3UM3A 1UN8A 3MEKA 3CVNA 3JXIA 3AJIA 3PNLB 3TGOA 4GPMA 5EILA 5EYPF 4DLOA 4OYSA 4YDEA 3E32A 1TN6A 1MX6A 1H0AA 1TJFA 2X3MA 3LPZA 4QFVA 3ASNE 3X2QE 2J49A 2YINA 2RFAA 4AEZC 2DCPA 2R02A 4O60A 3Q47B 1FT2A 4DX7D 3HVEB 3Q73A 4XE0A 1PAQA 3CKBA 4APOA 4NRHB 2P9UG 3QWWA 3EHQA 2XS1A 4U0SA 2IO3C 3RAUA 5EX0A 5JJ7A 2Y69E 4ZFHA 4F53A 4JD2G 1P5QA 1TNOA 2DBAA 3GW4A 3AS4A 2WXQA 3G2UA 4TXRA 4K03A 3FEXA 1U2VG 1HG5A 4AV7A 3L22A 4FP7A 3B7TA 4GZ5A 1TNBA 2J4DA 1TR4A 2QYUA 4ILGA 4W9RA 3ESKA 4GTQA 4V3IA 1HX8A 1V54E 4DX1A 1SVXA 4M7CA 4GZCA 4NIKA 1DC2A 4GYOA 3ZYQA 3V31A 3MKQB 4UQZA 4Y6WA 4AXHA 5AQAA 3OXLA 3CHSA 4WUYA 4DK5A 1N4RA 2I6HA 2YQ8A 2M63A 3ULYA 2J4BA 4I1MA 4C0EA 1IQRA 3P2BA 3JUIA 3L17A 4KZCA 3ZN3A 2AJAA 5ANRA 3LJNA 4JZYA 3PS6A 4A1GA 4L7TA 4HVBA 3R7RA 4BTBA 1Y8MA 5A7DB 3ZHEB 2AWIA 3JXJA 5E75A 5HRYA 4N5CA 3ML8A 5JHBA 5KJNA 3LS8A 3PNTB 3DEPA 3G2TA 3PEVB 3JQ0A 4JB8P 3MKQA 5FZSA 1A5EA 2WPVA 3CK7A 4K5AB 4XX5A 4YVQC 2V5FA 5A6CA 3R9MA 4AOFA 3QWPA 3WXXA 4BT8A 4I1AA 1OT8A 3Q9NC 3BEEA 5CMWA 4HNAD 4G26A 2IJGX 3UM1A 4GTTA 2FBNA 3NF1A 4EPZA 3CVPA 5CCLA 4HOTA 1U3CA 4E85A 2V5QC 3LY7A 3CSFA 3ZHEA 5KBAA 4PS8A 4RVBA 4CYMD 3APDA 5EN5D 4UWLA 4U63A 2ILRA 5B3SE 3IXEA 5CECB 3AAAC 3CKCA 2R03A 1PC2A 2QY7A 4AIFA 2WXOA 4FHJA 4AY6A 1OCRE 4RQIA 3ENEA 4HXIA 5H7PA 1E7VA 4LEUA 1IQUA 2P9KG 4HI9A 3UINC 4HRMB
chains in the Genus database with same CATH topology
4N2QA 1JWFA 1E8XA 2P58C 3CVLA 4RG6A 2VTBA 3L13A 4GA2A 5AJLA 4RSYA 3U9WA 2IQCA 2PZIA 1HF8A 1ZBPA 3FUFA 3QWVA 3S7FA 4BSXA 3Q5MA 2MRIA 4GCOA 5BUZA 3LDZA 3FUJA 3ZPJA 3FHEA 3RIBA 2AXUA 3TG5A 2WQHA 3T5XA 5KJLA 2V0PA 2YHCA 3QOUA 4KBQA 5FT9A 2CG2A 3D3MA 3FTYA 1H6KA 5T4YA 3BG0B 2EQXA 4EQFA 3OTNA 1XGWA 1QQEA 1W3BA 1NP7A 2A4ZA 2X6IA 2X38A 3I5PA 4FLBA 3TXNA 4H7YA 3B13A 3QB2A 4G23A 4GPKA 5C2YA 3MV2B 3ZFWA 4GYWA 4FJZA 3MCXA 3FH8A 3U66A 4ILIA 4D10C 4XIFA 2AXZA 2J09A 5EDSA 2I1JA 3HHMA 3CVUA 3CHRA 4EZLA 5G05J 3UQ3A 4B8CB 2LSUA 3FY4A 1TEZA 4Q96A 3ESLA 3UMVA 3PVLA 3FTUA 3RU0A 1KT0A 2XGMA 3G2VA 3Q49B 4U07A 5CMYA 1TJCA 1OWOA 4JHJA 3VTXA 4FJYA 1Y6IA 1ELRA 4NQ0A 3I4RB 1E96B 1E8YA 4CDMA 4J8SA 3UT4A 4PS3A 2I2OA 4ACKA 5BNWA 2XRZA 4AVXA 3PEUB 5BV1A 3S2AA 4ACLA 3ULQA 5AYWD 1HS6A 3CHQA 4UQYA 5LCWJ 3AS5A 3EHMA 4HOUA 3EHNA 1WM5A 3LY9A 4GZ3A 4DLQA 1NZNA 3U4TA 2KCKA 5ARFA 4CEMA 2RG8A 3FP3A 5G05C 5FQ8A 4LCTA 4N3AA 4AY5A 3S7DA 1HFAA 2Y3AA 5J08A 2OV8A 1Z6TA 5AENA 3LY8A 2NC9A 3ZEFA 3ZXSA 2OOEA 2KC7A 1HG2A 2MOWA 3UX4A 3PREA 2Q7FA 5G2NA 4WNEA 2CFUA 2R17C 4J8EA 3Q15A 4FHKA 1SZAA 4EBAG 2OVFA 2VSNA 4JC8A 2HM8A 4CCAA 4FADA 5C1DA 4HORA 4WWOA 4FULA 3G2SA 4IYPA 4ANXA 3I3NA 3FUHA 4GA1A 4U8HA 2LSVA 5FTPA 3K9IA 4APFA 1OWPA 1E8WA 3S7BA 2XPZA 5LCWC 2LNIA 2IF4A 1EF1C 4I9CA 3SNXA 3LEWA 4IULA 2JEKA 3FWVA 3LXUX 3D9PA 3PDNA 3LCAA 4FU3A 2A5UA 1Z3XA 2I1KA 4FC8A 3VLFA 3QAQA 4G25A 3TAXA 5FWQA 2IU1A 3SBSA 4ILHB 2FI7A 5DBKA 3VLDA 1JUQA 4OVVA 1DNPA 4F7AA 4A55A 2YNQA 3NZSA 4L23A 3TL5A 4Q94A 3CK9A 3P1UA 3ZW3A 1H19A 3D9OA 3ZYLA 5T8IA 2IONA 3FFLA 4L1BA 3MX3A 3IHYA 3QC1A 3ZVVA 5ARGA 2XPIA 1U3DA 2L6JA 1ELWA 1N52A 2QFCA 2WXKA 3PH0C 1A17A 1S0PA 2XEVA 4UI9K 1L5JA 2WXLA 4G2VA 2AXVA 4WWPA 1HZ4A 2I9CA 3SD5A 2VGYA 2XGSA 1EDUA 2FULA 3S7JA 3CVXA 3MYVA 1ELKA 3CGHA 2XQ0A 1KT1A 2C2LA 3FDHA 4JEUA 4DPRA 1QNFA 4UWKA 4GB9A 3URZA 3VTYA 3E4BA 5EX3A 4PUCA 1HE8A 2OVBA 3HVEA 4IN3B 4XZ4A 2PM6A 3ZIMA 2VSOE 4K0RA 1NA0A 3U64A 2VSYA 5DIZA 2JLBA 4B94A 3CVQA 2BTDA 4TUUA 5JJTA 3MA5A 3NQPA 2R5SA 3CSTA 3KAEA 3MGBA 3SHFA 3EJNA 4MRUA 3TJPA 3AU4A 3VLEA 4R7LA 2FF4A 3FH5A 4BX9A 3IBEA 2LAIA 2VGXB 3PZDA 2GGFA 2CHZA 3NZUA 3KS2A 4I6JA 5KCMA 4I6GA 3RK6A 4JA9A 3O48A 1HXIA 4I1OB 2MHKA 3APFA 3APCA 4G24A 3L08A 4N3CA 4KVMA 2NSZA 1ZU2A 3LYAA 4A3TA 1FCHA 2XPYA 5HI7A 1QZ2A 3MZLB 3OXGA 2XCBA 4UWFA 4ANVA 2E2EA 3PUJA 2PL2A 3UT8A 2C0MA 4EZJA 3FH7A 4UQXA 2LO6A 4C0MA 4HOQA 3CHOA 4KYOB 4LUNU 4ANWA 3TXMA 1UN8A 3MEKA 3CVNA 3T5VA 4J0UA 4GYYA 3KEZA 3PNLB 1OWNA 3TGOA 3FU3A 3PE4A 4GZ6A 4FA6A 4DI4A 3ZYMA 4AP2A 3C98A 5J90A 4N2SA 4DLOA 2X6JA 1MQSA 1BPOA 4OYSA 2X6FA 3ZGQA 4AJWA 4JHRA 4F3VA 4IRUA 4URKA 3N71A 4U04A 3CV0A 1TJFA 1H0AA 1YA0A 4BTAA 3FUDA 