1IYHA

Crystal structure of hematopoietic prostaglandin d synthase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
publication title Mechanism of metal activation of human hematopoietic prostaglandin D synthase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1iyhA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1iyhA01
6GSUA 2YV9A 3QD9A 3UL3A 4MDCA 3GKNA 3ZFLA 3Q19A 2H75A 3L9UA 3TRQA 5HQPA 12GSA 1AXDA 3D22A 1GP1A 4ULXA 2R4VA 5B7CA 4OFTA 1SK2A 3LSZA 1GSSA 5J41A 3KGKA 4NV2A 1TDIA 2B5EA 5IMAA 4YAPA 3KH7A 2YZHA 2QSIA 3D5JA 2XC2A 2LV3A 1ZCPA 3RPPA 2GSTA 4MZWA 4LMVA 2H1BA 2VUPA 2HRFA 2WRTA 4TVEA 3F63A 1GH2A 4IJ3A 1GRXA 4FQUA 1GNEA 4PUFC 2LNSA 4V1Ag 4MJEA 3E0UA 5AIVA 3G7YA 3M9JA 1TRWA 1GSUA 1EGOA 1PGTA 1G6YA 5IPHA 2YPMA 4ZIJA 1H75A 5F07A 3GA4A 4AJ6A 1VF1A 3LORA 2ZCTA 2LUSA 4GF0A 3F6FA 3JCML 1FAAA 2VL3A 1N8JA 4YAVA 5ID2B 1WE0A 2L59A 1O8WA 3N5OA 2UZ8A 5D93A 1V9WA 1OE8A 1SKSB 1TU8A 2YWMA 4IQ1A 3IR4A 4YQUA 4TKYA 3QFAC 4DSSB 1U88A 4O32A 1FB6A 2MMOA 4Q5QA 1RQMA 1BX9A 2LQQA 3Q18A 4HJ2A 2RM5A 3DYRA 4NWYA 3WT2A 2OADA 3ME8A 1T00A 3GNJA 1QFNA 2IFQB 5GSSA 2G0FA 2HSMB 1TXXA 2GZPA 4N0VA 1SL2B 5DAKB 4KGIA 5G2ZA 2VM1A 2AYTA 2CT6A 2FGXA 1X5DA 2XPDA 2YWNA 1K3YA 3ZFBA 4WBJA 2HZEB 1FVKA 3UIWA 3KXOA 4CW9A 2HRNA 22GSA 5ECOB 4WBRD 4D73B 1A0FA 2P5QA 1TU7A 4TR1A 2VCQA 1WWJA 2O89A 2C3QA 2F51A 5JCGA 5DQYA 1GUKA 2DMLA 4Q5NA 2WCIA 1WMJA 2IPAA 1ST9A 1U3AA 2HE3A 4HS1A 3PGTA 4KCAA 2CV4A 4TXOB 1SKRB 4XS4B 4CDOA 3DWVA 3BD2A 4MABA 2ALBA 3GKMA 3VPQA 4AJ7A 5H5QA 3RHCA 1X9WB 1MDIA 1EP7A 2IWTA 4QL7A 1VGLA 3LFLA 4LA1A 2XBQA 1PA3A 2TRXA 4FIWA 3GHAA 5JCUA 3TUEA 3AY8A 3MNGA 4KDUA 3ERGA 4BVYB 1TK0B 3J7Yk 4ZL9A 2V32A 4EKZA 4XS4A 3GL5A 2I9HA 2V2GA 3IOSA 1OC3A 3RAZA 1PQNA 1H4OA 5KN0A 2VD1A 3D4TA 1V98A 3TB2A 3GX8A 5CAXA 1RW1A 2LRNA 4EE0A 1I9DA 4ACSA 3KP8A 2GSQA 3BJ5A 10GSA 4IS0A 5IPGA 4ZBAA 5IMDA 4XHMA 2TRCP 3GURA 1OC8A 1TI1A 3KEBA 4WETA 5DJLA 3ME7A 2B7KA 2CZ2A 2QKEA 1ERUA 1N2AA 1GTUA 2J9HA 2O7KA 2MMNA 4ZILA 2WB9A 3PR8A 3GYKA 1C72A 1AQWA 5HR2A 1MDKA 3HYPA 1YZXA 1AIUA 1JZRA 3LGCA 3GUSA 3CSIA 4DEJA 2DLXA 3C7MA 3HVSA 4O92A 2GQMA 4RI7A 3IXRA 3ZVJD 1B9YC 1BJXA 4GSTA 8GSSA 1TRUA 2WS2A 1ILOA 2ZNMA 1X9MB 1PD21 3P2AA 2WFCA 3WGDA 4PXOA 2HT9A 4V2LA 5F8BA 2GZYA 3ZZXA 2P5RA 1DUGA 5J9CA 4JE1A 2IL3A 5J5NA 2M46A 2GDRA 2PVOC 1MD3A 4YQVA 4XIHA 2VLTA 5C00A 1EEJA 5JWRB 1GWCA 2CA8A 2HI7A 3APOA 2VLUA 5HR3A 2HNLA 2H1AA 2EIOA 4ZL7A 3HZ8A 1WJKA 3H79A 1T3BA 2C4JA 2B5XA 5E4WA 4KX4A 2OA7A 3E9JB 2GT5A 3TKPA 1U6TA 3F4TA 4FYUA 3QFBC 1M2AA 5CNWA 5HFKA 1ZYEA 3GRXA 4AGSA 1O6JA 4G0IA 4I97A 5BMUA 1GSFA 2H6XA 2PGTA 3TOUA 2JL4A 3IDVA 3GH6A 2KP1A 2AUVA 1BYEA 2PUKC 2YZUA 1BG5A 3UAPA 2L57A 3QAGA 2CQ9A 1R5PA 3HVXA 3DEXA 4YQMA 1UVZA 2FA8A 1EEMA 2PWJA 3BBYA 5EVOA 4WF4A 1XWGA 4K7NA 2H74A 2KUCA 2X8HA 1YEPA 4MK3A 5IQYA 1I5GA 3VWWA 1PKWA 2K9FA 3KJYA 2ES7A 3F4SA 4BVXA 1O7UA 4QQ7A 4ML1A 3FK8A 3UOMA 2VOCA 4K7IA 4MLYA 3L0HA 3GTUA 1YQ1A 2H76A 3APQA 5J3RA 1GUHA 4BL7A 6GSVA 3NIVA 3FEUA 2XPEA 2LNTA 1EV9A 2CX4A 3IBHA 5DQSA 2DIZA 1F9MA 3LYKA 1PRXA 1SJIA 2HQTA 4HEA2 5DVBA 2AV4A 3UEMA 1EZKA 1YY7A 3IRAA 2BTOT 2IJYA 18GSA 1S3CA 4O7HA 2R3XA 1EGRA 3LXTA 4K0GA 2HRKA 3PH9A 4G19A 1MTCA 3ZYWA 2YP6A 3EINA 1PX7A 4TR0A 2LTKA 5CRDA 4MF5A 1XZOA 5CREA 1SL1B 3A2XA 3FZ9A 3VI5A 3W6GA 2EIRA 2V6OA 4WF5A 3FR9A 3CSJA 2R5GA 4IELA 2KLXA 2MYGA 4GQCA 4MCUA 4FH8A 1TI3A 3QDNA 1THXA 3KH9A 4EVMA 1MDJA 1B4PA 4MH2A 2C80A 2GSSA 2OACA 2I1UA 2OJLA 2L6DA 3CTGA 1LBKA 2NTOA 1G0TA 3QCPA 1F3AA 3APSA 4POKA 2HXKA 2H73A 2VCVA 4F2IA 5IO2A 2P31A 3FKFA 4GXZA 1GTIA 6GSWA 3TJGA 4PNFA 2B6MA 4G2EA 1QQ2A 2GT6A 1XXUA 1KNGA 1LJRA 3WD6A 2H66A 2PMTA 3CRUA 3GV1A 3EURA 1TK5B 4HI7A 1T1VA 5FWGA 3V1WA 4PQHA 1XVWA 2YANA 1FHEA 2K8VA 5A4VA 4EC0A 5D9VA 3TJJA 13GSA 1SD9A 5B8AA 1THOA 4GSSA 3DVXA 3GSTA 3ZL5A 2CX3A 3O6TA 4V2NA 2I81A 1UN2A 1ACVA 4KW6A 2IN3A 3W8JA 5HFGA 2H0HA 3TRPA 4ZXGA 3M1GA 5G5FA 1Z7PA 3U5RE 3MDKA 1M99A 2OBKA 2L4QA 5B6NA 1OVNA 3FY7A 1UA5A 2B3SA 1BQ7A 3ZRDA 1XIYA 2M80A 2E0QA 5B6MA 4HOJA 4E8HA 17GSA 2HZFA 3L4NA 5ECPB 1B48A 2K8SA 2VCTA 2I4AA 2JSZA 1SYXA 2H1GA 2A2SA 2A2RA 9GSSA 1JZOA 1TRSA 4ECCA 2IMFA 4KA0A 5EY6A 4PNGA 1WPIA 4IVFA 3I9V2 5HFIA 5IMFA 3KTBA 2MBTA 2GLRA 3KIJA 6GSSA 5D9WA 1GULA 6GSXA 1BEDA 3GSSA 1JLVA 1Z6MA 3EVIA 1EOHA 2H72A 1ZZYA 4ZB6A 1A23A 1SK0A 2GVPA 4F03A 4TR1B 1CQHA 1SK1A 4KNDA 1URMA 3WT1A 4NXIA 3IC8A 1O81A 4IGJA 1GSDA 2LS5A 5GAND 4KSOA 2JZRA 4WR5A 2REMA 5IO0A 2IMKA 1M0UA 4G9HA 4TR3A 2VAFA 3EMPA 4K7OA 3VWXA 1USBA 2MMAA 3A5WA 1A24A 2H1DA 3H8QA 1XWBA 2NBSA 3WGXA 5CRGA 1ZL9A 3M9KA 4I2UA 2KOKA 2E2MA 3HA9A 2FY6A 2WJUA 3IAM2 4ZB9A 1S3DA 3M3MA 5IM9A 2F8FA 2DJKA 5KN3A 2YWOA 3QPMA 3TKRA 1JFUA 2LRTA 1AQVA 2E2GA 19GSA 2L5OA 2DJ2A 1PKZA 4TW5A 3F4RA 3FRCA 1M2BA 4POMA 2LJRA 3VLNA 3QAWA 2R37A 2PPTA 3IPZA 1GSEA 3FZ4A 3UVTA 3LEFA 1K0AA 5LNKe 1JZDA 2CVBA 1PN9A 4G0KA 4ECJA 1G7OA 2VD0A 1B8XA 4XS1A 4ZL8A 3EC3A 2IMEA 3TRXA 4I6XA 3P7XA 1VRSD 4WR4A 3VWVA 1EV4A 1AQXA 3GIXA 3MSZA 3DD3A 5H5SA 3TDGA 1ZGNA 2F8AA 3HCZA 4EUYA 3BOAA 4MA9A 4LLRA 2GS3A 2O85A 3CYNA 4KCEA 2CVDA 2HSYA 1AW9A 2F3MA 1TKDB 1PSQA 4H86A 2LEGA 2C3TA 2B7JA 4I8BA 1UC7A 2LJKA 2DMMA 1FVJA 3KZQA 1XCCA 4TR4A 4L5OA 3LJRA 4TN8A 3FYGA 3UJ1A 3ZREA 1XPVA 3IE3A 2MBSA 3IK9A 1ERWA 2DIYA 1V2AA 1Z3EA 2OE3A 2YN1A 1K3LA 2FWEA 1X9SB 4WEYA 4OFMA 1A8YA 1ML6A 2HSHA 3M0FA 2N5BA 2VIMA 1HNBA 2B5YA 1ERVA 3LXZA 1OKTA 1ERTA 1HYUA 1OYJA 1WOUA 5ENUA 4HQZA 2OE1A 3M8NA 3ZMLA 1M9BA 3SWLA 3FZ5A 4WXTA 1TP9A 1PL2A 3WGEA 1GL8A 4K0NA 1KEBA 2NDOA 4NHWA 1T4ZA 1A2MA 2BJXA 5ECSA 1U87A 4KE3A 1EP8A 2WZ9A 5D9XA 3PPUA 2YJ7A 4PX1A 1RK4A 4HDEA 3I6AA 3O3TA 1DE1A 4IP6A 4HJMA 2VCWA 5AGYA 20GSA 4G10A 1ABAA 4Q5RA 4QL9A 3LYPA 2RM6A 2ZUPA 4K8MA 1OKDA 2X8CA 5IIZA 1XWAA 3KM6A 1AAZA 4JEDA 3DRNA 4TRXA 2FCHA 5G31A 5JWQB 3VWUA 4BVXB 2GGTA 3F3QA 4XRDA 5IMVA 5IOXA 1O85A 1OC9A 3HJOA 4GQFA 2EC4A 2H30A 1GLPA 4KAEA 4MH3A 3GTUB 1Y25A 3KD0A 1W89A 2MMZA 4BL7B 1Z7RA 5CRHA 3ZTLA 2YCDA 4TXVA 2PBJA 4RQXA 1TOFA 5ECKB 4GRFA 1XFLA 4EF0A 3TJKA 5COHA 2C1YA 2WGRA 5J9BA 2YJHA 5DALA 5AIXA 4JU5A 3F3RA 2XHFA 2IMDA 5CYYA 3EE2A 1K0OA 2HRKB 4PURA 2FA4A 4J2FA 5ECMB 4MJAA 1M7TA 2C3NA 2C8UA 4IQAA 2FWGA 1EOGA 3TOTA 1F3BA 3HKRA 2LJAA 3US3A 4F0BA 1S3AA 3VK9A 2JADA 4POBA 4X0XA 4EDYA 2F9SA 1J08A 4DSQA 2H6ZA 1NW2A 16GSA 2DC5A 2NPBA 4MPFA 3H1NA 3O76A 2H19A 1QGVA 1K0CA 5LCZA 1A2LA 3HD5A 4LMWA 3G7IA 1PX6A 4BWSA 1GLQA 1JLWA 5H5RA 3C1RA 2QC7A 4OO5A 2FHEA 3GKKA 1NHYA 2H0IA 2X99A 3FHKA 3L78A 4KDXA 1J0FA 1LU4A 4XCSA 3KTLA 1A0RP 1T7PB 4EXJA 3RPNA 3EWLA 3ZMKA 1Z6NA 3J7Yb 1R5AA 1NHOA 2DJ3A 5D9TA 4Q5FA 2C0FA 4JRRA 1SJ6A 2V41A 1DE2A 2JSYA 3VURA 4RI6A 4FYBA 2JZTA 2FNOA 2O87A 4DVCA 1XBSA 2O8VB 1SU9A 1XOBA 5INYA 3LQ7A 2GQKA 4J56E 3K8NA 3HDCA 3GL3A 1GUMA 5E59A 2H6YA 3L9VA 2RUFA 5L71A 3N9JA 3DIEA 4IKHA 2DJ0A 3CMIA 4KUNA 5CRWA 4RUVA 5HR1A 1VF2A 3CRTA 4USSA 1B9XC 2NVLA 1W4VA 4IJIA 4ECBA 5ECLB 2L4CA 3A2VA 1TW9A 1K0NA 1VF3A 4F82A 1ZYQB 1SD8A 4LL4B 4KDYA 4X43A 1O73A 2IIYA 2VO4A 1K3OA 3D6IA 3W8SA 4EO3A 3CXGA 2ON5A 4NV5A 1CQGA 2GZZA 2N5FA 3S9FA 5A4UA 1SENA 3A3TA 5ECIB 2PN8A 3D4MA 2D2ZA 1R4WA 2LRCA 1YJ6A 1WRYA 1T4YA 2VL2A 3C73A 4PTSA 4I5QA 5FT3A 3IA1A 2H70A 2RIIA 3U6VA 3HHVA 3G9BA 4KH7A 5ECHB 5ECRB 3TKSA 1PL1A 3UBLA 1E6BA 4LL1B 3TJBA 5KN2A 2BMXA 1DBYA 2B1LA 5CO3A 1O8XA 1M9AA 1Z9HA 2H0GA 3OR5A 3HY2A 2HRAA 3QMXA 1SKWB 4JBBA 4E8EA 4AJ8A 3DMLA 1KBNA 4KF9A 1QXHA 4K6XA 1A2JA 4NPBA 1B4QA 4JR6A 4MJBA 2K18A 3EU3A 4P3YB 3DGQA 1HNCA 3HJMA 1V57A 2B1KA 3MAKA 2GQLA 1G7EA 4HU9A 4XS6A 5ID2A 3RBTA 1PMTA 2X64A 4PUAA 1A8LA 4ZBBA 3R2QA 2HFDA 1YDKA 1WP0A 3C71A 3HXSA 3R3EA 4HUAA 5CP1A 2IMIA 1GTAA 4DSSA 3Q74A 1WIKA 4CHSA 3PINA 3IAS2 5G1LA 5JCWA 1GSQA 2GSRA 3CSHA 4MZBA 4EL1A 3IHQA 1ON4A 2A4VA 2IFQA 3FZAA 3GKXA 2PU9C 5ELGA 2HSMA 5DAKA 4HU7A 4MMMA 4NAXA 2E7PA 2AAWA 5IMCA 4POLA 4I2TA 1GSYA 1Q4JA 4RQRA 4Z7XA 4IN0A 1QK8A 2HZEA 2K6VA 1XW5A 1ZOFA 4YH2A 2PVQA 4OCEA 5G30A 5G5EA 1DSBA 4D73A 1FW1A 1T8EB 1TJDA 1E2YA 2DJ1A 3SBCA 3ERFA 2HYXA 3ISOA 3IK7A 4KSMA 4PQIA 7GSSA 1Z5YE 3KMNA 5AISA 5A4WA 4FO5A 2Z9SA 2YNXA 2RUEA 2G2QA 4L8EA 5DBQA 4TXOA 3ED3A 5DJMA 1YKCA 4KB3A 1AUCA 4ECIA 2LKUA 4V2MA 2J23A 4OD7A 3LG6A 1J9BA 4FYCA 3GX0A 1NSWA 3WYWA 5F05A 5DCHA 4OO4A 4OWYA 2VL9A 1XWKA 4BVYA 4MF6A 2R6KA 2V1MA 2YV7A 4K9ZA 1U3IA 3CBUA 3TKQA 1BAYA 3E3EA 4MF7A 4N11A 5D73A 4IBPA 4ID0A 2HLSA 4DSRA 4OMVA 5G1KA 4GWRA 3P90A 2OE0A 1JHBA 2H71A 3H4KA 1XVQA 3ZLPA 1XW9A 3ERWA 2DJJA 3EU4A 1EWXA 2XBIA 3TCOA 1M2DA 5EL8A 1HQOA 1FOVA 3F6DA 1Q98A 2OBIA 3F8UA 5DCGA 1KTEA 3DXBA 2H8LA 2N5AA 4ZB8A 2VL2C 3I69A 11GSA 1OC9B 4NHZA 3UBKA 3UVHA 5KEJA 3IV4A 2DSAA 4ILFA 4NMUA 1GNWA 5C04A 3MWHA 4O5RA 1MEKA 1QUWA 5GZZB 2MZCA 2TIRA 4PQ1A 3TKSC 2C0DA 4GSNA 5J4UA 1SJZA 3GFKA 3QR6A 14GSA 3FW2A 1K0MA 4GLTA 3GMFA 2PERA 1K0DA 3EYTA 2AJQB 2JACA 1Y6EA 4JZQA 2QGVA 4MPGA 3UMAA 2VM2A 3QAVA 3VFIA 4JR4A 6GSTA 5ABRA 4AF2A 3F0IA 5A5KA 2YWIA 3UARA 3NOFA 2I3YA 5DALB 4IP1A 2EIQA 1K0BA 5F06A 5D8IA 3C1SA 2CAQA 3IC4A 5EPFA 1SYRA 4N30A 4L0UA 4F9ZA 2KP2A 4BPYA 1TK8B 1YF0A 2YOIA 2VLVA 2GTUA 3D0ZA 4F0CA 3NZNA 5IMZA 3P8WA 4WKWA 4OFNA 2L5LA 1HD2A 1FO5A 2HSNB 3EMXA 2FWFA 5GSTA 2FD3A 4GCIA 5IOWA 5AN1A 3ZITA 2JU5A 1QMVA 3KP9A 1XW6A 3ZVJA 2FLSA 2ON7A 2VCXA 5D96A 2LSTA 4XRAA 3BCKA 3FR6A 2AHEA 1XOAA 4ZBDA 1FG4A 3CTFA 1V40A 5F0GA 2JZSA 2LQOA 4N10A 4ML6A 1OE7A 2WDUA 4K1FA 1MD4A 5KN1A 2R2JA 6GSYA 1GTBA 3HZ4A 4HZ2A 1G6WA 3VI7A 4OCFA 2OKAA 1TTZA 4IHUA 1F2EA 1IYHA 3QOUA 1IYIA 2P0GA 4L5LA 3I43A 4HQSA 1X0RA 2DBCA 3HVVA 5HR0A 2VCZA 5DDLA 3RHBA 3A2WA 2X8GA 2C0EA 1SL0B 5ELAA 1NM3A 4L0WA 1R7HA 3ZIJA 4BWQA 2CAIA 4PGTA 4V1Ap 4BA7A 2AB6A 3GH9A 4IW9A 1X5CA 1R26A 2L6CA 5ECQB 5FHIA 1YKAA 3KMOA 3D21A 1JZWA 2CZ3A 2V6KA 2WULA 2FWHA 4N0ZA 5JWOB 3KCMA 4MZCA 3L9SA 3TJFA 4G0LA 1TRVA 4EDZA 5B8BA 3Q6OA 3G7JA 2C0GA 3TKSE 3F9UA 1OAZA 1X5EA 3LWAA 4J57E 3TGZA 3H93A 4HZ4A 1FB0A 4TOPA 3RDWA 2FUG2 1ZMAA 3ZIVA 2CVKA 3C8EA 1YEXA 1HNAA 1XWCA 5LD0A 2M72A 4MP4A 4MJCA 1AC1A 2KHPA 2RLIA 1YF1A 3DVWA 4ISDA 1F6MC 1F37A 3DKSA 5ECNB 1V58A 4GTUA 4K2DA 3FR3A 4X1UA 2H01A 1VF4A 5GAPD 4XTSA 3GN3A 3HJPA 3VPTA 3BCIA
