1IYHA

Crystal structure of hematopoietic prostaglandin d synthase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
publication title Mechanism of metal activation of human hematopoietic prostaglandin D synthase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1iyhA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1iyhA01
1AQXA 1X5DA 2HI7A 2AB6A 2E7PA 3IA1A 5C04A 2GZYA 4ECIA 3GKKA 2GT6A 3WGXA 4L5OA 1A8YA 2P31A 4ECBA 3ERFA 1V57A 2VM1A 2HZEB 1FO5A 1PX7A 3ZYWA 1Z6MA 2CV4A 4OFTA 5ID2B 4NMUA 2XHFA 1W4VA 1TJDA 1X9WB 1VRSD 5IMVA 2OJLA 1K3LA 1TOFA 3MDKA 4MZCA 4EDZA 2IFQA 4MMMA 4MA9A 4BL7B 1EEMA 3D21A 3IPZA 5J5NA 4ZBDA 2ZCTA 4KF9A 1K3OA 2BMXA 3KZQA 3DYRA 2R3XA 3LORA 2GSTA 3KJYA 2OACA 2DSAA 2LQQA 1S3AA 1HNAA 3G7JA 2LJRA 3R2QA 2FHEA 3EC3A 3VWUA 2C4JA 2OADA 3LXZA 2PGTA 2O85A 7GSSA 5ECKB 3CRUA 2J23A 1GUHA 1KEBA 6GSXA 1E2YA 3MNGA 3A2VA 5H5SA 3KEBA 2VUPA 3ME8A 3UARA 4F03A 1WOUA 2YANA 12GSA 3VI5A 3D22A 3GUSA 4OCFA 3FKFA 3LYPA 5D93A 1TI3A 1OE7A 2H76A 3GRXA 2A2RA 4YQUA 1ERWA 5DALA 5A5KA 1BAYA 3QR6A 1QGVA 4POBA 4RQRA 3H4KA 5IMAA 1PKWA 2NDOA 2IMKA 1EZKA 2YZHA 5FHIA 1LJRA 2DIYA 4JR6A 5G30A 1F6MC 3F4RA 4Z7XA 4YAPA 2PU9C 1SU9A 8GSSA 1A2JA 1GTIA 3GX8A 2X8HA 4QQ7A 4KSOA 5JWQB 2DMMA 1JFUA 2F3MA 1K0DA 3WT2A 4TR3A 4TW5A 1XWBA 2JZSA 1AW9A 2C3TA 1PKZA 3GL3A 1ST9A 4KCEA 2G0FA 3IHQA 3A2XA 3EU4A 1AQVA 4YH2A 1FB0A 4G9HA 1M9BA 3A2WA 20GSA 2H8LA 4ML6A 5CRDA 2VCZA 2HSYA 3KP8A 4G19A 2HSNB 4FQUA 2QGVA 5F07A 3DEXA 1XW6A 4NV5A 3PR8A 3VWXA 2G2QA 5EY6A 1TXXA 4KDUA 1VF3A 3DWVA 2KP1A 1FVKA 2XBIA 1RW1A 3RDWA 2JU5A 3FZ4A 5DAKA 4GCIA 4LA1A 4AJ8A 3BOAA 1IYHA 4FIWA 3DRNA 2B7JA 2YP6A 2ZNMA 5DDLA 1PL1A 4D73B 1U3IA 1XW5A 4I8BA 2JZRA 3TKRA 1UC7A 4MPFA 4MJEA 4AGSA 2D2ZA 1GRXA 1T8EB 17GSA 2YPMA 1JHBA 1XWGA 2H74A 3N5OA 4I2UA 4MH3A 2CVDA 1T00A 2DC5A 1WPIA 1J08A 3TRPA 1V2AA 1YJ6A 4PX1A 1GSYA 1OKTA 2LTKA 2PWJA 2KLXA 2IWTA 1O6JA 1XW9A 4N30A 4OFNA 1SL1B 2IFQB 3IR4A 1ZOFA 1PA3A 4XS1A 4DEJA 4XIHA 13GSA 2HE3A 2NBSA 5ECQB 3GX0A 2FWGA 16GSA 6GSWA 1U6TA 2IMIA 2PPTA 4RQXA 2WB9A 2VCQA 1Y6EA 3CYNA 5EPFA 3NIVA 2HXKA 4ULXA 5DQYA 4FO5A 3E0UA 3Q19A 3DMLA 2H6YA 3HVVA 14GSA 5L71A 1MDKA 1ZZYA 2H6XA 3I6AA 5JWRB 4G2EA 3GSSA 1YY7A 4KX4A 1URMA 4MH2A 2RUEA 4MJBA 2KOKA 4EF0A 2DJ0A 1KNGA 3IDVA 2LV3A 5DALB 1B4PA 1A0FA 2ES7A 2YWIA 2IJYA 4QL9A 1CQGA 3TRXA 3CSIA 1GWCA 2VAFA 1DE1A 3CMIA 3L4NA 3O76A 3ERWA 3HKRA 2R37A 2VD1A 2JSZA 4KA0A 1X5CA 1QXHA 3PH9A 2MYGA 2LQOA 4TOPA 3TKPA 2YWNA 4GSNA 4TXOA 2DLXA 5IMFA 1SL2B 1TU8A 2KP2A 1XWKA 2YV9A 5ECNB 3ZLPA 5IMZA 1U88A 3ZZXA 3TJJA 1EV9A 1G7OA 2RIIA 4WETA 4CW9A 4BWSA 6GSTA 3EE2A 3TDGA 1B4QA 2PERA 4V1Ap 5DBQA 4TVEA 1BEDA 2GTUA 1A0RP 2OKAA 3HZ4A 4FYUA 3AY8A 4N11A 1GSFA 2NPBA 2YJ7A 5CAXA 3FR6A 4PQ1A 3IK7A 1M99A 2XBQA 4Q5NA 2C80A 3H1NA 3ERGA 4N0ZA 4CHSA 4MJCA 3EMXA 4V1Ag 2LNTA 1T1VA 2UZ8A 1WRYA 3EVIA 3FRCA 5D9VA 1M2DA 1O8WA 2H0IA 3GSTA 2F8AA 5DAKB 4G0LA 2CAIA 2NVLA 3A5WA 4MK3A 4NAXA 2YNXA 5CRWA 5CNWA 3M0FA 2WGRA 4N10A 4TR1A 5KN3A 5HQPA 5IO0A 5B7CA 5ABRA 3D0ZA 3KTBA 1B48A 1MDIA 3RHBA 5AGYA 6GSSA 3D5JA 3E9JB 5ECOB 1ZYEA 2H1DA 1TU7A 1CQHA 3ZVJD 4ZBAA 4HZ4A 1OC8A 3M1GA 2P0GA 4IJ3A 3HDCA 3LGCA 1SENA 1BX9A 5G1KA 1UVZA 3M9KA 4V2NA 3WGDA 4Q5QA 3K8NA 5ELGA 2CX4A 1JLWA 3WD6A 3KCMA 2YOIA 4KCAA 2H0HA 4FYBA 4HU9A 3IBHA 3S9FA 4G0IA 1SK2A 3TKSA 1U87A 2HRAA 2L5OA 2F9SA 3QD9A 4EDYA 3KH9A 1PSQA 2YWMA 4DSSA 1V98A 2XPDA 2H1BA 2EIQA 3VPTA 4K0GA 4OO5A 1TRSA 4RUVA 3W6GA 2H1AA 3FZ9A 2H75A 3APOA 4V2LA 3KD0A 2QSIA 1ABAA 5BMUA 5JCWA 5IM9A 2E2MA 5CO3A 4ILFA 2K8SA 4YQMA 3HJMA 4HUAA 4PURA 1MEKA 3KH7A 1XWCA 1ZCPA 5AIVA 4I97A 5ECIB 3I43A 2H19A 4OO4A 3EMPA 2V41A 1MDJA 1PN9A 2O7KA 4OMVA 3ME7A 3DGQA 3HJOA 3W8JA 4WBJA 2CAQA 3FY7A 19GSA 1XOBA 1ACVA 4PQHA 4J2FA 4WF5A 2K9FA 2LRNA 1Q98A 1O81A 5IOXA 4MF6A 1TDIA 2CZ3A 1VGLA 5DCGA 4BVXA 9GSSA 1A2LA 1YKCA 2IMDA 2XC2A 1PL2A 4EUYA 1XBSA 2LJKA 4JEDA 3LFLA 4ZL9A 4GSSA 3VURA 2CX3A 1O8XA 4TXOB 1GSSA 1X0RA 5LD0A 3GKNA 5IO2A 1TRUA 3ZITA 1EGOA 4MJAA 2LSTA 2CVKA 3PINA 4OD7A 4I2TA 4MF7A 2IPAA 4DSQA 3CXGA 4E8HA 6GSUA 1VF2A 1GNEA 2FCHA 4EC0A 2LKUA 1YQ1A 4POLA 2B3SA 5D96A 3LQ7A 3L78A 1T4ZA 2H71A 4O92A 2E2GA 4XRDA 3GNJA 4PXOA 2FWHA 2HNLA 4ID0A 4LMVA 3KXOA 10GSA 3GV1A 4IJIA 2WRTA 3J7Yb 3F4TA 4ZXGA 4F82A 5HFKA 4KNDA 2C1YA 4ECJA 4ZL8A 5F06A 3O3TA 1GP1A 5G31A 4HJ2A 2KUCA 4QL7A 2B1KA 4TR4A 1BJXA 4JRRA 2CA8A 4ECCA 3TRQA 2R4VA 2C0FA 4ZIJA 3UVHA 1MD4A 1F3AA 4KW6A 1AXDA 2VOCA 4TR1B 2GZZA 4GLTA 3ZVJA 5D9XA 1GUMA 2X99A 3G9BA 2IMFA 4WR4A 1M9AA 5ELAA 4NWYA 2VCXA 3DXBA 3GKXA 3TOTA 3C73A 2GSSA 4X0XA 4KDXA 2AHEA 1A23A 4TR0A 3M3MA 3QAWA 3BJ5A 2V2GA 3EURA 3GH9A 1TK5B 3IV4A 2TRCP 2VL2A 1Y25A 1ERVA 3RAZA 2DMLA 2B1LA 1EWXA 2OE1A 2R6KA 3UAPA 2OBIA 3TUEA 1AUCA 2YWOA 1RK4A 4BVYA 2CT6A 3IAM2 3US3A 5FWGA 3MSZA 4MABA 3ZL5A 1SKWB 3BCKA 3F0IA 4K7IA 3LJRA 3TOUA 4IN0A 1GSEA 4PQIA 2FWFA 3DKSA 1PX6A 2GVPA 3TKQA 4DSRA 2MMZA 3LYKA 5J9BA 5G5FA 1G0TA 4HEA2 2B6MA 4BA7A 2VLVA 1K3YA 5E59A 3APSA 4TXVA 4ZB9A 4HQZA 4ISDA 2EIRA 3EU3A 4XS6A 2CZ2A 4YAVA 2C0DA 1F37A 3GFKA 2N5BA 3ZIVA 4IQ1A 1A2MA 5INYA 3ZMKA 4L0WA 2N5AA 4L0UA 1YZXA 3IE3A 1OYJA 3HHVA 3EINA 4JR4A 1HYUA 3L9UA 4K8MA 1SK1A 3OR5A 4PUFC 2FUG2 2R5GA 2H70A 22GSA 2AJQB 5DJLA 3LEFA 3R3EA 4IKHA 1V58A 4X43A 3F6DA 3TJKA 2FA4A 1B8XA 4WEYA 1M2AA 4O7HA 4CDOA 4BVXB 1Z7RA 1WWJA 2DIZA 2FD3A 4MP4A 1EOHA 4GSTA 2FLSA 1R26A 4HZ2A 1OC9A 4NV2A 2H30A 5B8AA 4X1UA 2HQTA 4HDEA 2HZFA 3VFIA 2VL3A 3UJ1A 2VCWA 3KTLA 4HJMA 1G6YA 1GTBA 3V1WA 1SD9A 4AJ6A 5CP1A 5E4WA 1XIYA 3CSHA 2VLTA 1O73A 3KGKA 1KBNA 2PVQA 3F9UA 4KDYA 3APQA 3G7IA 3W8SA 4L5LA 4OCEA 4I5QA 1PGTA 4XTSA 3LSZA 1EEJA 5J9CA 2DJ1A 4KE3A 3IXRA 4PUAA 3LWAA 3VLNA 2WCIA 1GTUA 1ERTA 1QK8A 4ML1A 1SKSB 4OFMA 4NXIA 4GF0A 2PVOC 2L6CA 3QAVA 1ON4A 2LNSA 1R5PA 3UEMA 3TKSC 3HA9A 2EIOA 1JZRA 3FEUA 4LMWA 5ECSA 2K6VA 2HYXA 4PGTA 1GLQA 3LG6A 2HZEA 2JADA 2ALBA 1GL8A 4IGJA 1ZGNA 3F3RA 1YF0A 2MMOA 3GTUA 2DJKA 2CQ9A 5ECLB 1AIUA 5H5QA 2R2JA 5ID2A 2AYTA 3FR3A 1R7HA 2IIYA 3F8UA 2GDRA 1N8JA 4IP6A 4RI7A 5AISA 3QCPA 1J9BA 2F8FA 1WMJA 4NHWA 3GIXA 3EWLA 2YN1A 5CRHA 1K0AA 3IC8A 3VWWA 1K0BA 2I9HA 4WBRD 2LRTA 4GQFA 1V40A 1GSQA 3GHAA 5D73A 5JCGA 2IMEA 3G7YA 2JL4A 3ZTLA 2A2SA 1S3DA 1Z3EA 3TJGA 1NM3A 4FYCA 4BPYA 3RPPA 2JZTA 1QMVA 1FVJA 3FZ5A 2GS3A 1R5AA 2GQMA 1F9MA 5HR3A 3J7Yk 1I5GA 1QUWA 4G10A 1EV4A 3KIJA 1TRVA 1SD8A 1THXA 1UA5A 3PPUA 3DD3A 4HQSA 4EE0A 3BD2A 5IPGA 3VWVA 4NHZA 5ENUA 3ED3A 5GAND 3QDNA 3QPMA 4AF2A 3UBLA 2GT5A 2I4AA 4KUNA 5CREA 2I1UA 4USSA 5B6NA 1E6BA 3F4SA 1BG5A 2I81A 3GYKA 2LUSA 4ZB8A 5GSTA 4HU7A 2H6ZA 4K6XA 2WJUA 4EVMA 4EKZA 1PMTA 2WFCA 4V2MA 5EL8A 2MBTA 4J57E 3ZFLA 1K0NA 3C7MA 1TTZA 1ML6A 5HR0A 1WE0A 1NW2A 3QAGA 2JACA 3H8QA 2YV7A 1TK8B 2I3YA 1Z9HA 3CTFA 4K0NA 1KTEA 2BTOT 5B8BA 1OC9B 2IN3A 2P5QA 2GSQA 2J9HA 1GTAA 1M0UA 4XS4A 1IYIA 2YZUA 4KSMA 4RI6A 4TN8A 1XVQA 2MMAA 5COHA 1ILOA 1F2EA 4HS1A 1GLPA 3ZREA 5B6MA 5F05A 2OA7A 1QFNA 4MLYA 6GSYA 1FB6A 3TGZA 1XOAA 1DSBA 1EOGA 5H5RA 2NTOA 3GKMA 5D9WA 5KN2A 2K8VA 4IS0A 1TKDB 2TRXA 3RHCA 5DJMA 1SJZA 2YJHA 1AC1A 1SYXA 2MBSA 3D4MA 2VL2C 2GQKA 2OBKA 1XZOA 4WKWA 4LL1B 5ECMB 4XRAA 2B7KA 2HRKA 5JCUA 2A4VA 4E8EA 4EL1A 2OE0A 2TIRA 3Q6OA 1GH2A 2H73A 4F0BA 5J41A 4WXTA 1TRWA 3L9SA 2O8VB 2RUFA 2DJ2A 1GSDA 1M2BA 3GTUB 3I9V2 1MD3A 3O6TA 2V32A 3DVWA 2WS2A 5KEJA 1I9DA 3L0HA 1X9SB 2LRCA 2H72A 2FNOA 4IP1A 4O32A 1SK0A 5AN1A 3QFBC 1NHYA 1SL0B 1YKAA 4ACSA 2MMNA 1YEXA 2WULA 5GAPD 1ZL9A 2AAWA 3C71A 