3ZYKA 4MKTA 1H2VC 2X3MA 3LPZA 4QFVA 3PRZA 3IEGA 1HU3A 4RG9A 3HIZA 2J49A 4AM9A 2VGXA 4NURA 3TG4A 2CHWA 2PM7A 2E0IA 2GRMA 2YINA 2FEZA 4AEZC 3CVYA 2PQRA 2DCPA 2WMNA 2WXIA 5M72A 1N54A 4EBAA 4ANUA 3Q47B 3FEYA 1FVHA 4CDNA 3G2WA 2XHEA 2KM4A 3HVEB 5ANLA 2Y4TA 1KLXA 3LVRE 3QJZA 4XE0A 3LVQE 1PAQA 3CKBA 4ABNA 4APOA 4HS2A 4NRHB 1UW4B 4UWGA 2IOSA 3L6AA 3PUKA 1E8ZA 1NA3A 3IKOB 3QWWA 4UI9J 3QARA 4L2LA 1UJKA 2WXRA 1DVPA 1SQMA 3D9NA 1X5BA 2L9BA 4I43A 4U0SA 2X6KA 4C9BB 2GRLA 5G04J 5KJMA 5LFAA 2ZU6B 1EPUA 2HYZA 2KATA 3CLJA 3JCKC 1JPLA 3KD7A 3ASDA 5EX0A 5JJ7A 3SBTB 1OUVA 2IFUA 3ZRHA 1JWGA 3AS8A 5LX8A 3FTZA 3MKRA 1PY1A 5AJDA 2XGOA 2WXPA 4F53A 4J8DA 4XKCA 2VYIA 1P5QA 3LKUA 4A3VA 2DBAA 3GW4A 3QK0A 4JVSA 3AS4A 4WNGA 1H2TC 2WXQA 4I6EA 3RJVA 5HQ8A 3RKVA 3BG1B 3G2UA 4P29A 4K03A 4E6HA 3FEXA 2WXJA 5FJYA 2V8SE 4JPSA 3OAWA 1HG5A 2VQ2A 4AV7A 4G11A 3L22A 3ONKA 3HDXA 4FP7A 4KVOA 4UI9C 3ASGA 5LOZA 2FO7A 3ASHA 3B7TA 4GZ5A 5FZQA 2VJ8A 1B89A 4WWNA 4N39A 5G04C 4TV3A 2WXGA 4B8AA 2WVIA 2J4DA 4GMJA 5JJ6A 4ILGA 1Z3YA 4F1SA 4W9RA 1XNFA 3ESKA 4BFRA 4GCNA 5D0OD 4BT9A 4V3IA 3HYMB 1MHQA 1HX8A 4WNDA 3SF4A 2BF0X 2XRYA 4GZCA 4LRZA 5FQ6A 4OVUA 2WXMA 4I2WA 4GYOA 5E76A 1E7UA 4PH4B 3ZYQA 4XI0A 3FUKA 3GZ2A 5JHAA 3MKQB 5CHEE 3RO2A 4UQZA 4Y6WA 4GU5A 4AXHA 3FULA 5KJKA 3AU5A 3CQCB 3UUXA 3FTVA 5LP0A 3UPVA 1EYHA 1HH8A 1OWMA 2CHXA 3OXLA 3QDNA 2WXFA 2J08A 3CHSA 4WUYA 5BT1A 3RRUA 2DIWA 2WMOA 2XCCA 3FU0A 3SFZA 4DK5A 1UN9A 2WXNA 2I6HA 3EIQC 3JQ1A 2YQ8A 4CDRA 4GAAA 2M63A 1UG3A 2KCLA 2J07A 3B7RL 3CR3A 2WXHA 2BUGA 3GZSA 2WB2A 2CG3A 4KMOA 3GYZA 4U0UA 3JYSA 2J4BA 2AVPA 3L54A 4I1MA 4C0EA 3MJWA 1WAO1 2V4LA 3L16A 4B89A 3FTXA 3FTWA 4CRWA 4GZDA 3OXFA 1WY6A 1IQRA 2PQNA 3P2BA 3U3WA 3JUIA 3L17A 4KZCA 3SZ7A 5ANRA 3ZN3A 4BWRA 3D9KA 4EZKA 3CHMA 4YNDA 4HFGA 4JZYA 4M3OA 3PS6A 5D0QD 4A1GA 4L7TA 4HVBA 3R7RA 3ONLA 4CT4A 4G1TA 2KCVA 4ATGA 2R59A 4BTBA 1Y8MA 5A7DB 3ZHEB 2UY1B 4Q69A 1UJJA 2AWIA 3RO3A 3T8MA 3CIAA 1SZ9A 4EECA 4MLPA 5E75A 3MV3B 4GMLA 4N5CA 2LAHA 3ML8A 3RRMB 2KZTB 5JHBA 5CCMA 2NXPA 2ONDA 2AW6A 5KJNA 4U0ZA 3LS8A 3PNTB 3IHVA 3CVVA 3G2TA 3PEVB 3PE3A 4FLHA 4L2YA 4NACA 5A23A 3DBSA 3CEQA 4Y6CA 4DI3A 4XKBA 4WAFA 3JQ0A 4I9EA 2Y4UA 5ENNA 2WQ6A 3MKQA 5FZSA 3D9JA 4PS7A 2WQ7A 2WPVA 3CK7A 3ASFA 2RD0A 4XI9A 4XX5A 4YVQC 5BPPA 2V5FA 4MS6A 3R9AB 4HLEA 1INZA 5A6CA 4I17A 2C0LA 4AOFA 3CK8A 3QWPA 3WXXA 4WNFA 4BT8A 3D9LA 4I1AA 3BEEA 5T3RA 5FZRA 4DJAA 5CMWA 4G26A 4CGVA 2IJGX 3Q4AB 2IOLA 3D9MA 5EKQD 3O4ZA 1GW6A 4GA0A 2FBNA 3FTSA 3EDTB 3NF1A 4JW1A 3B7SA 3CHPA 4H7XA 4EPZA 4CT0A 4PDXA 3D9IA 5BW8C 2VSXE 2VTBB 4KZ0A 3CVPA 4TRQA 3FU5A 5CCLA 3EIJA 3B7UX 3FUIA 4BX8A 4HOTA 1U3CA 1IYGA 4E85A 1VDYA 2UWJG 4ME2A 5BV0A 3SI5A 1IHGA 2WM9A 1HO8A 2L0IA 3GZ1A 2GW1A 3LJ3A 3LY7A 4LERA 4YVOA 4JHKA 3FUMA 3CSFA 4JXTA 4BY6A 4J6IA 3ZHEA 2UY1A 4CGWA 3ML9A 3DPDA 4B0ZA 4PS8A 1H2UA 2KZTA 5AIJA 4RVBA 3QNKA 2YHEA 3APDA 4UWLA 3R7QA 4U63A 3I4GA 3QKYA 2ILRA 2HO1A 4KXKB 1OWLA 5FQ4A 3IV0A 4N3BA 3UT7A 4JL0A 5G55A 4O6FA 1LF8A 2L0TB 4KT6B 2J9QA 3SGHA 3CKCA 1E90A 4J8FA 1PC2A 2QY7A 3FUEA 2WXOA 4AIFA 4FHJA 4I2ZA 5FQ7A 4AY6A 3FUNA 4A1SA 3FU6A 3ENEA 3RRNB 4HXIA 2CFZA 4HOSA 4JEHA 3CVWA 4UWHA 1E7VA 4LEUA 2X6HA 1IQUA 3CQGB 1FVFA 4JA7A 2HR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N2Q A;  2P58 C;  3CVL A;  4RG6 A;  4GA2 A;  2PZI A;  3QWV A;  1ZBP A;  3S7F A;  3Q5M A;  4GCO A;  3ZPJ A;  3RIB A;  3TG5 A;  2WQH A;  5KJL A;  2YHC A;  3QOU A;  4KBQ A;  5FT9 A;  4EQF A;  1QQE A;  1W3B A;  4H7Y A;  4G23 A;  4GPK A;  3MV2 B;  3ZFW A;  4GYW A;  4XIF A;  5G05 J;  3UQ3 A;  2LSU A;  3RU0 A;  1KT0 A;  2XGM A;  3Q49 B;  4U07 A;  1TJC A;  3VTX A;  1ELR A;  4NQ0 A;  1E96 B;  5BNW A;  3ULQ A;  5AYW D;  4UQY A;  5LCW J;  3AS5 A;  4HOU A;  1WM5 A;  3LY9 A;  4GZ3 A;  1NZN A;  3U4T A;  2KCK A;  5ARF A;  3FP3 A;  5G05 C;  4N3A A;  4AY5 A;  3S7D A;  3LY8 A;  2NC9 A;  2OOE A;  2KC7 A;  2Q7F A;  4WNE A;  4J8E A;  3Q15 A;  2VSN A;  5C1D A;  4HOR A;  4GA1 A;  2LSV A;  5FTP A;  3K9I A;  3S7B A;  5LCW C;  2LNI A;  2IF4 A;  4I9C A;  3FWV A;  3PDN A;  3LCA A;  4G25 A;  3TAX A;  2FI7 A;  5DBK