chains in the Genus database with same CATH superfamily
6GSUA 2YV9A 3QD9A 3UL3A 4MDCA 3GKNA 3ZFLA 3Q19A 2DKHA 2H75A 3L9UA 3TRQA 5HQPA 12GSA 1AXDA 3IHGA 3D22A 1GP1A 4K5SA 4ULXA 2R4VA 5B7CA 4OFTA 1SK2A 3LSZA 1GSSA 5J41A 3KGKA 4NV2A 1TDIA 2B5EA 5IMAA 4YAPA 3KH7A 2YZHA 2QSIA 3D5JA 2XC2A 2LV3A 1ZCPA 3RPPA 4AKIA 2GSTA 4MZWA 4EIQA 4LMVA 2H1BA 2VUPA 2HRFA 2WRTA 4TVEA 3F63A 4W66A 1GH2A 4IJ3A 1GRXA 4FQUA 1GNEA 4PUFC 2LNSA 4V1Ag 4MJEA 3E0UA 5AIVA 3G7YA 3M9JA 1TRWA 1GSUA 1EGOA 1PGTA 4EIPA 1G6YA 5IPHA 2YPMA 4ZIJA 1H75A 5F07A 3GA4A 4AJ6A 1VF1A 3LORA 2ZCTA 2LUSA 4GF0A 3F6FA 3JCML 1FAAA 2VL3A 1N8JA 1ZYPA 4YAVA 5ID2B 1WE0A 2L59A 1O8WA 3N5OA 2UZ8A 5D93A 1V9WA 1OE8A 1SKSB 1TU8A 1N25A 2YWMA 4IQ1A 3IR4A 4YQUA 4TKYA 3QFAC 4DSSB 1U88A 4O32A 1FB6A 2MMOA 4Q5QA 1RQMA 1BX9A 2LQQA 3Q18A 4HJ2A 2RM5A 3DYRA 4NWYA 3WT2A 4Z2TA 2OADA 3ME8A 1T00A 3GNJA 1QFNA 2IFQB 5GSSA 2G0FA 2HSMB 4QMKA 1TXXA 2GZPA 4N0VA 1SL2B 5DAKB 4KGIA 5G2ZA 2VM1A 2AYTA 2CT6A 2FGXA 1YVLA 1X5DA 2XPDA 2YWNA 1K3YA 3ZFBA 4WBJA 2HZEB 1FVKA 3UIWA 3KXOA 4CW9A 2HRNA 22GSA 5ECOB 4WBRD 4D73B 4G01A 1A0FA 2P5QA 1TU7A 4TR1A 2VCQA 1WWJA 2O89A 2C3QA 2F51A 3CHXC 5JCGA 5DQYA 1GUKA 2DMLA 4Q5NA 2H1LA 2WCIA 1WMJA 2IPAA 1ST9A 1U3AA 2HE3A 4HS1A 3PGTA 4KCAA 2CV4A 4TXOB 4AI6A 1SKRB 4XS4B 4CDOA 3DWVA 3BD2A 4O5QA 4MABA 2ALBA 2WW3A 3GKMA 3VPQA 4AJ7A 5H5QA 3RHCA 1X9WB 1MDIA 1EP7A 2IWTA 4QL7A 1VGLA 3LFLA 4LA1A 2XBQA 1PA3A 2TRXA 4FIWA 3GHAA 5JCUA 3TUEA 3AY8A 3MNGA 4KDUA 3ERGA 4BVYB 1TK0B 3J7Yk 4ZL9A 2V32A 4EKZA 4XS4A 3GL5A 2I9HA 2V2GA 3IOSA 1OC3A 3RAZA 1PQNA 4PI0C 1H4OA 5KN0A 2VD1A 3D4TA 1V98A 3TB2A 2A2PA 3GX8A 5CAXA 1RW1A 2LRNA 4EE0A 1I9DA 4ACSA 3KP8A 2GSQA 3BJ5A 10GSA 4IS0A 5IPGA 4ZBAA 5IMDA 4XHMA 5J40A 2TRCP 3GURA 1OC8A 1TI1A 3KEBA 4WETA 5DJLA 3ME7A 5J47A 2B7KA 2CZ2A 2QKEA 1ERUA 1N2AA 1GTUA 2J9HA 2O7KA 2MMNA 4ZILA 2WB9A 3PR8A 3GYKA 1C72A 1AQWA 5HR2A 1MDKA 3HYPA 1YZXA 1AIUA 1JZRA 3LGCA 3GUSA 3CSIA 4DEJA 2DLXA 3C7MA 3HVSA 4O92A 2GQMA 4RI7A 3IXRA 3ZVJD 1B9YC 1BJXA 4GSTA 8GSSA 1TRUA 2WS2A 1ILOA 2ZNMA 1X9MB 1PD21 3P2AA 1XG8A 1TXUA 2WFCA 3WGDA 4PI2C 4PXOA 2HT9A 4V2LA 5F8BA 2GZYA 3ZZXA 2P5RA 1DUGA 5J9CA 4JE1A 2IL3A 5J5NA 4AKHA 2M46A 2GDRA 2PVOC 1MD3A 4YQVA 4XIHA 2VLTA 5C00A 1EEJA 5JWRB 1GWCA 5KOXA 2CA8A 2HI7A 3APOA 2VLUA 5HR3A 2HNLA 5A34A 2H1AA 2EIOA 4O5UA 4ZL7A 3HZ8A 1WJKA 3H79A 1T3BA 2C4JA 2B5XA 1SVLA 5E4WA 4KX4A 4CY8A 2OA7A 3E9JB 2GT5A 3TKPA 3TU3B 1U6TA 3F4TA 4FYUA 2X4AA 3QFBC 1M2AA 5CNWA 5HFKA 1ZYEA 3GRXA 4AGSA 1O6JA 4G0IA 4I97A 5BMUA 1GSFA 2H6XA 2PGTA 3TOUA 2JL4A 3IDVA 2VKZG 3GH6A 2KP1A 2AUVA 1BYEA 2PUKC 2YZUA 1BG5A 3UAPA 2L57A 3QAGA 2CQ9A 1R5PA 3HVXA 3DEXA 4YQMA 1UVZA 2FA8A 1EEMA 2WW2A 2PWJA 3BBYA 5EVOA 4WF4A 1XWGA 2QA1A 4K7NA 2H74A 2KUCA 2X8HA 1YEPA 4MK3A 5IQYA 1I5GA 3VWWA 1PKWA 2K9FA 3KJYA 2ES7A 3F4SA 4BVXA 1O7UA 4QQ7A 4ML1A 3FK8A 3UOMA 2VOCA 4K7IA 4MLYA 3L0HA 3GTUA 1YQ1A 2H76A 3APQA 5J3RA 1GUHA 4BL7A 6GSVA 3NIVA 3FEUA 2XPEA 2LNTA 1EV9A 2CX4A 3IBHA 5DQSA 2DIZA 1F9MA 3LYKA 1PRXA 1SJIA 2HQTA 4HEA2 4PHZC 5DVBA 2AV4A 3UEMA 3MYDA 1EZKA 1YY7A 3IRAA 2BTOT 2IJYA 18GSA 1S3CA 4O7HA 2R3XA 1EGRA 3LXTA 2O36A 4K0GA 2HRKA 3PH9A 4G19A 4ZB7A 1MTCA 3ZYWA 2YP6A 3EINA 1PX7A 4TR0A 2LTKA 5CRDA 4MF5A 1XZOA 5CREA 1SL1B 3A2XA 3FZ9A 3VI5A 3W6GA 2EIRA 2V6OA 4WF5A 3FR9A 3CSJA 2R5GA 4IELA 2KLXA 2MYGA 4GQCA 4MCUA 4FH8A 1TI3A 3QDNA 1THXA 3KH9A 4EVMA 1MDJA 1B4PA 4MH2A 2C80A 2GSSA 2OACA 2I1UA 2OJLA 5J4YA 3RGBC 2L6DA 3CTGA 1LBKA 2NTOA 1G0TA 3QCPA 1F3AA 1S3RA 3APSA 4POKA 2HXKA 2H73A 2VCVA 4F2IA 5IO2A 2P31A 3FKFA 4GXZA 1GTIA 6GSWA 3TJGA 4PNFA 2B6MA 4G2EA 1QQ2A 2GT6A 1XXUA 1KNGA 1LJRA 3WD6A 2H66A 2PMTA 1PFOA 3CRUA 3GV1A 3EURA 1TK5B 4HI7A 1T1VA 5FWGA 3V1WA 4PQHA 1XVWA 2WVXA 2YANA 1FHEA 2K8VA 5A4VA 4EC0A 5D9VA 3TJJA 13GSA 1SD9A 5B8AA 1THOA 4GSSA 3DVXA 3GSTA 3ZL5A 1PN0A 2CX3A 3O6TA 5KOWA 4V2NA 2I81A 1UN2A 1ACVA 4KW6A 2IN3A 3W8JA 5HFGA 2H0HA 3TRPA 4ZXGA 3M1GA 5G5FA 1Z7PA 3U5RE 3MDKA 1M99A 2OBKA 2L4QA 5B6NA 1OVNA 3FY7A 1UA5A 2B3SA 1BQ7A 2WVYA 2UV8G 3ZRDA 1XIYA 2M80A 2E0QA 5B6MA 4HOJA 4E8HA 17GSA 2HZFA 3L4NA 5ECPB 1B48A 2K8SA 2VCTA 2I4AA 2JSZA 2WZSA 1SYXA 2H1GA 2A2SA 2A2RA 9GSSA 2R0PA 1JZOA 1TRSA 4ECCA 2IMFA 4KA0A 5EY6A 4PNGA 1WPIA 4IVFA 3I9V2 5HFIA 5IMFA 4Z2UA 3KTBA 2MBTA 2GLRA 3KIJA 6GSSA 5D9WA 1GULA 6GSXA 1BEDA 3GSSA 1JLVA 1Z6MA 3EVIA 1EOHA 3RFRC 2H72A 1ZZYA 4ZB6A 1A23A 1SK0A 2GVPA 4F03A 4TR1B 1CQHA 1FOHA 1SK1A 4KNDA 1URMA 3WT1A 4NXIA 3IC8A 1O81A 4IGJA 1GSDA 2LS5A 5GAND 4KSOA 2JZRA 4WR5A 2REMA 5IO0A 1I1IP 2IMKA 1M0UA 4G9HA 4TR3A 2VAFA 3EMPA 4K7OA 3VWXA 1USBA 2MMAA 3A5WA 1A24A 2H1DA 3H8QA 1XWBA 2NBSA 3WGXA 5CRGA 1ZL9A 3M9KA 4I2UA 2KOKA 2E2MA 3HA9A 2FY6A 2WJUA 3IAM2 2X49A 4ZB9A 1S3DA 3M3MA 5IM9A 2F8FA 2DJKA 5KN3A 2YWOA 3QPMA 3TKRA 1JFUA 2LRTA 1AQVA 2E2GA 19GSA 2L5OA 2DJ2A 1PKZA 4TW5A 3F4RA 3FRCA 1M2BA 4POMA 2LJRA 1YEWC 3VLNA 3QAWA 2R37A 2PPTA 3IPZA 1GSEA 3FZ4A 3UVTA 3LEFA 1K0AA 5LNKe 1JZDA 2CVBA 1PN9A 4G0KA 4ECJA 1G7OA 2VD0A 1B8XA 4XS1A 4ZL8A 3EC3A 2IMEA 3TRXA 4I6XA 3P7XA 1VRSD 4WR4A 3VWVA 1EV4A 1AQXA 3GIXA 3MSZA 2R0GA 3DD3A 5H5SA 3TDGA 1ZGNA 2F8AA 3HCZA 4EUYA 3BOAA 4MA9A 4LLRA 2GS3A 2O85A 3CYNA 4KCEA 2CVDA 2HSYA 1AW9A 2F3MA 5A1NA 1TKDB 1PSQA 4H86A 2LEGA 1M3IA 2C3TA 2B7JA 4I8BA 1UC7A 2LJKA 2DMMA 1FVJA 3KZQA 1XCCA 4TR4A 4L5OA 3LJRA 4TN8A 3FYGA 3UJ1A 3ZREA 1XPVA 3IE3A 2MBSA 5A34B 3IK9A 1ERWA 2DIYA 1V2AA 1Z3EA 2OE3A 2YN1A 1K3LA 2FWEA 1X9SB 4WEYA 4OFMA 1A8YA 1ML6A 2HSHA 3M0FA 2N5BA 1Y1UA 2VIMA 1HNBA 5A5HA 2B5YA 1ERVA 3LXZA 1OKTA 1ERTA 1HYUA 5BMUB 1OYJA 1WOUA 5ENUA 4HQZA 2OE1A 2WW0A 3M8NA 3ZMLA 1M9BA 3SWLA 3FZ5A 4WXTA 1TP9A 1PL2A 3WGEA 1GL8A 4K0NA 1KEBA 2NDOA 4NHWA 1T4ZA 1A2MA 2BJXA 5ECSA 1U87A 4KE3A 1EP8A 2WZ9A 5D9XA 3PPUA 2YJ7A 4PX1A 1RK4A 5BRTA 4HDEA 3I6AA 3O3TA 1DE1A 4IP6A 4HJMA 2VCWA 5AGYA 20GSA 4G10A 1ABAA 4Q5RA 4QL9A 3LYPA 2RM6A 2ZUPA 4K8MA 1OKDA 2X8CA 5IIZA 1XWAA 3KM6A 1AAZA 4JEDA 3DRNA 4TRXA 2FCHA 5G31A 5JWQB 3VWUA 4BVXB 2GGTA 3F3QA 4XRDA 5IMVA 5IOXA 1O85A 1OC9A 3HJOA 4GQFA 2EC4A 2H30A 1GLPA 4KAEA 4MH3A 3GTUB 1Y25A 3KD0A 1W89A 2MMZA 4BL7B 1Z7RA 5CRHA 3ZTLA 2YCDA 4TXVA 2PBJA 3CWGA 4RQXA 1TOFA 5ECKB 4GRFA 1XFLA 4EF0A 3TJKA 5COHA 2C1YA 2WGRA 5J9BA 2YJHA 5DALA 5AIXA 4JU5A 3F3RA 2XHFA 2IMDA 5CYYA 3EE2A 1K0OA 2HRKB 4PURA 2WW1A 2FA4A 4J2FA 5ECMB 4MJAA 1M7TA 2C3NA 2C8UA 4IQAA 2FWGA 1EOGA 3TOTA 1F3BA 3HKRA 2LJAA 3US3A 4F0BA 1S3AA 2HSNA 3VK9A 2JADA 4POBA 4X0XA 4EDYA 2F9SA 1J08A 4DSQA 2H6ZA 1NW2A 16GSA 2DC5A 2NPBA 4MPFA 3LW9A 3H1NA 3O76A 2H19A 1QGVA 1M3JA 1K0CA 5LCZA 1A2LA 3HD5A 4LMWA 3G7IA 2R0CA 1PX6A 4BWSA 1GLQA 1JLWA 5H5RA 3C1RA 2QC7A 4OO5A 2FHEA 3GKKA 4AKGA 1NHYA 2H0IA 2X99A 3FHKA 3L78A 4KDXA 1J0FA 1LU4A 4XCSA 3KTLA 1A0RP 1T7PB 4EXJA 3RPNA 3EWLA 3ZMKA 1Z6NA 3J7Yb 1R5AA 1NHOA 2WVXB 2DJ3A 5D9TA 4Q5FA 2C0FA 4JRRA 4BIKA 1SJ6A 4X4JA 2V41A 1DE2A 2JSYA 3VURA 4RI6A 4FYBA 2JZTA 2FNOA 4CY6A 2O87A 4DVCA 1XBSA 4K5RA 2O8VB 1SU9A 1XOBA 5INYA 3LQ7A 2GQKA 4J56E 3K8NA 3HDCA 3GL3A 4GDFA 1GUMA 3A5IA 5E59A 2H6YA 3L9VA 3FMWA 2RUFA 5L71A 3N9JA 3DIEA 4IKHA 2DJ0A 3CMIA 4KUNA 5CRWA 4RUVA 5HR1A 1VF2A 3CRTA 4USSA 1BG1A 1B9XC 2NVLA 1W4VA 4IJIA 4ECBA 5ECLB 2L4CA 3A2VA 1TW9A 1K0NA 1VF3A 4F82A 1ZYQB 1SD8A 4LL4B 4KDYA 4X43A 1S4BP 1O73A 2IIYA 2VO4A 1K3OA 3D6IA 3W8SA 4EO3A 3CXGA 2ON5A 4NV5A 1CQGA 2GZZA 2N5FA 3MIXA 3S9FA 5A4UA 1SENA 3A3TA 5ECIB 2PN8A 3D4MA 2D2ZA 1R4WA 1BF5A 2LRCA 3HMJG 1YJ6A 1WRYA 1T4YA 2VL2A 3C73A 4PTSA 4I5QA 5FT3A 3IA1A 2H70A 2RIIA 3U6VA 3HHVA 3G9BA 4KH7A 5ECHB 5ECRB 3TKSA 1PL1A 3UBLA 1E6BA 4LL1B 3TJBA 5KN2A 2BMXA 1DBYA 2B1LA 5CO3A 1O8XA 1M9AA 4ICYA 1Z9HA 2H0GA 3HY2A 3OR5A 2HRAA 3QMXA 4FXYP 1SKWB 4JBBA 4YKFA 4E8EA 4AJ8A 3DMLA 1KBNA 4KF9A 1QXHA 4K6XA 1A2JA 4NPBA 1B4QA 4MNNA 4JR6A 4MJBA 2K18A 3EU3A 4P3YB 3DGQA 1HNCA 3HJMA 3EPTA 1V57A 2B1KA 3MAKA 2GQLA 1G7EA 3HVNA 4HU9A 4XS6A 5ID2A 3RBTA 1PMTA 2X64A 4PUAA 1A8LA 4ZBBA 3R2QA 2HFDA 1YDKA 1WP0A 3C71A 3HXSA 3R3EA 4HUAA 5CP1A 2IMIA 1GTAA 4DSSA 3Q74A 1WIKA 4CHSA 3PINA 3IAS2 5G1LA 5JCWA 1GSQA 2GSRA 3CSHA 4MZBA 4EL1A 2EFEA 3IHQA 1ON4A 2A4VA 2IFQA 3FZAA 3GKXA 2PU9C 5ELGA 1SVMA 2HSMA 5DAKA 4Z2RA 4HU7A 2EFHA 4MMMA 4NAXA 2E7PA 2AAWA 5IMCA 4POLA 4I2TA 1GSYA 1Q4JA 4RQRA 4Z7XA 4IN0A 1QK8A 2HZEA 2K6VA 1XW5A 1ZOFA 4YH2A 2PVQA 4OCEA 5G30A 5G5EA 1DSBA 2DKIA 4D73A 1FW1A 1T8EB 1TJDA 1E2YA 5A1NB 2DJ1A 3SBCA 3ERFA 2HYXA 3ISOA 3IK7A 4KSMA 4PQIA 7GSSA 1Z5YE 2A4HA 3KMNA 5AISA 5A4WA 4FO5A 2Z9SA 2YNXA 2RUEA 2G2QA 4L8EA 5DBQA 4TXOA 3ED3A 5DJMA 1YKCA 4KB3A 1AUCA 4ECIA 2LKUA 4V2MA 2J23A 4OD7A 3LG6A 1J9BA 4FYCA 3GX0A 1NSWA 3WYWA 5F05A 5DCHA 4OO4A 4OWYA 2VL9A 1XWKA 4BVYA 4MF6A 2R6KA 5A5HB 2V1MA 2YV7A 4K9ZA 1U3IA 3CBUA 3TKQA 4E68A 1BAYA 3E3EA 4MF7A 4N11A 5D73A 4IBPA 4ID0A 5J4VA 2HLSA 2O3EA 4DSRA 4N3ZA 4OMVA 5G1KA 4GWRA 3P90A 2OE0A 1JHBA 2H71A 4AKXB 3H4KA 2WVZA 1XVQA 3ZLPA 1XW9A 3ERWA 2DJJA 3EU4A 1EWXA 2XBIA 3TCOA 1M2DA 5EL8A 1HQOA 1FOVA 3F6DA 1Q98A 2OBIA 3F8UA 5DCGA 1KTEA 3DXBA 2H8LA 2N5AA 4ZB8A 2VL2C 3I69A 11GSA 1OC9B 4NHZA 3UBKA 3UVHA 5KEJA 3IV4A 2DSAA 4ILFA 4NMUA 1GNWA 5C04A 3MWHA 4O5RA 1MEKA 1QUWA 5GZZB 2MZCA 2TIRA 4PQ1A 3TKSC 2C0DA 4GSNA 5J4UA 1SJZA 3GFKA 3QR6A 14GSA 3FW2A 2QA2A 1K0MA 4GLTA 3GMFA 2PERA 1K0DA 3EYTA 2AJQB 2JACA 1Y6EA 4JZQA 2QGVA 4MPGA 3UMAA 2VM2A 3QAVA 3VFIA 4JR4A 1SVOA 6GSTA 5ABRA 4HSCX 4AF2A 3F0IA 5A5KA 2YWIA 3UARA 3NOFA 2I3YA 5DALB 4IP1A 2EIQA 1K0BA 5F06A 5D8IA 3C1SA 2CAQA 3IC4A 5EPFA 1SYRA 4N30A 4L0UA 4F9ZA 2KP2A 4BPYA 1TK8B 1YF0A 2YOIA 2VLVA 2GTUA 3D0ZA 4F0CA 3NZNA 5IMZA 3P8WA 4WKWA 4OFNA 2L5LA 1HD2A 1FO5A 2HSNB 2EFCA 3EMXA 2FWFA 5GSTA 2FD3A 4GCIA 5IOWA 5AN1A 3ZITA 2JU5A 1QMVA 3KP9A 1XW6A 3ZVJA 2FLSA 2ON7A 2VCXA 5D96A 2LSTA 4XRAA 3BCKA 3FR6A 2AHEA 1ZYNA 1XOAA 4ZBDA 1FG4A 3CTFA 1V40A 2OT3A 5F0GA 2JZSA 2LQOA 4N10A 4ML6A 1OE7A 2WDUA 4K1FA 1MD4A 5KN1A 2R2JA 6GSYA 1GTBA 3HZ4A 4HZ2A 1G6WA 3VI7A 4OCFA 2OKAA 1TTZA 4IHUA 1F2EA 1IYHA 3QOUA 1IYIA 2P0GA 4L5LA 3I43A 4HQSA 1X0RA 2DBCA 2O5VA 3HVVA 5HR0A 2VCZA 5DDLA 3RHBA 3A2WA 2X8GA 2C0EA 1SL0B 5ELAA 1NM3A 4L0WA 1R7HA 3ZIJA 4BWQA 2CAIA 4PGTA 4V1Ap 4BA7A 2AB6A 3GH9A 1X5CA 4IW9A 1R26A 2L6CA 5ECQB 5FHIA 1YKAA 3KMOA 3D21A 1JZWA 2CZ3A 2V6KA 2WULA 2FWHA 4N0ZA 5JWOB 3KCMA 4MZCA 3L9SA 3TJFA 4G0LA 1TRVA 4EDZA 5B8BA 3Q6OA 3G7JA 2C0GA 3TKSE 3F9UA 1OAZA 1X5EA 3LWAA 4J57E 3TGZA 3H93A 4HZ4A 1FB0A 4TOPA 3RDWA 2FUG2 1ZMAA 3ZIVA 2CVKA 3C8EA 1YEXA 1HNAA 2EFDA 1XWCA 5LD0A 2M72A 4MP4A 4MJCA 1AC1A 2KHPA 2RLIA 1YF1A 3DVWA 4ISDA 4K2XA 1F6MC 3CQFA 1F37A 3DKSA 5ECNB 1V58A 4GTUA 4K2DA 3FR3A 4YKGA 4X1UA 2H01A 1VF4A 4A5PA 4XTSA 5GAPD 3GN3A 3HJPA 3VPTA 3BCIA