3PGTA 2HRFA 4ZBBA 2C0EA 2LEGA 3TB2A 1B9YC 5F8BA 4TKYA 1JZWA 3C1RA 5HR2A 1FG4A 3M9JA 3VPQA 2OE3A 11GSA 2GQLA 3WGEA 3P8WA 2MZCA 3C1SA 5IQYA 1OKDA 3F63A 2K18A 5AIXA 2M72A 3ZRDA 3KM6A 3SWLA 2EC4A 2C3NA 2IL3A 4F9ZA 4JZQA 3C8EA 5DCHA 3FR9A 3MAKA 2ON7A 5DVBA 3HJPA 2FWEA 2L57A 5C00A 1OAZA 3GL5A 4L8EA 1SKRB 3UMAA 1LBKA 5GSSA 3F6FA 1U3AA 5A4UA 4F2IA 3QMXA 3IK9A 1GSUA 1PQNA 1TK0B 4MF5A 3D6IA 3HZ8A 3QFAC 2ZUPA 3CTGA 1EGRA 4YQVA 2O89A 2VLUA 3KMNA 3HXSA 2FA8A 1ERUA 5ECPB 2H01A 3E3EA 4DVCA 3VK9A 3IAS2 2L4CA 1Z5YE 5KN1A 4DSSB 4N0VA 4XS4B 4BWQA 3KMOA 1VF4A 3ZMLA 3HY2A 3DIEA 1THOA 2GSRA 3H93A 2L5LA 2GLRA 3U6VA 1OC3A 2VO4A 2X64A 5CYYA 2B5YA 2VD0A 2WZ9A 2RM5A 4MZBA 2Z9SA 1A8LA 2PN8A 1WJKA 1GUKA 3HVSA 4IW9A 1J0FA 2V6OA 1YEPA 4LL4B 3CSJA 2VIMA 3P2AA 1WIKA 2HSMA 1YDKA 2HT9A 5EVOA 2C8UA 4K7NA 1V9WA 1XCCA 3M8NA 2V1MA 4LLRA 4PNGA 2B5XA 1H4OA 3FW2A 6GSVA 1C72A 4IVFA 1K0MA 3UOMA 3ISOA 3A3TA 2HRKB 2LJAA 2O87A 2PBJA 3TJBA 1OE8A 5CRGA 3FZAA 2X8GA 4K7OA 2F51A 2M46A 5A4VA 4XHMA 5D9TA 2FGXA 5G2ZA 4EO3A 1K0OA 5A4WA 4F0CA 3L9VA 1UN2A 1XWAA 1Z7PA 3N9JA 2REMA 4WR5A 1WP0A 1QQ2A 1O85A 3TKSE 1SJIA 4K9ZA 4OWYA 2E0QA 2AV4A 4ZB6A 3P7XA 1SYRA 3NZNA 1XFLA 1VF1A 4J56E 1FHEA 1T4YA 5IIZA 5IMDA 1NSWA 2GGTA 4FH8A 2DJ3A 5G5EA 3TCOA 4XCSA 3BCIA 1FOVA 1FAAA 2H66A 4KGIA 3MWHA 4PTSA 1BYEA 4HI7A 2VM2A 4EXJA 3FYGA 3Q18A 1JZDA 1GNWA 3ZIJA 4WF4A 1W89A 4ZILA 1G6WA 5HR1A 5D8IA 2WDUA 1HD2A 2VCVA 4GXZA 3CRTA 1HQOA 1NHOA 1K0CA 4GRFA 5ECRB 2H1GA 5FT3A 5J4UA 5IMCA 2YCDA 2HFDA 3U5RE 1YF1A 5JWOB 2HRNA 4JBBA 3NOFA 1A24A 2XPEA 3RBTA 1Z6NA 4PNFA 1RQMA 1AQWA 4P3YB 2HSHA 5ECHB 4AJ7A 3Q74A 4HOJA 3P90A 1USBA 5IPHA 3WYWA 1XVWA 2C0GA 1TI1A 1XXUA 4BL7A 2QC7A 4BVYB 1GULA 3RPNA 4KH7A 3UL3A 1LU4A 1S3CA 3GN3A 1TW9A 1B9XC 1Q4JA 1FW1A 4O5RA 2L6DA 2FY6A 5IOWA 1MTCA 3UVTA 3FHKA 5G1LA 3IC4A 3GH6A 18GSA 1R4WA 4MDCA 4K1FA 4IELA 1HNCA 3SBCA 4KB3A 3UBKA 4POMA 2GZPA 3IOSA 1X5EA 4H86A 4JE1A 3IRAA 5LNKe 3D4TA 2HSMB 4NPBA 2PUKC 4TRXA 4IHUA 1BQ7A 1H75A 5GZZB 3TJFA 4G0KA 2AUVA 2RLIA 3GURA 1EP8A 3CBUA 2B5EA 2L59A 4Q5FA 3HCZA 4ZL7A 4JU5A 2PMTA 1SJ6A 1M7TA 5DQSA 2HLSA 1EP7A 2VL9A 4K2DA 2JSYA 3LXTA 4MZWA 3EYTA 3KP9A 4IQAA 2DBCA 1T3BA 1PD21 4GTUA 1TP9A 4GQCA 2KHPA 3DVXA 3JCML 2LS5A 3ZFBA 3BBYA 4MCUA 3HD5A 2CVBA 5J3RA 2DJJA 2QKEA 1OVNA 2H0GA 1JZOA 2ON5A 1DBYA 3I69A 1G7EA 4I6XA 3FK8A 3HYPA 2RM6A 1DUGA 1ZYQB 1X9MB 3UIWA 5KN0A 4GWRA 2BJXA 1ZMAA 2V6KA 3QOUA 3WT1A 2N5FA 5F0GA 5HFIA 3GMFA 2M80A 5LCZA 3VI7A 4KAEA 4MPGA 2VCTA 1F3BA 1DE2A 1PRXA 5HFGA 4Q5RA 1HNBA 2P5RA 1O7UA 1XPVA 3HVXA 3F3QA 3GA4A 1JLVA 4POKA 4IBPA 4D73A 2X8CA 3H79A 1N2AA 2C3QA 1T7PB 1AAZA 2L4QA
chains in the Genus database with same CATH superfamily
1AQXA 1X5DA 2HI7A 2AB6A 2E7PA 3IA1A 4ZB7A 3HMJG 5C04A 2GZYA 4ECIA 3GKKA 2GT6A 3WGXA 4L5OA 1A8YA 2P31A 4ECBA 3ERFA 1V57A 2VM1A 2HZEB 1FO5A 4Z2UA 1PX7A 3ZYWA 1Z6MA 2CV4A 4OFTA 5ID2B 4NMUA 2XHFA 1W4VA 3MIXA 1TJDA 1X9WB 1VRSD 5IMVA 2OJLA 1K3LA 1TOFA 3MDKA 4MZCA 4EDZA 2IFQA 4MMMA 4MA9A 4BL7B 1EEMA 3D21A 3IPZA 5J5NA 4ZBDA 2ZCTA 4KF9A 1K3OA 2BMXA 3KZQA 3DYRA 2R3XA 3LORA 2GSTA 3KJYA 2OACA 2DSAA 2LQQA 1S3AA 1HNAA 3G7JA 2LJRA 3R2QA 2FHEA 3EC3A 3VWUA 2C4JA 2OADA 3LXZA 2PGTA 2O85A 7GSSA 5ECKB 3FMWA 3CRUA 4K5RA 2J23A 1GUHA 1KEBA 6GSXA 1E2YA 3MNGA 3A2VA 5H5SA 1ZYPA 3KEBA 2VUPA 3ME8A 1BF5A 3UARA 4F03A 1WOUA 2YANA 12GSA 3VI5A 3D22A 3GUSA 4OCFA 3FKFA 3LYPA 5D93A 1TI3A 1OE7A 2H76A 3GRXA 2A2RA 4YQUA 1ERWA 5DALA 5A5KA 1BAYA 3QR6A 1QGVA 4POBA 4RQRA 3H4KA 5IMAA 1PKWA 2NDOA 4AI6A 4AKXB 2IMKA 1EZKA 2YZHA 5FHIA 1LJRA 2DIYA 4JR6A 5G30A 1F6MC 3F4RA 4Z7XA 4YAPA 2PU9C 1SU9A 8GSSA 1A2JA 1GTIA 3GX8A 2X8HA 4QQ7A 4KSOA 5JWQB 2DMMA 2X49A 1JFUA 2F3MA 1K0DA 3WT2A 4TR3A 4TW5A 1XWBA 2JZSA 1AW9A 2C3TA 1PKZA 3GL3A 1ST9A 4KCEA 2G0FA 3IHQA 3A2XA 3EU4A 1AQVA 4YH2A 1FB0A 4G9HA 1M9BA 3A2WA 20GSA 2H8LA 4ML6A 5CRDA 2VCZA 2HSYA 2R0CA 3KP8A 2H1LA 2HSNB 4G19A 4FQUA 2QGVA 5F07A 3DEXA 1XW6A 4NV5A 3PR8A 3VWXA 2G2QA 5EY6A 1TXXA 4KDUA 1VF3A 3DWVA 2KP1A 1FVKA 2XBIA 1RW1A 3RDWA 2JU5A 3FZ4A 5DAKA 4GCIA 4QMKA 4LA1A 4EIQA 4AJ8A 3BOAA 1IYHA 4FIWA 3DRNA 2ZNMA 2B7JA 2YP6A 5DDLA 1PL1A 4D73B 1U3IA 1XW5A 4I8BA 5J4VA 2JZRA 3TKRA 1UC7A 4MPFA 4MJEA 4AGSA 2WW0A 2D2ZA 1GRXA 1T8EB 17GSA 2YPMA 1JHBA 1XWGA 2H74A 3N5OA 4I2UA 4MH3A 2CVDA 1T00A 2DC5A 1WPIA 1J08A 3TRPA 1V2AA 1YJ6A 4PX1A 1GSYA 1OKTA 2LTKA 2PWJA 2KLXA 2IWTA 5KOXA 1O6JA 1XW9A 4N30A 4OFNA 1SL1B 2EFEA 2IFQB 3IR4A 1ZOFA 1PA3A 4XS1A 4DEJA 4XIHA 4K5SA 13GSA 2HE3A 2NBSA 5ECQB 3GX0A 2FWGA 16GSA 6GSWA 1U6TA 2IMIA 2PPTA 4RQXA 2WB9A 2VCQA 1Y6EA 3CYNA 5EPFA 3NIVA 2HXKA 4ULXA 4AKGA 4BIKA 5DQYA 4FO5A 3E0UA 3Q19A 3DMLA 2H6YA 3HVVA 14GSA 5L71A 1MDKA 1XG8A 1ZZYA 2H6XA 3I6AA 5JWRB 4G2EA 3GSSA 1YY7A 4KX4A 1URMA 4MH2A 2RUEA 4MJBA 2KOKA 4EF0A 2DJ0A 1KNGA 3IDVA 2LV3A 5DALB 1B4PA 1A0FA 2ES7A 2YWIA 2IJYA 4QL9A 1CQGA 3TRXA 3CSIA 1GWCA 2EFDA 2VAFA 1DE1A 3CMIA 3L4NA 4W66A 3O76A 3ERWA 3HKRA 2R37A 2VD1A 2JSZA 4KA0A 1X5CA 1QXHA 4E68A 3PH9A 2MYGA 2LQOA 4TOPA 3TKPA 2YWNA 4GSNA 4TXOA 2DLXA 5IMFA 1SL2B 1TU8A 2KP2A 1XWKA 2YV9A 5ECNB 3ZLPA 5IMZA 1U88A 3ZZXA 3TJJA 1EV9A 1G7OA 2RIIA 4WETA 4CW9A 4BWSA 6GSTA 3EE2A 3TDGA 1B4QA 3CQFA 2PERA 4V1Ap 5DBQA 4TVEA 1BEDA 3IHGA 2GTUA 1S3RA 1A0RP 2OKAA 3HZ4A 4FYUA 3AY8A 4N11A 1GSFA 2NPBA 2YJ7A 5CAXA 3FR6A 4PQ1A 3IK7A 1M99A 2XBQA 4Q5NA 2C80A 3H1NA 3ERGA 5A5HB 4PI2C 4N0ZA 4CHSA 4MJCA 3EMXA 4V1Ag 2LNTA 1T1VA 2UZ8A 1WRYA 3EVIA 3FRCA 5D9VA 1M2DA 1O8WA 2H0IA 4PHZC 3GSTA 2F8AA 5DAKB 4G0LA 2CAIA 2NVLA 3A5WA 4MK3A 4NAXA 2YNXA 5CRWA 5CNWA 2DKIA 3M0FA 2WGRA 4N10A 4TR1A 5KN3A 5HQPA 5IO0A 5B7CA 5ABRA 3D0ZA 3KTBA 4X4JA 1B48A 1MDIA 3RHBA 5AGYA 6GSSA 3A5IA 3D5JA 3E9JB 5A34A 5ECOB 1ZYEA 2H1DA 1TU7A 1CQHA 3ZVJD 4ZBAA 4HZ4A 1OC8A 3M1GA 2P0GA 4IJ3A 3HDCA 3LGCA 1SENA 1BX9A 5G1KA 1UVZA 3M9KA 4V2NA 3WGDA 4Q5QA 3RGBC 3K8NA 5ELGA 2CX4A 1JLWA 3WD6A 3KCMA 2YOIA 4KCAA 2H0HA 4FYBA 4HU9A 3IBHA 3S9FA 4G0IA 1SK2A 3TKSA 1U87A 2HRAA 2WW1A 2L5OA 2F9SA 3QD9A 4EDYA 3KH9A 1PSQA 2YWMA 4DSSA 1V98A 2XPDA 2H1BA 2EIQA 3VPTA 4K0GA 1M3JA 4K2XA 4OO5A 1TRSA 4RUVA 3W6GA 2H1AA 3FZ9A 2H75A 3APOA 4V2LA 3KD0A 2QSIA 1ABAA 5BMUA 5JCWA 5IM9A 2E2MA 5CO3A 4ILFA 2K8SA 4YQMA 3HJMA 4HUAA 4PURA 1MEKA 3KH7A 1XWCA 1ZCPA 5AIVA 4I97A 5ECIB 3I43A 5A1NB 2H19A 4OO4A 3EMPA 2V41A 1MDJA 1YEWC 1PN9A 2O7KA 4OMVA 3ME7A 3DGQA 3HJOA 3W8JA 4WBJA 2CAQA 3FY7A 19GSA 4YKGA 1XOBA 1ACVA 4PQHA 4J2FA 4WF5A 2K9FA 2LRNA 1Q98A 1O81A 5IOXA 4MF6A 1TDIA 4G01A 2CZ3A 1VGLA 5DCGA 4BVXA 9GSSA 1A2LA 1YKCA 2IMDA 2WVYA 2XC2A 1PL2A 4EUYA 1XBSA 2LJKA 4JEDA 3LFLA 4ZL9A 4GSSA 3VURA 2CX3A 1O8XA 4CY8A 4TXOB 1GSSA 2O36A 1X0RA 5LD0A 3GKNA 5IO2A 1TRUA 3ZITA 1EGOA 4MJAA 2LSTA 2CVKA 3PINA 4OD7A 4I2TA 4MF7A 2IPAA 4DSQA 3CXGA 4E8HA 6GSUA 1VF2A 1GNEA 2FCHA 4EC0A 2LKUA 1YQ1A 2O5VA 4POLA 2B3SA 5D96A 3LQ7A 3L78A 1T4ZA 1ZYNA 2H71A 4O92A 2E2GA 4XRDA 3GNJA 4PXOA 2FWHA 2HNLA 4ID0A 4LMVA 3KXOA 10GSA 3GV1A 4IJIA 2WRTA 3J7Yb 3F4TA 4ZXGA 1FOHA 4FXYP 4F82A 5HFKA 4KNDA 2C1YA 4ECJA 4ZL8A 5F06A 3O3TA 1GP1A 5G31A 2O3EA 4HJ2A 2DKHA 2KUCA 4QL7A 2B1KA 4TR4A 1BJXA 4JRRA 2CA8A 4ECCA 3TRQA 2R4VA 2C0FA 4ZIJA 3UVHA 1MD4A 1F3AA 4KW6A 1AXDA 2VOCA 4TR1B 2GZZA 4GLTA 3ZVJA 5D9XA 1GUMA 2X99A 3G9BA 2IMFA 4WR4A 1M9AA 5ELAA 5KOWA 4NWYA 2VCXA 3DXBA 3GKXA 3TOTA 3C73A 2GSSA 4X0XA 4KDXA 2AHEA 5A34B 1A23A 4TR0A 3M3MA 3QAWA 3BJ5A 2V2GA 3EURA 3GH9A 1TK5B 3IV4A 2TRCP 2VL2A 1Y25A 1ERVA 3RAZA 2DMLA 2B1LA 1EWXA 2OE1A 2R6KA 3UAPA 1Y1UA 2OBIA 3TUEA 