A;  3CK9 A;  3FFL A;  5ARG A;  2XPI A;  2L6J A;  2QFC A;  1ELW A;  1A17 A;  2XEV A;  4UI9 K;  4G2V A;  1HZ4 A;  2VGY A;  2XGS A;  3S7J A;  1KT1 A;  2C2L A;  3URZ A;  3VTY A;  3E4B A;  5EX3 A;  4IN3 B;  1NA0 A;  2VSY A;  5DIZ A;  2JLB A;  4B94 A;  3CVQ A;  5JJT A;  3MA5 A;  2R5S A;  3KAE A;  2FF4 A;  2VGX B;  3KS2 A;  4JA9 A;  3O48 A;  1HXI A;  2MHK A;  4N3C A;  4G24 A;  1ZU2 A;  3LYA A;  1FCH A;  5HI7 A;  1QZ2 A;  3OXG A;  2XCB A;  2E2E A;  2PL2 A;  2C0M A;  4UQX A;  4HOQ A;  4KYO B;  3MEK A;  3CVN A;  4J0U A;  4GYY A;  3TGO A;  3PE4 A;  4GZ6 A;  4N2S A;  3ZGQ A;  4JHR A;  4F3V A;  3N71 A;  4U04 A;  3CV0 A;  1YA0 A;  4BTA A;  3LPZ A;  3IEG A;  4RG9 A;  4AM9 A;  2VGX A;  3TG4 A;  2FEZ A;  2PQR A;  5M72 A;  3Q47 B;  2Y4T A;  1KLX A;  3CKB A;  4ABN A;  4APO A;  4NRH B;  1NA3 A;  3QWW A;  4UI9 J;  5KJM A;  4U0S A;  5G04 J;  2HYZ A;  2KAT A;  3KD7 A;  5EX0 A;  3ASD A;  5JJ7 A;  1OUV A;  2IFU A;  3AS8 A;  3MKR A;  2XGO A;  4J8D A;  2VYI A;  1P5Q A;  3LKU A;  2DBA A;  3GW4 A;  4WNG A;  3AS4 A;  5HQ8 A;  3RJV A;  3RKV A;  5FJY A;  2VQ2 A;  4UI9 C;  3ASG A;  2FO7 A;  3ASH A;  5FZQ A;  4GZ5 A;  1B89 A;  4N39 A;  5G04 C;  5JJ6 A;  4W9R A;  1XNF A;  3ESK A;  4GCN A;  5D0O D;  4BT9 A;  3HYM B;  3SF4 A;  4WND A;  4I2W A;  4GYO A;  4XI0 A;  3GZ2 A;  5CHE E;  3RO2 A;  4UQZ A;  4Y6W A;  5KJK A;  3UUX A;  3UPV A;  1HH8 A;  3OXL A;  3QDN A;  4WUY A;  5BT1 A;  2XCC A;  2I6H A;  2YQ8 A;  4CDR A;  2KCL A;  2BUG A;  3GYZ A;  4U0U A;  3JYS A;  2AVP A;  1WAO 1;  3OXF A;  2PQN A;  3U3W A;  3SZ7 A;  3ZN3 A;  4BWR A;  4YND A;  5D0Q D;  4G1T A;  2KCV A;  4BTB A;  1Y8M A;  5A7D B;  3ZHE B;  2UY1 B;  3RO3 A;  3MV3 B;  4N5C A;  5CCM A;  2OND A;  5KJN A;  4U0Z A;  3PE3 A;  3CEQ A;  4Y6C A;  4I9E A;  2Y4U A;  5FZS A;  2WPV A;  3CK7 A;  3ASF A;  4XI9 A;  4YVQ C;  2V5F A;  3R9A B;  5A6C A;  4I17 A;  2C0L A;  3CK8 A;  3QWP A;  3WXX A;  4WNF A;  4BT8 A;  4I1A A;  3BEE A;  5FZR A;  4G26 A;  4CGV A;  3Q4A B;  5EKQ D;  4GA0 A;  2FBN A;  3NF1 A;  3EDT B;  4H7X A;  5BW8 C;  3CVP A;  5CCL A;  1IYG A;  4HOT A;  2UWJ G;  4ME2 A;  1IHG A;  3GZ1 A;  2GW1 A;  3LY7 A;  4YVO A;  3ZHE A;  2UY1 A;  4CGW A;  3QKY A;  2HO1 A;  4KXK B;  4N3B A;  4JL0 A;  4O6F A;  2J9Q A;  3CKC A;  4J8F A;  1PC2 A;  4AIF A;  4I2Z A;  4AY6 A;  4A1S A;  4HOS A;  4LEU A;  4JA7 A;  2HR2 A; 
#chains in the Genus database with same CATH topology
 4N2Q A;  4RG6 A;  4RSY A;  3U9W A;  4BSX A;  3UKR G;  3V30 A;  3B95 A;  4TUM A;  3ZU7 B;  3FUJ A;  2AXU A;  5FT9 A;  2CG2 A;  2XEN A;  2GRQ B;  3FTY A;  1H6K A;  4GTV A;  3BG0 B;  1NP7 A;  2A4Z A;  4FLB A;  4O1P A;  5C2Y A;  3MV2 B;  3ZFW A;  3DXK G;  3FH8 A;  3U66 A;  4XIF A;  3PZ1 A;  3HHM A;  3PVL A;  3RU0 A;  3Q49 B;  2XEE A;  3HXB A;  4XEI G;  4RLY A;  1AWC B;  3UT4 A;  4ACL A;  3ULQ A;  4UQY A;  4YDW A;  4GZ3 A;  1NZN A;  2KCK A;  2RG8 A;  5AN8 A;  5G05 C;  3SQV A;  4ATZ D;  4AY5 A;  3S7D A;  5J08 A;  2OV8 A;  3UTM A;  3LY8 A;  1HG2 A;  2CFU A;  3Q15 A;  4FHK A;  3F6Q A;  4FAD A;  1NL4 A;  4HOR A;  1S70 B;  4WWO A;  4FUL A;  3NOC D;  1BU9 A;  3I3N A;  3FUH A;  4GA1 A;  1OWP A;  2XPZ A;  4LSZ E;  3D9H A;  1TNY A;  5CBN A;  2A5U A;  4FC8 A;  3TAX A;  1D8E A;  2FI7 A;  1JUQ A;  4OVV A;  4F7A A;  2YNQ A;  3NZS A;  3TL5 A;  1LD7 A;  3ZW3 A;  3ZYL A;  2ION A;  4QQI A;  1ELW A;  1N52 A;  1S0P A;  1UOH A;  1L5J A;  2WXL A;  3C72 A;  2AXV A;  2XGS A;  1EDU A;  3CVX A;  2XQ0 A;  1KT1 A;  2ZGD A;  2C2L A;  4JEU A;  4DPR A;  4GB9 A;  5ITZ F;  4PUC A;  3HXF A;  4IN3 B;  4XZ4 A;  2PM6 A;  2VSO E;  4K0R A;  1BLX B;  4CZ2 D;  2VGE A;  5KWD A;  3CST A;  3TJP A;  3EJN A;  3V2O A;  4R7L A;  4BX9 A;  2VGX B;  3PZD A;  3DEO A;  4I1O B;  2DZO A;  3L08 A;  2NSZ A;  4J8Y A;  1ZU2 A;  3LYA A;  1FCH A;  2MYO A;  2XPY A;  3OXG A;  4ANV A;  2E2E A;  1N0R A;  4UQX A;  2LO6 A;  3CHO A;  4KYO B;  2F8X K;  3T5V A;  5CRU A;  3KEZ A;  1TN7 A;  3FU3 A;  4GZ6 A;  3C98 A;  4N2S A;  3ZGQ A;  1YCS B;  4F3V A;  4URK A;  3N71 A;  3CV0 A;  1H2V C;  5AQ7 A;  2LXM A;  1V55 E;  4RG9 A;  2VGX