chains in the Genus database with same CATH topology
6GSUA 2YV9A 3QD9A 3UL3A 4MDCA 3GKNA 3ZFLA 3Q19A 2DKHA 2H75A 3L9UA 3TRQA 5HQPA 12GSA 1AXDA 3IHGA 3D22A 1GP1A 4K5SA 4ULXA 2R4VA 5B7CA 4OFTA 1SK2A 3LSZA 1GSSA 5J41A 3KGKA 4NV2A 1TDIA 2B5EA 5IMAA 4YAPA 3KH7A 2YZHA 2QSIA 3D5JA 2XC2A 2LV3A 1ZCPA 3RPPA 4AKIA 2GSTA 4MZWA 4EIQA 4LMVA 2H1BA 2VUPA 2HRFA 2WRTA 4TVEA 3F63A 4W66A 1GH2A 4IJ3A 1GRXA 4FQUA 1GNEA 4PUFC 2LNSA 4V1Ag 4MJEA 3E0UA 5AIVA 3G7YA 3M9JA 1TRWA 1GSUA 1EGOA 1PGTA 4EIPA 1G6YA 5IPHA 2YPMA 4ZIJA 1H75A 5F07A 3GA4A 4AJ6A 1VF1A 3LORA 2ZCTA 2LUSA 4GF0A 3F6FA 3JCML 1FAAA 2VL3A 1N8JA 1ZYPA 4YAVA 5ID2B 1WE0A 2L59A 1O8WA 3N5OA 2UZ8A 5D93A 1V9WA 1OE8A 1SKSB 1TU8A 1N25A 2YWMA 4IQ1A 3IR4A 4YQUA 4TKYA 3QFAC 4DSSB 1U88A 4O32A 1FB6A 2MMOA 4Q5QA 1RQMA 1BX9A 2LQQA 3Q18A 4HJ2A 2RM5A 3DYRA 4NWYA 3WT2A 4Z2TA 2OADA 3ME8A 1T00A 3GNJA 1QFNA 2IFQB 5GSSA 2G0FA 2HSMB 4QMKA 1TXXA 2GZPA 4N0VA 1SL2B 5DAKB 4KGIA 5G2ZA 2VM1A 2AYTA 2CT6A 2FGXA 1YVLA 1X5DA 2XPDA 2YWNA 1K3YA 3ZFBA 4WBJA 2HZEB 1FVKA 3UIWA 3KXOA 4CW9A 2HRNA 22GSA 5ECOB 4WBRD 4D73B 4G01A 1A0FA 2P5QA 1TU7A 4TR1A 2VCQA 1WWJA 2O89A 2C3QA 2F51A 5JCGA 5DQYA 1GUKA 2DMLA 4Q5NA 2H1LA 2WCIA 1WMJA 2IPAA 1ST9A 1U3AA 2HE3A 4HS1A 3PGTA 4KCAA 2CV4A 4TXOB 4AI6A 1SKRB 4XS4B 4CDOA 3DWVA 3BD2A 4O5QA 4MABA 2ALBA 3GKMA 3VPQA 4AJ7A 5H5QA 3RHCA 1X9WB 1MDIA 1EP7A 2IWTA 4QL7A 1VGLA 3LFLA 4LA1A 2XBQA 1PA3A 2TRXA 4FIWA 3GHAA 5JCUA 3TUEA 3AY8A 3MNGA 4KDUA 3ERGA 4BVYB 1TK0B 3J7Yk 4ZL9A 2V32A 4EKZA 4XS4A 3GL5A 2I9HA 2V2GA 3IOSA 1OC3A 3RAZA 1PQNA 1H4OA 5KN0A 2VD1A 3D4TA 1V98A 3TB2A 2A2PA 3GX8A 5CAXA 1RW1A 2LRNA 4EE0A 1I9DA 4ACSA 3KP8A 2GSQA 3BJ5A 10GSA 4IS0A 5IPGA 4ZBAA 5IMDA 4XHMA 5J40A 2TRCP 3GURA 1OC8A 1TI1A 3KEBA 4WETA 5DJLA 3ME7A 5J47A 2B7KA 2CZ2A 2QKEA 1ERUA 1N2AA 1GTUA 2J9HA 2O7KA 2MMNA 4ZILA 2WB9A 3PR8A 3GYKA 1C72A 1AQWA 5HR2A 1MDKA 3HYPA 1YZXA 1AIUA 1JZRA 3LGCA 3GUSA 3CSIA 4DEJA 2DLXA 3C7MA 3HVSA 4O92A 2GQMA 4RI7A 3IXRA 3ZVJD 1B9YC 1BJXA 4GSTA 8GSSA 1TRUA 2WS2A 1ILOA 2ZNMA 1X9MB 1PD21 3P2AA 1TXUA 2WFCA 3WGDA 4PXOA 2HT9A 4V2LA 5F8BA 2GZYA 3ZZXA 2P5RA 1DUGA 5J9CA 4JE1A 2IL3A 5J5NA 4AKHA 2M46A 2GDRA 2PVOC 1MD3A 4YQVA 4XIHA 2VLTA 5C00A 1EEJA 5JWRB 1GWCA 5KOXA 2CA8A 2HI7A 3APOA 2VLUA 5HR3A 2HNLA 5A34A 2H1AA 2EIOA 4O5UA 4ZL7A 3HZ8A 1WJKA 3H79A 1T3BA 2C4JA 2B5XA 1SVLA 5E4WA 4KX4A 4CY8A 2OA7A 3E9JB 2GT5A 3TKPA 3TU3B 1U6TA 3F4TA 4FYUA 2X4AA 3QFBC 1M2AA 5CNWA 5HFKA 1ZYEA 3GRXA 4AGSA 1O6JA 4G0IA 4I97A 5BMUA 1GSFA 2H6XA 2PGTA 3TOUA 2JL4A 3IDVA 2VKZG 3GH6A 2KP1A 2AUVA 1BYEA 2PUKC 2YZUA 1BG5A 3UAPA 2L57A 3QAGA 2CQ9A 1R5PA 3HVXA 3DEXA 4YQMA 1UVZA 2FA8A 1EEMA 2PWJA 3BBYA 5EVOA 4WF4A 1XWGA 2QA1A 4K7NA 2H74A 2KUCA 2X8HA 1YEPA 4MK3A 5IQYA 1I5GA 3VWWA 1PKWA 2K9FA 3KJYA 2ES7A 3F4SA 4BVXA 1O7UA 4QQ7A 4ML1A 3FK8A 3UOMA 2VOCA 4K7IA 4MLYA 3L0HA 3GTUA 1YQ1A 2H76A 3APQA 5J3RA 1GUHA 4BL7A 6GSVA 3NIVA 3FEUA 2XPEA 2LNTA 1EV9A 2CX4A 3IBHA 5DQSA 2DIZA 1F9MA 3LYKA 1PRXA 1SJIA 2HQTA 4HEA2 5DVBA 2AV4A 3UEMA 3MYDA 1EZKA 1YY7A 3IRAA 2BTOT 2IJYA 18GSA 1S3CA 4O7HA 2R3XA 1EGRA 3LXTA 4K0GA 2HRKA 3PH9A 4G19A 4ZB7A 1MTCA 3ZYWA 2YP6A 3EINA 1PX7A 4TR0A 2LTKA 5CRDA 4MF5A 1XZOA 5CREA 1SL1B 3A2XA 3FZ9A 3VI5A 3W6GA 2EIRA 2V6OA 4WF5A 3FR9A 3CSJA 2R5GA 4IELA 2KLXA 2MYGA 4GQCA 4MCUA 4FH8A 1TI3A 3QDNA 1THXA 3KH9A 4EVMA 1MDJA 1B4PA 4MH2A 2C80A 2GSSA 2OACA 2I1UA 2OJLA 5J4YA 2L6DA 3CTGA 1LBKA 2NTOA 1G0TA 3QCPA 1F3AA 3APSA 4POKA 2HXKA 2H73A 2VCVA 4F2IA 5IO2A 2P31A 3FKFA 4GXZA 1GTIA 6GSWA 3TJGA 4PNFA 2B6MA 4G2EA 1QQ2A 2GT6A 1XXUA 1KNGA 1LJRA 3WD6A 2H66A 2PMTA 3CRUA 3GV1A 3EURA 1TK5B 4HI7A 1T1VA 5FWGA 3V1WA 4PQHA 1XVWA 2YANA 1FHEA 2K8VA 5A4VA 4EC0A 5D9VA 3TJJA 13GSA 1SD9A 5B8AA 1THOA 4GSSA 3DVXA 3GSTA 3ZL5A 1PN0A 2CX3A 3O6TA 5KOWA 4V2NA 2I81A 1UN2A 1ACVA 4KW6A 2IN3A 3W8JA 5HFGA 2H0HA 3TRPA 4ZXGA 3M1GA 5G5FA 1Z7PA 3U5RE 3MDKA 1M99A 2OBKA 2L4QA 5B6NA 1OVNA 3FY7A 1UA5A 2B3SA 1BQ7A 2UV8G 3ZRDA 1XIYA 2M80A 2E0QA 5B6MA 4HOJA 4E8HA 17GSA 2HZFA 3L4NA 5ECPB 1B48A 2K8SA 2VCTA 2I4AA 2JSZA 1SYXA 2H1GA 2A2SA 2A2RA 9GSSA 2R0PA 1JZOA 1TRSA 4ECCA 2IMFA 4KA0A 5EY6A 4PNGA 1WPIA 4IVFA 3I9V2 5HFIA 5IMFA 4Z2UA 3KTBA 2MBTA 2GLRA 3KIJA 6GSSA 5D9WA 1GULA 6GSXA 1BEDA 3GSSA 1JLVA 1Z6MA 3EVIA 1EOHA 2H72A 1ZZYA 4ZB6A 1A23A 1SK0A 2GVPA 4F03A 4TR1B 1CQHA 1FOHA 1SK1A 4KNDA 1URMA 3WT1A 4NXIA 3IC8A 1O81A 4IGJA 1GSDA 2LS5A 5GAND 4KSOA 2JZRA 4WR5A 2REMA 5IO0A 2IMKA 1M0UA 4G9HA 4TR3A 2VAFA 3EMPA 4K7OA 3VWXA 1USBA 2MMAA 3A5WA 1A24A 2H1DA 3H8QA 1XWBA 2NBSA 3WGXA 5CRGA 1ZL9A 3M9KA 4I2UA 2KOKA 2E2MA 3HA9A 2FY6A 2WJUA 3IAM2 2X49A 4ZB9A 1S3DA 3M3MA 5IM9A 2F8FA 2DJKA 5KN3A 2YWOA 3QPMA 3TKRA 1JFUA 2LRTA 1AQVA 2E2GA 19GSA 2L5OA 2DJ2A 1PKZA 4TW5A 3F4RA 3FRCA 1M2BA 4POMA 2LJRA 3VLNA 3QAWA 2R37A 2PPTA 3IPZA 1GSEA 3FZ4A 3UVTA 3LEFA 1K0AA 5LNKe 1JZDA 2CVBA 1PN9A 4G0KA 4ECJA 1G7OA 2VD0A 1B8XA 4XS1A 4ZL8A 3EC3A 2IMEA 3TRXA 4I6XA 3P7XA 1VRSD 4WR4A 3VWVA 1EV4A 1AQXA 3GIXA 3MSZA 2R0GA 3DD3A 5H5SA 3TDGA 1ZGNA 2F8AA 3HCZA 4EUYA 3BOAA 4MA9A 4LLRA 2GS3A 2O85A 3CYNA 4KCEA 2CVDA 2HSYA 1AW9A 2F3MA 5A1NA 1TKDB 1PSQA 4H86A 2LEGA 2C3TA 2B7JA 4I8BA 1UC7A 2LJKA 2DMMA 1FVJA 3KZQA 1XCCA 4TR4A 4L5OA 3LJRA 4TN8A 3FYGA 3UJ1A 3ZREA 1XPVA 3IE3A 2MBSA 5A34B 3IK9A 1ERWA 2DIYA 1V2AA 1Z3EA 2OE3A 2YN1A 1K3LA 2FWEA 1X9SB 4WEYA 4OFMA 1A8YA 1ML6A 2HSHA 3M0FA 2N5BA 1Y1UA 2VIMA 1HNBA 5A5HA 2B5YA 1ERVA 3LXZA 1OKTA 1ERTA 1HYUA 5BMUB 1OYJA 1WOUA 5ENUA 4HQZA 2OE1A 3M8NA 3ZMLA 1M9BA 3SWLA 3FZ5A 4WXTA 1TP9A 1PL2A 3WGEA 1GL8A 4K0NA 1KEBA 2NDOA 4NHWA 1T4ZA 1A2MA 2BJXA 5ECSA 1U87A 4KE3A 1EP8A 2WZ9A 5D9XA 3PPUA 2YJ7A 4PX1A 1RK4A 5BRTA 4HDEA 3I6AA 3O3TA 1DE1A 4IP6A 4HJMA 2VCWA 5AGYA 20GSA 4G10A 1ABAA 4Q5RA 4QL9A 3LYPA 2RM6A 2ZUPA 4K8MA 1OKDA 2X8CA 5IIZA 1XWAA 3KM6A 1AAZA 4JEDA 3DRNA 4TRXA 2FCHA 5G31A 5JWQB 3VWUA 4BVXB 2GGTA 3F3QA 4XRDA 5IMVA 5IOXA 1O85A 1OC9A 3HJOA 4GQFA 2EC4A 2H30A 1GLPA 4KAEA 4MH3A 3GTUB 1Y25A 3KD0A 1W89A 2MMZA 4BL7B 1Z7RA 5CRHA 3ZTLA 2YCDA 4TXVA 2PBJA 3CWGA 4RQXA 1TOFA 5ECKB 4GRFA 1XFLA 4EF0A 3TJKA 5COHA 2C1YA 2WGRA 5J9BA 2YJHA 5DALA 5AIXA 4JU5A 3F3RA 2XHFA 2IMDA 5CYYA 3EE2A 1K0OA 2HRKB 4PURA 2FA4A 4J2FA 5ECMB 4MJAA 1M7TA 2C3NA 2C8UA 4IQAA 2FWGA 1EOGA 3TOTA 1F3BA 3HKRA 2LJAA 3US3A 4F0BA 1S3AA 2HSNA 3VK9A 2JADA 4POBA 4X0XA 4EDYA 2F9SA 1J08A 4DSQA 2H6ZA 1NW2A 16GSA 2DC5A 2NPBA 4MPFA 3LW9A 3H1NA 3O76A 2H19A 1QGVA 1K0CA 5LCZA 1A2LA 3HD5A 4LMWA 3G7IA 2R0CA 1PX6A 4BWSA 1GLQA 1JLWA 5H5RA 3C1RA 2QC7A 4OO5A 2FHEA 3GKKA 4AKGA 1NHYA 2H0IA 2X99A 3FHKA 3L78A 4KDXA 1J0FA 1LU4A 4XCSA 3KTLA 1A0RP 1T7PB 4EXJA 3RPNA 3EWLA 3ZMKA 1Z6NA 3J7Yb 1R5AA 1NHOA 2DJ3A 5D9TA 4Q5FA 2C0FA 4JRRA 1SJ6A 4X4JA 2V41A 1DE2A 2JSYA 3VURA 4RI6A 4FYBA 2JZTA 2FNOA 4CY6A 2O87A 4DVCA 1XBSA 4K5RA 2O8VB 1SU9A 1XOBA 5INYA 3LQ7A 2GQKA 4J56E 3K8NA 3HDCA 3GL3A 4GDFA 1GUMA 3A5IA 5E59A 2H6YA 3L9VA 3FMWA 2RUFA 5L71A 3N9JA 3DIEA 4IKHA 2DJ0A 3CMIA 4KUNA 5CRWA 4RUVA 5HR1A 1VF2A 3CRTA 4USSA 1BG1A 1B9XC 2NVLA 1W4VA 4IJIA 4ECBA 5ECLB 2L4CA 3A2VA 1TW9A 1K0NA 1VF3A 4F82A 1ZYQB 1SD8A 4LL4B 4KDYA 4X43A 1O73A 2IIYA 2VO4A 1K3OA 3D6IA 3W8SA 4EO3A 3CXGA 2ON5A 4NV5A 1CQGA 2GZZA 2N5FA 3MIXA 3S9FA 5A4UA 1SENA 3A3TA 5ECIB 2PN8A 3D4MA 2D2ZA 1R4WA 1BF5A 2LRCA 3HMJG 1YJ6A 1WRYA 1T4YA 2VL2A 3C73A 4PTSA 4I5QA 5FT3A 3IA1A 2H70A 2RIIA 3U6VA 3HHVA 3G9BA 4KH7A 5ECHB 5ECRB 3TKSA 1PL1A 3UBLA 1E6BA 4LL1B 3TJBA 5KN2A 2BMXA 1DBYA 2B1LA 5CO3A 1O8XA 1M9AA 4ICYA 1Z9HA 2H0GA 3HY2A 3OR5A 2HRAA 3QMXA 1SKWB 4JBBA 4YKFA 4E8EA 4AJ8A 3DMLA 1KBNA 4KF9A 1QXHA 4K6XA 1A2JA 4NPBA 1B4QA 4MNNA 4JR6A 4MJBA 2K18A 3EU3A 4P3YB 3DGQA 1HNCA 3HJMA 3EPTA 1V57A 2B1KA 3MAKA 2GQLA 1G7EA 4HU9A 4XS6A 5ID2A 3RBTA 1PMTA 2X64A 4PUAA 1A8LA 4ZBBA 3R2QA 2HFDA 1YDKA 1WP0A 3C71A 3HXSA 3R3EA 4HUAA 5CP1A 2IMIA 1GTAA 4DSSA 3Q74A 1WIKA 4CHSA 3PINA 3IAS2 5G1LA 5JCWA 1GSQA 2GSRA 3CSHA 4MZBA 4EL1A 2EFEA 3IHQA 1ON4A 2A4VA 2IFQA 3FZAA 3GKXA 2PU9C 5ELGA 1SVMA 2HSMA 5DAKA 4Z2RA 4HU7A 2EFHA 4MMMA 4NAXA 2E7PA 2AAWA 5IMCA 4POLA 4I2TA 1GSYA 1Q4JA 4RQRA 4Z7XA 4IN0A 1QK8A 2HZEA 2K6VA 1XW5A 1ZOFA 4YH2A 2PVQA 4OCEA 5G30A 5G5EA 1DSBA 2DKIA 4D73A 1FW1A 1T8EB 1TJDA 1E2YA 5A1NB 2DJ1A 3SBCA 3ERFA 2HYXA 3ISOA 3IK7A 4KSMA 4PQIA 7GSSA 1Z5YE 2A4HA 3KMNA 5AISA 5A4WA 4FO5A 2Z9SA 2YNXA 