1AUCA 2YWOA 1RK4A 4BVYA 2CT6A 3IAM2 3US3A 5FWGA 3MSZA 4MABA 3ZL5A 1SKWB 3BCKA 3F0IA 4K7IA 3LJRA 3TOUA 4IN0A 1GSEA 4PQIA 2FWFA 3DKSA 1PX6A 2GVPA 3TKQA 4DSRA 2MMZA 3LYKA 5J9BA 5G5FA 1G0TA 1TXUA 4HEA2 2B6MA 4BA7A 2VLVA 1K3YA 5E59A 3MYDA 3APSA 4TXVA 4ZB9A 4HQZA 4ISDA 5BMUB 3EU3A 2EIRA 4XS6A 2CZ2A 4YAVA 2C0DA 1F37A 3GFKA 2N5BA 3ZIVA 4IQ1A 1A2MA 5INYA 3ZMKA 4L0WA 2N5AA 4L0UA 1YZXA 3IE3A 1OYJA 3HHVA 3EINA 4JR4A 1HYUA 3L9UA 4K8MA 1SK1A 3OR5A 4PUFC 2FUG2 2R5GA 2H70A 22GSA 2AJQB 5DJLA 3LEFA 3R3EA 4IKHA 1V58A 4X43A 3F6DA 3TJKA 2FA4A 1B8XA 4WEYA 1M2AA 4O7HA 4CDOA 4BVXB 1Z7RA 1WWJA 2DIZA 2FD3A 2R0GA 4MP4A 1EOHA 3CHXC 4GSTA 2FLSA 1R26A 4HZ2A 4PI0C 1OC9A 4NV2A 2H30A 5B8AA 4X1UA 2HQTA 4HDEA 2HZFA 1S4BP 3VFIA 2VL3A 3UJ1A 2VCWA 3KTLA 4HJMA 1G6YA 1GTBA 3V1WA 1SD9A 4AJ6A 5CP1A 5E4WA 1XIYA 2WVXA 3CSHA 1O73A 2VLTA 3KGKA 1KBNA 2PVQA 3F9UA 4KDYA 3APQA 3G7IA 3W8SA 4L5LA 4OCEA 4I5QA 1SVOA 1PGTA 4XTSA 3LSZA 1EEJA 5J9CA 2DJ1A 4KE3A 3IXRA 4PUAA 3LWAA 3VLNA 2WCIA 1GTUA 1ERTA 1QK8A 4ML1A 1SKSB 4OFMA 4NXIA 4GF0A 2PVOC 2L6CA 3QAVA 1ON4A 2LNSA 1R5PA 4ICYA 3UEMA 3TKSC 3HA9A 2EIOA 1JZRA 3FEUA 4LMWA 5ECSA 2K6VA 2HYXA 4PGTA 1GLQA 3LG6A 2HZEA 4A5PA 2JADA 2ALBA 1GL8A 4IGJA 1ZGNA 3F3RA 1YF0A 1PFOA 2MMOA 3GTUA 2DJKA 2CQ9A 5ECLB 1AIUA 5H5QA 2R2JA 5ID2A 2AYTA 3FR3A 1R7HA 2IIYA 3F8UA 2GDRA 1N8JA 4IP6A 4RI7A 5AISA 3QCPA 1J9BA 2F8FA 1WMJA 4NHWA 2QA1A 3GIXA 3EWLA 2YN1A 5CRHA 1K0AA 3IC8A 3VWWA 1K0BA 2I9HA 4WBRD 2LRTA 4GQFA 1V40A 1GSQA 3GHAA 5D73A 5JCGA 3CWGA 2IMEA 3G7YA 2JL4A 3ZTLA 2A2SA 1S3DA 1Z3EA 3TJGA 1NM3A 4FYCA 4BPYA 3RPPA 2JZTA 1QMVA 1FVJA 3FZ5A 2GS3A 1R5AA 2GQMA 1F9MA 5HR3A 3J7Yk 1I1IP 1I5GA 1QUWA 4G10A 1EV4A 3KIJA 1TRVA 1SD8A 1THXA 4AKIA 1UA5A 3PPUA 3DD3A 4HQSA 4EE0A 3BD2A 5IPGA 3VWVA 4NHZA 5ENUA 3ED3A 5GAND 3QDNA 4AKHA 3QPMA 3UBLA 4AF2A 2GT5A 2EFCA 2I4AA 2VKZG 4KUNA 5CREA 2I1UA 4USSA 5B6NA 1E6BA 3F4SA 4EIPA 1BG5A 2I81A 3GYKA 2LUSA 4ZB8A 5GSTA 4HU7A 2H6ZA 4K6XA 2WJUA 4EVMA 4EKZA 1PMTA 2X4AA 2WFCA 4V2MA 5EL8A 2MBTA 4J57E 3ZFLA 1K0NA 3C7MA 1TTZA 1ML6A 5HR0A 1WE0A 1NW2A 3QAGA 2JACA 3H8QA 2YV7A 4CY6A 1TK8B 2I3YA 1Z9HA 3CTFA 4K0NA 1KTEA 2BTOT 5B8BA 1OC9B 2IN3A 2P5QA 2GSQA 2J9HA 1GTAA 1M0UA 4XS4A 1IYIA 2YZUA 4KSMA 4RI6A 4TN8A 1XVQA 2MMAA 5COHA 1ILOA 1F2EA 4HS1A 1GLPA 3ZREA 5B6MA 5F05A 2OA7A 1QFNA 4MLYA 6GSYA 1FB6A 3TGZA 1XOAA 1DSBA 1EOGA 5H5RA 2NTOA 3GKMA 5D9WA 5KN2A 2K8VA 4IS0A 1TKDB 2TRXA 3RHCA 5DJMA 3RFRC 1SJZA 2YJHA 1M3IA 1AC1A 1SYXA 2MBSA 3D4MA 2VL2C 2GQKA 2OBKA 1XZOA 4WKWA 4LL1B 5ECMB 4XRAA 2B7KA 2HRKA 5JCUA 2A4VA 4E8EA 4EL1A 2OE0A 2TIRA 3Q6OA 1GH2A 2H73A 4F0BA 5J41A 4WXTA 1TRWA 3L9SA 2O8VB 2RUFA 2DJ2A 1GSDA 1M2BA 4Z2RA 3GTUB 3I9V2 1MD3A 3O6TA 2V32A 2OT3A 3DVWA 2WS2A 5KEJA 1I9DA 3L0HA 1X9SB 2LRCA 2H72A 1SVMA 2FNOA 4IP1A 4O32A 1SK0A 5AN1A 3QFBC 1NHYA 1SL0B 1YKAA 4ACSA 2MMNA 1YEXA 2WULA 4Z2TA 5GAPD 1ZL9A 2AAWA 3C71A 3PGTA 2HRFA 4ZBBA 2C0EA 2LEGA 3TB2A 1B9YC 5F8BA 4TKYA 1JZWA 3C1RA 5HR2A 1FG4A 3M9JA 3VPQA 2OE3A 11GSA 2GQLA 3WGEA 3P8WA 2MZCA 3C1SA 5IQYA 5J4YA 1OKDA 3F63A 2K18A 5AIXA 2M72A 3ZRDA 3KM6A 3SWLA 2A4HA 2EC4A 4MNNA 2C3NA 2IL3A 3HVNA 4F9ZA 4O5UA 4JZQA 3C8EA 5DCHA 3FR9A 3MAKA 2ON7A 5DVBA 3HJPA 2FWEA 2L57A 5C00A 1OAZA 3GL5A 4L8EA 1SKRB 3UMAA 1LBKA 5GSSA 3F6FA 1U3AA 5A4UA 4F2IA 3QMXA 3IK9A 1GSUA 1PQNA 1TK0B 4MF5A 3D6IA 3HZ8A 3QFAC 4HSCX 2ZUPA 3CTGA 1EGRA 4YQVA 2O89A 2VLUA 2A2PA 3KMNA 2WW2A 3HXSA 2FA8A 1ERUA 5ECPB 2H01A 3E3EA 4DVCA 3VK9A 3IAS2 2L4CA 1Z5YE 5KN1A 4DSSB 4N0VA 4XS4B 4BWQA 3KMOA 1VF4A 3ZMLA 3HY2A 3DIEA 1THOA 2GSRA 3H93A 2L5LA 2GLRA 3U6VA 4O5QA 1OC3A 2VO4A 2X64A 5CYYA 2B5YA 2VD0A 2WZ9A 2RM5A 4MZBA 2Z9SA 1A8LA 5A5HA 2PN8A 1WJKA 1PN0A 1GUKA 3HVSA 4IW9A 1J0FA 2V6OA 1YEPA 4LL4B 3CSJA 2VIMA 3P2AA 1WIKA 2HSMA 2QA2A 1YDKA 2HT9A 5EVOA 2C8UA 4K7NA 1V9WA 1XCCA 3M8NA 2V1MA 4LLRA 4PNGA 2B5XA 1H4OA 3FW2A 6GSVA 1C72A 4IVFA 1K0MA 3UOMA 3ISOA 3A3TA 2HRKB 2LJAA 2O87A 2PBJA 3TJBA 1OE8A 5CRGA 3FZAA 2X8GA 4K7OA 2F51A 2M46A 5A4VA 4XHMA 5D9TA 2FGXA 5G2ZA 4EO3A 1K0OA 5A4WA 4F0CA 3L9VA 1UN2A 1XWAA 1BG1A 1Z7PA 4N3ZA 3N9JA 2REMA 4WR5A 1WP0A 1QQ2A 1O85A 3TKSE 1SJIA 4K9ZA 4OWYA 2E0QA 2AV4A 2WVZA 4ZB6A 3P7XA 1SYRA 3NZNA 1XFLA 1VF1A 4J56E 1FHEA 1T4YA 5IIZA 5IMDA 1NSWA 2WZSA 2GGTA 4FH8A 2DJ3A 5G5EA 4YKFA 3TCOA 4XCSA 3BCIA 1FOVA 1FAAA 2H66A 4KGIA 3MWHA 4PTSA 1BYEA 4HI7A 2VM2A 4EXJA 3FYGA 3Q18A 1JZDA 1GNWA 5A1NA 3ZIJA 4WF4A 2UV8G 1W89A 4ZILA 1G6WA 5HR1A 5D8IA 2WDUA 1HD2A 2VCVA 4GXZA 3CRTA 1HQOA 1NHOA 1K0CA 4GRFA 1YVLA 5ECRB 2H1GA 5FT3A 3LW9A 5J4UA 5IMCA 2YCDA 2HFDA 3U5RE 1YF1A 5JWOB 2HRNA 4JBBA 3NOFA 1A24A 2XPEA 3RBTA 1Z6NA 4PNFA 1RQMA 1AQWA 4P3YB 2HSHA 5ECHB 4AJ7A 3Q74A 4HOJA 3P90A 1USBA 5IPHA 3WYWA 1XVWA 2C0GA 1TI1A 1XXUA 4BL7A 2QC7A 4BVYB 1GULA 2EFHA 3RPNA 4KH7A 3UL3A 1LU4A 5J40A 1S3CA 3GN3A 1TW9A 1B9XC 1Q4JA 1FW1A 4O5RA 2L6DA 2FY6A 5IOWA 1MTCA 3UVTA 2R0PA 3FHKA 5G1LA 3IC4A 3GH6A 18GSA 1R4WA 4MDCA 4K1FA 4IELA 1HNCA 3SBCA 4KB3A 3UBKA 4POMA 2GZPA 3IOSA 1X5EA 4H86A 4JE1A 3IRAA 5LNKe 3D4TA 2HSMB 4NPBA 2PUKC 4TRXA 2WW3A 4IHUA 1BQ7A 1H75A 5GZZB 3TJFA 4G0KA 2AUVA 2RLIA 3GURA 1SVLA 1EP8A 3CBUA 2B5EA 2L59A 4Q5FA 3HCZA 4ZL7A 4JU5A 2PMTA 1SJ6A 1M7TA 5DQSA 2HLSA 5BRTA 3TU3B 1EP7A 2VL9A 4K2DA 2JSYA 3LXTA 4MZWA 3EYTA 3KP9A 4IQAA 2DBCA 1T3BA 1PD21 4GTUA 1TP9A 4GDFA 4GQCA 2KHPA 3DVXA 3JCML 2LS5A 3ZFBA 3BBYA 4MCUA 3EPTA 3HD5A 2CVBA 5J3RA 2DJJA 5J47A 2QKEA 1OVNA 2H0GA 1JZOA 2ON5A 1DBYA 2WVXB 3I69A 1G7EA 4I6XA 3FK8A 3HYPA 2RM6A 1DUGA 1ZYQB 1X9MB 1N25A 3UIWA 5KN0A 2HSNA 4GWRA 2BJXA 1ZMAA 2V6KA 3QOUA 3WT1A 2N5FA 5F0GA 5HFIA 3GMFA 2M80A 5LCZA 3VI7A 4KAEA 4MPGA 2VCTA 1F3BA 1DE2A 1PRXA 5HFGA 4Q5RA 1HNBA 2P5RA 1O7UA 1XPVA 3HVXA 3F3QA 3GA4A 1JLVA 4POKA 4IBPA 4D73A 2X8CA 3H79A 1N2AA 2C3QA 1T7PB 1AAZA 2L4QA
chains in the Genus database with same CATH topology
1AQXA 1X5DA 2HI7A 2AB6A 2E7PA 3IA1A 4ZB7A 3HMJG 5C04A 2GZYA 4ECIA 3GKKA 2GT6A 3WGXA 4L5OA 1A8YA 2P31A 4ECBA 3ERFA 1V57A 2VM1A 2HZEB 1FO5A 4Z2UA 1PX7A 3ZYWA 1Z6MA 2CV4A 4OFTA 5ID2B 4NMUA 2XHFA 1W4VA 3MIXA 1TJDA 1X9WB 1VRSD 5IMVA 2OJLA 1K3LA 1TOFA 3MDKA 4MZCA 4EDZA 2IFQA 4MMMA 4MA9A 4BL7B 1EEMA 3D21A 3IPZA 5J5NA 4ZBDA 2ZCTA 4KF9A 1K3OA 2BMXA 3KZQA 3DYRA 2R3XA 3LORA 2GSTA 3KJYA 2OACA 2DSAA 2LQQA 1S3AA 1HNAA 3G7JA 2LJRA 3R2QA 2FHEA 3EC3A 3VWUA 2C4JA 2OADA 3LXZA 2PGTA 2O85A 7GSSA 5ECKB 3FMWA 3CRUA 4K5RA 2J23A 1GUHA 1KEBA 6GSXA 1E2YA 3MNGA 3A2VA 5H5SA 1ZYPA 3KEBA 2VUPA 3ME8A 1BF5A 3UARA 4F03A 1WOUA 2YANA 12GSA 3VI5A 3D22A 3GUSA 4OCFA 3FKFA 3LYPA 5D93A 1TI3A 1OE7A 2H76A 3GRXA 2A2RA 4YQUA 1ERWA 5DALA 5A5KA 1BAYA 3QR6A 1QGVA 4POBA 4RQRA 3H4KA 5IMAA 1PKWA 2NDOA 4AI6A 4AKXB 2IMKA 1EZKA 2YZHA 5FHIA 1LJRA 2DIYA 4JR6A 5G30A 1F6MC 3F4RA 4Z7XA 4YAPA 2PU9C 1SU9A 8GSSA 1A2JA 1GTIA 3GX8A 2X8HA 4QQ7A 4KSOA 5JWQB 2DMMA 2X49A 1JFUA 2F3MA 1K0DA 3WT2A 4TR3A 4TW5A 1XWBA 2JZSA 1AW9A 2C3TA 1PKZA 3GL3A 1ST9A 4KCEA 2G0FA 3IHQA 3A2XA 3EU4A 1AQVA 4YH2A 1FB0A 4G9HA 1M9BA 3A2WA 20GSA 2H8LA 4ML6A 5CRDA 2VCZA 2HSYA 2R0CA 3KP8A 2H1LA 2HSNB 4G19A 4FQUA 2QGVA 5F07A 3DEXA 1XW6A 4NV5A 3PR8A 3VWXA 2G2QA 5EY6A 1TXXA 4KDUA 1VF3A 3DWVA 2KP1A 1FVKA 2XBIA 1RW1A 3RDWA 2JU5A 3FZ4A 5DAKA 4GCIA 4QMKA 4LA1A 4EIQA 4AJ8A 3BOAA 1IYHA 4FIWA 3DRNA 2ZNMA 2B7JA 2YP6A 5DDLA 1PL1A 4D73B 1U3IA 1XW5A 4I8BA 5J4VA 2JZRA 3TKRA 1UC7A 4MPFA 4MJEA 4AGSA 2D2ZA 1GRXA 1T8EB 17GSA 2YPMA 1JHBA 1XWGA 2H74A 3N5OA 4I2UA 4MH3A 2CVDA 1T00A 2DC5A 1WPIA 1J08A 3TRPA 1V2AA 1YJ6A 4PX1A 1GSYA 