A;  2CHW A;  3AG1 E;  2E0I A;  2GRM A;  2FEZ A;  3V2X A;  2WMN A;  3FEY A;  4CDN A;  3G2W A;  4K5B A;  5HS0 A;  1Z5S C;  1S63 A;  2KXP C;  5ANL A;  3UKU G;  1KLX A;  2F37 A;  3L6A A;  3PUK A;  1E8Z A;  4TXP A;  4L2L A;  1UJK A;  1SQM A;  3D9N A;  1X5B A;  3E30 A;  5KJM A;  4C9B B;  3HXC A;  2ZU6 B;  2KAT A;  3KD7 A;  2IFU A;  1JWG A;  1PY1 A;  2XGO A;  4XKC A;  2VYI A;  5ENT D;  3QK0 A;  4JVS A;  1H2T C;  4I6E A;  3RKV A;  4P29 A;  1TNU A;  3OAW A;  3ASO E;  3NOG D;  4UI9 C;  3HDX A;  3ASG A;  5LOZ A;  3ASH A;  5FZQ A;  2IO2 C;  2VJ8 A;  1B89 A;  4WWN A;  5G04 C;  2WVI A;  1Z3Y A;  3UXG A;  5D0O D;  4BT9 A;  5BXU A;  3SF4 A;  2BF0 X;  2PNN A;  5FQ6 A;  1E7U A;  5JHA A;  1TN8 A;  4GU5 A;  5KJK A;  1OWM A;  2CHX A;  2WXF A;  3SFZ A;  2DIW A;  2WMO A;  2XCC A;  4U95 D;  2P9N G;  2GRP B;  2BUG A;  2BKG A;  3JYS A;  1K8K G;  3MJW A;  1WAO 1;  2V4L A;  3FTX A;  3FTW A;  4GZD A;  3U3W A;  4GTR A;  4LNG A;  3ONL A;  4G1T A;  3T8M A;  3RO3 A;  4MLP A;  4GML A;  2LAH A;  3RRM B;  5CCM A;  1DCE A;  4U0Z A;  3IHV A;  3NAW A;  3PE3 A;  5A23 A;  4Y6C A;  4DI3 A;  4PS7 A;  2WQ7 A;  3ASF A;  4HLE A;  3CK8 A;  4WNF A;  3D9L A;  5T3R A;  3Q4A B;  3ISM C;  5AAR A;  1GW6 A;  4F6R D;  2ETC A;  3FTS A;  3EDT B;  4JW1 A;  3B7S A;  4H7X A;  4PDX A;  2VTB B;  4TRQ A;  3EIJ A;  4BX8 A;  1VDY A;  2UWJ G;  4ME2 A;  5BV0 A;  2WM9 A;  2H6H A;  1HO8 A;  2L0I A;  3TWW A;  2GW1 A;  3LJ3 A;  3FUM A;  4G8L A;  4J6I A;  2EIK E;  4OAV B;  4KXK B;  1OWL A;  3W9G A;  4N3B A;  3SO8 A;  4JL0 A;  1YMP A;  1LF8 A;  4J7W A;  3EUV A;  3FUE A;  3FUN A;  3E34 A;  2FO1 E;  3FU6 A;  3RRN B;  3EU9 A;  3WG7 E;  4UWH A;  5ENO D;  4GMR A;  1FVF A;  4LG6 A;  2VTB A;  5AJL A;  2IQC A;  3FUF A;  1QYM A;  2MRI A;  2GRO B;  2ZXW E;  3FHE A;  4HI8 A;  3RIB A;  2YHC A;  3QOU A;  3OTN A;  1XGW A;  2X6I A;  4H7Y A;  4FJZ A;  4ILI A;  4D10 C;  3KEA A;  5EDS A;  4GTS A;  3CHR A;  5G05 J;  3UQ3 A;  2LSU A;  3ABM E;  3FY4 A;  4GTM A;  3PZ2 A;  3KSL A;  3FTU A;  1JCR A;  2XGM A;  3G2V A;  4BSZ B;  1TNZ A;  4FJY A;  3J5P A;  4HQD A;  1ELR A;  3I4R B;  1E96 B;  1E8Y A;  4ACK A;  2I2O A;  5BNW A;  4AVX A;  5BV1 A;  5AYW D;  3AS5 A;  4HOU A;  1K1B A;  1WM5 A;  1O1T A;  4LCT A;  4N3A A;  2Y3A A;  3UM2 A;  3ZXS A;  2KC7 A;  3PRE A;  5G2N A;  4J8E A;  2R17 C;  2IY0 C;  1BD8 A;  4DX5 D;  4DUI A;  5C1D A;  4ANX A;  3UIP C;  3K9I A;  1E8W A;  3S7B A;  2F0Y A;  1H6O A;  1EF1 C;  4I9C A;  2JEK A;  3FWV A;  2IU1 A;  2H6F A;  5DBK A;  4Q94 A;  3CK9 A;  3DSW A;  1N0Q A;  3D9O A;  2EIN E;  2XZT G;  4L1B A;  3MX3 A;  3IHY A;  1U3D A;  4DRX E;  1JCQ A;  2XEV A;  3HXD A;  3BUA A;  4G2V A;  1HZ4 A;  2VGY A;  3MYV A;  3FDH A;  3E4B A;  5EX3 A;  1HE8 A;  2OVB A;  1NA0 A;  2JLB A;  4B94 A;  5AQ9 A;  3CVQ A;  2BTD A;  5JJT A;  4MRU A;  3AU4 A;  3IBE A;  3NZU A;  3RK6 A;  1DCQ A;  3O48 A;  1HXI A;  3Q79 A;  2MHK A;  3APC A;  4C48 B;  3UT8 A;  4EZJ A;  3FH7 A;  4C0M A;  3TXM A;  4J0U A;  4GYY A;  1OWN A;  4FA6 A;  4DI4 A;  3UIO C;  2X6J A;  4JHR A;  1YA0 A;  3FUD A;  4MKT A;  3PRZ A;  1HU3 A;  3HIZ A;  4AM9 A;  3NBN B;  5ENQ D;  2PQR A;  5M72 A;  2WXI A;  3PZ4 A;  1N54 A;  2XHE A;  3LVR E;  3QJZ A;  4BER A;  4UWG A;  2IOS A;  1OCC E;  2DYS E;  4UI9 J;  3QAR A;  2WXR A;  1DVP A;  4I43 A;  1RZ4 A;  5G04 J;  5LFA A;  2LXL A;  2V4H C;  2DVW A;  3CLJ A;  3JCK C;  1JPL A;  1OUV A;  3ZRH A;  3AS8 A;  5AJD A;  2XEH A;  4J8D A;  4A3V A;  4WNG A;  5HQ8 A;  1MX4 A;  2J8S D;  2EIM E;  3BG1 B;  3ABK E;  4E6H A;  5FJY A;  2V8S E;  3J5Q B;  2VQ2 A;  1KZP A;  2BKK B;  2FO7 A;  4TV3 A;  4B8A A;  5KNH D;  1XNF A;  4BFR A;  4WND A;  2XRY A;  4LRZ A;  4OVU A;  4I2W A;  4PH4 B;  4XI0 A;  3FUK A;  3GZ2 A;  3RO2 A;  4UUC A;  3UPV A;  3DWL G;  5LP0 A;  3DRA A;  1EYH A;  1OCZ E;  3QDN A;  2J08 A;  3RRU A;  1AP7 A;  1MJ0 A;  1UN9 A;  3JQ1 A;  4CDR A;  4GAA A;  2KCL A;  2J07 A;  3B7R L;  3CR3 A;  2WXH A;  2WB2 A;  3GYZ A;  2AVP A;  2H6I A;  4G8K A;  4CRW A;  3OXF A;  1BI8 B;  4N5Q A;  1S64 A;  4BWR A;  4U96 D;  4CT4 A;  2KCV A;  3E33 