2RUEA 2G2QA 4L8EA 5DBQA 4TXOA 3ED3A 5DJMA 1YKCA 4KB3A 1AUCA 4ECIA 2LKUA 4V2MA 2J23A 4OD7A 3LG6A 1J9BA 4FYCA 3GX0A 1NSWA 3WYWA 5F05A 5DCHA 4OO4A 4OWYA 2VL9A 1XWKA 4BVYA 4MF6A 2R6KA 5A5HB 2V1MA 2YV7A 4K9ZA 1U3IA 3CBUA 3TKQA 4E68A 1BAYA 3E3EA 4MF7A 4N11A 5D73A 4IBPA 4ID0A 5J4VA 2HLSA 4DSRA 4N3ZA 4OMVA 5G1KA 4GWRA 3P90A 2OE0A 1JHBA 2H71A 4AKXB 3H4KA 1XVQA 3ZLPA 1XW9A 3ERWA 2DJJA 3EU4A 1EWXA 2XBIA 3TCOA 1M2DA 5EL8A 1HQOA 1FOVA 3F6DA 1Q98A 2OBIA 3F8UA 5DCGA 1KTEA 3DXBA 2H8LA 2N5AA 4ZB8A 2VL2C 3I69A 11GSA 1OC9B 4NHZA 3UBKA 3UVHA 5KEJA 3IV4A 2DSAA 4ILFA 4NMUA 1GNWA 5C04A 3MWHA 4O5RA 1MEKA 1QUWA 5GZZB 2MZCA 2TIRA 4PQ1A 3TKSC 2C0DA 4GSNA 5J4UA 1SJZA 3GFKA 3QR6A 14GSA 3FW2A 2QA2A 1K0MA 4GLTA 3GMFA 2PERA 1K0DA 3EYTA 2AJQB 2JACA 1Y6EA 4JZQA 2QGVA 4MPGA 3UMAA 2VM2A 3QAVA 3VFIA 4JR4A 1SVOA 6GSTA 5ABRA 4AF2A 3F0IA 5A5KA 2YWIA 3UARA 3NOFA 2I3YA 5DALB 4IP1A 2EIQA 1K0BA 5F06A 5D8IA 3C1SA 2CAQA 3IC4A 5EPFA 1SYRA 4N30A 4L0UA 4F9ZA 2KP2A 4BPYA 1TK8B 1YF0A 2YOIA 2VLVA 2GTUA 3D0ZA 4F0CA 3NZNA 5IMZA 3P8WA 4WKWA 4OFNA 2L5LA 1HD2A 1FO5A 2HSNB 2EFCA 3EMXA 2FWFA 5GSTA 2FD3A 4GCIA 5IOWA 5AN1A 3ZITA 2JU5A 1QMVA 3KP9A 1XW6A 3ZVJA 2FLSA 2ON7A 2VCXA 5D96A 2LSTA 4XRAA 3BCKA 3FR6A 2AHEA 1ZYNA 1XOAA 4ZBDA 1FG4A 3CTFA 1V40A 2OT3A 5F0GA 2JZSA 2LQOA 4N10A 4ML6A 1OE7A 2WDUA 4K1FA 1MD4A 5KN1A 2R2JA 6GSYA 1GTBA 3HZ4A 4HZ2A 1G6WA 3VI7A 4OCFA 2OKAA 1TTZA 4IHUA 1F2EA 1IYHA 3QOUA 1IYIA 2P0GA 4L5LA 3I43A 4HQSA 1X0RA 2DBCA 2O5VA 3HVVA 5HR0A 2VCZA 5DDLA 3RHBA 3A2WA 2X8GA 2C0EA 1SL0B 5ELAA 1NM3A 4L0WA 1R7HA 3ZIJA 4BWQA 2CAIA 4PGTA 4V1Ap 4BA7A 2AB6A 3GH9A 4IW9A 1X5CA 1R26A 2L6CA 5ECQB 5FHIA 1YKAA 3KMOA 3D21A 1JZWA 2CZ3A 2V6KA 2WULA 2FWHA 4N0ZA 5JWOB 3KCMA 4MZCA 3L9SA 3TJFA 4G0LA 1TRVA 4EDZA 5B8BA 3Q6OA 3G7JA 2C0GA 3TKSE 3F9UA 1OAZA 1X5EA 3LWAA 4J57E 3TGZA 3H93A 4HZ4A 1FB0A 4TOPA 3RDWA 2FUG2 1ZMAA 3ZIVA 2CVKA 3C8EA 1YEXA 1HNAA 2EFDA 1XWCA 5LD0A 2M72A 4MP4A 4MJCA 1AC1A 2KHPA 2RLIA 1YF1A 3DVWA 4ISDA 4K2XA 1F6MC 1F37A 3DKSA 5ECNB 1V58A 4GTUA 4K2DA 3FR3A 4YKGA 4X1UA 2H01A 1VF4A 4A5PA 4XTSA 5GAPD 3GN3A 3HJPA 3VPTA 3BCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6GSU A;  2YV9 A;  3QD9 A;  3UL3 A;  4MDC A;  3GKN A;  3ZFL A;  3Q19 A;  2H75 A;  3L9U A;  3TRQ A;  5HQP A;  12GS A;  1AXD A;  3D22 A;  1GP1 A;  4ULX A;  2R4V A;  5B7C A;  4OFT A;  1SK2 A;  3LSZ A;  1GSS A;  5J41 A;  3KGK A;  4NV2 A;  1TDI A;  2B5E A;  5IMA A;  4YAP A;  3KH7 A;  2YZH A;  2QSI A;  3D5J A;  2XC2 A;  2LV3 A;  1ZCP A;  3RPP A;  2GST A;  4MZW A;  4LMV A;  2H1B A;  2VUP A;  2HRF A;  2WRT A;  4TVE A;  3F63 A;  1GH2 A;  4IJ3 A;  1GRX A;  4FQU A;  1GNE A;  4PUF C;  2LNS A;  4V1A g;  4MJE A;  3E0U A;  5AIV A;  3G7Y A;  3M9J A;  1TRW A;  1GSU A;  1EGO A;  1PGT A;  1G6Y A;  5IPH A;  2YPM A;  4ZIJ A;  1H75 A;  5F07 A;  3GA4 A;  4AJ6 A;  1VF1 A;  3LOR A;  2ZCT A;  2LUS A;  4GF0 A;  3F6F A;  3JCM L;  1FAA A;  2VL3 A;  1N8J A;  4YAV A;  5ID2 B;  1WE0 A;  2L59 A;  1O8W A;  3N5O A;  2UZ8 A;  5D93 A;  1V9W A;  1OE8 A;  1SKS B;  1TU8 A;  2YWM A;  4IQ1 A;  3IR4 A;  4YQU A;  4TKY A;  3QFA C;  4DSS B;  1U88 A;  4O32 A;  1FB6 A;  2MMO A;  4Q5Q A;  1RQM A;  1BX9 A;  2LQQ A;  3Q18 A;  4HJ2 A;  2RM5 A;  3DYR A;  4NWY A;  3WT2 A;  2OAD A;  3ME8 A;  1T00 A;  3GNJ A;  1QFN A;  2IFQ B;  5GSS A;  2G0F A;  2HSM B;  1TXX A;  2GZP A;  4N0V A;  1SL2 B;  5DAK B;  4KGI A;  5G2Z A;  2VM1 A;  2AYT A;  2CT6 A;  2FGX A;  1X5D A;  2XPD A;  2YWN A;  1K3Y A;  3ZFB A;  4WBJ A;  2HZE B;  1FVK A;  3UIW A;  3KXO A;  4CW9 A;  2HRN A;  22GS A;  5ECO B;  4WBR D;  4D73 B;  1A0F A;  2P5Q A;  1TU7 A;  4TR1 A;  2VCQ A;  1WWJ A;  2O89 A;  2C3Q A;  2F51 A;  5JCG A;  5DQY A;  1GUK A;  2DML A;  4Q5N A;  2WCI A;  1WMJ A;  2IPA A;  1ST9 A;  1U3A A;  2HE3 A;  4HS1 A;  3PGT A;  4KCA A;  2CV4 A;  4TXO B;  1SKR B;  4XS4 B;  4CDO A;  3DWV A;  3BD2 A;  4MAB A;  2ALB A;  3GKM A;  3VPQ A;  4AJ7 A;  5H5Q A;  3RHC A;  1X9W B;  1MDI A;  1EP7 A;  2IWT A;  4QL7 A;  1VGL A;  3LFL A;  4LA1 A;  2XBQ A;  1PA3 A;  2TRX A;  4FIW A;  3GHA A;  5JCU A;  3TUE A;  3AY8 A;  3MNG A;  4KDU A;  3ERG A;  4BVY B;  1TK0 B;  3J7Y k;  4ZL9 A;  2V32 A;  4EKZ A;  4XS4 A;  3GL5 A;  2I9H A;  2V2G A;  3IOS A;  1OC3 A;  3RAZ A;  1PQN A;  1H4O A;  5KN0 A;  2VD1 A;  3D4T A;  1V98 A;  3TB2 A;  3GX8 A;  5CAX A;  1RW1 A;  2LRN A;  4EE0 A;  1I9D A;  4ACS A;  3KP8 A;  2GSQ A;  3BJ5 A;  10GS A;  4IS0 A;  5IPG A;  4ZBA A;  5IMD A;  4XHM A;  2TRC P;  3GUR A;  1OC8 A;  1TI1 A;  3KEB A;  4WET A;  5DJL A;  3ME7 A;  2B7K A;  2CZ2 A;  2QKE A;  1ERU A;  1N2A A;  1GTU A;  2J9H A;  2O7K A;  2MMN A;  4ZIL A;  2WB9 A;  3PR8 A;  3GYK A;  1C72 A;  1AQW A;  5HR2 A;  1MDK A;  3HYP A;  1YZX A;  1AIU A;  1JZR A;  3LGC A;  3GUS A;  3CSI A;  4DEJ A;  2DLX A;  3C7M A;  3HVS A;  4O92 A;  2GQM A;  4RI7 A;  3IXR A;  3ZVJ D;  1B9Y C;  1BJX A;  4GST A;  8GSS A;  1TRU A;  2WS2 A;  1ILO A;  2ZNM A;  1X9M B;  1PD2 1;  3P2A A;  2WFC A;  3WGD A;  4PXO A;  2HT9 A;  4V2L A;  5F8B A;  2GZY A;  3ZZX A;  2P5R A;  1DUG A;  5J9C A;  4JE1 A;  2IL3 A;  5J5N A;  2M46 A;  2GDR A;  2PVO C;  1MD3 A;  4YQV A;  4XIH A;  2VLT A;  5C00 A;  1EEJ A;  5JWR B;  1GWC A;  2CA8 A;  2HI7 A;  3APO A;  2VLU A;  5HR3 A;  2HNL A;  2H1A A;  2EIO A;  4ZL7 A;  3HZ8 A;  1WJK A;  3H79 A;  1T3B A;  2C4J A;  2B5X A;  5E4W A;  4KX4 A;  2OA7 A;  3E9J B;  2GT5 A;  3TKP A;  1U6T A;  3F4T A;  4FYU A;  3QFB C;  1M2A A;  5CNW A;  5HFK A;  1ZYE A;  3GRX A;  4AGS A;  1O6J A;  4G0I A;  4I97 A;  5BMU A;  1GSF A;  2H6X A;  2PGT A;  3TOU A;  2JL4 A;  3IDV A;  3GH6 A;  2KP1 A;  2AUV A;  1BYE A;  2PUK C;  2YZU A;  1BG5 A;  3UAP A;  2L57 A;  3QAG A;  2CQ9 A;  1R5P A;  3HVX A;  3DEX A;  4YQM A;  1UVZ A;  2FA8 A;  1EEM A;  2PWJ A;  3BBY A;  5EVO A;  4WF4 A;  1XWG A;  4K7N A;  2H74 A;  2KUC A;  2X8H A;  1YEP A;  4MK3 A;  5IQY A;  1I5G A;  3VWW A;  1PKW A;  2K9F A;  3KJY A;  2ES7 A;  3F4S A;  4BVX A;  1O7U A;  4QQ7 A;  4ML1 A;  3FK8 A;  3UOM A;  2VOC A;  4K7I A;  4MLY A;  3L0H A;  3GTU A;  1YQ1 A;  2H76 A;  3APQ A;  5J3R A;  1GUH A;  4BL7 A;  6GSV A;  3NIV A;  3FEU A;  2XPE A;  2LNT A;  1EV9 A;  2CX4 A;  3IBH A;  5DQS A;  2DIZ A;  1F9M A;  3LYK A;  1PRX A;  1SJI A;  2HQT A;  4HEA 2;  5DVB A;  2AV4 A;  3UEM A;  1EZK A;  1YY7 A;  3IRA A;  2BTO T;  2IJY A;  18GS A;  1S3C A;  4O7H A;  2R3X A;  1EGR A;  3LXT A;  4K0G A;  2HRK A;  3PH9 A;  4G19 A;  1MTC A;  3ZYW A;  2YP6 A;  3EIN A;  1PX7 A;  4TR0 A;  2LTK A;  5CRD A;  4MF5 A;  1XZO A;  5CRE A;  1SL1 B;  3A2X A;  3FZ9 A;  3VI5 A;  3W6G A;  2EIR A;  2V6O A;  4WF5 A;  3FR9 A;  3CSJ A;  2R5G A;  4IEL A;  2KLX A;  2MYG A;  4GQC A;  4MCU A;  4FH8 A;  1TI3 A;  3QDN A;  1THX A;  3KH9 A;  4EVM A;  1MDJ A;  1B4P A;  4MH2 A;  2C80 A;  2GSS A;  2OAC A;  2I1U A;  2OJL A;  2L6D A;  3CTG A;  1LBK A;  2NTO A;  1G0T A;  3QCP A;  1F3A A;  3APS A;  4POK A;  2HXK A;  2H73 A;  2VCV A;  4F2I A;  5IO2 A;  2P31 A;  3FKF A;  4GXZ A;  1GTI A;  6GSW A;  3TJG A;  4PNF A;  2B6M A;  4G2E A;  1QQ2 A;  2GT6 A;  1XXU A;  1KNG A;  1LJR A;  3WD6 A;  2H66 A;  2PMT A;  3CRU A;  3GV1 A;  3EUR A;  1TK5 B;  4HI7 A;  1T1V A;  5FWG A;  3V1W A;  4PQH A;  1XVW A;  2YAN A;  1FHE A;  2K8V A;  5A4V A;  4EC0 A;  5D9V A;  3TJJ A;  13GS A;  1SD9 A;  5B8A A;  1THO A;  4GSS A;  3DVX A;  3GST A;  3ZL5 A;  2CX3 A;  3O6T A;  4V2N A;  2I81 A;  1UN2 A;  1ACV A;  4KW6 A;  2IN3 A;  3W8J A;  5HFG A;  2H0H A;  3TRP A;  4ZXG A;  3M1G A;  5G5F A;  1Z7P A;  3U5R E;  3MDK A;  1M99 A;  2OBK A;  2L4Q A;  5B6N A;  1OVN A;  3FY7 A;  1UA5 A;  2B3S A;  1BQ7 A;  3ZRD A;  1XIY A;  2M80 A;  2E0Q A;  5B6M A;  4HOJ A;  4E8H A;  17GS A;  2HZF A;  3L4N A;  5ECP B;  1B48 A;  2K8S A;  2VCT A;  2I4A A;  2JSZ A;  1SYX A;  2H1G A;  2A2S A;  2A2R A;  9GSS A;  1JZO A;  1TRS A;  4ECC A;  2IMF A;  4KA0 A;  5EY6 A;  4PNG A;  1WPI A;  4IVF A;  3I9V 2;  5HFI A;  5IMF A;  3KTB A;  2MBT A;  2GLR A;  3KIJ A;  6GSS A;  5D9W A;  1GUL A;  6GSX A;  1BED A;  3GSS A;  1JLV A;  1Z6M A;  3EVI A;  1EOH A;  2H72 A;  1ZZY A;  4ZB6 A;  1A23 A;  1SK0 A;  2GVP A;  4F03 A;  4TR1 B;  1CQH A;  1SK1 A;  4KND A;  1URM A;  3WT1 A;  4NXI A;  3IC8 A;  1O81 A;  4IGJ A;  1GSD A;  2LS5 A;  5GAN D;  4KSO A;  2JZR A;  4WR5 A;  2REM A;  5IO0 A;  2IMK A;  1M0U A;  4G9H A;  4TR3 A;  2VAF A;  3EMP A;  4K7O A;  3VWX A;  1USB A;  2MMA A;  3A5W A;  1A24 A;  2H1D A;  3H8Q A;  1XWB A;  2NBS A;  3WGX A;  5CRG A;  1ZL9 A;  3M9K A;  4I2U A;  2KOK A;  2E2M A;  3HA9 A;  2FY6 A;  2WJU A;  3IAM 2;  4ZB9 A;  1S3D A;  3M3M A;  5IM9 A;  2F8F A;  2DJK A;  5KN3 A;  2YWO A;  3QPM A;  3TKR A;  1JFU A;  2LRT A;  1AQV A;  2E2G A;  19GS A;  2L5O A;  2DJ2 A;  1PKZ A;  4TW5 A;  3F4R A;  3FRC A;  1M2B A;  4POM A;  2LJR A;  3VLN A;  3QAW A;  2R37 A;  2PPT A;  3IPZ A;  1GSE A;  3FZ4 A;  3UVT A;  3LEF A;  1K0A A;  5LNK e;  1JZD A;  2CVB A;  1PN9 A;  4G0K A;  4ECJ A;  1G7O A;  2VD0 A;  1B8X A;  4XS1 A;  4ZL8 A;  3EC3 A;  2IME A;  3TRX A;  4I6X A;  3P7X A;  1VRS D;  4WR4 A;  3VWV A;  1EV4 A;  1AQX A;  3GIX A;  3MSZ A;  3DD3 A;  5H5S A;  3TDG A;  1ZGN A;  2F8A A;  3HCZ A;  4EUY A;  3BOA A;  4MA9 A;  4LLR A;  2GS3 A;  2O85 A;  3CYN A;  4KCE A;  2CVD A;  2HSY A;  1AW9 A;  2F3M A;  1TKD B;  1PSQ A;  4H86 A;  2LEG A;  2C3T A;  2B7J A;  4I8B A;  1UC7 A;  2LJK A;  2DMM A;  1FVJ A;  3KZQ A;  1XCC A;  4TR4 A;  4L5O A;  3LJR A;  4TN8 A;  3FYG A;  3UJ1 A;  3ZRE A;  1XPV A;  3IE3 A;  2MBS A;  3IK9 A;  1ERW A;  2DIY A;  1V2A A;  1Z3E A;  2OE3 A;  2YN1 A;  1K3L A;  2FWE A;  1X9S B;  4WEY A;  