1OKTA 2LTKA 2PWJA 2KLXA 2IWTA 5KOXA 1O6JA 1XW9A 4N30A 4OFNA 1SL1B 2EFEA 2IFQB 3IR4A 1ZOFA 1PA3A 4XS1A 4DEJA 4XIHA 4K5SA 13GSA 2HE3A 2NBSA 5ECQB 3GX0A 2FWGA 16GSA 6GSWA 1U6TA 2IMIA 2PPTA 4RQXA 2WB9A 2VCQA 1Y6EA 3CYNA 5EPFA 3NIVA 2HXKA 4ULXA 4AKGA 5DQYA 4FO5A 3E0UA 3Q19A 3DMLA 2H6YA 3HVVA 14GSA 5L71A 1MDKA 1ZZYA 2H6XA 3I6AA 5JWRB 4G2EA 3GSSA 1YY7A 4KX4A 1URMA 4MH2A 2RUEA 4MJBA 2KOKA 4EF0A 2DJ0A 1KNGA 3IDVA 2LV3A 5DALB 1B4PA 1A0FA 2ES7A 2YWIA 2IJYA 4QL9A 1CQGA 3TRXA 3CSIA 1GWCA 2EFDA 2VAFA 1DE1A 3CMIA 3L4NA 4W66A 3O76A 3ERWA 3HKRA 2R37A 2VD1A 2JSZA 4KA0A 1X5CA 1QXHA 4E68A 3PH9A 2MYGA 2LQOA 4TOPA 3TKPA 2YWNA 4GSNA 4TXOA 2DLXA 5IMFA 1SL2B 1TU8A 2KP2A 1XWKA 2YV9A 5ECNB 3ZLPA 5IMZA 1U88A 3ZZXA 3TJJA 1EV9A 1G7OA 2RIIA 4WETA 4CW9A 4BWSA 6GSTA 3EE2A 3TDGA 1B4QA 2PERA 4V1Ap 5DBQA 4TVEA 1BEDA 3IHGA 2GTUA 1A0RP 2OKAA 3HZ4A 4FYUA 3AY8A 4N11A 1GSFA 2NPBA 2YJ7A 5CAXA 3FR6A 4PQ1A 3IK7A 1M99A 2XBQA 4Q5NA 2C80A 3H1NA 3ERGA 5A5HB 4N0ZA 4CHSA 4MJCA 3EMXA 4V1Ag 2LNTA 1T1VA 2UZ8A 1WRYA 3EVIA 3FRCA 5D9VA 1M2DA 1O8WA 2H0IA 3GSTA 2F8AA 5DAKB 4G0LA 2CAIA 2NVLA 3A5WA 4MK3A 4NAXA 2YNXA 5CRWA 5CNWA 2DKIA 3M0FA 2WGRA 4N10A 4TR1A 5KN3A 5HQPA 5IO0A 5B7CA 5ABRA 3D0ZA 3KTBA 4X4JA 1B48A 1MDIA 3RHBA 5AGYA 6GSSA 3A5IA 3D5JA 3E9JB 5A34A 5ECOB 1ZYEA 2H1DA 1TU7A 1CQHA 3ZVJD 4ZBAA 4HZ4A 1OC8A 3M1GA 2P0GA 4IJ3A 3HDCA 3LGCA 1SENA 1BX9A 5G1KA 1UVZA 3M9KA 4V2NA 3WGDA 4Q5QA 3K8NA 5ELGA 2CX4A 1JLWA 3WD6A 3KCMA 2YOIA 4KCAA 2H0HA 4FYBA 4HU9A 3IBHA 3S9FA 4G0IA 1SK2A 3TKSA 1U87A 2HRAA 2L5OA 2F9SA 3QD9A 4EDYA 3KH9A 1PSQA 2YWMA 4DSSA 1V98A 2XPDA 2H1BA 2EIQA 3VPTA 4K0GA 4K2XA 4OO5A 1TRSA 4RUVA 3W6GA 2H1AA 3FZ9A 2H75A 3APOA 4V2LA 3KD0A 2QSIA 1ABAA 5BMUA 5JCWA 5IM9A 2E2MA 5CO3A 4ILFA 2K8SA 4YQMA 3HJMA 4HUAA 4PURA 1MEKA 3KH7A 1XWCA 1ZCPA 5AIVA 4I97A 5ECIB 3I43A 5A1NB 2H19A 4OO4A 3EMPA 2V41A 1MDJA 1PN9A 2O7KA 4OMVA 3ME7A 3DGQA 3HJOA 3W8JA 4WBJA 2CAQA 3FY7A 19GSA 4YKGA 1XOBA 1ACVA 4PQHA 4J2FA 4WF5A 2K9FA 2LRNA 1Q98A 1O81A 5IOXA 4MF6A 1TDIA 4G01A 2CZ3A 1VGLA 5DCGA 4BVXA 9GSSA 1A2LA 1YKCA 2IMDA 2XC2A 1PL2A 4EUYA 1XBSA 2LJKA 4JEDA 3LFLA 4ZL9A 4GSSA 3VURA 2CX3A 1O8XA 4CY8A 4TXOB 1GSSA 1X0RA 5LD0A 3GKNA 5IO2A 1TRUA 3ZITA 1EGOA 4MJAA 2LSTA 2CVKA 3PINA 4OD7A 4I2TA 4MF7A 2IPAA 4DSQA 3CXGA 4E8HA 6GSUA 1VF2A 1GNEA 2FCHA 4EC0A 2LKUA 1YQ1A 2O5VA 4POLA 2B3SA 5D96A 3LQ7A 3L78A 1T4ZA 1ZYNA 2H71A 4O92A 2E2GA 4XRDA 3GNJA 4PXOA 2FWHA 2HNLA 4ID0A 4LMVA 3KXOA 10GSA 3GV1A 4IJIA 2WRTA 3J7Yb 3F4TA 4ZXGA 1FOHA 4F82A 5HFKA 4KNDA 2C1YA 4ECJA 4ZL8A 5F06A 3O3TA 1GP1A 5G31A 4HJ2A 2DKHA 2KUCA 4QL7A 2B1KA 4TR4A 1BJXA 4JRRA 2CA8A 4ECCA 3TRQA 2R4VA 2C0FA 4ZIJA 3UVHA 1MD4A 1F3AA 4KW6A 1AXDA 2VOCA 4TR1B 2GZZA 4GLTA 3ZVJA 5D9XA 1GUMA 2X99A 3G9BA 2IMFA 4WR4A 1M9AA 5ELAA 5KOWA 4NWYA 2VCXA 3DXBA 3GKXA 3TOTA 3C73A 2GSSA 4X0XA 4KDXA 2AHEA 5A34B 1A23A 4TR0A 3M3MA 3QAWA 3BJ5A 2V2GA 3EURA 3GH9A 1TK5B 3IV4A 2TRCP 2VL2A 1Y25A 1ERVA 3RAZA 2DMLA 2B1LA 1EWXA 2OE1A 2R6KA 3UAPA 1Y1UA 2OBIA 3TUEA 1AUCA 2YWOA 1RK4A 4BVYA 2CT6A 3IAM2 3US3A 5FWGA 3MSZA 4MABA 3ZL5A 1SKWB 3BCKA 3F0IA 4K7IA 3LJRA 3TOUA 4IN0A 1GSEA 4PQIA 2FWFA 3DKSA 1PX6A 2GVPA 3TKQA 4DSRA 2MMZA 3LYKA 5J9BA 5G5FA 1G0TA 1TXUA 4HEA2 2B6MA 4BA7A 2VLVA 1K3YA 5E59A 3MYDA 3APSA 4TXVA 4ZB9A 4HQZA 4ISDA 5BMUB 3EU3A 2EIRA 4XS6A 2CZ2A 4YAVA 2C0DA 1F37A 3GFKA 2N5BA 3ZIVA 4IQ1A 1A2MA 5INYA 3ZMKA 4L0WA 2N5AA 4L0UA 1YZXA 3IE3A 1OYJA 3HHVA 3EINA 4JR4A 1HYUA 3L9UA 4K8MA 1SK1A 3OR5A 4PUFC 2FUG2 2R5GA 2H70A 22GSA 2AJQB 5DJLA 3LEFA 3R3EA 4IKHA 1V58A 4X43A 3F6DA 3TJKA 2FA4A 1B8XA 4WEYA 1M2AA 4O7HA 4CDOA 4BVXB 1Z7RA 1WWJA 2DIZA 2FD3A 2R0GA 4MP4A 1EOHA 4GSTA 2FLSA 1R26A 4HZ2A 1OC9A 4NV2A 2H30A 5B8AA 4X1UA 2HQTA 4HDEA 2HZFA 3VFIA 2VL3A 3UJ1A 2VCWA 3KTLA 4HJMA 1G6YA 1GTBA 3V1WA 1SD9A 4AJ6A 5CP1A 5E4WA 1XIYA 3CSHA 2VLTA 1O73A 3KGKA 1KBNA 2PVQA 3F9UA 4KDYA 3APQA 3G7IA 3W8SA 4L5LA 4OCEA 4I5QA 1SVOA 1PGTA 4XTSA 3LSZA 1EEJA 5J9CA 2DJ1A 4KE3A 3IXRA 4PUAA 3LWAA 3VLNA 2WCIA 1GTUA 1ERTA 1QK8A 4ML1A 1SKSB 4OFMA 4NXIA 4GF0A 2PVOC 2L6CA 3QAVA 1ON4A 2LNSA 1R5PA 4ICYA 3UEMA 3TKSC 3HA9A 2EIOA 1JZRA 3FEUA 4LMWA 5ECSA 2K6VA 2HYXA 4PGTA 1GLQA 3LG6A 2HZEA 4A5PA 2JADA 2ALBA 1GL8A 4IGJA 1ZGNA 3F3RA 1YF0A 2MMOA 3GTUA 2DJKA 2CQ9A 5ECLB 1AIUA 5H5QA 2R2JA 5ID2A 2AYTA 3FR3A 1R7HA 2IIYA 3F8UA 2GDRA 1N8JA 4IP6A 4RI7A 5AISA 3QCPA 1J9BA 2F8FA 1WMJA 4NHWA 2QA1A 3GIXA 3EWLA 2YN1A 5CRHA 1K0AA 3IC8A 3VWWA 1K0BA 2I9HA 4WBRD 2LRTA 4GQFA 1V40A 1GSQA 3GHAA 5D73A 5JCGA 3CWGA 2IMEA 3G7YA 2JL4A 3ZTLA 2A2SA 1S3DA 1Z3EA 3TJGA 1NM3A 4FYCA 4BPYA 3RPPA 2JZTA 1QMVA 1FVJA 3FZ5A 2GS3A 1R5AA 2GQMA 1F9MA 5HR3A 3J7Yk 1I5GA 1QUWA 4G10A 1EV4A 3KIJA 1TRVA 1SD8A 1THXA 4AKIA 1UA5A 3PPUA 3DD3A 4HQSA 4EE0A 3BD2A 5IPGA 3VWVA 4NHZA 5ENUA 3ED3A 5GAND 3QDNA 4AKHA 3QPMA 3UBLA 4AF2A 2GT5A 2EFCA 2I4AA 2VKZG 4KUNA 5CREA 2I1UA 4USSA 5B6NA 1E6BA 3F4SA 4EIPA 1BG5A 2I81A 3GYKA 2LUSA 4ZB8A 5GSTA 4HU7A 2H6ZA 4K6XA 2WJUA 4EVMA 4EKZA 1PMTA 2X4AA 2WFCA 4V2MA 5EL8A 2MBTA 4J57E 3ZFLA 1K0NA 3C7MA 1TTZA 1ML6A 5HR0A 1WE0A 1NW2A 3QAGA 2JACA 3H8QA 2YV7A 4CY6A 1TK8B 2I3YA 1Z9HA 3CTFA 4K0NA 1KTEA 2BTOT 5B8BA 1OC9B 2IN3A 2P5QA 2GSQA 2J9HA 1GTAA 1M0UA 4XS4A 1IYIA 2YZUA 4KSMA 4RI6A 4TN8A 1XVQA 2MMAA 5COHA 1ILOA 1F2EA 4HS1A 1GLPA 3ZREA 5B6MA 5F05A 2OA7A 1QFNA 4MLYA 6GSYA 1FB6A 3TGZA 1XOAA 1DSBA 1EOGA 5H5RA 2NTOA 3GKMA 5D9WA 5KN2A 2K8VA 4IS0A 1TKDB 2TRXA 3RHCA 5DJMA 1SJZA 2YJHA 1AC1A 1SYXA 2MBSA 3D4MA 2VL2C 2GQKA 2OBKA 1XZOA 4WKWA 4LL1B 5ECMB 4XRAA 2B7KA 2HRKA 5JCUA 2A4VA 4E8EA 4EL1A 2OE0A 2TIRA 3Q6OA 1GH2A 2H73A 4F0BA 5J41A 4WXTA 1TRWA 3L9SA 2O8VB 2RUFA 2DJ2A 1GSDA 1M2BA 4Z2RA 3GTUB 3I9V2 1MD3A 3O6TA 2V32A 2OT3A 3DVWA 2WS2A 5KEJA 1I9DA 3L0HA 1X9SB 2LRCA 2H72A 1SVMA 2FNOA 4IP1A 4O32A 1SK0A 5AN1A 3QFBC 1NHYA 1SL0B 1YKAA 4ACSA 2MMNA 1YEXA 2WULA 4Z2TA 5GAPD 1ZL9A 2AAWA 3C71A 3PGTA 2HRFA 4ZBBA 2C0EA 2LEGA 3TB2A 1B9YC 5F8BA 4TKYA 1JZWA 3C1RA 5HR2A 1FG4A 3M9JA 3VPQA 2OE3A 11GSA 2GQLA 3WGEA 3P8WA 2MZCA 3C1SA 5IQYA 5J4YA 1OKDA 3F63A 2K18A 5AIXA 2M72A 3ZRDA 3KM6A 3SWLA 2A4HA 2EC4A 4MNNA 2C3NA 2IL3A 4F9ZA 4O5UA 4JZQA 3C8EA 5DCHA 3FR9A 3MAKA 2ON7A 5DVBA 3HJPA 2FWEA 2L57A 5C00A 1OAZA 3GL5A 4L8EA 1SKRB 3UMAA 1LBKA 5GSSA 3F6FA 1U3AA 5A4UA 4F2IA 3QMXA 3IK9A 1GSUA 1PQNA 1TK0B 4MF5A 3D6IA 3HZ8A 3QFAC 2ZUPA 3CTGA 1EGRA 4YQVA 2O89A 2VLUA 2A2PA 3KMNA 3HXSA 2FA8A 1ERUA 5ECPB 2H01A 3E3EA 4DVCA 3VK9A 3IAS2 2L4CA 1Z5YE 5KN1A 4DSSB 4N0VA 4XS4B 4BWQA 3KMOA 1VF4A 3ZMLA 3HY2A 3DIEA 1THOA 2GSRA 3H93A 2L5LA 2GLRA 3U6VA 4O5QA 1OC3A 2VO4A 2X64A 5CYYA 2B5YA 2VD0A 2WZ9A 2RM5A 4MZBA 2Z9SA 1A8LA 5A5HA 2PN8A 1WJKA 1PN0A 1GUKA 3HVSA 4IW9A 1J0FA 2V6OA 1YEPA 4LL4B 3CSJA 2VIMA 3P2AA 1WIKA 2HSMA 2QA2A 1YDKA 2HT9A 5EVOA 2C8UA 4K7NA 1V9WA 1XCCA 3M8NA 2V1MA 4LLRA 4PNGA 2B5XA 1H4OA 3FW2A 6GSVA 1C72A 4IVFA 1K0MA 3UOMA 3ISOA 3A3TA 2HRKB 2LJAA 2O87A 2PBJA 3TJBA 1OE8A 5CRGA 3FZAA 2X8GA 4K7OA 2F51A 2M46A 5A4VA 4XHMA 5D9TA 2FGXA 5G2ZA 4EO3A 1K0OA 5A4WA 4F0CA 3L9VA 1UN2A 1XWAA 1BG1A 1Z7PA 4N3ZA 3N9JA 2REMA 4WR5A 1WP0A 1QQ2A 1O85A 3TKSE 1SJIA 4K9ZA 4OWYA 2E0QA 2AV4A 4ZB6A 3P7XA 1SYRA 3NZNA 1XFLA 1VF1A 4J56E 1FHEA 1T4YA 5IIZA 5IMDA 1NSWA 2GGTA 4FH8A 2DJ3A 5G5EA 4YKFA 3TCOA 4XCSA 3BCIA 1FOVA 1FAAA 2H66A 4KGIA 3MWHA 4PTSA 1BYEA 4HI7A 2VM2A 4EXJA 3FYGA 3Q18A 1JZDA 1GNWA 5A1NA 3ZIJA 4WF4A 2UV8G 1W89A 4ZILA 1G6WA 5HR1A 5D8IA 2WDUA 1HD2A 2VCVA 4GXZA 3CRTA 1HQOA 1NHOA 1K0CA 4GRFA 1YVLA 5ECRB 2H1GA 5FT3A 3LW9A 