A;  2R59 A;  1UJJ A;  4EEC A;  3MV3 B;  1D8D A;  2NXP A;  2OND A;  2AW6 A;  4LNU D;  3CVV A;  5HKP A;  4L2Y A;  5D66 A;  2A5E A;  3CEQ A;  4WAF A;  5ENN A;  2WQ6 A;  4XI9 A;  3R9A B;  1INZ A;  4I17 A;  2C0L A;  5CBO A;  5ENP D;  4DJA A;  2IOL A;  3D9M A;  4GA0 A;  1WG0 A;  3SY2 A;  4CT0 A;  3D9I A;  5BW8 C;  2VSX E;  4KZ0 A;  1WDY A;  3FU5 A;  1IYG A;  3B7U X;  3FUI A;  3SI5 A;  1IHG A;  4L9P A;  4LER A;  4JHK A;  4JXT A;  3HRA A;  4X8Q A;  3ML9 A;  2Y1L E;  3DPD A;  3L9T A;  3ZXP A;  4B0Z A;  1FT1 A;  1LTX A;  3BQO A;  3R7Q A;  2HO1 A;  3IV0 A;  1N95 A;  4Z68 A;  2L0T B;  4KT6 B;  2J9Q A;  3SGH A;  1E90 A;  2DWZ A;  3ZNG A;  1KPS B;  5ENR D;  2CFZ A;  3CVW A;  1X81 A;  3CQG B;  2L6B A;  4HRL A;  1O1S A;  4JA7 A;  4DX2 A;  1JWF A;  2P58 C;  2P9S G;  2QZA A;  3Q7F A;  3L13 A;  1HF8 A;  1ZBP A;  3S7F A;  1G3N B;  4LNB A;  3Q5M A;  2WQH A;  4YDO A;  5KNG A;  2V0P A;  3D3M A;  1SA5 A;  5T4Y A;  2EQX A;  2R2L A;  3DXM G;  1Q2Z A;  1QQE A;  3TXN A;  2GRN B;  3QB2 A;  4G23 A;  4GTP A;  4GPK A;  5CER B;  4GYW A;  2EIJ E;  3MCX A;  3TWR A;  2J09 A;  3CVU A;  2XS8 A;  2DZN A;  1D9S A;  4DX6 D;  4B8C B;  1TEZ A;  4Q96 A;  3ESL A;  1IHB A;  2R05 A;  1YYH A;  3DSX A;  4U07 A;  5CMY A;  1RW2 A;  1OWO A;  4NQ0 A;  1QBQ A;  4CDM A;  3AG2 E;  4PS3 A;  2XRZ A;  3PEU B;  3EHM A;  3EHN A;  3LY9 A;  4DLQ A;  3U4T A;  5ARF A;  4CEM A;  4GTO A;  5FQ8 A;  1HFA A;  3Q78 A;  5AEN A;  2NC9 A;  2MOW A;  3UX4 A;  1N4Q A;  4EBA G;  2OVF A;  2VSN A;  2Y0B G;  2HM8 A;  4JC8 A;  4IYP A;  1MYO A;  2DYR E;  3C3R A;  4APF A;  5LCW C;  2IF4 A;  3SNX A;  3LEW A;  3LCA A;  4FU3 A;  3VLF A;  2IEJ A;  2I1K A;  3QAQ A;  4G25 A;  4ILH B;  3TWV A;  1DNP A;  4L23 A;  3P1U A;  3FFL A;  5AAO A;  3ZVV A;  5ARG A;  2XPI A;  2L6J A;  2WXK A;  4BET A;  2H6G A;  4OAU C;  2I9C A;  3S7J A;  4HRN A;  1QNF A;  4UWK A;  3URZ A;  3SFX A;  3NB2 A;  3W9F A;  3HVE A;  5ENS D;  2VSY A;  1OXJ A;  4TUU A;  3MA5 A;  3MGB A;  2ETA A;  2FF4 A;  2LAI A;  3HXE A;  3KS2 A;  3E37 A;  4JA9 A;  4N3C A;  4G24 A;  4KVM A;  4UWF A;  5IY5 E;  2P9I G;  5CED B;  4HOQ A;  4HB5 A;  3UM0 A;  4LUN U;  5FIN A;  3ULE G;  2QC9 A;  4HLL A;  3PE4 A;  3ZYM A;  4AP2 A;  5J90 A;  1MQS A;  1BPO A;  1BI7 B;  2X6F A;  4AJW A;  4IRU A;  2GRR B;  4U04 A;  4BTA A;  3ZYK A;  3IEG A;  1N94 A;  4NUR A;  3TG4 A;  5AQB A;  2PM7 A;  1ZB1 A;  2P9P G;  3CVY A;  4U8Y D;  4EBA A;  4ANU A;  1FVH A;  2KBX A;  2KM4 A;  3TWT A;  1N4P A;  2Y4T A;  3LVQ E;  4ABN A;  1N4S A;  4HS2 A;  1UW4 B;  3TWU A;  3IKO B;  1NA3 A;  5D2M C;  1OY3 D;  4HBD A;  2L9B A;  2X6K A;  1K1A A;  2GRL A;  3RSE G;  1SA4 A;  1EPU A;  2HYZ A;  3ASD A;  3DST A;  3SBT B;  5LX8 A;  3FTZ A;  2QYJ A;  3MKR A;  2OEW A;  3KSQ A;  2WXP A;  1MX2 A;  3LKU A;  3RJV A;  1N11 A;  3UI2 A;  3Q75 A;  2WXJ A;  5FIO A;  4JPS A;  4G11 A;  3ONK A;  4KVO A;  5CEA A;  4N39 A;  2WXG A;  1NI1 A;  2OEV A;  4GMJ A;  5JJ6 A;  4F1S A;  3B7B A;  4GCN A;  3V79 K;  3HYM B;  1MHQ A;  2WXM A;  5E76 A;  5CHE E;  3FUL A;  3AU5 A;  3CQC B;  3UUX A;  3FTV A;  4O1O A;  1HH8 A;  1SW6 A;  5BT1 A;  3FU0 A;  3PZ3 A;  2WXN A;  3EIQ C;  2ZIR A;  1UG3 A;  3GZS A;  2CG3 A;  4KMO A;  1TYQ G;  4U0U A;  1IXV A;  3L54 A;  3L16 A;  4B89 A;  1WY6 A;  5EIB E;  2PQN A;  2EIL E;  3SZ7 A;  4EZK A;  3D9K A;  3CHM A;  4YND A;  4HFG A;  4M3O A;  5D0Q D;  5JMN D;  4ATG A;  4Q69 A;  2UY1 B;  3CIA A;  1SZ9 A;  3DSS A;  4BES A;  2KZT B;  3JUE A;  3L82 A;  4YDY A;  4FLH A;  4NAC A;  3DBS A;  4XKB A;  4I9E A;  2Y4U A;  3D9J A;  2RD0 A;  5BPP A;  4MS6 A;  3ABL E;  1K3Z D;  5FZR A;  1OCO E;  4CGV A;  5EKQ D;  3O4Z A;  3CHP A;  5EID A;  2NYJ A;  1JCS A;  3GZ1 A;  3DPY A;  4YVO A;  4BY6 A;  2UY1 A;  4CGW A;  1O5M A;  1H2U A;  2KZT A;  5AIJ A;  3QNK A;  2YHE A;  2ZIS A;  3T8K A;  3I4G A;  3QKY A;  3DSV A;  2ZGG A;  3DSU A;  5FQ4 A;  3UT7 A;  5G55 A;  4O6F A;  4TXQ A;  4J8F A;  4I2Z A;  5FQ7 A;  4A1S A;  3HG0 D;  3ZKJ A;  4HOS A;  4JEH A;  2X6H A;  3Q9U C;  2HR2 A;  1E8X A;  3CVL A;  4GA2 A;  2JAB A;  4A63 B;  2PZI A;  3C3Q A;  