4OFM A;  1A8Y A;  1ML6 A;  2HSH A;  3M0F A;  2N5B A;  2VIM A;  1HNB A;  2B5Y A;  1ERV A;  3LXZ A;  1OKT A;  1ERT A;  1HYU A;  1OYJ A;  1WOU A;  5ENU A;  4HQZ A;  2OE1 A;  3M8N A;  3ZML A;  1M9B A;  3SWL A;  3FZ5 A;  4WXT A;  1TP9 A;  1PL2 A;  3WGE A;  1GL8 A;  4K0N A;  1KEB A;  2NDO A;  4NHW A;  1T4Z A;  1A2M A;  2BJX A;  5ECS A;  1U87 A;  4KE3 A;  1EP8 A;  2WZ9 A;  5D9X A;  3PPU A;  2YJ7 A;  4PX1 A;  1RK4 A;  4HDE A;  3I6A A;  3O3T A;  1DE1 A;  4IP6 A;  4HJM A;  2VCW A;  5AGY A;  20GS A;  4G10 A;  1ABA A;  4Q5R A;  4QL9 A;  3LYP A;  2RM6 A;  2ZUP A;  4K8M A;  1OKD A;  2X8C A;  5IIZ A;  1XWA A;  3KM6 A;  1AAZ A;  4JED A;  3DRN A;  4TRX A;  2FCH A;  5G31 A;  5JWQ B;  3VWU A;  4BVX B;  2GGT A;  3F3Q A;  4XRD A;  5IMV A;  5IOX A;  1O85 A;  1OC9 A;  3HJO A;  4GQF A;  2EC4 A;  2H30 A;  1GLP A;  4KAE A;  4MH3 A;  3GTU B;  1Y25 A;  3KD0 A;  1W89 A;  2MMZ A;  4BL7 B;  1Z7R A;  5CRH A;  3ZTL A;  2YCD A;  4TXV A;  2PBJ A;  4RQX A;  1TOF A;  5ECK B;  4GRF A;  1XFL A;  4EF0 A;  3TJK A;  5COH A;  2C1Y A;  2WGR A;  5J9B A;  2YJH A;  5DAL A;  5AIX A;  4JU5 A;  3F3R A;  2XHF A;  2IMD A;  5CYY A;  3EE2 A;  1K0O A;  2HRK B;  4PUR A;  2FA4 A;  4J2F A;  5ECM B;  4MJA A;  1M7T A;  2C3N A;  2C8U A;  4IQA A;  2FWG A;  1EOG A;  3TOT A;  1F3B A;  3HKR A;  2LJA A;  3US3 A;  4F0B A;  1S3A A;  3VK9 A;  2JAD A;  4POB A;  4X0X A;  4EDY A;  2F9S A;  1J08 A;  4DSQ A;  2H6Z A;  1NW2 A;  16GS A;  2DC5 A;  2NPB A;  4MPF A;  3H1N A;  3O76 A;  2H19 A;  1QGV A;  1K0C A;  5LCZ A;  1A2L A;  3HD5 A;  4LMW A;  3G7I A;  1PX6 A;  4BWS A;  1GLQ A;  1JLW A;  5H5R A;  3C1R A;  2QC7 A;  4OO5 A;  2FHE A;  3GKK A;  1NHY A;  2H0I A;  2X99 A;  3FHK A;  3L78 A;  4KDX A;  1J0F A;  1LU4 A;  4XCS A;  3KTL A;  1A0R P;  1T7P B;  4EXJ A;  3RPN A;  3EWL A;  3ZMK A;  1Z6N A;  3J7Y b;  1R5A A;  1NHO A;  2DJ3 A;  5D9T A;  4Q5F A;  2C0F A;  4JRR A;  1SJ6 A;  2V41 A;  1DE2 A;  2JSY A;  3VUR A;  4RI6 A;  4FYB A;  2JZT A;  2FNO A;  2O87 A;  4DVC A;  1XBS A;  2O8V B;  1SU9 A;  1XOB A;  5INY A;  3LQ7 A;  2GQK A;  4J56 E;  3K8N A;  3HDC A;  3GL3 A;  1GUM A;  5E59 A;  2H6Y A;  3L9V A;  2RUF A;  5L71 A;  3N9J A;  3DIE A;  4IKH A;  2DJ0 A;  3CMI A;  4KUN A;  5CRW A;  4RUV A;  5HR1 A;  1VF2 A;  3CRT A;  4USS A;  1B9X C;  2NVL A;  1W4V A;  4IJI A;  4ECB A;  5ECL B;  2L4C A;  3A2V A;  1TW9 A;  1K0N A;  1VF3 A;  4F82 A;  1ZYQ B;  1SD8 A;  4LL4 B;  4KDY A;  4X43 A;  1O73 A;  2IIY A;  2VO4 A;  1K3O A;  3D6I A;  3W8S A;  4EO3 A;  3CXG A;  2ON5 A;  4NV5 A;  1CQG A;  2GZZ A;  2N5F A;  3S9F A;  5A4U A;  1SEN A;  3A3T A;  5ECI B;  2PN8 A;  3D4M A;  2D2Z A;  1R4W A;  2LRC A;  1YJ6 A;  1WRY A;  1T4Y A;  2VL2 A;  3C73 A;  4PTS A;  4I5Q A;  5FT3 A;  3IA1 A;  2H70 A;  2RII A;  3U6V A;  3HHV A;  3G9B A;  4KH7 A;  5ECH B;  5ECR B;  3TKS A;  1PL1 A;  3UBL A;  1E6B A;  4LL1 B;  3TJB A;  5KN2 A;  2BMX A;  1DBY A;  2B1L A;  5CO3 A;  1O8X A;  1M9A A;  1Z9H A;  2H0G A;  3OR5 A;  3HY2 A;  2HRA A;  3QMX A;  1SKW B;  4JBB A;  4E8E A;  4AJ8 A;  3DML A;  1KBN A;  4KF9 A;  1QXH A;  4K6X A;  1A2J A;  4NPB A;  1B4Q A;  4JR6 A;  4MJB A;  2K18 A;  3EU3 A;  4P3Y B;  3DGQ A;  1HNC A;  3HJM A;  1V57 A;  2B1K A;  3MAK A;  2GQL A;  1G7E A;  4HU9 A;  4XS6 A;  5ID2 A;  3RBT A;  1PMT A;  2X64 A;  4PUA A;  1A8L A;  4ZBB A;  3R2Q A;  2HFD A;  1YDK A;  1WP0 A;  3C71 A;  3HXS A;  3R3E A;  4HUA A;  5CP1 A;  2IMI A;  1GTA A;  4DSS A;  3Q74 A;  1WIK A;  4CHS A;  3PIN A;  3IAS 2;  5G1L A;  5JCW A;  1GSQ A;  2GSR A;  3CSH A;  4MZB A;  4EL1 A;  3IHQ A;  1ON4 A;  2A4V A;  2IFQ A;  3FZA A;  3GKX A;  2PU9 C;  5ELG A;  2HSM A;  5DAK A;  4HU7 A;  4MMM A;  4NAX A;  2E7P A;  2AAW A;  5IMC A;  4POL A;  4I2T A;  1GSY A;  1Q4J A;  4RQR A;  4Z7X A;  4IN0 A;  1QK8 A;  2HZE A;  2K6V A;  1XW5 A;  1ZOF A;  4YH2 A;  2PVQ A;  4OCE A;  5G30 A;  5G5E A;  1DSB A;  4D73 A;  1FW1 A;  1T8E B;  1TJD A;  1E2Y A;  2DJ1 A;  3SBC A;  3ERF A;  2HYX A;  3ISO A;  3IK7 A;  4KSM A;  4PQI A;  7GSS A;  1Z5Y E;  3KMN A;  5AIS A;  5A4W A;  4FO5 A;  2Z9S A;  2YNX A;  2RUE A;  2G2Q A;  4L8E A;  5DBQ A;  4TXO A;  3ED3 A;  5DJM A;  1YKC A;  4KB3 A;  1AUC A;  4ECI A;  2LKU A;  4V2M A;  2J23 A;  4OD7 A;  3LG6 A;  1J9B A;  4FYC A;  3GX0 A;  1NSW A;  3WYW A;  5F05 A;  5DCH A;  4OO4 A;  4OWY A;  2VL9 A;  1XWK A;  4BVY A;  4MF6 A;  2R6K A;  2V1M A;  2YV7 A;  4K9Z A;  1U3I A;  3CBU A;  3TKQ A;  1BAY A;  3E3E A;  4MF7 A;  4N11 A;  5D73 A;  4IBP A;  4ID0 A;  2HLS A;  4DSR A;  4OMV A;  5G1K A;  4GWR A;  3P90 A;  2OE0 A;  1JHB A;  2H71 A;  3H4K A;  1XVQ A;  3ZLP A;  1XW9 A;  3ERW A;  2DJJ A;  3EU4 A;  1EWX A;  2XBI A;  3TCO A;  1M2D A;  5EL8 A;  1HQO A;  1FOV A;  3F6D A;  1Q98 A;  2OBI A;  3F8U A;  5DCG A;  1KTE A;  3DXB A;  2H8L A;  2N5A A;  4ZB8 A;  2VL2 C;  3I69 A;  11GS A;  1OC9 B;  4NHZ A;  3UBK A;  3UVH A;  5KEJ A;  3IV4 A;  2DSA A;  4ILF A;  4NMU A;  1GNW A;  5C04 A;  3MWH A;  4O5R A;  1MEK A;  1QUW A;  5GZZ B;  2MZC A;  2TIR A;  4PQ1 A;  3TKS C;  2C0D A;  4GSN A;  5J4U A;  1SJZ A;  3GFK A;  3QR6 A;  14GS A;  3FW2 A;  1K0M A;  4GLT A;  3GMF A;  2PER A;  1K0D A;  3EYT A;  2AJQ B;  2JAC A;  1Y6E A;  4JZQ A;  2QGV A;  4MPG A;  3UMA A;  2VM2 A;  3QAV A;  3VFI A;  4JR4 A;  6GST A;  5ABR A;  4AF2 A;  3F0I A;  5A5K A;  2YWI A;  3UAR A;  3NOF A;  2I3Y A;  5DAL B;  4IP1 A;  2EIQ A;  1K0B A;  5F06 A;  5D8I A;  3C1S A;  2CAQ A;  3IC4 A;  5EPF A;  1SYR A;  4N30 A;  4L0U A;  4F9Z A;  2KP2 A;  4BPY A;  1TK8 B;  1YF0 A;  2YOI A;  2VLV A;  2GTU A;  3D0Z A;  4F0C A;  3NZN A;  5IMZ A;  3P8W A;  4WKW A;  4OFN A;  2L5L A;  1HD2 A;  1FO5 A;  2HSN B;  3EMX A;  2FWF A;  5GST A;  2FD3 A;  4GCI A;  5IOW A;  5AN1 A;  3ZIT A;  2JU5 A;  1QMV A;  3KP9 A;  1XW6 A;  3ZVJ A;  2FLS A;  2ON7 A;  2VCX A;  5D96 A;  2LST A;  4XRA A;  3BCK A;  3FR6 A;  2AHE A;  1XOA A;  4ZBD A;  1FG4 A;  3CTF A;  1V40 A;  5F0G A;  2JZS A;  2LQO A;  4N10 A;  4ML6 A;  1OE7 A;  2WDU A;  4K1F A;  1MD4 A;  5KN1 A;  2R2J A;  6GSY A;  1GTB A;  3HZ4 A;  4HZ2 A;  1G6W A;  3VI7 A;  4OCF A;  2OKA A;  1TTZ A;  4IHU A;  1F2E A;  1IYH A;  3QOU A;  1IYI A;  2P0G A;  4L5L A;  3I43 A;  4HQS A;  1X0R A;  2DBC A;  3HVV A;  5HR0 A;  2VCZ A;  5DDL A;  3RHB A;  3A2W A;  2X8G A;  2C0E A;  1SL0 B;  5ELA A;  1NM3 A;  4L0W A;  1R7H A;  3ZIJ A;  4BWQ A;  2CAI A;  4PGT A;  4V1A p;  4BA7 A;  2AB6 A;  3GH9 A;  4IW9 A;  1X5C A;  1R26 A;  2L6C A;  5ECQ B;  5FHI A;  1YKA A;  3KMO A;  3D21 A;  1JZW A;  2CZ3 A;  2V6K A;  2WUL A;  2FWH A;  4N0Z A;  5JWO B;  3KCM A;  4MZC A;  3L9S A;  3TJF A;  4G0L A;  1TRV A;  4EDZ A;  5B8B A;  3Q6O A;  3G7J A;  2C0G A;  3TKS E;  3F9U A;  1OAZ A;  1X5E A;  3LWA A;  4J57 E;  3TGZ A;  3H93 A;  4HZ4 A;  1FB0 A;  4TOP A;  3RDW A;  2FUG 2;  1ZMA A;  3ZIV A;  2CVK A;  3C8E A;  1YEX A;  1HNA A;  1XWC A;  5LD0 A;  2M72 A;  4MP4 A;  4MJC A;  1AC1 A;  2KHP A;  2RLI A;  1YF1 A;  3DVW A;  4ISD A;  1F6M C;  1F37 A;  3DKS A;  5ECN B;  1V58 A;  4GTU A;  4K2D A;  3FR3 A;  4X1U A;  2H01 A;  1VF4 A;  5GAP D;  4XTS A;  3GN3 A;  3HJP A;  3VPT A;  3BCI A; 
#chains in the Genus database with same CATH topology
 6GSU A;  2YV9 A;  3QD9 A;  3UL3 A;  4MDC A;  3GKN A;  3ZFL A;  3Q19 A;  2DKH A;  2H75 A;  3L9U A;  3TRQ A;  5HQP A;  12GS A;  1AXD A;  3IHG A;  3D22 A;  1GP1 A;  4K5S A;  4ULX A;  2R4V A;  5B7C A;  4OFT A;  1SK2 A;  3LSZ A;  1GSS A;  5J41 A;  3KGK A;  4NV2 A;  1TDI A;  2B5E A;  5IMA A;  4YAP A;  3KH7 A;  2YZH A;  2QSI A;  3D5J A;  2XC2 A;  2LV3 A;  1ZCP A;  3RPP A;  4AKI A;  2GST A;  4MZW A;  4EIQ A;  4LMV A;  2H1B A;  2VUP A;  2HRF A;  2WRT A;  4TVE A;  3F63 A;  4W66 A;  1GH2 A;  4IJ3 A;  1GRX A;  4FQU A;  1GNE A;  4PUF C;  2LNS A;  4V1A g;  4MJE A;  3E0U A;  5AIV A;  3G7Y A;  3M9J A;  1TRW A;  1GSU A;  1EGO A;  1PGT A;  4EIP A;  1G6Y A;  5IPH A;  2YPM A;  4ZIJ A;  1H75 A;  5F07 A;  3GA4 A;  4AJ6 A;  1VF1 A;  3LOR A;  2ZCT A;  2LUS A;  4GF0 A;  3F6F A;  3JCM L;  1FAA A;  2VL3 A;  1N8J A;  1ZYP A;  4YAV A;  5ID2 B;  1WE0 A;  2L59 A;  1O8W A;  3N5O A;  2UZ8 A;  5D93 A;  1V9W A;  1OE8 A;  1SKS B;  1TU8 A;  1N25 A;  2YWM A;  4IQ1 A;  3IR4 A;  4YQU A;  4TKY A;  3QFA C;  4DSS B;  1U88 A;  4O32 A;  1FB6 A;  2MMO A;  4Q5Q A;  1RQM A;  1BX9 A;  2LQQ A;  3Q18 A;  4HJ2 A;  2RM5 A;  3DYR A;  4NWY A;  3WT2 A;  4Z2T A;  2OAD A;  3ME8 A;  1T00 A;  3GNJ A;  1QFN A;  2IFQ B;  5GSS A;  2G0F A;  2HSM B;  4QMK A;  1TXX A;  2GZP A;  4N0V A;  1SL2 B;  5DAK B;  4KGI A;  5G2Z A;  2VM1 A;  2AYT A;  2CT6 A;  2FGX A;  1YVL A;  1X5D A;  2XPD A;  2YWN A;  1K3Y A;  3ZFB A;  4WBJ A;  2HZE B;  1FVK A;  3UIW A;  3KXO A;  4CW9 A;  2HRN A;  22GS A;  5ECO B;  4WBR D;  4D73 B;  4G01 A;  1A0F A;  2P5Q A;  1TU7 A;  4TR1 A;  2VCQ A;  1WWJ A;  2O89 A;  2C3Q A;  2F51 A;  3CHX C;  5JCG A;  5DQY A;  1GUK A;  2DML A;  4Q5N A;  2H1L A;  2WCI A;  1WMJ A;  2IPA A;  1ST9 A;  1U3A A;  2HE3 A;  4HS1 A;  3PGT A;  4KCA A;  2CV4 A;  4TXO B;  4AI6 A;  1SKR B;  4XS4 B;  4CDO A;  3DWV A;  3BD2 A;  4O5Q A;  4MAB A;  2ALB A;  2WW3 A;  3GKM A;  3VPQ A;  4AJ7 A;  5H5Q A;  3RHC A;  1X9W B;  1MDI A;  1EP7 A;  2IWT A;  4QL7 A;  1VGL A;  3LFL A;  4LA1 A;  2XBQ A;  1PA3 A;  2TRX A;  4FIW A;  3GHA A;  5JCU A;  3TUE A;  3AY8 A;  3MNG A;  4KDU A;  3ERG A;  4BVY B;  1TK0 B;  3J7Y k;  4ZL9 A;  2V32 A;  4EKZ A;  4XS4 A;  3GL5 A;  2I9H A;  2V2G A;  3IOS A;  1OC3 A;  3RAZ A;  1PQN A;  4PI0 C;  1H4O A;  5KN0 A;  2VD1 A;  3D4T A;  1V98 A;  3TB2 A;  2A2P A;  3GX8 A;  5CAX A;  1RW1 A;  2LRN A;  4EE0 A;  1I9D A;  