5J4UA 5IMCA 2YCDA 2HFDA 3U5RE 1YF1A 5JWOB 2HRNA 4JBBA 3NOFA 1A24A 2XPEA 3RBTA 1Z6NA 4PNFA 1RQMA 1AQWA 4P3YB 2HSHA 5ECHB 4AJ7A 3Q74A 4HOJA 3P90A 1USBA 5IPHA 3WYWA 1XVWA 2C0GA 1TI1A 1XXUA 4BL7A 2QC7A 4BVYB 1GULA 2EFHA 3RPNA 4KH7A 3UL3A 1LU4A 5J40A 1S3CA 3GN3A 1TW9A 1B9XC 1Q4JA 1FW1A 4O5RA 2L6DA 2FY6A 5IOWA 1MTCA 3UVTA 2R0PA 3FHKA 5G1LA 3IC4A 3GH6A 18GSA 1R4WA 4MDCA 4K1FA 4IELA 1HNCA 3SBCA 4KB3A 3UBKA 4POMA 2GZPA 3IOSA 1X5EA 4H86A 4JE1A 3IRAA 5LNKe 3D4TA 2HSMB 4NPBA 2PUKC 4TRXA 4IHUA 1BQ7A 1H75A 5GZZB 3TJFA 4G0KA 2AUVA 2RLIA 3GURA 1SVLA 1EP8A 3CBUA 2B5EA 2L59A 4Q5FA 3HCZA 4ZL7A 4JU5A 2PMTA 1SJ6A 1M7TA 5DQSA 2HLSA 5BRTA 3TU3B 1EP7A 2VL9A 4K2DA 2JSYA 3LXTA 4MZWA 3EYTA 3KP9A 4IQAA 2DBCA 1T3BA 1PD21 4GTUA 1TP9A 4GDFA 4GQCA 2KHPA 3DVXA 3JCML 2LS5A 3ZFBA 3BBYA 4MCUA 3EPTA 3HD5A 2CVBA 5J3RA 2DJJA 5J47A 2QKEA 1OVNA 2H0GA 1JZOA 2ON5A 1DBYA 3I69A 1G7EA 4I6XA 3FK8A 3HYPA 2RM6A 1DUGA 1ZYQB 1X9MB 1N25A 3UIWA 5KN0A 2HSNA 4GWRA 2BJXA 1ZMAA 2V6KA 3QOUA 3WT1A 2N5FA 5F0GA 5HFIA 3GMFA 2M80A 5LCZA 3VI7A 4KAEA 4MPGA 2VCTA 1F3BA 1DE2A 1PRXA 5HFGA 4Q5RA 1HNBA 2P5RA 1O7UA 1XPVA 3HVXA 3F3QA 3GA4A 1JLVA 4POKA 4IBPA 4D73A 2X8CA 3H79A 1N2AA 2C3QA 1T7PB 1AAZA 2L4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQX A;  1X5D A;  2HI7 A;  2AB6 A;  2E7P A;  3IA1 A;  5C04 A;  2GZY A;  4ECI A;  3GKK A;  2GT6 A;  3WGX A;  4L5O A;  1A8Y A;  2P31 A;  4ECB A;  3ERF A;  1V57 A;  2VM1 A;  2HZE B;  1FO5 A;  1PX7 A;  3ZYW A;  1Z6M A;  2CV4 A;  4OFT A;  5ID2 B;  4NMU A;  2XHF A;  1W4V A;  1TJD A;  1X9W B;  1VRS D;  5IMV A;  2OJL A;  1K3L A;  1TOF A;  3MDK A;  4MZC A;  4EDZ A;  2IFQ A;  4MMM A;  4MA9 A;  4BL7 B;  1EEM A;  3D21 A;  3IPZ A;  5J5N A;  4ZBD A;  2ZCT A;  4KF9 A;  1K3O A;  2BMX A;  3KZQ A;  3DYR A;  2R3X A;  3LOR A;  2GST A;  3KJY A;  2OAC A;  2DSA A;  2LQQ A;  1S3A A;  1HNA A;  3G7J A;  2LJR A;  3R2Q A;  2FHE A;  3EC3 A;  3VWU A;  2C4J A;  2OAD A;  3LXZ A;  2PGT A;  2O85 A;  7GSS A;  5ECK B;  3CRU A;  2J23 A;  1GUH A;  1KEB A;  6GSX A;  1E2Y A;  3MNG A;  3A2V A;  5H5S A;  3KEB A;  2VUP A;  3ME8 A;  3UAR A;  4F03 A;  1WOU A;  2YAN A;  12GS A;  3VI5 A;  3D22 A;  3GUS A;  4OCF A;  3FKF A;  3LYP A;  5D93 A;  1TI3 A;  1OE7 A;  2H76 A;  3GRX A;  2A2R A;  4YQU A;  1ERW A;  5DAL A;  5A5K A;  1BAY A;  3QR6 A;  1QGV A;  4POB A;  4RQR A;  3H4K A;  5IMA A;  1PKW A;  2NDO A;  2IMK A;  1EZK A;  2YZH A;  5FHI A;  1LJR A;  2DIY A;  4JR6 A;  5G30 A;  1F6M C;  3F4R A;  4Z7X A;  4YAP A;  2PU9 C;  1SU9 A;  8GSS A;  1A2J A;  1GTI A;  3GX8 A;  2X8H A;  4QQ7 A;  4KSO A;  5JWQ B;  2DMM A;  1JFU A;  2F3M A;  1K0D A;  3WT2 A;  4TR3 A;  4TW5 A;  1XWB A;  2JZS A;  1AW9 A;  2C3T A;  1PKZ A;  3GL3 A;  1ST9 A;  4KCE A;  2G0F A;  3IHQ A;  3A2X A;  3EU4 A;  1AQV A;  4YH2 A;  1FB0 A;  4G9H A;  1M9B A;  3A2W A;  20GS A;  2H8L A;  4ML6 A;  5CRD A;  2VCZ A;  2HSY A;  3KP8 A;  4G19 A;  2HSN B;  4FQU A;  2QGV A;  5F07 A;  3DEX A;  1XW6 A;  4NV5 A;  3PR8 A;  3VWX A;  2G2Q A;  5EY6 A;  1TXX A;  4KDU A;  1VF3 A;  3DWV A;  2KP1 A;  1FVK A;  2XBI A;  1RW1 A;  3RDW A;  2JU5 A;  3FZ4 A;  5DAK A;  4GCI A;  4LA1 A;  4AJ8 A;  3BOA A;  1IYH A;  4FIW A;  3DRN A;  2B7J A;  2YP6 A;  2ZNM A;  5DDL A;  1PL1 A;  4D73 B;  1U3I A;  1XW5 A;  4I8B A;  2JZR A;  3TKR A;  1UC7 A;  4MPF A;  4MJE A;  4AGS A;  2D2Z A;  1GRX A;  1T8E B;  17GS A;  2YPM A;  1JHB A;  1XWG A;  2H74 A;  3N5O A;  4I2U A;  4MH3 A;  2CVD A;  1T00 A;  2DC5 A;  1WPI A;  1J08 A;  3TRP A;  1V2A A;  1YJ6 A;  4PX1 A;  1GSY A;  1OKT A;  2LTK A;  2PWJ A;  2KLX A;  2IWT A;  1O6J A;  1XW9 A;  4N30 A;  4OFN A;  1SL1 B;  2IFQ B;  3IR4 A;  1ZOF A;  1PA3 A;  4XS1 A;  4DEJ A;  4XIH A;  13GS A;  2HE3 A;  2NBS A;  5ECQ B;  3GX0 A;  2FWG A;  16GS A;  6GSW A;  1U6T A;  2IMI A;  2PPT A;  4RQX A;  2WB9 A;  2VCQ A;  1Y6E A;  3CYN A;  5EPF A;  3NIV A;  2HXK A;  4ULX A;  5DQY A;  4FO5 A;  3E0U A;  3Q19 A;  3DML A;  2H6Y A;  3HVV A;  14GS A;  5L71 A;  1MDK A;  1ZZY A;  2H6X A;  3I6A A;  5JWR B;  4G2E A;  3GSS A;  1YY7 A;  4KX4 A;  1URM A;  4MH2 A;  2RUE A;  4MJB A;  2KOK A;  4EF0 A;  2DJ0 A;  1KNG A;  3IDV A;  2LV3 A;  5DAL B;  1B4P A;  1A0F A;  2ES7 A;  2YWI A;  2IJY A;  4QL9 A;  1CQG A;  3TRX A;  3CSI A;  1GWC A;  2VAF A;  1DE1 A;  3CMI A;  3L4N A;  3O76 A;  3ERW A;  3HKR A;  2R37 A;  2VD1 A;  2JSZ A;  4KA0 A;  1X5C A;  1QXH A;  3PH9 A;  2MYG A;  2LQO A;  4TOP A;  3TKP A;  2YWN A;  4GSN A;  4TXO A;  2DLX A;  5IMF A;  1SL2 B;  1TU8 A;  2KP2 A;  1XWK A;  2YV9 A;  5ECN B;  3ZLP A;  5IMZ A;  1U88 A;  3ZZX A;  3TJJ A;  1EV9 A;  1G7O A;  2RII A;  4WET A;  4CW9 A;  4BWS A;  6GST A;  3EE2 A;  3TDG A;  1B4Q A;  2PER A;  4V1A p;  5DBQ A;  4TVE A;  1BED A;  2GTU A;  1A0R P;  2OKA A;  3HZ4 A;  4FYU A;  3AY8 A;  4N11 A;  1GSF A;  2NPB A;  2YJ7 A;  5CAX A;  3FR6 A;  4PQ1 A;  3IK7 A;  1M99 A;  2XBQ A;  4Q5N A;  2C80 A;  3H1N A;  3ERG A;  4N0Z A;  4CHS A;  4MJC A;  3EMX A;  4V1A g;  2LNT A;  1T1V A;  2UZ8 A;  1WRY A;  3EVI A;  3FRC A;  5D9V A;  1M2D A;  1O8W A;  2H0I A;  3GST A;  2F8A A;  5DAK B;  4G0L A;  2CAI A;  2NVL A;  3A5W A;  4MK3 A;  4NAX A;  2YNX A;  5CRW A;  5CNW A;  3M0F A;  2WGR A;  4N10 A;  4TR1 A;  5KN3 A;  5HQP A;  5IO0 A;  5B7C A;  5ABR A;  3D0Z A;  3KTB A;  1B48 A;  1MDI A;  3RHB A;  5AGY A;  6GSS A;  3D5J A;  3E9J B;  5ECO B;  1ZYE A;  2H1D A;  1TU7 A;  1CQH A;  3ZVJ D;  4ZBA A;  4HZ4 A;  1OC8 A;  3M1G A;  2P0G A;  4IJ3 A;  3HDC A;  3LGC A;  1SEN A;  1BX9 A;  5G1K A;  1UVZ A;  3M9K A;  4V2N A;  3WGD A;  4Q5Q A;  3K8N A;  5ELG A;  2CX4 A;  1JLW A;  3WD6 A;  3KCM A;  2YOI A;  4KCA A;  2H0H A;  4FYB A;  4HU9 A;  3IBH A;  3S9F A;  4G0I A;  1SK2 A;  3TKS A;  1U87 A;  2HRA A;  2L5O A;  2F9S A;  3QD9 A;  4EDY A;  3KH9 A;  1PSQ A;  2YWM A;  4DSS A;  1V98 A;  2XPD A;  2H1B A;  2EIQ A;  3VPT A;  4K0G A;  4OO5 A;  1TRS A;  4RUV A;  3W6G A;  2H1A A;  3FZ9 A;  2H75 A;  3APO A;  4V2L A;  3KD0 A;  2QSI A;  1ABA A;  5BMU A;  5JCW A;  5IM9 A;  2E2M A;  5CO3 A;  4ILF A;  2K8S A;  4YQM A;  3HJM A;  4HUA A;  4PUR A;  1MEK A;  3KH7 A;  1XWC A;  1ZCP A;  5AIV A;  4I97 A;  5ECI B;  3I43 A;  2H19 A;  4OO4 A;  3EMP A;  2V41 A;  1MDJ A;  1PN9 A;  2O7K A;  4OMV A;  3ME7 A;  3DGQ A;  3HJO A;  3W8J A;  4WBJ A;  2CAQ A;  3FY7 A;  19GS A;  1XOB A;  1ACV A;  4PQH A;  4J2F A;  4WF5 A;  2K9F A;  2LRN A;  1Q98 A;  1O81 A;  5IOX A;  4MF6 A;  1TDI A;  2CZ3 A;  1VGL A;  5DCG A;  4BVX A;  9GSS A;  1A2L A;  1YKC A;  2IMD A;  2XC2 A;  1PL2 A;  4EUY A;  1XBS A;  2LJK A;  4JED A;  3LFL A;  4ZL9 A;  4GSS A;  3VUR A;  2CX3 A;  1O8X A;  4TXO B;  1GSS A;  1X0R A;  5LD0 A;  3GKN A;  5IO2 A;  1TRU A;  3ZIT A;  1EGO A;  4MJA A;  2LST A;  2CVK A;  3PIN A;  4OD7 A;  4I2T A;  4MF7 A;  2IPA A;  4DSQ A;  3CXG A;  4E8H A;  6GSU A;  1VF2 A;  1GNE A;  2FCH A;  4EC0 A;  2LKU A;  1YQ1 A;  4POL A;  2B3S A;  5D96 A;  3LQ7 A;  3L78 A;  1T4Z A;  2H71 A;  4O92 A;  2E2G A;  4XRD A;  3GNJ A;  4PXO A;  2FWH A;  2HNL A;  4ID0 A;  4LMV A;  3KXO A;  10GS A;  3GV1 A;  4IJI A;  2WRT A;  3J7Y b;  3F4T A;  4ZXG A;  4F82 A;  5HFK A;  4KND A;  2C1Y A;  4ECJ A;  4ZL8 A;  5F06 A;  3O3T A;  1GP1 A;  5G31 A;  4HJ2 A;  2KUC A;  4QL7 A;  2B1K A;  4TR4 A;  1BJX A;  4JRR A;  2CA8 A;  4ECC A;  3TRQ A;  2R4V A;  2C0F A;  4ZIJ A;  3UVH A;  1MD4 A;  1F3A A;  4KW6 A;  1AXD A;  2VOC A;  4TR1 B;  2GZZ A;  4GLT A;  