3QWV A;  4EHM A;  4GCO A;  5BUZ A;  3LDZ A;  3ZPJ A;  3TG5 A;  3T5X A;  5KJL A;  4KBQ A;  4EQF A;  1MZC A;  1W3B A;  2X38 A;  3I5P A;  3B13 A;  2B0O E;  2AXZ A;  2I1J A;  4EZL A;  3TWS A;  3C5R A;  3UMV A;  5B1B E;  1KT0 A;  1TJC A;  2RKK A;  4JHJ A;  3C3O A;  2RFM A;  3VTX A;  1Y6I A;  3TWX A;  2OCC E;  4J8S A;  3S2A A;  3AG3 E;  1HS6 A;  5B1A E;  3CHQ A;  5LCW J;  2F8Y A;  3TWQ A;  2B6C A;  3EHR A;  3FP3 A;  5BXO A;  1H6P A;  1Z6T A;  3EU5 A;  3ZEF A;  2OOE A;  4B93 B;  3T9K A;  2Q7F A;  4WNE A;  1N9A A;  1SZA A;  4CCA A;  4K5C A;  3G2S A;  2ETB A;  1LD8 A;  4U7E B;  4U8H A;  2LSV A;  5FTP A;  3ZUV B;  4MBG A;  4ZHB A;  2LNI A;  4IUL A;  3PDN A;  3LXU X;  3D9P A;  1Z3X A;  4BEP A;  5FWQ A;  3SBS A;  3VLD A;  1IKN D;  4A55 A;  2BED A;  1H19 A;  5T8I A;  1O1R A;  2HE0 A;  3QC1 A;  2XZD G;  2P9L G;  2QFC A;  3PH0 C;  1A17 A;  4UI9 K;  5JA4 D;  5CRV A;  4F1P A;  4WWP A;  3SD5 A;  1KZO A;  3SFY A;  2FUL A;  1ELK A;  3CGH A;  4U8V D;  2LUH A;  3VTY A;  5EYL A;  1NFI E;  3ZIM A;  3U64 A;  5DIZ A;  3NQP A;  2R5S A;  3KAE A;  1FPP A;  3VLE A;  3SHF A;  3FH5 A;  2GGF A;  2CHZ A;  4I6J A;  5KCM A;  4I6G A;  3APF A;  2P2C P;  3AG4 E;  4A3T A;  3BU8 A;  5HI7 A;  1QZ2 A;  3MZL B;  3Q7A A;  2XCB A;  3PUJ A;  2PL2 A;  2C0M A;  4ANW A;  3UM3 A;  1UN8 A;  3MEK A;  3CVN A;  3JXI A;  3AJI A;  3PNL B;  3TGO A;  4GPM A;  5EIL A;  5EYP F;  4DLO A;  4OYS A;  4YDE A;  3E32 A;  1TN6 A;  1MX6 A;  1H0A A;  1TJF A;  2X3M A;  3LPZ A;  4QFV A;  3ASN E;  3X2Q E;  2J49 A;  2YIN A;  2RFA A;  4AEZ C;  2DCP A;  2R02 A;  4O60 A;  3Q47 B;  1FT2 A;  4DX7 D;  3HVE B;  3Q73 A;  4XE0 A;  1PAQ A;  3CKB A;  4APO A;  4NRH B;  2P9U G;  3QWW A;  3EHQ A;  2XS1 A;  4U0S A;  2IO3 C;  3RAU A;  5EX0 A;  5JJ7 A;  2Y69 E;  4ZFH A;  4F53 A;  4JD2 G;  1P5Q A;  1TNO A;  2DBA A;  3GW4 A;  3AS4 A;  2WXQ A;  3G2U A;  4TXR A;  4K03 A;  3FEX A;  1U2V G;  1HG5 A;  4AV7 A;  3L22 A;  4FP7 A;  3B7T A;  4GZ5 A;  1TNB A;  2J4D A;  1TR4 A;  2QYU A;  4ILG A;  4W9R A;  3ESK A;  4GTQ A;  4V3I A;  1HX8 A;  1V54 E;  4DX1 A;  1SVX A;  4M7C A;  4GZC A;  4NIK A;  1DC2 A;  4GYO A;  3ZYQ A;  3V31 A;  3MKQ B;  4UQZ A;  4Y6W A;  4AXH A;  5AQA A;  3OXL A;  3CHS A;  4WUY A;  4DK5 A;  1N4R A;  2I6H A;  2YQ8 A;  2M63 A;  3ULY A;  2J4B A;  4I1M A;  4C0E A;  1IQR A;  3P2B A;  3JUI A;  3L17 A;  4KZC A;  3ZN3 A;  2AJA A;  5ANR A;  3LJN A;  4JZY A;  3PS6 A;  4A1G A;  4L7T A;  4HVB A;  3R7R A;  4BTB A;  1Y8M A;  5A7D B;  3ZHE B;  2AWI A;  3JXJ A;  5E75 A;  5HRY A;  4N5C A;  3ML8 A;  5JHB A;  5KJN A;  3LS8 A;  3PNT B;  3DEP A;  3G2T A;  3PEV B;  3JQ0 A;  4JB8 P;  3MKQ A;  5FZS A;  1A5E A;  2WPV A;  3CK7 A;  4K5A B;  4XX5 A;  4YVQ C;  2V5F A;  5A6C A;  3R9M A;  4AOF A;  3QWP A;  3WXX A;  4BT8 A;  4I1A A;  1OT8 A;  3Q9N C;  3BEE A;  5CMW A;  4HNA D;  4G26 A;  2IJG X;  3UM1 A;  4GTT A;  2FBN A;  3NF1 A;  4EPZ A;  3CVP A;  5CCL A;  4HOT A;  1U3C A;  4E85 A;  2V5Q C;  3LY7 A;  3CSF A;  3ZHE A;  5KBA A;  4PS8 A;  4RVB A;  4CYM D;  3APD A;  5EN5 D;  4UWL A;  4U63 A;  2ILR A;  5B3S E;  3IXE A;  5CEC B;  3AAA C;  3CKC A;  2R03 A;  1PC2 A;  2QY7 A;  4AIF A;  2WXO A;  4FHJ A;  4AY6 A;  1OCR E;  4RQI A;  3ENE A;  4HXI A;  5H7P A;  1E7V A;  4LEU A;  1IQU A;  2P9K G;  4HI9 A;  3UIN C;  4HRM B; 
#chains in the Genus database with same CATH homology
 4N2Q A;  1JWF A;  1E8X A;  2P58 C;  3CVL A;  4RG6 A;  2VTB A;  3L13 A;  4GA2 A;  5AJL A;  4RSY A;  3U9W A;  2IQC A;  2PZI A;  1HF8 A;  1ZBP A;  3FUF A;  3QWV A;  3S7F A;  4BSX A;  3Q5M A;  2MRI A;  4GCO A;  5BUZ A;  3LDZ A;  3FUJ A;  3ZPJ A;  3FHE A;  3RIB A;  2AXU A;  3TG5 A;  2WQH A;  3T5X A;  5KJL A;  2V0P A;  2YHC A;  3QOU A;  4KBQ A;  5FT9 A;  2CG2 A;  3D3M A;  3FTY A;  1H6K A;  5T4Y A;  3BG0 B;  2EQX A;  4EQF A;  3OTN A;  1XGW A;  1QQE A;  1W3B A;  1NP7 A;  2A4Z A;  2X6I A;  2X38 A;  3I5P A;  4FLB A;  3TXN A;  4H7Y A;  3B13 A;  3QB2 A;  4G23 A;  4GPK A;  5C2Y A;  3MV2 B;  3ZFW A;  4GYW A;  4FJZ A;  3MCX A;  3FH8 A;  3U66 A;  4ILI A;  4D10 C;  4XIF A;  2AXZ A;  2J09 A;  