4ACS A;  3KP8 A;  2GSQ A;  3BJ5 A;  10GS A;  4IS0 A;  5IPG A;  4ZBA A;  5IMD A;  4XHM A;  5J40 A;  2TRC P;  3GUR A;  1OC8 A;  1TI1 A;  3KEB A;  4WET A;  5DJL A;  3ME7 A;  5J47 A;  2B7K A;  2CZ2 A;  2QKE A;  1ERU A;  1N2A A;  1GTU A;  2J9H A;  2O7K A;  2MMN A;  4ZIL A;  2WB9 A;  3PR8 A;  3GYK A;  1C72 A;  1AQW A;  5HR2 A;  1MDK A;  3HYP A;  1YZX A;  1AIU A;  1JZR A;  3LGC A;  3GUS A;  3CSI A;  4DEJ A;  2DLX A;  3C7M A;  3HVS A;  4O92 A;  2GQM A;  4RI7 A;  3IXR A;  3ZVJ D;  1B9Y C;  1BJX A;  4GST A;  8GSS A;  1TRU A;  2WS2 A;  1ILO A;  2ZNM A;  1X9M B;  1PD2 1;  3P2A A;  1XG8 A;  1TXU A;  2WFC A;  3WGD A;  4PI2 C;  4PXO A;  2HT9 A;  4V2L A;  5F8B A;  2GZY A;  3ZZX A;  2P5R A;  1DUG A;  5J9C A;  4JE1 A;  2IL3 A;  5J5N A;  4AKH A;  2M46 A;  2GDR A;  2PVO C;  1MD3 A;  4YQV A;  4XIH A;  2VLT A;  5C00 A;  1EEJ A;  5JWR B;  1GWC A;  5KOX A;  2CA8 A;  2HI7 A;  3APO A;  2VLU A;  5HR3 A;  2HNL A;  5A34 A;  2H1A A;  2EIO A;  4O5U A;  4ZL7 A;  3HZ8 A;  1WJK A;  3H79 A;  1T3B A;  2C4J A;  2B5X A;  1SVL A;  5E4W A;  4KX4 A;  4CY8 A;  2OA7 A;  3E9J B;  2GT5 A;  3TKP A;  3TU3 B;  1U6T A;  3F4T A;  4FYU A;  2X4A A;  3QFB C;  1M2A A;  5CNW A;  5HFK A;  1ZYE A;  3GRX A;  4AGS A;  1O6J A;  4G0I A;  4I97 A;  5BMU A;  1GSF A;  2H6X A;  2PGT A;  3TOU A;  2JL4 A;  3IDV A;  2VKZ G;  3GH6 A;  2KP1 A;  2AUV A;  1BYE A;  2PUK C;  2YZU A;  1BG5 A;  3UAP A;  2L57 A;  3QAG A;  2CQ9 A;  1R5P A;  3HVX A;  3DEX A;  4YQM A;  1UVZ A;  2FA8 A;  1EEM A;  2WW2 A;  2PWJ A;  3BBY A;  5EVO A;  4WF4 A;  1XWG A;  2QA1 A;  4K7N A;  2H74 A;  2KUC A;  2X8H A;  1YEP A;  4MK3 A;  5IQY A;  1I5G A;  3VWW A;  1PKW A;  2K9F A;  3KJY A;  2ES7 A;  3F4S A;  4BVX A;  1O7U A;  4QQ7 A;  4ML1 A;  3FK8 A;  3UOM A;  2VOC A;  4K7I A;  4MLY A;  3L0H A;  3GTU A;  1YQ1 A;  2H76 A;  3APQ A;  5J3R A;  1GUH A;  4BL7 A;  6GSV A;  3NIV A;  3FEU A;  2XPE A;  2LNT A;  1EV9 A;  2CX4 A;  3IBH A;  5DQS A;  2DIZ A;  1F9M A;  3LYK A;  1PRX A;  1SJI A;  2HQT A;  4HEA 2;  4PHZ C;  5DVB A;  2AV4 A;  3UEM A;  3MYD A;  1EZK A;  1YY7 A;  3IRA A;  2BTO T;  2IJY A;  18GS A;  1S3C A;  4O7H A;  2R3X A;  1EGR A;  3LXT A;  2O36 A;  4K0G A;  2HRK A;  3PH9 A;  4G19 A;  4ZB7 A;  1MTC A;  3ZYW A;  2YP6 A;  3EIN A;  1PX7 A;  4TR0 A;  2LTK A;  5CRD A;  4MF5 A;  1XZO A;  5CRE A;  1SL1 B;  3A2X A;  3FZ9 A;  3VI5 A;  3W6G A;  2EIR A;  2V6O A;  4WF5 A;  3FR9 A;  3CSJ A;  2R5G A;  4IEL A;  2KLX A;  2MYG A;  4GQC A;  4MCU A;  4FH8 A;  1TI3 A;  3QDN A;  1THX A;  3KH9 A;  4EVM A;  1MDJ A;  1B4P A;  4MH2 A;  2C80 A;  2GSS A;  2OAC A;  2I1U A;  2OJL A;  5J4Y A;  3RGB C;  2L6D A;  3CTG A;  1LBK A;  2NTO A;  1G0T A;  3QCP A;  1F3A A;  1S3R A;  3APS A;  4POK A;  2HXK A;  2H73 A;  2VCV A;  4F2I A;  5IO2 A;  2P31 A;  3FKF A;  4GXZ A;  1GTI A;  6GSW A;  3TJG A;  4PNF A;  2B6M A;  4G2E A;  1QQ2 A;  2GT6 A;  1XXU A;  1KNG A;  1LJR A;  3WD6 A;  2H66 A;  2PMT A;  1PFO A;  3CRU A;  3GV1 A;  3EUR A;  1TK5 B;  4HI7 A;  1T1V A;  5FWG A;  3V1W A;  4PQH A;  1XVW A;  2WVX A;  2YAN A;  1FHE A;  2K8V A;  5A4V A;  4EC0 A;  5D9V A;  3TJJ A;  13GS A;  1SD9 A;  5B8A A;  1THO A;  4GSS A;  3DVX A;  3GST A;  3ZL5 A;  1PN0 A;  2CX3 A;  3O6T A;  5KOW A;  4V2N A;  2I81 A;  1UN2 A;  1ACV A;  4KW6 A;  2IN3 A;  3W8J A;  5HFG A;  2H0H A;  3TRP A;  4ZXG A;  3M1G A;  5G5F A;  1Z7P A;  3U5R E;  3MDK A;  1M99 A;  2OBK A;  2L4Q A;  5B6N A;  1OVN A;  3FY7 A;  1UA5 A;  2B3S A;  1BQ7 A;  2WVY A;  2UV8 G;  3ZRD A;  1XIY A;  2M80 A;  2E0Q A;  5B6M A;  4HOJ A;  4E8H A;  17GS A;  2HZF A;  3L4N A;  5ECP B;  1B48 A;  2K8S A;  2VCT A;  2I4A A;  2JSZ A;  2WZS A;  1SYX A;  2H1G A;  2A2S A;  2A2R A;  9GSS A;  2R0P A;  1JZO A;  1TRS A;  4ECC A;  2IMF A;  4KA0 A;  5EY6 A;  4PNG A;  1WPI A;  4IVF A;  3I9V 2;  5HFI A;  5IMF A;  4Z2U A;  3KTB A;  2MBT A;  2GLR A;  3KIJ A;  6GSS A;  5D9W A;  1GUL A;  6GSX A;  1BED A;  3GSS A;  1JLV A;  1Z6M A;  3EVI A;  1EOH A;  3RFR C;  2H72 A;  1ZZY A;  4ZB6 A;  1A23 A;  1SK0 A;  2GVP A;  4F03 A;  4TR1 B;  1CQH A;  1FOH A;  1SK1 A;  4KND A;  1URM A;  3WT1 A;  4NXI A;  3IC8 A;  1O81 A;  4IGJ A;  1GSD A;  2LS5 A;  5GAN D;  4KSO A;  2JZR A;  4WR5 A;  2REM A;  5IO0 A;  1I1I P;  2IMK A;  1M0U A;  4G9H A;  4TR3 A;  2VAF A;  3EMP A;  4K7O A;  3VWX A;  1USB A;  2MMA A;  3A5W A;  1A24 A;  2H1D A;  3H8Q A;  1XWB A;  2NBS A;  3WGX A;  5CRG A;  1ZL9 A;  3M9K A;  4I2U A;  2KOK A;  2E2M A;  3HA9 A;  2FY6 A;  2WJU A;  3IAM 2;  2X49 A;  4ZB9 A;  1S3D A;  3M3M A;  5IM9 A;  2F8F A;  2DJK A;  5KN3 A;  2YWO A;  3QPM A;  3TKR A;  1JFU A;  2LRT A;  1AQV A;  2E2G A;  19GS A;  2L5O A;  2DJ2 A;  1PKZ A;  4TW5 A;  3F4R A;  3FRC A;  1M2B A;  4POM A;  2LJR A;  1YEW C;  3VLN A;  3QAW A;  2R37 A;  2PPT A;  3IPZ A;  1GSE A;  3FZ4 A;  3UVT A;  3LEF A;  1K0A A;  5LNK e;  1JZD A;  2CVB A;  1PN9 A;  4G0K A;  4ECJ A;  1G7O A;  2VD0 A;  1B8X A;  4XS1 A;  4ZL8 A;  3EC3 A;  2IME A;  3TRX A;  4I6X A;  3P7X A;  1VRS D;  4WR4 A;  3VWV A;  1EV4 A;  1AQX A;  3GIX A;  3MSZ A;  2R0G A;  3DD3 A;  5H5S A;  3TDG A;  1ZGN A;  2F8A A;  3HCZ A;  4EUY A;  3BOA A;  4MA9 A;  4LLR A;  2GS3 A;  2O85 A;  3CYN A;  4KCE A;  2CVD A;  2HSY A;  1AW9 A;  2F3M A;  5A1N A;  1TKD B;  1PSQ A;  4H86 A;  2LEG A;  1M3I A;  2C3T A;  2B7J A;  4I8B A;  1UC7 A;  2LJK A;  2DMM A;  1FVJ A;  3KZQ A;  1XCC A;  4TR4 A;  4L5O A;  3LJR A;  4TN8 A;  3FYG A;  3UJ1 A;  3ZRE A;  1XPV A;  3IE3 A;  2MBS A;  5A34 B;  3IK9 A;  1ERW A;  2DIY A;  1V2A A;  1Z3E A;  2OE3 A;  2YN1 A;  1K3L A;  2FWE A;  1X9S B;  4WEY A;  4OFM A;  1A8Y A;  1ML6 A;  2HSH A;  3M0F A;  2N5B A;  1Y1U A;  2VIM A;  1HNB A;  5A5H A;  2B5Y A;  1ERV A;  3LXZ A;  1OKT A;  1ERT A;  1HYU A;  5BMU B;  1OYJ A;  1WOU A;  5ENU A;  4HQZ A;  2OE1 A;  2WW0 A;  3M8N A;  3ZML A;  1M9B A;  3SWL A;  3FZ5 A;  4WXT A;  1TP9 A;  1PL2 A;  3WGE A;  1GL8 A;  4K0N A;  1KEB A;  2NDO A;  4NHW A;  1T4Z A;  1A2M A;  2BJX A;  5ECS A;  1U87 A;  4KE3 A;  1EP8 A;  2WZ9 A;  5D9X A;  3PPU A;  2YJ7 A;  4PX1 A;  1RK4 A;  5BRT A;  4HDE A;  3I6A A;  3O3T A;  1DE1 A;  4IP6 A;  4HJM A;  2VCW A;  5AGY A;  20GS A;  4G10 A;  1ABA A;  4Q5R A;  4QL9 A;  3LYP A;  2RM6 A;  2ZUP A;  4K8M A;  1OKD A;  2X8C A;  5IIZ A;  1XWA A;  3KM6 A;  1AAZ A;  4JED A;  3DRN A;  4TRX A;  2FCH A;  5G31 A;  5JWQ B;  3VWU A;  4BVX B;  2GGT A;  3F3Q A;  4XRD A;  5IMV A;  5IOX A;  1O85 A;  1OC9 A;  3HJO A;  4GQF A;  2EC4 A;  2H30 A;  1GLP A;  4KAE A;  4MH3 A;  3GTU B;  1Y25 A;  3KD0 A;  1W89 A;  2MMZ A;  4BL7 B;  1Z7R A;  5CRH A;  3ZTL A;  2YCD A;  4TXV A;  2PBJ A;  3CWG A;  4RQX A;  1TOF A;  5ECK B;  4GRF A;  1XFL A;  4EF0 A;  3TJK A;  5COH A;  2C1Y A;  2WGR A;  5J9B A;  2YJH A;  5DAL A;  5AIX A;  4JU5 A;  3F3R A;  2XHF A;  2IMD A;  5CYY A;  3EE2 A;  1K0O A;  2HRK B;  4PUR A;  2WW1 A;  2FA4 A;  4J2F A;  5ECM B;  4MJA A;  1M7T A;  2C3N A;  2C8U A;  4IQA A;  2FWG A;  1EOG A;  3TOT A;  1F3B A;  3HKR A;  2LJA A;  3US3 A;  4F0B A;  1S3A A;  2HSN A;  3VK9 A;  2JAD A;  4POB A;  4X0X A;  4EDY A;  2F9S A;  1J08 A;  4DSQ A;  2H6Z A;  1NW2 A;  16GS A;  2DC5 A;  2NPB A;  4MPF A;  3LW9 A;  3H1N A;  3O76 A;  2H19 A;  1QGV A;  1M3J A;  1K0C A;  5LCZ A;  1A2L A;  3HD5 A;  4LMW A;  3G7I A;  2R0C A;  1PX6 A;  4BWS A;  1GLQ A;  1JLW A;  5H5R A;  3C1R A;  2QC7 A;  4OO5 A;  2FHE A;  3GKK A;  4AKG A;  1NHY A;  2H0I A;  2X99 A;  3FHK A;  3L78 A;  4KDX A;  1J0F A;  1LU4 A;  4XCS A;  3KTL A;  1A0R P;  1T7P B;  4EXJ A;  3RPN A;  3EWL A;  3ZMK A;  1Z6N A;  3J7Y b;  1R5A A;  1NHO A;  2WVX B;  2DJ3 A;  5D9T A;  4Q5F A;  2C0F A;  4JRR A;  4BIK A;  1SJ6 A;  4X4J A;  2V41 A;  1DE2 A;  2JSY A;  3VUR A;  4RI6 A;  4FYB A;  2JZT A;  2FNO A;  4CY6 A;  2O87 A;  4DVC A;  1XBS A;  4K5R A;  2O8V B;  1SU9 A;  1XOB A;  5INY A;  3LQ7 A;  2GQK A;  4J56 E;  3K8N A;  3HDC A;  3GL3 A;  4GDF A;  1GUM A;  3A5I A;  5E59 A;  2H6Y A;  3L9V A;  3FMW A;  2RUF A;  5L71 A;  3N9J A;  3DIE A;  4IKH A;  2DJ0 A;  3CMI A;  4KUN A;  5CRW A;  4RUV A;  5HR1 A;  1VF2 A;  3CRT A;  4USS A;  1BG1 A;  1B9X C;  2NVL A;  1W4V A;  4IJI A;  4ECB A;  5ECL B;  2L4C A;  3A2V A;  1TW9 A;  1K0N A;  1VF3 A;  4F82 A;  1ZYQ B;  1SD8 A;  4LL4 B;  4KDY A;  4X43 A;  1S4B P;  1O73 A;  2IIY A;  2VO4 A;  1K3O A;  3D6I A;  3W8S A;  4EO3 A;  3CXG A;  2ON5 A;  4NV5 A;  1CQG A;  2GZZ A;  2N5F A;  3MIX A;  3S9F A;  5A4U A;  1SEN A;  3A3T A;  5ECI B;  2PN8 A;  3D4M A;  2D2Z A;  1R4W A;  1BF5 A;  2LRC A;  3HMJ G;  1YJ6 A;  1WRY A;  1T4Y A;  2VL2 A;  3C73 A;  4PTS A;  4I5Q A;  5FT3 A;  3IA1 A;  2H70 A;  2RII A;  3U6V A;  3HHV A;  3G9B A;  4KH7 A;  5ECH B;  5ECR B;  3TKS A;  1PL1 A;  3UBL A;  1E6B A;  4LL1 B;  3TJB A;  5KN2 A;  2BMX A;  1DBY A;  2B1L A;  5CO3 A;  1O8X A;  1M9A A;  4ICY A;  1Z9H A;  2H0G A;  3HY2 A;  3OR5 A;  2HRA A;  3QMX A;  4FXY P;  1SKW B;  4JBB A;  4YKF A;  4E8E A;  4AJ8 A;  3DML A;  1KBN A;  4KF9 A;  1QXH A;  4K6X A;  1A2J A;  4NPB A;  1B4Q A;  4MNN A;  4JR6 A;  4MJB A;  2K18 A;  3EU3 A;  4P3Y B;  3DGQ A;  1HNC A;  3HJM A;  3EPT A;  1V57 A;  2B1K A;  3MAK A;  2GQL A;  1G7E A;  3HVN A;  4HU9 A;  4XS6 A;  5ID2 A;  3RBT A;  1PMT A;  2X64 A;  4PUA A;  1A8L A;  4ZBB A;  3R2Q A;  2HFD A;  1YDK A;  1WP0 A;  3C71 A;  3HXS A;  3R3E A;  4HUA A;  5CP1 A;  2IMI A;  1GTA A;  4DSS A;  3Q74 A;  1WIK A;  4CHS A;  3PIN A;  3IAS 2;  5G1L A;  5JCW A;  1GSQ A;  2GSR A;  3CSH A;  4MZB A;  4EL1 A;  2EFE A;  3IHQ A;  1ON4 A;  2A4V A;  2IFQ A;  3FZA A;  3GKX A;  2PU9 C;  5ELG A;  1SVM A;  2HSM A;  5DAK A;  