3ZVJ A;  5D9X A;  1GUM A;  2X99 A;  3G9B A;  2IMF A;  4WR4 A;  1M9A A;  5ELA A;  4NWY A;  2VCX A;  3DXB A;  3GKX A;  3TOT A;  3C73 A;  2GSS A;  4X0X A;  4KDX A;  2AHE A;  1A23 A;  4TR0 A;  3M3M A;  3QAW A;  3BJ5 A;  2V2G A;  3EUR A;  3GH9 A;  1TK5 B;  3IV4 A;  2TRC P;  2VL2 A;  1Y25 A;  1ERV A;  3RAZ A;  2DML A;  2B1L A;  1EWX A;  2OE1 A;  2R6K A;  3UAP A;  2OBI A;  3TUE A;  1AUC A;  2YWO A;  1RK4 A;  4BVY A;  2CT6 A;  3IAM 2;  3US3 A;  5FWG A;  3MSZ A;  4MAB A;  3ZL5 A;  1SKW B;  3BCK A;  3F0I A;  4K7I A;  3LJR A;  3TOU A;  4IN0 A;  1GSE A;  4PQI A;  2FWF A;  3DKS A;  1PX6 A;  2GVP A;  3TKQ A;  4DSR A;  2MMZ A;  3LYK A;  5J9B A;  5G5F A;  1G0T A;  4HEA 2;  2B6M A;  4BA7 A;  2VLV A;  1K3Y A;  5E59 A;  3APS A;  4TXV A;  4ZB9 A;  4HQZ A;  4ISD A;  2EIR A;  3EU3 A;  4XS6 A;  2CZ2 A;  4YAV A;  2C0D A;  1F37 A;  3GFK A;  2N5B A;  3ZIV A;  4IQ1 A;  1A2M A;  5INY A;  3ZMK A;  4L0W A;  2N5A A;  4L0U A;  1YZX A;  3IE3 A;  1OYJ A;  3HHV A;  3EIN A;  4JR4 A;  1HYU A;  3L9U A;  4K8M A;  1SK1 A;  3OR5 A;  4PUF C;  2FUG 2;  2R5G A;  2H70 A;  22GS A;  2AJQ B;  5DJL A;  3LEF A;  3R3E A;  4IKH A;  1V58 A;  4X43 A;  3F6D A;  3TJK A;  2FA4 A;  1B8X A;  4WEY A;  1M2A A;  4O7H A;  4CDO A;  4BVX B;  1Z7R A;  1WWJ A;  2DIZ A;  2FD3 A;  4MP4 A;  1EOH A;  4GST A;  2FLS A;  1R26 A;  4HZ2 A;  1OC9 A;  4NV2 A;  2H30 A;  5B8A A;  4X1U A;  2HQT A;  4HDE A;  2HZF A;  3VFI A;  2VL3 A;  3UJ1 A;  2VCW A;  3KTL A;  4HJM A;  1G6Y A;  1GTB A;  3V1W A;  1SD9 A;  4AJ6 A;  5CP1 A;  5E4W A;  1XIY A;  3CSH A;  2VLT A;  1O73 A;  3KGK A;  1KBN A;  2PVQ A;  3F9U A;  4KDY A;  3APQ A;  3G7I A;  3W8S A;  4L5L A;  4OCE A;  4I5Q A;  1PGT A;  4XTS A;  3LSZ A;  1EEJ A;  5J9C A;  2DJ1 A;  4KE3 A;  3IXR A;  4PUA A;  3LWA A;  3VLN A;  2WCI A;  1GTU A;  1ERT A;  1QK8 A;  4ML1 A;  1SKS B;  4OFM A;  4NXI A;  4GF0 A;  2PVO C;  2L6C A;  3QAV A;  1ON4 A;  2LNS A;  1R5P A;  3UEM A;  3TKS C;  3HA9 A;  2EIO A;  1JZR A;  3FEU A;  4LMW A;  5ECS A;  2K6V A;  2HYX A;  4PGT A;  1GLQ A;  3LG6 A;  2HZE A;  2JAD A;  2ALB A;  1GL8 A;  4IGJ A;  1ZGN A;  3F3R A;  1YF0 A;  2MMO A;  3GTU A;  2DJK A;  2CQ9 A;  5ECL B;  1AIU A;  5H5Q A;  2R2J A;  5ID2 A;  2AYT A;  3FR3 A;  1R7H A;  2IIY A;  3F8U A;  2GDR A;  1N8J A;  4IP6 A;  4RI7 A;  5AIS A;  3QCP A;  1J9B A;  2F8F A;  1WMJ A;  4NHW A;  3GIX A;  3EWL A;  2YN1 A;  5CRH A;  1K0A A;  3IC8 A;  3VWW A;  1K0B A;  2I9H A;  4WBR D;  2LRT A;  4GQF A;  1V40 A;  1GSQ A;  3GHA A;  5D73 A;  5JCG A;  2IME A;  3G7Y A;  2JL4 A;  3ZTL A;  2A2S A;  1S3D A;  1Z3E A;  3TJG A;  1NM3 A;  4FYC A;  4BPY A;  3RPP A;  2JZT A;  1QMV A;  1FVJ A;  3FZ5 A;  2GS3 A;  1R5A A;  2GQM A;  1F9M A;  5HR3 A;  3J7Y k;  1I5G A;  1QUW A;  4G10 A;  1EV4 A;  3KIJ A;  1TRV A;  1SD8 A;  1THX A;  1UA5 A;  3PPU A;  3DD3 A;  4HQS A;  4EE0 A;  3BD2 A;  5IPG A;  3VWV A;  4NHZ A;  5ENU A;  3ED3 A;  5GAN D;  3QDN A;  3QPM A;  4AF2 A;  3UBL A;  2GT5 A;  2I4A A;  4KUN A;  5CRE A;  2I1U A;  4USS A;  5B6N A;  1E6B A;  3F4S A;  1BG5 A;  2I81 A;  3GYK A;  2LUS A;  4ZB8 A;  5GST A;  4HU7 A;  2H6Z A;  4K6X A;  2WJU A;  4EVM A;  4EKZ A;  1PMT A;  2WFC A;  4V2M A;  5EL8 A;  2MBT A;  4J57 E;  3ZFL A;  1K0N A;  3C7M A;  1TTZ A;  1ML6 A;  5HR0 A;  1WE0 A;  1NW2 A;  3QAG A;  2JAC A;  3H8Q A;  2YV7 A;  1TK8 B;  2I3Y A;  1Z9H A;  3CTF A;  4K0N A;  1KTE A;  2BTO T;  5B8B A;  1OC9 B;  2IN3 A;  2P5Q A;  2GSQ A;  2J9H A;  1GTA A;  1M0U A;  4XS4 A;  1IYI A;  2YZU A;  4KSM A;  4RI6 A;  4TN8 A;  1XVQ A;  2MMA A;  5COH A;  1ILO A;  1F2E A;  4HS1 A;  1GLP A;  3ZRE A;  5B6M A;  5F05 A;  2OA7 A;  1QFN A;  4MLY A;  6GSY A;  1FB6 A;  3TGZ A;  1XOA A;  1DSB A;  1EOG A;  5H5R A;  2NTO A;  3GKM A;  5D9W A;  5KN2 A;  2K8V A;  4IS0 A;  1TKD B;  2TRX A;  3RHC A;  5DJM A;  1SJZ A;  2YJH A;  1AC1 A;  1SYX A;  2MBS A;  3D4M A;  2VL2 C;  2GQK A;  2OBK A;  1XZO A;  4WKW A;  4LL1 B;  5ECM B;  4XRA A;  2B7K A;  2HRK A;  5JCU A;  2A4V A;  4E8E A;  4EL1 A;  2OE0 A;  2TIR A;  3Q6O A;  1GH2 A;  2H73 A;  4F0B A;  5J41 A;  4WXT A;  1TRW A;  3L9S A;  2O8V B;  2RUF A;  2DJ2 A;  1GSD A;  1M2B A;  3GTU B;  3I9V 2;  1MD3 A;  3O6T A;  2V32 A;  3DVW A;  2WS2 A;  5KEJ A;  1I9D A;  3L0H A;  1X9S B;  2LRC A;  2H72 A;  2FNO A;  4IP1 A;  4O32 A;  1SK0 A;  5AN1 A;  3QFB C;  1NHY A;  1SL0 B;  1YKA A;  4ACS A;  2MMN A;  1YEX A;  2WUL A;  5GAP D;  1ZL9 A;  2AAW A;  3C71 A;  3PGT A;  2HRF A;  4ZBB A;  2C0E A;  2LEG A;  3TB2 A;  1B9Y C;  5F8B A;  4TKY A;  1JZW A;  3C1R A;  5HR2 A;  1FG4 A;  3M9J A;  3VPQ A;  2OE3 A;  11GS A;  2GQL A;  3WGE A;  3P8W A;  2MZC A;  3C1S A;  5IQY A;  1OKD A;  3F63 A;  2K18 A;  5AIX A;  2M72 A;  3ZRD A;  3KM6 A;  3SWL A;  2EC4 A;  2C3N A;  2IL3 A;  4F9Z A;  4JZQ A;  3C8E A;  5DCH A;  3FR9 A;  3MAK A;  2ON7 A;  5DVB A;  3HJP A;  2FWE A;  2L57 A;  5C00 A;  1OAZ A;  3GL5 A;  4L8E A;  1SKR B;  3UMA A;  1LBK A;  5GSS A;  3F6F A;  1U3A A;  5A4U A;  4F2I A;  3QMX A;  3IK9 A;  1GSU A;  1PQN A;  1TK0 B;  4MF5 A;  3D6I A;  3HZ8 A;  3QFA C;  2ZUP A;  3CTG A;  1EGR A;  4YQV A;  2O89 A;  2VLU A;  3KMN A;  3HXS A;  2FA8 A;  1ERU A;  5ECP B;  2H01 A;  3E3E A;  4DVC A;  3VK9 A;  3IAS 2;  2L4C A;  1Z5Y E;  5KN1 A;  4DSS B;  4N0V A;  4XS4 B;  4BWQ A;  3KMO A;  1VF4 A;  3ZML A;  3HY2 A;  3DIE A;  1THO A;  2GSR A;  3H93 A;  2L5L A;  2GLR A;  3U6V A;  1OC3 A;  2VO4 A;  2X64 A;  5CYY A;  2B5Y A;  2VD0 A;  2WZ9 A;  2RM5 A;  4MZB A;  2Z9S A;  1A8L A;  2PN8 A;  1WJK A;  1GUK A;  3HVS A;  4IW9 A;  1J0F A;  2V6O A;  1YEP A;  4LL4 B;  3CSJ A;  2VIM A;  3P2A A;  1WIK A;  2HSM A;  1YDK A;  2HT9 A;  5EVO A;  2C8U A;  4K7N A;  1V9W A;  1XCC A;  3M8N A;  2V1M A;  4LLR A;  4PNG A;  2B5X A;  1H4O A;  3FW2 A;  6GSV A;  1C72 A;  4IVF A;  1K0M A;  3UOM A;  3ISO A;  3A3T A;  2HRK B;  2LJA A;  2O87 A;  2PBJ A;  3TJB A;  1OE8 A;  5CRG A;  3FZA A;  2X8G A;  4K7O A;  2F51 A;  2M46 A;  5A4V A;  4XHM A;  5D9T A;  2FGX A;  5G2Z A;  4EO3 A;  1K0O A;  5A4W A;  4F0C A;  3L9V A;  1UN2 A;  1XWA A;  1Z7P A;  3N9J A;  2REM A;  4WR5 A;  1WP0 A;  1QQ2 A;  1O85 A;  3TKS E;  1SJI A;  4K9Z A;  4OWY A;  2E0Q A;  2AV4 A;  4ZB6 A;  3P7X A;  1SYR A;  3NZN A;  1XFL A;  1VF1 A;  4J56 E;  1FHE A;  1T4Y A;  5IIZ A;  5IMD A;  1NSW A;  2GGT A;  4FH8 A;  2DJ3 A;  5G5E A;  3TCO A;  4XCS A;  3BCI A;  1FOV A;  1FAA A;  2H66 A;  4KGI A;  3MWH A;  4PTS A;  1BYE A;  4HI7 A;  2VM2 A;  4EXJ A;  3FYG A;  3Q18 A;  1JZD A;  1GNW A;  3ZIJ A;  4WF4 A;  1W89 A;  4ZIL A;  1G6W A;  5HR1 A;  5D8I A;  2WDU A;  1HD2 A;  2VCV A;  4GXZ A;  3CRT A;  1HQO A;  1NHO A;  1K0C A;  4GRF A;  5ECR B;  2H1G A;  5FT3 A;  5J4U A;  5IMC A;  2YCD A;  2HFD A;  3U5R E;  1YF1 A;  5JWO B;  2HRN A;  4JBB A;  3NOF A;  1A24 A;  2XPE A;  3RBT A;  1Z6N A;  4PNF A;  1RQM A;  1AQW A;  4P3Y B;  2HSH A;  5ECH B;  4AJ7 A;  3Q74 A;  4HOJ A;  3P90 A;  1USB A;  5IPH A;  3WYW A;  1XVW A;  2C0G A;  1TI1 A;  1XXU A;  4BL7 A;  2QC7 A;  4BVY B;  1GUL A;  3RPN A;  4KH7 A;  3UL3 A;  1LU4 A;  1S3C A;  3GN3 A;  1TW9 A;  1B9X C;  1Q4J A;  1FW1 A;  4O5R A;  2L6D A;  2FY6 A;  5IOW A;  1MTC A;  3UVT A;  3FHK A;  5G1L A;  3IC4 A;  3GH6 A;  18GS A;  1R4W A;  4MDC A;  4K1F A;  4IEL A;  1HNC A;  3SBC A;  4KB3 A;  3UBK A;  4POM A;  2GZP A;  3IOS A;  1X5E A;  4H86 A;  4JE1 A;  3IRA A;  5LNK e;  3D4T A;  2HSM B;  4NPB A;  2PUK C;  4TRX A;  4IHU A;  1BQ7 A;  1H75 A;  5GZZ B;  3TJF A;  4G0K A;  2AUV A;  2RLI A;  3GUR A;  1EP8 A;  3CBU A;  2B5E A;  2L59 A;  4Q5F A;  3HCZ A;  4ZL7 A;  4JU5 A;  2PMT A;  1SJ6 A;  1M7T A;  5DQS A;  2HLS A;  1EP7 A;  2VL9 A;  4K2D A;  2JSY A;  3LXT A;  4MZW A;  3EYT A;  3KP9 A;  4IQA A;  2DBC A;  1T3B A;  1PD2 1;  4GTU A;  1TP9 A;  4GQC A;  2KHP A;  3DVX A;  3JCM L;  2LS5 A;  3ZFB A;  3BBY A;  4MCU A;  3HD5 A;  2CVB A;  5J3R A;  2DJJ A;  2QKE A;  1OVN A;  2H0G A;  1JZO A;  2ON5 A;  1DBY A;  3I69 A;  1G7E A;  4I6X A;  3FK8 A;  3HYP A;  2RM6 A;  1DUG A;  1ZYQ B;  1X9M B;  3UIW A;  5KN0 A;  4GWR A;  2BJX A;  1ZMA A;  2V6K A;  3QOU A;  3WT1 A;  2N5F A;  5F0G A;  5HFI A;  3GMF A;  2M80 A;  5LCZ A;  3VI7 A;  4KAE A;  4MPG A;  2VCT A;  1F3B A;  1DE2 A;  1PRX A;  5HFG A;  4Q5R A;  1HNB A;  2P5R A;  1O7U A;  1XPV A;  3HVX A;  3F3Q A;  3GA4 A;  1JLV A;  4POK A;  4IBP A;  4D73 A;  2X8C A;  3H79 A;  1N2A A;  2C3Q A;  1T7P B;  1AAZ A;  2L4Q A; 