5EDS A;  2I1J A;  3HHM A;  3CVU A;  3CHR A;  4EZL A;  5G05 J;  3UQ3 A;  4B8C B;  2LSU A;  3FY4 A;  1TEZ A;  4Q96 A;  3ESL A;  3UMV A;  3PVL A;  3FTU A;  3RU0 A;  1KT0 A;  2XGM A;  3G2V A;  3Q49 B;  4U07 A;  5CMY A;  1TJC A;  1OWO A;  4JHJ A;  3VTX A;  4FJY A;  1Y6I A;  1ELR A;  4NQ0 A;  3I4R B;  1E96 B;  1E8Y A;  4CDM A;  4J8S A;  3UT4 A;  4PS3 A;  2I2O A;  4ACK A;  5BNW A;  2XRZ A;  4AVX A;  3PEU B;  5BV1 A;  3S2A A;  4ACL A;  3ULQ A;  5AYW D;  1HS6 A;  3CHQ A;  4UQY A;  5LCW J;  3AS5 A;  3EHM A;  4HOU A;  3EHN A;  1WM5 A;  3LY9 A;  4GZ3 A;  4DLQ A;  1NZN A;  3U4T A;  2KCK A;  5ARF A;  4CEM A;  2RG8 A;  3FP3 A;  5G05 C;  5FQ8 A;  4LCT A;  4N3A A;  4AY5 A;  3S7D A;  1HFA A;  2Y3A A;  5J08 A;  2OV8 A;  1Z6T A;  5AEN A;  3LY8 A;  2NC9 A;  3ZEF A;  3ZXS A;  2OOE A;  2KC7 A;  1HG2 A;  2MOW A;  3UX4 A;  3PRE A;  2Q7F A;  5G2N A;  4WNE A;  2CFU A;  2R17 C;  4J8E A;  3Q15 A;  4FHK A;  1SZA A;  4EBA G;  2OVF A;  2VSN A;  4JC8 A;  2HM8 A;  4CCA A;  4FAD A;  5C1D A;  4HOR A;  4WWO A;  4FUL A;  3G2S A;  4IYP A;  4ANX A;  3I3N A;  3FUH A;  4GA1 A;  4U8H A;  2LSV A;  5FTP A;  3K9I A;  4APF A;  1OWP A;  1E8W A;  3S7B A;  2XPZ A;  5LCW C;  2LNI A;  2IF4 A;  1EF1 C;  4I9C A;  3SNX A;  3LEW A;  4IUL A;  2JEK A;  3FWV A;  3LXU X;  3D9P A;  3PDN A;  3LCA A;  4FU3 A;  2A5U A;  1Z3X A;  2I1K A;  4FC8 A;  3VLF A;  3QAQ A;  4G25 A;  3TAX A;  5FWQ A;  2IU1 A;  3SBS A;  4ILH B;  2FI7 A;  5DBK A;  3VLD A;  1JUQ A;  4OVV A;  1DNP A;  4F7A A;  4A55 A;  2YNQ A;  3NZS A;  4L23 A;  3TL5 A;  4Q94 A;  3CK9 A;  3P1U A;  3ZW3 A;  1H19 A;  3D9O A;  3ZYL A;  5T8I A;  2ION A;  3FFL A;  4L1B A;  3MX3 A;  3IHY A;  3QC1 A;  3ZVV A;  5ARG A;  2XPI A;  1U3D A;  2L6J A;  1ELW A;  1N52 A;  2QFC A;  2WXK A;  3PH0 C;  1A17 A;  1S0P A;  2XEV A;  4UI9 K;  1L5J A;  2WXL A;  4G2V A;  2AXV A;  4WWP A;  1HZ4 A;  2I9C A;  3SD5 A;  2VGY A;  2XGS A;  1EDU A;  2FUL A;  3S7J A;  3CVX A;  3MYV A;  1ELK A;  3CGH A;  2XQ0 A;  1KT1 A;  2C2L A;  3FDH A;  4JEU A;  4DPR A;  1QNF A;  4UWK A;  4GB9 A;  3URZ A;  3VTY A;  3E4B A;  5EX3 A;  4PUC A;  1HE8 A;  2OVB A;  3HVE A;  4IN3 B;  4XZ4 A;  2PM6 A;  3ZIM A;  2VSO E;  4K0R A;  1NA0 A;  3U64 A;  2VSY A;  5DIZ A;  2JLB A;  4B94 A;  3CVQ A;  2BTD A;  4TUU A;  5JJT A;  3MA5 A;  3NQP A;  2R5S A;  3CST A;  3KAE A;  3MGB A;  3SHF A;  3EJN A;  4MRU A;  3TJP A;  3AU4 A;  3VLE A;  4R7L A;  2FF4 A;  3FH5 A;  4BX9 A;  3IBE A;  2LAI A;  2VGX B;  3PZD A;  2GGF A;  2CHZ A;  3NZU A;  3KS2 A;  4I6J A;  5KCM A;  4I6G A;  3RK6 A;  4JA9 A;  3O48 A;  1HXI A;  4I1O B;  2MHK A;  3APF A;  3APC A;  4G24 A;  3L08 A;  4N3C A;  4KVM A;  2NSZ A;  1ZU2 A;  3LYA A;  4A3T A;  1FCH A;  2XPY A;  5HI7 A;  1QZ2 A;  3MZL B;  3OXG A;  2XCB A;  4UWF A;  4ANV A;  2E2E A;  3PUJ A;  2PL2 A;  3UT8 A;  2C0M A;  4EZJ A;  3FH7 A;  4UQX A;  2LO6 A;  4C0M A;  4HOQ A;  3CHO A;  4KYO B;  4LUN U;  4ANW A;  3TXM A;  1UN8 A;  3MEK A;  3CVN A;  3T5V A;  4J0U A;  4GYY A;  3KEZ A;  3PNL B;  1OWN A;  3TGO A;  3FU3 A;  3PE4 A;  4GZ6 A;  4FA6 A;  4DI4 A;  3ZYM A;  4AP2 A;  3C98 A;  5J90 A;  4N2S A;  4DLO A;  2X6J A;  1MQS A;  1BPO A;  4OYS A;  2X6F A;  3ZGQ A;  4AJW A;  4JHR A;  4F3V A;  4IRU A;  4URK A;  3N71 A;  4U04 A;  3CV0 A;  1TJF A;  1H0A A;  1YA0 A;  4BTA A;  3FUD A;  3ZYK A;  4MKT A;  1H2V C;  2X3M A;  3LPZ A;  4QFV A;  3PRZ A;  3IEG A;  1HU3 A;  4RG9 A;  3HIZ A;  2J49 A;  4AM9 A;  2VGX A;  4NUR A;  3TG4 A;  2CHW A;  2PM7 A;  2E0I A;  2GRM A;  2YIN A;  2FEZ A;  4AEZ C;  3CVY A;  2PQR A;  2DCP A;  2WMN A;  2WXI A;  5M72 A;  1N54 A;  4EBA A;  4ANU A;  3Q47 B;  3FEY A;  1FVH A;  4CDN A;  3G2W A;  2XHE A;  2KM4 A;  3HVE B;  5ANL A;  2Y4T A;  1KLX A;  3LVR E;  3QJZ A;  4XE0 A;  3LVQ E;  1PAQ A;  3CKB A;  4ABN A;  4APO A;  4HS2 A;  4NRH B;  1UW4 B;  4UWG A;  2IOS A;  3L6A A;  3PUK A;  1E8Z A;  1NA3 A;  3IKO B;  3QWW A;  4UI9 J;  3QAR A;  4L2L A;  1UJK A;  2WXR A;  1DVP A;  1SQM A;  3D9N A;  1X5B A;  2L9B A;  4I43 A;  4U0S A;  2X6K A;  4C9B B;  2GRL A;  5G04 J;  5KJM A;  5LFA A;  2ZU6 B;  1EPU