4Z2R A;  4HU7 A;  2EFH A;  4MMM A;  4NAX A;  2E7P A;  2AAW A;  5IMC A;  4POL A;  4I2T A;  1GSY A;  1Q4J A;  4RQR A;  4Z7X A;  4IN0 A;  1QK8 A;  2HZE A;  2K6V A;  1XW5 A;  1ZOF A;  4YH2 A;  2PVQ A;  4OCE A;  5G30 A;  5G5E A;  1DSB A;  2DKI A;  4D73 A;  1FW1 A;  1T8E B;  1TJD A;  1E2Y A;  5A1N B;  2DJ1 A;  3SBC A;  3ERF A;  2HYX A;  3ISO A;  3IK7 A;  4KSM A;  4PQI A;  7GSS A;  1Z5Y E;  2A4H A;  3KMN A;  5AIS A;  5A4W A;  4FO5 A;  2Z9S A;  2YNX A;  2RUE A;  2G2Q A;  4L8E A;  5DBQ A;  4TXO A;  3ED3 A;  5DJM A;  1YKC A;  4KB3 A;  1AUC A;  4ECI A;  2LKU A;  4V2M A;  2J23 A;  4OD7 A;  3LG6 A;  1J9B A;  4FYC A;  3GX0 A;  1NSW A;  3WYW A;  5F05 A;  5DCH A;  4OO4 A;  4OWY A;  2VL9 A;  1XWK A;  4BVY A;  4MF6 A;  2R6K A;  5A5H B;  2V1M A;  2YV7 A;  4K9Z A;  1U3I A;  3CBU A;  3TKQ A;  4E68 A;  1BAY A;  3E3E A;  4MF7 A;  4N11 A;  5D73 A;  4IBP A;  4ID0 A;  5J4V A;  2HLS A;  2O3E A;  4DSR A;  4N3Z A;  4OMV A;  5G1K A;  4GWR A;  3P90 A;  2OE0 A;  1JHB A;  2H71 A;  4AKX B;  3H4K A;  2WVZ A;  1XVQ A;  3ZLP A;  1XW9 A;  3ERW A;  2DJJ A;  3EU4 A;  1EWX A;  2XBI A;  3TCO A;  1M2D A;  5EL8 A;  1HQO A;  1FOV A;  3F6D A;  1Q98 A;  2OBI A;  3F8U A;  5DCG A;  1KTE A;  3DXB A;  2H8L A;  2N5A A;  4ZB8 A;  2VL2 C;  3I69 A;  11GS A;  1OC9 B;  4NHZ A;  3UBK A;  3UVH A;  5KEJ A;  3IV4 A;  2DSA A;  4ILF A;  4NMU A;  1GNW A;  5C04 A;  3MWH A;  4O5R A;  1MEK A;  1QUW A;  5GZZ B;  2MZC A;  2TIR A;  4PQ1 A;  3TKS C;  2C0D A;  4GSN A;  5J4U A;  1SJZ A;  3GFK A;  3QR6 A;  14GS A;  3FW2 A;  2QA2 A;  1K0M A;  4GLT A;  3GMF A;  2PER A;  1K0D A;  3EYT A;  2AJQ B;  2JAC A;  1Y6E A;  4JZQ A;  2QGV A;  4MPG A;  3UMA A;  2VM2 A;  3QAV A;  3VFI A;  4JR4 A;  1SVO A;  6GST A;  5ABR A;  4HSC X;  4AF2 A;  3F0I A;  5A5K A;  2YWI A;  3UAR A;  3NOF A;  2I3Y A;  5DAL B;  4IP1 A;  2EIQ A;  1K0B A;  5F06 A;  5D8I A;  3C1S A;  2CAQ A;  3IC4 A;  5EPF A;  1SYR A;  4N30 A;  4L0U A;  4F9Z A;  2KP2 A;  4BPY A;  1TK8 B;  1YF0 A;  2YOI A;  2VLV A;  2GTU A;  3D0Z A;  4F0C A;  3NZN A;  5IMZ A;  3P8W A;  4WKW A;  4OFN A;  2L5L A;  1HD2 A;  1FO5 A;  2HSN B;  2EFC A;  3EMX A;  2FWF A;  5GST A;  2FD3 A;  4GCI A;  5IOW A;  5AN1 A;  3ZIT A;  2JU5 A;  1QMV A;  3KP9 A;  1XW6 A;  3ZVJ A;  2FLS A;  2ON7 A;  2VCX A;  5D96 A;  2LST A;  4XRA A;  3BCK A;  3FR6 A;  2AHE A;  1ZYN A;  1XOA A;  4ZBD A;  1FG4 A;  3CTF A;  1V40 A;  2OT3 A;  5F0G A;  2JZS A;  2LQO A;  4N10 A;  4ML6 A;  1OE7 A;  2WDU A;  4K1F A;  1MD4 A;  5KN1 A;  2R2J A;  6GSY A;  1GTB A;  3HZ4 A;  4HZ2 A;  1G6W A;  3VI7 A;  4OCF A;  2OKA A;  1TTZ A;  4IHU A;  1F2E A;  1IYH A;  3QOU A;  1IYI A;  2P0G A;  4L5L A;  3I43 A;  4HQS A;  1X0R A;  2DBC A;  2O5V A;  3HVV A;  5HR0 A;  2VCZ A;  5DDL A;  3RHB A;  3A2W A;  2X8G A;  2C0E A;  1SL0 B;  5ELA A;  1NM3 A;  4L0W A;  1R7H A;  3ZIJ A;  4BWQ A;  2CAI A;  4PGT A;  4V1A p;  4BA7 A;  2AB6 A;  3GH9 A;  1X5C A;  4IW9 A;  1R26 A;  2L6C A;  5ECQ B;  5FHI A;  1YKA A;  3KMO A;  3D21 A;  1JZW A;  2CZ3 A;  2V6K A;  2WUL A;  2FWH A;  4N0Z A;  5JWO B;  3KCM A;  4MZC A;  3L9S A;  3TJF A;  4G0L A;  1TRV A;  4EDZ A;  5B8B A;  3Q6O A;  3G7J A;  2C0G A;  3TKS E;  3F9U A;  1OAZ A;  1X5E A;  3LWA A;  4J57 E;  3TGZ A;  3H93 A;  4HZ4 A;  1FB0 A;  4TOP A;  3RDW A;  2FUG 2;  1ZMA A;  3ZIV A;  2CVK A;  3C8E A;  1YEX A;  1HNA A;  2EFD A;  1XWC A;  5LD0 A;  2M72 A;  4MP4 A;  4MJC A;  1AC1 A;  2KHP A;  2RLI A;  1YF1 A;  3DVW A;  4ISD A;  4K2X A;  1F6M C;  3CQF A;  1F37 A;  3DKS A;  5ECN B;  1V58 A;  4GTU A;  4K2D A;  3FR3 A;  4YKG A;  4X1U A;  2H01 A;  1VF4 A;  4A5P A;  4XTS A;  5GAP D;  3GN3 A;  3HJP A;  3VPT A;  3BCI A; 
#chains in the Genus database with same CATH homology
 6GSU A;  2YV9 A;  3QD9 A;  3UL3 A;  4MDC A;  3GKN A;  3ZFL A;  3Q19 A;  2DKH A;  2H75 A;  3L9U A;  3TRQ A;  5HQP A;  12GS A;  1AXD A;  3IHG A;  3D22 A;  1GP1 A;  4K5S A;  4ULX A;  2R4V A;  5B7C A;  4OFT A;  1SK2 A;  3LSZ A;  1GSS A;  5J41 A;  3KGK A;  4NV2 A;  1TDI A;  2B5E A;  5IMA A;  4YAP A;  3KH7 A;  2YZH A;  2QSI A;  3D5J A;  2XC2 A;  2LV3 A;  1ZCP A;  3RPP A;  4AKI A;  2GST A;  4MZW A;  4EIQ A;  4LMV A;  2H1B A;  2VUP A;  2HRF A;  2WRT A;  4TVE A;  3F63 A;  4W66 A;  1GH2 A;  4IJ3 A;  1GRX A;  4FQU A;  1GNE A;  4PUF C;  2LNS A;  4V1A g;  4MJE A;  3E0U A;  5AIV A;  3G7Y A;  3M9J A;  1TRW A;  1GSU A;  1EGO A;  1PGT A;  4EIP A;  1G6Y A;  5IPH A;  2YPM A;  4ZIJ A;  1H75 A;  5F07 A;  3GA4 A;  4AJ6 A;  1VF1 A;  3LOR A;  2ZCT A;  2LUS A;  4GF0 A;  3F6F A;  3JCM L;  1FAA A;  2VL3 A;  1N8J A;  1ZYP A;  4YAV A;  5ID2 B;  1WE0 A;  2L59 A;  1O8W A;  3N5O A;  2UZ8 A;  5D93 A;  1V9W A;  1OE8 A;  1SKS B;  1TU8 A;  1N25 A;  2YWM A;  4IQ1 A;  3IR4 A;  4YQU A;  4TKY A;  3QFA C;  4DSS B;  1U88 A;  4O32 A;  1FB6 A;  2MMO A;  4Q5Q A;  1RQM A;  1BX9 A;  2LQQ A;  3Q18 A;  4HJ2 A;  2RM5 A;  3DYR A;  4NWY A;  3WT2 A;  4Z2T A;  2OAD A;  3ME8 A;  1T00 A;  3GNJ A;  1QFN A;  2IFQ B;  5GSS A;  2G0F A;  2HSM B;  4QMK A;  1TXX A;  2GZP A;  4N0V A;  1SL2 B;  5DAK B;  4KGI A;  5G2Z A;  2VM1 A;  2AYT A;  2CT6 A;  2FGX A;  1YVL A;  1X5D A;  2XPD A;  2YWN A;  1K3Y A;  3ZFB A;  4WBJ A;  2HZE B;  1FVK A;  3UIW A;  3KXO A;  4CW9 A;  2HRN A;  22GS A;  5ECO B;  4WBR D;  4D73 B;  4G01 A;  1A0F A;  2P5Q A;  1TU7 A;  4TR1 A;  2VCQ A;  1WWJ A;  2O89 A;  2C3Q A;  2F51 A;  5JCG A;  5DQY A;  1GUK A;  2DML A;  4Q5N A;  2H1L A;  2WCI A;  1WMJ A;  2IPA A;  1ST9 A;  1U3A A;  2HE3 A;  4HS1 A;  3PGT A;  4KCA A;  2CV4 A;  4TXO B;  4AI6 A;  1SKR B;  4XS4 B;  4CDO A;  3DWV A;  3BD2 A;  4O5Q A;  4MAB A;  2ALB A;  3GKM A;  3VPQ A;  4AJ7 A;  5H5Q A;  3RHC A;  1X9W B;  1MDI A;  1EP7 A;  2IWT A;  4QL7 A;  1VGL A;  3LFL A;  4LA1 A;  2XBQ A;  1PA3 A;  2TRX A;  4FIW A;  3GHA A;  5JCU A;  3TUE A;  3AY8 A;  3MNG A;  4KDU A;  3ERG A;  4BVY B;  1TK0 B;  3J7Y k;  4ZL9 A;  2V32 A;  4EKZ A;  4XS4 A;  3GL5 A;  2I9H A;  2V2G A;  3IOS A;  1OC3 A;  3RAZ A;  1PQN A;  1H4O A;  5KN0 A;  2VD1 A;  3D4T A;  1V98 A;  3TB2 A;  2A2P A;  3GX8 A;  5CAX A;  1RW1 A;  2LRN A;  4EE0 A;  1I9D A;  4ACS A;  3KP8 A;  2GSQ A;  3BJ5 A;  10GS A;  4IS0 A;  5IPG A;  4ZBA A;  5IMD A;  4XHM A;  5J40 A;  2TRC P;  3GUR A;  1OC8 A;  1TI1 A;  3KEB A;  4WET A;  5DJL A;  3ME7 A;  5J47 A;  2B7K A;  2CZ2 A;  2QKE A;  1ERU A;  1N2A A;  1GTU A;  2J9H A;  2O7K A;  2MMN A;  4ZIL A;  2WB9 A;  3PR8 A;  3GYK A;  1C72 A;  1AQW A;  5HR2 A;  1MDK A;  3HYP A;  1YZX A;  1AIU A;  1JZR A;  3LGC A;  3GUS A;  3CSI A;  4DEJ A;  2DLX A;  3C7M A;  3HVS A;  4O92 A;  2GQM A;  4RI7 A;  3IXR A;  3ZVJ D;  1B9Y C;  1BJX A;  4GST A;  8GSS A;  1TRU A;  2WS2 A;  1ILO A;  2ZNM A;  1X9M B;  1PD2 1;  3P2A A;  1TXU A;  2WFC A;  3WGD A;  4PXO A;  2HT9 A;  4V2L A;  5F8B A;  2GZY A;  3ZZX A;  2P5R A;  1DUG A;  5J9C A;  4JE1 A;  2IL3 A;  5J5N A;  4AKH A;  2M46 A;  2GDR A;  2PVO C;  1MD3 A;  4YQV A;  4XIH A;  2VLT A;  5C00 A;  1EEJ A;  5JWR B;  1GWC A;  5KOX A;  2CA8 A;  2HI7 A;  3APO A;  2VLU A;  5HR3 A;  2HNL A;  5A34 A;  2H1A A;  2EIO A;  4O5U A;  4ZL7 A;  3HZ8 A;  1WJK A;  3H79 A;  1T3B A;  2C4J A;  2B5X A;  1SVL A;  5E4W A;  4KX4 A;  4CY8 A;  2OA7 A;  3E9J B;  2GT5 A;  3TKP A;  3TU3 B;  1U6T A;  3F4T A;  4FYU A;  2X4A A;  3QFB C;  1M2A A;  5CNW A;  5HFK A;  1ZYE A;  3GRX A;  4AGS A;  1O6J A;  4G0I A;  4I97 A;  5BMU A;  1GSF A;  2H6X A;  2PGT A;  3TOU A;  2JL4 A;  3IDV A;  2VKZ G;  3GH6 A;  2KP1 A;  2AUV A;  1BYE A;  2PUK C;  2YZU A;  1BG5 A;  3UAP A;  2L57 A;  3QAG A;  2CQ9 A;  1R5P A;  3HVX A;  3DEX A;  4YQM A;  1UVZ A;  2FA8 A;  1EEM A;  2PWJ A;  3BBY A;  5EVO A;  4WF4 A;  1XWG A;  2QA1 A;  4K7N A;  2H74 A;  2KUC A;  2X8H A;  1YEP A;  4MK3 A;  5IQY A;  1I5G A;  3VWW A;  1PKW A;  2K9F A;  3KJY A;  2ES7 A;  3F4S A;  4BVX A;  1O7U A;  4QQ7 A;  4ML1 A;  3FK8 A;  3UOM A;  2VOC A;  4K7I A;  4MLY A;  3L0H A;  3GTU A;  1YQ1 A;  2H76 A;  3APQ A;  5J3R A;  1GUH A;  4BL7 A;  6GSV A;  3NIV A;  3FEU A;  2XPE A;  2LNT A;  1EV9 A;  2CX4 A;  3IBH A;  5DQS A;  2DIZ A;  1F9M A;  3LYK A;  1PRX A;  1SJI A;  2HQT A;  4HEA 2;  5DVB A;  2AV4 A;  3UEM A;  3MYD A;  1EZK A;  1YY7 A;  3IRA A;  2BTO T;  2IJY A;  18GS A;  1S3C A;  4O7H A;  2R3X A;  1EGR A;  3LXT A;  4K0G A;  2HRK A;  3PH9 A;  4G19 A;  4ZB7 A;  1MTC A;  3ZYW A;  2YP6 A;  3EIN A;  1PX7 A;  4TR0 A;  2LTK A;  5CRD A;  4MF5 A;  1XZO A;  5CRE A;  1SL1 B;  3A2X A;  3FZ9 A;  3VI5 A;  3W6G A;  2EIR A;  2V6O A;  4WF5 A;  3FR9 A;  3CSJ A;  2R5G A;  4IEL A;  2KLX A;  2MYG A;  4GQC A;  4MCU A;  4FH8 A;  1TI3 A;  3QDN A;  1THX A;  3KH9 A;  4EVM A;  1MDJ A;  1B4P A;  4MH2 A;  2C80 A;  2GSS A;  2OAC A;  2I1U A;  2OJL A;  5J4Y A;  2L6D A;  3CTG A;  1LBK A;  2NTO A;  1G0T A;  3QCP A;  1F3A A;  3APS A;  4POK A;  2HXK A;  2H73 A;  2VCV A;  4F2I A;  5IO2 A;  2P31 A;  3FKF A;  4GXZ A;  1GTI A;  6GSW A;  3TJG A;  4PNF A;  2B6M A;  4G2E A;  1QQ2 A;  2GT6 A;  1XXU A;  1KNG A;  1LJR A;  3WD6 A;  2H66 A;  2PMT A;  3CRU A;  3GV1 A;  3EUR A;  1TK5 B;  4HI7 A;  1T1V A;  5FWG A;  3V1W A;  4PQH A;  1XVW A;  2YAN A;  1FHE A;  2K8V A;  5A4V A;  4EC0 A;  5D9V A;  3TJJ A;  13GS A;  1SD9 A;  5B8A A;  1THO A;  4GSS A;  3DVX A;  3GST A;  3ZL5 A;  1PN0 A;  2CX3 A;  3O6T A;  5KOW A;  4V2N A;  2I81 A;  1UN2 A;  1ACV A;  4KW6 A;  2IN3 A;  3W8J A;  5HFG A;  2H0H A;  3TRP A;  4ZXG A;  3M1G A;  5G5F A;  1Z7P A;  3U5R E;  3MDK A;  1M99 A;  2OBK A;  2L4Q A;  5B6N A;  1OVN A;  3FY7 A;  1UA5 A;  2B3S A;  1BQ7 A;  2UV8 G;  3ZRD A;  1XIY A;  2M80 A;  2E0Q A;  5B6M A;  4HOJ A;  4E8H A;  17GS A;  2HZF A;  3L4N A;  5ECP B;  1B48 A;  2K8S A;  2VCT A;  2I4A A;  2JSZ A;  1SYX A;  2H1G A;  2A2S A;  2A2R A;  9GSS A;  2R0P A;  1JZO A;  1TRS A;  4ECC A;  2IMF A;  4KA0 A;  5EY6 A;  4PNG A;  1WPI A;  4IVF A;  3I9V 2;  5HFI A;  5IMF A;  4Z2U A;  3KTB A;  2MBT A;  2GLR A;  3KIJ A;  6GSS A;  5D9W A;  1GUL A;  6GSX A;  1BED A;  3GSS A;  1JLV A;  1Z6M A;  3EVI A;  1EOH A;  2H72 A;  1ZZY A;  4ZB6 A;  1A23 A;  1SK0 A;  2GVP A;  4F03 A;  4TR1 B;  1CQH A;  1FOH A;  1SK1 A;  4KND A;  1URM A;  3WT1 A;  4NXI A;  3IC8 A;  1O81 A;  4IGJ A;  1GSD A;  2LS5 A;  5GAN D;  4KSO A;  2JZR A;  4WR5 A;  2REM A;  5IO0 A;  2IMK A;  1M0U A;  4G9H A;  4TR3 A;  2VAF A;  3EMP A;  4K7O A;  3VWX A;  1USB A;  2MMA A;  3A5W A;  1A24 A;  2H1D A;  3H8Q A;  1XWB A;  2NBS A;  3WGX A;  5CRG A;  1ZL9 A;  3M9K A;  4I2U A;  2KOK A;  2E2M A;  3HA9 A;  2FY6 A;  2WJU A;  3IAM 2;  2X49 A;  4ZB9 A;  1S3D A;  3M3M A;  5IM9 A;  2F8F A;  2DJK A;  5KN3 A;  2YWO A;  3QPM A;  3TKR A;  1JFU A;  2LRT A;  1AQV A;  2E2G A;  19GS A;  2L5O A;  2DJ2 A;  1PKZ A;  4TW5 A;  3F4R A;  3FRC A;  1M2B A;  4POM A;  2LJR A;  3VLN A;  3QAW A;  2R37 A;  2PPT A;  3IPZ A;  1GSE A;  3FZ4 A;  3UVT A;  3LEF A;  1K0A A;  5LNK e;  1JZD A;  2CVB A;  1PN9 A;  4G0K A;  4ECJ A;  1G7O A;  2VD0 A;  1B8X A;  4XS1 A;  4ZL8 A;  3EC3 A;  2IME A;  3TRX A;  4I6X A;  3P7X A;  1VRS D;  4WR4 A;  3VWV A;  1EV4 A;  1AQX A;  3GIX A;  3MSZ A;  2R0G A;  3DD3 A;  5H5S A;  3TDG A;  1ZGN A;  2F8A A;  3HCZ A;  4EUY A;  3BOA A;  4MA9 A;  4LLR A;  2GS3 A;  2O85 A;  3CYN A;  4KCE A;  2CVD A;  2HSY A;  1AW9 A;  2F3M A;  5A1N A;  1TKD B;  1PSQ A;  4H86 A;  2LEG A;  2C3T A;  2B7J A;  4I8B A;  1UC7 A;  2LJK A;  2DMM A;  1FVJ A;  3KZQ A;  1XCC A;  4TR4 A;  4L5O A;  3LJR A;  4TN8 A;  3FYG A;  3UJ1 A;  3ZRE A;  1XPV A;  3IE3 A;  2MBS A;  5A34 B;  3IK9 A;  1ERW A;  2DIY A;  1V2A A;  1Z3E A;  2OE3 A;  2YN1 A;  1K3L A;  2FWE A;  1X9S B;  4WEY A;  4OFM A;  1A8Y A;  1ML6 A;  2HSH A;  3M0F A;  2N5B A;  1Y1U A;  2VIM A;  1HNB A;  5A5H A;  2B5Y A;  1ERV A;  3LXZ A;  1OKT A;  1ERT A;  1HYU A;  5BMU B;  1OYJ A;  1WOU A;  5ENU A;  4HQZ A;  2OE1 A;  3M8N A;  3ZML A;  1M9B A;  3SWL A;  3FZ5 A;  4WXT A;  1TP9 A;  1PL2 A;  3WGE A;  1GL8 A;  4K0N A;  1KEB A;  2NDO A;  4NHW A;  1T4Z A;  1A2M A;  2BJX A;  5ECS A;  1U87 A;  4KE3 A;  1EP8 A;  2WZ9 A;  5D9X A;  3PPU A;  2YJ7 A;  4PX1 A;  1RK4 A;  5BRT A;  4HDE A;  3I6A A;  3O3T A;  1DE1 A;  4IP6 A;  4HJM A;  2VCW A;  5AGY A;  20GS A;  4G10 A;  1ABA A;  4Q5R A;  4QL9 A;  3LYP A;  2RM6 A;  2ZUP A;  4K8M A;  1OKD A;  2X8C A;  5IIZ A;  1XWA A;  3KM6 A;  1AAZ A;  4JED A;  3DRN A;  4TRX A;  2FCH A;  5G31 A;  5JWQ B;  3VWU A;  4BVX B;  2GGT A;  3F3Q A;  4XRD A;  5IMV A;  5IOX A;  1O85 A;  1OC9 A;  3HJO A;  4GQF A;  2EC4 A;  2H30 A;  1GLP A;  4KAE A;  4MH3 A;  3GTU B;  1Y25 A;  3KD0 A;  1W89 A;  2MMZ A;  4BL7 B;  1Z7R A;  5CRH A;  3ZTL A;  2YCD A;  4TXV A;  2PBJ A;  3CWG A;  4RQX A;  1TOF A;  5ECK B;  4GRF A;  1XFL A;  4EF0 A;  3TJK A;  5COH A;  2C1Y A;  2WGR A;  5J9B A;  2YJH A;  5DAL A;  5AIX A;  4JU5 A;  3F3R A;  2XHF A;  2IMD A;  5CYY A;  3EE2 A;  1K0O A;  2HRK B;  4PUR A;  2FA4 A;  4J2F A;  5ECM B;  4MJA A;  1M7T A;  2C3N A;  2C8U A;  4IQA A;  2FWG A;  1EOG A;  3TOT A;  1F3B A;  3HKR A;  2LJA A;  3US3 A;  4F0B A;  1S3A A;  2HSN A;  3VK9 A;  2JAD A;  4POB A;  4X0X A;  4EDY A;  2F9S A;  1J08 A;  4DSQ A;  2H6Z A;  1NW2 A;  16GS A;  2DC5 A;  2NPB A;  4MPF A;  3LW9 A;  3H1N A;  3O76 A;  2H19 A;  1QGV A;  1K0C A;  5LCZ A;  1A2L A;  3HD5 A;  4LMW A;  3G7I A;  2R0C A;  1PX6 A;  4BWS A;  1GLQ A;  1JLW A;  5H5R A;  3C1R A;  2QC7 A;  4OO5 A;  2FHE A;  3GKK A;  4AKG A;  1NHY A;  2H0I A;  2X99 A;  3FHK A;  3L78 A;  4KDX A;  1J0F A;  1LU4 A;  4XCS A;  3KTL A;  1A0R P;  1T7P B;  4EXJ A;  3RPN A;  3EWL A;  3ZMK A;  1Z6N A;  3J7Y b;  1R5A A;  1NHO A;  2DJ3 A;  5D9T A;  4Q5F A;  2C0F A;  4JRR A;  1SJ6 A;  4X4J A;  2V41 A;  1DE2 A;  2JSY A;  3VUR A;  4RI6 A;  4FYB A;  2JZT A;  2FNO A;  4CY6 A;  2O87 A;  4DVC A;  1XBS A;  4K5R A;  2O8V B;  1SU9 A;  1XOB A;  5INY A;  3LQ7 A;  2GQK A;  4J56 E;  3K8N A;  3HDC A;  3GL3 A;  4GDF A;  1GUM A;  3A5I A;  5E59 A;  2H6Y A;  3L9V A;  3FMW A;  2RUF A;  5L71 A;  3N9J A;  3DIE A;  4IKH A;  2DJ0 A;  3CMI A;  4KUN A;  5CRW A;  4RUV A;  5HR1 A;  1VF2 A;  3CRT A;  4USS A;  1BG1 A;  1B9X C;  2NVL A;  1W4V A;  4IJI A;  4ECB A;  5ECL B;  2L4C A;  3A2V A;  1TW9 A;  1K0N A;  1VF3 A;  4F82 A;  1ZYQ B;  1SD8 A;  4LL4 B;  4KDY A;  4X43 A;  1O73 A;  2IIY A;  2VO4 A;  1K3O A;  3D6I A;  3W8S A;  4EO3 A;  3CXG A;  2ON5 A;  4NV5 A;  1CQG A;  2GZZ A;  2N5F A;  3MIX A;  3S9F A;  5A4U A;  1SEN A;  3A3T A;  5ECI B;  2PN8 A;  3D4M A;  2D2Z A;  1R4W A;  1BF5 A;  2LRC A;  3HMJ G;  1YJ6 A;  1WRY A;  1T4Y A;  2VL2 A;  3C73 A;  4PTS A;  4I5Q A;  5FT3 A;  3IA1 A;  2H70 A;  2RII A;  3U6V A;  3HHV A;  3G9B A;  4KH7 A;  5ECH B;  5ECR B;  3TKS A;  1PL1 A;  3UBL A;  1E6B A;  4LL1 B;  3TJB A;  5KN2 A;  2BMX A;  1DBY A;  2B1L A;  5CO3 A;  1O8X A;  1M9A A;  4ICY A;  1Z9H A;  2H0G A;  3HY2 A;  3OR5 A;  2HRA A;  3QMX A;  1SKW B;  4JBB A;  4YKF A;  4E8E A;  4AJ8 A;  3DML A;  1KBN A;  4KF9 A;  1QXH A;  4K6X A;  1A2J A;  4NPB A;  1B4Q A;  4MNN A;  4JR6 A;  4MJB A;  2K18 A;  3EU3 A;  4P3Y B;  3DGQ A;  1HNC A;  3HJM A;  3EPT A;  1V57 A;  2B1K A;  3MAK A;  2GQL A;  1G7E A;  4HU9 A;  4XS6 A;  5ID2 A;  3RBT A;  1PMT A;  2X64 A;  4PUA A;  1A8L A;  4ZBB A;  3R2Q A;  2HFD A;  1YDK A;  1WP0 A;  3C71 A;  3HXS A;  3R3E A;  4HUA A;  5CP1 A;  2IMI A;  1GTA A;  4DSS A;  3Q74 A;  1WIK A;  4CHS A;  3PIN A;  3IAS 2;  5G1L A;  5JCW A;  1GSQ A;  2GSR A;  3CSH A;  4MZB A;  4EL1 A;  2EFE A;  3IHQ A;  1ON4 A;  2A4V A;  2IFQ A;  3FZA A;  3GKX A;  2PU9 C;  5ELG A;  1SVM A;  2HSM A;  5DAK A;  4Z2R A;  4HU7 A;  2EFH A;  4MMM A;  4NAX A;  2E7P A;  2AAW A;  5IMC A;  4POL A;  4I2T A;  1GSY A;  1Q4J A;  4RQR A;  4Z7X A;  4IN0 A;  1QK8 A;  2HZE A;  2K6V A;  1XW5 A;  1ZOF A;  4YH2 A;  2PVQ A;  4OCE A;  5G30 A;  5G5E A;  1DSB A;  2DKI A;  4D73 A;  1FW1 A;  1T8E B;  1TJD A;  1E2Y A;  5A1N B;  2DJ1 A;  3SBC A;  3ERF A;  2HYX A;  3ISO A;  3IK7 A;  4KSM A;  4PQI A;  7GSS A;  1Z5Y E;  2A4H A;  3KMN A;  5AIS A;  5A4W A;  4FO5 A;  2Z9S A;  2YNX A;  2RUE A;  2G2Q A;  4L8E A;  5DBQ A;  4TXO A;  3ED3 A;  5DJM A;  1YKC A;  4KB3 A;  1AUC A;  4ECI A;  2LKU A;  4V2M A;  2J23 A;  4OD7 A;  3LG6 A;  1J9B A;  4FYC A;  3GX0 A;  1NSW A;  3WYW A;  5F05 A;  5DCH A;  4OO4 A;  4OWY A;  2VL9 A;  1XWK A;  4BVY A;  4MF6 A;  2R6K A;  5A5H B;  2V1M A;  2YV7 A;  4K9Z A;  1U3I A;  3CBU A;  3TKQ A;  4E68 A;  1BAY A;  3E3E A;  4MF7 A;  4N11 A;  5D73 A;  4IBP A;  4ID0 A;  5J4V A;  2HLS A;  4DSR A;  4N3Z A;  4OMV A;  5G1K A;  4GWR A;  3P90 A;  2OE0 A;  1JHB A;  2H71 A;  4AKX B;  3H4K A;  1XVQ A;  3ZLP A;  1XW9 A;  3ERW A;  2DJJ A;  3EU4 A;  1EWX A;  2XBI A;  3TCO A;  1M2D A;  5EL8 A;  1HQO A;  1FOV A;  3F6D A;  1Q98 A;  2OBI A;  3F8U A;  5DCG A;  1KTE A;  3DXB A;  2H8L A;  2N5A A;  4ZB8 A;  2VL2 C;  3I69 A;  11GS A;  1OC9 B;  4NHZ A;  3UBK A;  3UVH A;  5KEJ A;  3IV4 A;  2DSA A;  4ILF A;  4NMU A;  1GNW A;  5C04 A;  3MWH A;  4O5R A;  1MEK A;  1QUW A;  5GZZ B;  2MZC A;  2TIR A;  4PQ1 A;  3TKS C;  2C0D A;  4GSN A;  5J4U A;  1SJZ A;  3GFK A;  3QR6 A;  14GS A;  3FW2 A;  2QA2 A;  1K0M A;  4GLT A;  3GMF A;  2PER A;  1K0D A;  3EYT A;  2AJQ B;  2JAC A;  1Y6E A;  4JZQ A;  2QGV A;  4MPG A;  3UMA A;  2VM2 A;  3QAV A;  3VFI A;  4JR4 A;  1SVO A;  6GST A;  5ABR A;  4AF2 A;  3F0I A;  5A5K A;  2YWI A;  3UAR A;  3NOF A;  2I3Y A;  5DAL B;  4IP1 A;  2EIQ A;  1K0B A;  5F06 A;  5D8I A;  3C1S A;  2CAQ A;  3IC4 A;  5EPF A;  1SYR A;  4N30 A;  4L0U A;  4F9Z A;  2KP2 A;  4BPY A;  1TK8 B;  1YF0 A;  2YOI A;  2VLV A;  2GTU A;  3D0Z A;  4F0C A;  3NZN A;  5IMZ A;  3P8W A;  4WKW A;  4OFN A;  2L5L A;  1HD2 A;  1FO5 A;  2HSN B;  2EFC A;  3EMX A;  2FWF A;  5GST A;  2FD3 A;  4GCI A;  5IOW A;  5AN1 A;  3ZIT A;  2JU5 A;  1QMV A;  3KP9 A;  1XW6 A;  3ZVJ A;  2FLS A;  2ON7 A;  2VCX A;  5D96 A;  2LST A;  4XRA A;  3BCK A;  3FR6 A;  2AHE A;  1ZYN A;  1XOA A;  4ZBD A;  1FG4 A;  3CTF A;  1V40 A;  2OT3 A;  5F0G A;  2JZS A;  2LQO A;  4N10 A;  4ML6 A;  1OE7 A;  2WDU A;  4K1F A;  1MD4 A;  5KN1 A;  2R2J A;  6GSY A;  1GTB A;  3HZ4 A;  4HZ2 A;  1G6W A;  3VI7 A;  4OCF A;  2OKA A;  1TTZ A;  4IHU A;  1F2E A;  1IYH A;  3QOU A;  1IYI A;  2P0G A;  4L5L A;  3I43 A;  4HQS A;  1X0R A;  2DBC A;  2O5V A;  3HVV A;  5HR0 A;  2VCZ A;  5DDL A;  3RHB A;  3A2W A;  2X8G A;  2C0E A;  1SL0 B;  5ELA A;  1NM3 A;  4L0W A;  1R7H A;  3ZIJ A;  4BWQ A;  2CAI A;  4PGT A;  4V1A p;  4BA7 A;  2AB6 A;  3GH9 A;  4IW9 A;  1X5C A;  1R26 A;  2L6C A;  5ECQ B;  5FHI A;  1YKA A;  3KMO A;  3D21 A;  1JZW A;  2CZ3 A;  2V6K A;  2WUL A;  2FWH A;  4N0Z A;  5JWO B;  3KCM A;  4MZC A;  3L9S A;  3TJF A;  4G0L A;  1TRV A;  4EDZ A;  5B8B A;  3Q6O A;  3G7J A;  2C0G A;  3TKS E;  3F9U A;  1OAZ A;  1X5E A;  3LWA A;  4J57 E;  3TGZ A;  3H93 A;  4HZ4 A;  1FB0 A;  4TOP A;  3RDW A;  2FUG 2;  1ZMA A;  3ZIV A;  2CVK A;  3C8E A;  1YEX A;  1HNA A;  2EFD A;  1XWC A;  5LD0 A;  2M72 A;  4MP4 A;  4MJC A;  1AC1 A;  2KHP A;  2RLI A;  1YF1 A;  3DVW A;  4ISD A;  4K2X A;  1F6M C;  1F37 A;  3DKS A;  5ECN B;  1V58 A;  4GTU A;  4K2D A;  3FR3 A;  4YKG A;  4X1U A;  2H01 A;  1VF4 A;  4A5P A;  4XTS A;  5GAP D;  3GN3 A;  3HJP A;  3VPT A;  3BCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...