A;  2HYZ A;  2KAT A;  3CLJ A;  3JCK C;  1JPL A;  3KD7 A;  3ASD A;  5EX0 A;  5JJ7 A;  3SBT B;  1OUV A;  2IFU A;  3ZRH A;  1JWG A;  3AS8 A;  5LX8 A;  3FTZ A;  3MKR A;  1PY1 A;  5AJD A;  2XGO A;  2WXP A;  4F53 A;  4J8D A;  4XKC A;  2VYI A;  1P5Q A;  3LKU A;  4A3V A;  2DBA A;  3GW4 A;  3QK0 A;  4JVS A;  3AS4 A;  4WNG A;  1H2T C;  2WXQ A;  4I6E A;  3RJV A;  5HQ8 A;  3RKV A;  3BG1 B;  3G2U A;  4P29 A;  4K03 A;  4E6H A;  3FEX A;  2WXJ A;  5FJY A;  2V8S E;  4JPS A;  3OAW A;  1HG5 A;  2VQ2 A;  4AV7 A;  4G11 A;  3L22 A;  3ONK A;  3HDX A;  4FP7 A;  4KVO A;  4UI9 C;  3ASG A;  5LOZ A;  2FO7 A;  3ASH A;  3B7T A;  4GZ5 A;  5FZQ A;  2VJ8 A;  1B89 A;  4WWN A;  4N39 A;  5G04 C;  4TV3 A;  2WXG A;  4B8A A;  2WVI A;  2J4D A;  4GMJ A;  5JJ6 A;  4ILG A;  1Z3Y A;  4F1S A;  4W9R A;  1XNF A;  3ESK A;  4BFR A;  4GCN A;  5D0O D;  4BT9 A;  4V3I A;  3HYM B;  1MHQ A;  1HX8 A;  4WND A;  3SF4 A;  2BF0 X;  2XRY A;  4GZC A;  4LRZ A;  5FQ6 A;  4OVU A;  2WXM A;  4I2W A;  4GYO A;  5E76 A;  1E7U A;  4PH4 B;  3ZYQ A;  4XI0 A;  3FUK A;  3GZ2 A;  5JHA A;  3MKQ B;  5CHE E;  3RO2 A;  4UQZ A;  4Y6W A;  4GU5 A;  4AXH A;  3FUL A;  5KJK A;  3AU5 A;  3CQC B;  3UUX A;  3FTV A;  5LP0 A;  3UPV A;  1EYH A;  1HH8 A;  1OWM A;  2CHX A;  3OXL A;  3QDN A;  2WXF A;  2J08 A;  3CHS A;  4WUY A;  5BT1 A;  3RRU A;  2DIW A;  2WMO A;  2XCC A;  3FU0 A;  3SFZ A;  4DK5 A;  1UN9 A;  2WXN A;  2I6H A;  3EIQ C;  3JQ1 A;  2YQ8 A;  4CDR A;  4GAA A;  2M63 A;  1UG3 A;  2KCL A;  2J07 A;  3B7R L;  3CR3 A;  2WXH A;  2BUG A;  3GZS A;  2WB2 A;  2CG3 A;  4KMO A;  3GYZ A;  4U0U A;  3JYS A;  2J4B A;  2AVP A;  3L54 A;  4I1M A;  4C0E A;  3MJW A;  1WAO 1;  2V4L A;  3L16 A;  4B89 A;  3FTX A;  3FTW A;  4CRW A;  4GZD A;  3OXF A;  1WY6 A;  1IQR A;  2PQN A;  3P2B A;  3U3W A;  3JUI A;  3L17 A;  4KZC A;  3SZ7 A;  5ANR A;  3ZN3 A;  4BWR A;  3D9K A;  4EZK A;  3CHM A;  4YND A;  4HFG A;  4JZY A;  4M3O A;  3PS6 A;  5D0Q D;  4A1G A;  4L7T A;  4HVB A;  3R7R A;  3ONL A;  4CT4 A;  4G1T A;  2KCV A;  4ATG A;  2R59 A;  4BTB A;  1Y8M A;  5A7D B;  3ZHE B;  2UY1 B;  4Q69 A;  1UJJ A;  2AWI A;  3RO3 A;  3T8M A;  3CIA A;  1SZ9 A;  4EEC A;  4MLP A;  5E75 A;  3MV3 B;  4GML A;  4N5C A;  2LAH A;  3ML8 A;  3RRM B;  2KZT B;  5JHB A;  5CCM A;  2NXP A;  2OND A;  2AW6 A;  5KJN A;  4U0Z A;  3LS8 A;  3PNT B;  3IHV A;  3CVV A;  3G2T A;  3PEV B;  3PE3 A;  4FLH A;  4L2Y A;  4NAC A;  5A23 A;  3DBS A;  3CEQ A;  4Y6C A;  4DI3 A;  4XKB A;  4WAF A;  3JQ0 A;  4I9E A;  2Y4U A;  5ENN A;  2WQ6 A;  3MKQ A;  5FZS A;  3D9J A;  4PS7 A;  2WQ7 A;  2WPV A;  3CK7 A;  3ASF A;  2RD0 A;  4XI9 A;  4XX5 A;  4YVQ C;  5BPP A;  2V5F A;  4MS6 A;  3R9A B;  4HLE A;  1INZ A;  5A6C A;  4I17 A;  2C0L A;  4AOF A;  3CK8 A;  3QWP A;  3WXX A;  4WNF A;  4BT8 A;  3D9L A;  4I1A A;  3BEE A;  5T3R A;  5FZR A;  4DJA A;  5CMW A;  4G26 A;  4CGV A;  2IJG X;  3Q4A B;  2IOL A;  3D9M A;  5EKQ D;  3O4Z A;  1GW6 A;  4GA0 A;  2FBN A;  3FTS A;  3EDT B;  3NF1 A;  4JW1 A;  3B7S A;  3CHP A;  4H7X A;  4EPZ A;  4CT0 A;  4PDX A;  3D9I A;  5BW8 C;  2VSX E;  2VTB B;  4KZ0 A;  3CVP A;  4TRQ A;  3FU5 A;  5CCL A;  3EIJ A;  3B7U X;  3FUI A;  4BX8 A;  4HOT A;  1U3C A;  1IYG A;  4E85 A;  1VDY A;  2UWJ G;  4ME2 A;  5BV0 A;  3SI5 A;  1IHG A;  2WM9 A;  1HO8 A;  2L0I A;  3GZ1 A;  2GW1 A;  3LJ3 A;  3LY7 A;  4LER A;  4YVO A;  4JHK A;  3FUM A;  3CSF A;  4JXT A;  4BY6 A;  4J6I A;  3ZHE A;  2UY1 A;  4CGW A;  3ML9 A;  3DPD A;  4B0Z A;  4PS8 A;  1H2U A;  2KZT A;  5AIJ A;  4RVB A;  3QNK A;  2YHE A;  3APD A;  4UWL A;  3R7Q A;  4U63 A;  3I4G A;  3QKY A;  2ILR A;  2HO1 A;  4KXK B;  1OWL A;  5FQ4 A;  3IV0 A;  4N3B A;  3UT7 A;  4JL0 A;  5G55 A;  4O6F A;  1LF8 A;  2L0T B;  4KT6 B;  2J9Q A;  3SGH A;  3CKC A;  1E90 A;  4J8F A;  1PC2 A;  2QY7 A;  3FUE A;  2WXO A;  4AIF A;  4FHJ A;  4I2Z A;  5FQ7 A;  4AY6 A;  3FUN A;  4A1S A;  3FU6 A;  3ENE A;  3RRN B;  4HXI A;  2CFZ A;  4HOS A;  4JEH A;  3CVW A;  4UWH A;  1E7V A;  4LEU A;  2X6H A;  1IQU A;  3CQG B;  1FVF A;  4JA7 A;  2HR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...