#chains in the Genus database with same CATH topology
 1AQX A;  1X5D A;  2HI7 A;  2AB6 A;  2E7P A;  3IA1 A;  4ZB7 A;  3HMJ G;  5C04 A;  2GZY A;  4ECI A;  3GKK A;  2GT6 A;  3WGX A;  4L5O A;  1A8Y A;  2P31 A;  4ECB A;  3ERF A;  1V57 A;  2VM1 A;  2HZE B;  1FO5 A;  4Z2U A;  1PX7 A;  3ZYW A;  1Z6M A;  2CV4 A;  4OFT A;  5ID2 B;  4NMU A;  2XHF A;  1W4V A;  3MIX A;  1TJD A;  1X9W B;  1VRS D;  5IMV A;  2OJL A;  1K3L A;  1TOF A;  3MDK A;  4MZC A;  4EDZ A;  2IFQ A;  4MMM A;  4MA9 A;  4BL7 B;  1EEM A;  3D21 A;  3IPZ A;  5J5N A;  4ZBD A;  2ZCT A;  4KF9 A;  1K3O A;  2BMX A;  3KZQ A;  3DYR A;  2R3X A;  3LOR A;  2GST A;  3KJY A;  2OAC A;  2DSA A;  2LQQ A;  1S3A A;  1HNA A;  3G7J A;  2LJR A;  3R2Q A;  2FHE A;  3EC3 A;  3VWU A;  2C4J A;  2OAD A;  3LXZ A;  2PGT A;  2O85 A;  7GSS A;  5ECK B;  3FMW A;  3CRU A;  4K5R A;  2J23 A;  1GUH A;  1KEB A;  6GSX A;  1E2Y A;  3MNG A;  3A2V A;  5H5S A;  1ZYP A;  3KEB A;  2VUP A;  3ME8 A;  1BF5 A;  3UAR A;  4F03 A;  1WOU A;  2YAN A;  12GS A;  3VI5 A;  3D22 A;  3GUS A;  4OCF A;  3FKF A;  3LYP A;  5D93 A;  1TI3 A;  1OE7 A;  2H76 A;  3GRX A;  2A2R A;  4YQU A;  1ERW A;  5DAL A;  5A5K A;  1BAY A;  3QR6 A;  1QGV A;  4POB A;  4RQR A;  3H4K A;  5IMA A;  1PKW A;  2NDO A;  4AI6 A;  4AKX B;  2IMK A;  1EZK A;  2YZH A;  5FHI A;  1LJR A;  2DIY A;  4JR6 A;  5G30 A;  1F6M C;  3F4R A;  4Z7X A;  4YAP A;  2PU9 C;  1SU9 A;  8GSS A;  1A2J A;  1GTI A;  3GX8 A;  2X8H A;  4QQ7 A;  4KSO A;  5JWQ B;  2DMM A;  2X49 A;  1JFU A;  2F3M A;  1K0D A;  3WT2 A;  4TR3 A;  4TW5 A;  1XWB A;  2JZS A;  1AW9 A;  2C3T A;  1PKZ A;  3GL3 A;  1ST9 A;  4KCE A;  2G0F A;  3IHQ A;  3A2X A;  3EU4 A;  1AQV A;  4YH2 A;  1FB0 A;  4G9H A;  1M9B A;  3A2W A;  20GS A;  2H8L A;  4ML6 A;  5CRD A;  2VCZ A;  2HSY A;  2R0C A;  3KP8 A;  2H1L A;  2HSN B;  4G19 A;  4FQU A;  2QGV A;  5F07 A;  3DEX A;  1XW6 A;  4NV5 A;  3PR8 A;  3VWX A;  2G2Q A;  5EY6 A;  1TXX A;  4KDU A;  1VF3 A;  3DWV A;  2KP1 A;  1FVK A;  2XBI A;  1RW1 A;  3RDW A;  2JU5 A;  3FZ4 A;  5DAK A;  4GCI A;  4QMK A;  4LA1 A;  4EIQ A;  4AJ8 A;  3BOA A;  1IYH A;  4FIW A;  3DRN A;  2ZNM A;  2B7J A;  2YP6 A;  5DDL A;  1PL1 A;  4D73 B;  1U3I A;  1XW5 A;  4I8B A;  5J4V A;  2JZR A;  3TKR A;  1UC7 A;  4MPF A;  4MJE A;  4AGS A;  2WW0 A;  2D2Z A;  1GRX A;  1T8E B;  17GS A;  2YPM A;  1JHB A;  1XWG A;  2H74 A;  3N5O A;  4I2U A;  4MH3 A;  2CVD A;  1T00 A;  2DC5 A;  1WPI A;  1J08 A;  3TRP A;  1V2A A;  1YJ6 A;  4PX1 A;  1GSY A;  1OKT A;  2LTK A;  2PWJ A;  2KLX A;  2IWT A;  5KOX A;  1O6J A;  1XW9 A;  4N30 A;  4OFN A;  1SL1 B;  2EFE A;  2IFQ B;  3IR4 A;  1ZOF A;  1PA3 A;  4XS1 A;  4DEJ A;  4XIH A;  4K5S A;  13GS A;  2HE3 A;  2NBS A;  5ECQ B;  3GX0 A;  2FWG A;  16GS A;  6GSW A;  1U6T A;  2IMI A;  2PPT A;  4RQX A;  2WB9 A;  2VCQ A;  1Y6E A;  3CYN A;  5EPF A;  3NIV A;  2HXK A;  4ULX A;  4AKG A;  4BIK A;  5DQY A;  4FO5 A;  3E0U A;  3Q19 A;  3DML A;  2H6Y A;  3HVV A;  14GS A;  5L71 A;  1MDK A;  1XG8 A;  1ZZY A;  2H6X A;  3I6A A;  5JWR B;  4G2E A;  3GSS A;  1YY7 A;  4KX4 A;  1URM A;  4MH2 A;  2RUE A;  4MJB A;  2KOK A;  4EF0 A;  2DJ0 A;  1KNG A;  3IDV A;  2LV3 A;  5DAL B;  1B4P A;  1A0F A;  2ES7 A;  2YWI A;  2IJY A;  4QL9 A;  1CQG A;  3TRX A;  3CSI A;  1GWC A;  2EFD A;  2VAF A;  1DE1 A;  3CMI A;  3L4N A;  4W66 A;  3O76 A;  3ERW A;  3HKR A;  2R37 A;  2VD1 A;  2JSZ A;  4KA0 A;  1X5C A;  1QXH A;  4E68 A;  3PH9 A;  2MYG A;  2LQO A;  4TOP A;  3TKP A;  2YWN A;  4GSN A;  4TXO A;  2DLX A;  5IMF A;  1SL2 B;  1TU8 A;  2KP2 A;  1XWK A;  2YV9 A;  5ECN B;  3ZLP A;  5IMZ A;  1U88 A;  3ZZX A;  3TJJ A;  1EV9 A;  1G7O A;  2RII A;  4WET A;  4CW9 A;  4BWS A;  6GST A;  3EE2 A;  3TDG A;  1B4Q A;  3CQF A;  2PER A;  4V1A p;  5DBQ A;  4TVE A;  1BED A;  3IHG A;  2GTU A;  1S3R A;  1A0R P;  2OKA A;  3HZ4 A;  4FYU A;  3AY8 A;  4N11 A;  1GSF A;  2NPB A;  2YJ7 A;  5CAX A;  3FR6 A;  4PQ1 A;  3IK7 A;  1M99 A;  2XBQ A;  4Q5N A;  2C80 A;  3H1N A;  3ERG A;  5A5H B;  4PI2 C;  4N0Z A;  4CHS A;  4MJC A;  3EMX A;  4V1A g;  2LNT A;  1T1V A;  2UZ8 A;  1WRY A;  3EVI A;  3FRC A;  5D9V A;  1M2D A;  1O8W A;  2H0I A;  4PHZ C;  3GST A;  2F8A A;  5DAK B;  4G0L A;  2CAI A;  2NVL A;  3A5W A;  4MK3 A;  4NAX A;  2YNX A;  5CRW A;  5CNW A;  2DKI A;  3M0F A;  2WGR A;  4N10 A;  4TR1 A;  5KN3 A;  5HQP A;  5IO0 A;  5B7C A;  5ABR A;  3D0Z A;  3KTB A;  4X4J A;  1B48 A;  1MDI A;  3RHB A;  5AGY A;  6GSS A;  3A5I A;  3D5J A;  3E9J B;  5A34 A;  5ECO B;  1ZYE A;  2H1D A;  1TU7 A;  1CQH A;  3ZVJ D;  4ZBA A;  4HZ4 A;  1OC8 A;  3M1G A;  2P0G A;  4IJ3 A;  3HDC A;  3LGC A;  1SEN A;  1BX9 A;  5G1K A;  1UVZ A;  3M9K A;  4V2N A;  3WGD A;  4Q5Q A;  3RGB C;  3K8N A;  5ELG A;  2CX4 A;  1JLW A;  3WD6 A;  3KCM A;  2YOI A;  4KCA A;  2H0H A;  4FYB A;  4HU9 A;  3IBH A;  3S9F A;  4G0I A;  1SK2 A;  3TKS A;  1U87 A;  2HRA A;  2WW1 A;  2L5O A;  2F9S A;  3QD9 A;  4EDY A;  3KH9 A;  1PSQ A;  2YWM A;  4DSS A;  1V98 A;  2XPD A;  2H1B A;  2EIQ A;  3VPT A;  4K0G A;  1M3J A;  4K2X A;  4OO5 A;  1TRS A;  4RUV A;  3W6G A;  2H1A A;  3FZ9 A;  2H75 A;  3APO A;  4V2L A;  3KD0 A;  2QSI A;  1ABA A;  5BMU A;  5JCW A;  5IM9 A;  2E2M A;  5CO3 A;  4ILF A;  2K8S A;  4YQM A;  3HJM A;  4HUA A;  4PUR A;  1MEK A;  3KH7 A;  1XWC A;  1ZCP A;  5AIV A;  4I97 A;  5ECI B;  3I43 A;  5A1N B;  2H19 A;  4OO4 A;  3EMP A;  2V41 A;  1MDJ A;  1YEW C;  1PN9 A;  2O7K A;  4OMV A;  3ME7 A;  3DGQ A;  3HJO A;  3W8J A;  4WBJ A;  2CAQ A;  3FY7 A;  19GS A;  4YKG A;  1XOB A;  1ACV A;  4PQH A;  4J2F A;  4WF5 A;  2K9F A;  2LRN A;  1Q98 A;  1O81 A;  5IOX A;  4MF6 A;  1TDI A;  4G01 A;  2CZ3 A;  1VGL A;  5DCG A;  4BVX A;  9GSS A;  1A2L A;  1YKC A;  2IMD A;  2WVY A;  2XC2 A;  1PL2 A;  4EUY A;  1XBS A;  2LJK A;  4JED A;  3LFL A;  4ZL9 A;  4GSS A;  3VUR A;  2CX3 A;  1O8X A;  4CY8 A;  4TXO B;  1GSS A;  2O36 A;  1X0R A;  5LD0 A;  3GKN A;  5IO2 A;  1TRU A;  3ZIT A;  1EGO A;  4MJA A;  2LST A;  2CVK A;  3PIN A;  4OD7 A;  4I2T A;  4MF7 A;  2IPA A;  4DSQ A;  3CXG A;  4E8H A;  6GSU A;  1VF2 A;  1GNE A;  2FCH A;  4EC0 A;  2LKU A;  1YQ1 A;  2O5V A;  4POL A;  2B3S A;  5D96 A;  3LQ7 A;  3L78 A;  1T4Z A;  1ZYN A;  2H71 A;  4O92 A;  2E2G A;  4XRD A;  3GNJ A;  4PXO A;  2FWH A;  2HNL A;  4ID0 A;  4LMV A;  3KXO A;  10GS A;  3GV1 A;  4IJI A;  2WRT A;  3J7Y b;  3F4T A;  4ZXG A;  1FOH A;  4FXY P;  4F82 A;  5HFK A;  4KND A;  2C1Y A;  4ECJ A;  4ZL8 A;  5F06 A;  3O3T A;  1GP1 A;  5G31 A;  2O3E A;  4HJ2 A;  2DKH A;  2KUC A;  4QL7 A;  2B1K A;  4TR4 A;  1BJX A;  4JRR A;  2CA8 A;  4ECC A;  3TRQ A;  2R4V A;  2C0F A;  4ZIJ A;  3UVH A;  1MD4 A;  1F3A A;  4KW6 A;  1AXD A;  2VOC A;  4TR1 B;  2GZZ A;  4GLT A;  3ZVJ A;  5D9X A;  1GUM A;  2X99 A;  3G9B A;  2IMF A;  4WR4 A;  1M9A A;  5ELA A;  5KOW A;  4NWY A;  2VCX A;  3DXB A;  3GKX A;  3TOT A;  3C73 A;  2GSS A;  4X0X A;  4KDX A;  2AHE A;  5A34 B;  1A23 A;  4TR0 A;  3M3M A;  3QAW A;  3BJ5 A;  2V2G A;  3EUR A;  3GH9 A;  1TK5 B;  3IV4 A;  2TRC P;  2VL2 A;  1Y25 A;  1ERV A;  3RAZ A;  2DML A;  2B1L A;  1EWX A;  2OE1 A;  2R6K A;  3UAP A;  1Y1U A;  2OBI A;  3TUE A;  1AUC A;  2YWO A;  1RK4 A;  4BVY A;  2CT6 A;  3IAM 2;  3US3 A;  5FWG A;  3MSZ A;  4MAB A;  3ZL5 A;  1SKW B;  3BCK A;  3F0I A;  4K7I A;  3LJR A;  3TOU A;  4IN0 A;  1GSE A;  4PQI A;  2FWF A;  3DKS A;  1PX6 A;  2GVP A;  3TKQ A;  4DSR A;  2MMZ A;  3LYK A;  5J9B A;  5G5F A;  1G0T A;  1TXU A;  4HEA 2;  2B6M A;  4BA7 A;  2VLV A;  1K3Y A;  5E59 A;  3MYD A;  3APS A;  4TXV A;  4ZB9 A;  4HQZ A;  4ISD A;  5BMU B;  3EU3 A;  2EIR A;  4XS6 A;  2CZ2 A;  4YAV A;  2C0D A;  1F37 A;  3GFK A;  2N5B A;  3ZIV A;  4IQ1 A;  1A2M A;  5INY A;  3ZMK A;  4L0W A;  2N5A A;  4L0U A;  1YZX A;  3IE3 A;  1OYJ A;  3HHV A;  3EIN A;  4JR4 A;  1HYU A;  3L9U A;  4K8M A;  1SK1 A;  3OR5 A;  4PUF C;  2FUG 2;  2R5G A;  2H70 A;  22GS A;  2AJQ B;  5DJL A;  3LEF A;  3R3E A;  4IKH A;  1V58 A;  4X43 A;  3F6D A;  3TJK A;  2FA4 A;  1B8X A;  4WEY A;  1M2A A;  4O7H A;  4CDO A;  4BVX B;  1Z7R A;  1WWJ A;  2DIZ A;  2FD3 A;  2R0G A;  4MP4 A;  1EOH A;  3CHX C;  4GST A;  2FLS A;  1R26 A;  4HZ2 A;  4PI0 C;  1OC9 A;  4NV2 A;  2H30 A;  5B8A A;  4X1U A;  2HQT A;  4HDE A;  2HZF A;  1S4B P;  3VFI A;  2VL3 A;  3UJ1 A;  2VCW A;  3KTL A;  4HJM A;  1G6Y A;  1GTB A;  3V1W A;  1SD9 A;  4AJ6 A;  5CP1 A;  5E4W A;  1XIY A;  2WVX A;  3CSH A;  1O73 A;  2VLT A;  3KGK A;  1KBN A;  2PVQ A;  3F9U A;  4KDY A;  3APQ A;  3G7I A;  3W8S A;  4L5L A;  4OCE A;  4I5Q A;  1SVO A;  1PGT A;  4XTS A;  3LSZ A;  1EEJ A;  5J9C A;  2DJ1 A;  4KE3 A;  3IXR A;  4PUA A;  3LWA A;  3VLN A;  2WCI A;  1GTU A;  1ERT A;  1QK8 A;  4ML1 A;  1SKS B;  4OFM A;  4NXI A;  4GF0 A;  2PVO C;  2L6C A;  3QAV A;  1ON4 A;  2LNS A;  1R5P A;  4ICY A;  3UEM A;  3TKS C;  3HA9 A;  2EIO A;  1JZR A;  3FEU A;  4LMW A;  5ECS A;  2K6V A;  2HYX A;  4PGT A;  1GLQ A;  3LG6 A;  2HZE A;  4A5P A;  2JAD A;  2ALB A;  1GL8 A;  4IGJ A;  1ZGN A;  3F3R A;  1YF0 A;  1PFO A;  2MMO A;  3GTU A;  2DJK A;  2CQ9 A;  5ECL B;  1AIU A;  5H5Q A;  2R2J A;  5ID2 A;  2AYT A;  3FR3 A;  1R7H A;  2IIY A;  3F8U A;  2GDR A;  1N8J A;  4IP6 A;  4RI7 A;  5AIS A;  3QCP A;  1J9B A;  2F8F A;  1WMJ A;  4NHW A;  2QA1 A;  3GIX A;  3EWL A;  2YN1 A;  5CRH A;  1K0A A;  3IC8 A;  3VWW A;  1K0B A;  2I9H A;  4WBR D;  2LRT A;  4GQF A;  1V40 A;  1GSQ A;  3GHA A;  5D73 A;  5JCG A;  3CWG A;  2IME A;  3G7Y A;  2JL4 A;  3ZTL A;  2A2S A;  1S3D A;  1Z3E A;  3TJG A;  1NM3 A;  4FYC A;  4BPY A;  3RPP A;  2JZT A;  1QMV A;  1FVJ A;  3FZ5 A;  2GS3 A;  1R5A A;  2GQM A;  1F9M A;  5HR3 A;  3J7Y k;  1I1I P;  1I5G A;  1QUW A;  4G10 A;  1EV4 A;  3KIJ A;  1TRV A;  1SD8 A;  1THX A;  4AKI A;  1UA5 A;  3PPU A;  3DD3 A;  4HQS A;  4EE0 A;  3BD2 A;  5IPG A;  3VWV A;  4NHZ A;  5ENU A;  3ED3 A;  5GAN D;  3QDN A;  4AKH A;  3QPM A;  3UBL A;  4AF2 A;  2GT5 A;  2EFC A;  2I4A A;  2VKZ G;  4KUN A;  5CRE A;  2I1U A;  4USS A;  5B6N A;  1E6B A;  3F4S A;  4EIP A;  1BG5 A;  2I81 A;  3GYK A;  2LUS A;  4ZB8 A;  5GST A;  4HU7 A;  2H6Z A;  4K6X A;  2WJU A;  4EVM A;  4EKZ A;  1PMT A;  2X4A A;  2WFC A;  4V2M A;  5EL8 A;  2MBT A;  4J57 E;  3ZFL A;  1K0N A;  3C7M A;  1TTZ A;  1ML6 A;  5HR0 A;  1WE0 A;  1NW2 A;  3QAG A;  2JAC A;  3H8Q A;  2YV7 A;  4CY6 A;  1TK8 B;  2I3Y A;  1Z9H A;  3CTF A;  4K0N A;  1KTE A;  2BTO T;  5B8B A;  1OC9 B;  2IN3 A;  2P5Q A;  2GSQ A;  2J9H A;  1GTA A;  1M0U A;  4XS4 A;  1IYI A;  2YZU A;  4KSM A;  4RI6 A;  4TN8 A;  1XVQ A;  2MMA A;  5COH A;  1ILO A;  1F2E A;  4HS1 A;  1GLP A;  3ZRE A;  5B6M A;  5F05 A;  2OA7 A;  1QFN A;  4MLY A;  6GSY A;  1FB6 A;  3TGZ A;  1XOA A;  1DSB A;  1EOG A;  5H5R A;  2NTO A;  3GKM A;  5D9W A;  5KN2 A;  2K8V A;  4IS0 A;  1TKD B;  2TRX A;  3RHC A;  5DJM A;  3RFR C;  1SJZ A;  2YJH A;  1M3I A;  1AC1 A;  1SYX A;  2MBS A;  3D4M A;  2VL2 C;  2GQK A;  2OBK A;  1XZO A;  4WKW A;  4LL1 B;  5ECM B;  4XRA A;  2B7K A;  2HRK A;  5JCU A;  2A4V A;  4E8E A;  4EL1 A;  2OE0 A;  2TIR A;  3Q6O A;  1GH2 A;  2H73 A;  4F0B A;  5J41 A;  4WXT A;  1TRW A;  3L9S A;  2O8V B;  2RUF A;  2DJ2 A;  1GSD A;  1M2B A;  4Z2R A;  3GTU B;  3I9V 2;  1MD3 A;  3O6T A;  2V32 A;  2OT3 A;  3DVW A;  2WS2 A;  5KEJ A;  1I9D A;  3L0H A;  1X9S B;  2LRC A;  2H72 A;  1SVM A;  2FNO A;  4IP1 A;  4O32 A;  1SK0 A;  5AN1 A;  3QFB C;  1NHY A;  1SL0 B;  1YKA A;  4ACS A;  2MMN A;  1YEX A;  2WUL A;  4Z2T A;  5GAP D;  1ZL9 A;  2AAW A;  3C71 A;  3PGT A;  2HRF A;  4ZBB A;  2C0E A;  2LEG A;  3TB2 A;  1B9Y C;  5F8B A;  4TKY A;  1JZW A;  3C1R A;  5HR2 A;  1FG4 A;  3M9J A;  3VPQ A;  2OE3 A;  11GS A;  2GQL A;  3WGE A;  3P8W A;  2MZC A;  3C1S A;  5IQY A;  5J4Y A;  1OKD A;  3F63 A;  2K18 A;  5AIX A;  2M72 A;  3ZRD A;  3KM6 A;  3SWL A;  2A4H A;  2EC4 A;  4MNN A;  2C3N A;  2IL3 A;  3HVN A;  4F9Z A;  4O5U A;  4JZQ A;  3C8E A;  5DCH A;  3FR9 A;  3MAK A;  2ON7 A;  5DVB A;  3HJP A;  2FWE A;  2L57 A;  5C00 A;  1OAZ A;  3GL5 A;  4L8E A;  1SKR B;  3UMA A;  1LBK A;  5GSS A;  3F6F A;  1U3A A;  5A4U A;  4F2I A;  3QMX A;  3IK9 A;  1GSU A;  1PQN A;  1TK0 B;  4MF5 A;  3D6I A;  3HZ8 A;  3QFA C;  4HSC X;  2ZUP A;  3CTG A;  1EGR A;  4YQV A;  2O89 A;  2VLU A;  2A2P A;  3KMN A;  2WW2 A;  3HXS A;  2FA8 A;  1ERU A;  5ECP B;  2H01 A;  3E3E A;  4DVC A;  3VK9 A;  3IAS 2;  2L4C A;  1Z5Y E;  5KN1 A;  4DSS B;  4N0V A;  4XS4 B;  4BWQ A;  3KMO A;  1VF4 A;  3ZML A;  3HY2 A;  3DIE A;  1THO A;  2GSR A;  3H93 A;  2L5L A;  2GLR A;  3U6V A;  4O5Q A;  1OC3 A;  2VO4 A;  2X64 A;  5CYY A;  2B5Y A;  2VD0 A;  2WZ9 A;  2RM5 A;  4MZB A;  2Z9S A;  1A8L A;  5A5H A;  2PN8 A;  1WJK A;  1PN0 A;  1GUK A;  3HVS A;  4IW9 A;  1J0F A;  2V6O A;  1YEP A;  4LL4 B;  3CSJ A;  2VIM A;  3P2A A;  1WIK A;  2HSM A;  2QA2 A;  1YDK A;  2HT9 A;  5EVO A;  2C8U A;  4K7N A;  1V9W A;  1XCC A;  3M8N A;  2V1M A;  4LLR A;  4PNG A;  2B5X A;  1H4O A;  3FW2 A;  6GSV A;  1C72 A;  4IVF A;  1K0M A;  3UOM A;  3ISO A;  3A3T A;  2HRK B;  2LJA A;  2O87 A;  2PBJ A;  3TJB A;  1OE8 A;  5CRG A;  3FZA A;  2X8G A;  4K7O A;  2F51 A;  2M46 A;  5A4V A;  4XHM A;  5D9T A;  2FGX A;  5G2Z A;  4EO3 A;  1K0O A;  5A4W A;  4F0C A;  3L9V A;  1UN2 A;  1XWA A;  1BG1 A;  1Z7P A;  4N3Z A;  3N9J A;  2REM A;  4WR5 A;  1WP0 A;  1QQ2 A;  1O85 A;  3TKS E;  1SJI A;  4K9Z A;  4OWY A;  2E0Q A;  2AV4 A;  2WVZ A;  4ZB6 A;  3P7X A;  1SYR A;  3NZN A;  1XFL A;  1VF1 A;  4J56 E;  1FHE A;  1T4Y A;  5IIZ A;  5IMD A;  1NSW A;  2WZS A;  2GGT A;  4FH8 A;  2DJ3 A;  5G5E A;  4YKF A;  3TCO A;  4XCS A;  3BCI A;  1FOV A;  1FAA A;  2H66 A;  4KGI A;  3MWH A;  4PTS A;  1BYE A;  4HI7 A;  2VM2 A;  4EXJ A;  3FYG A;  3Q18 A;  1JZD A;  1GNW A;  5A1N A;  3ZIJ A;  4WF4 A;  2UV8 G;  1W89 A;  4ZIL A;  1G6W A;  5HR1 A;  5D8I A;  2WDU A;  1HD2 A;  2VCV A;  4GXZ A;  3CRT A;  1HQO A;  1NHO A;  1K0C A;  4GRF A;  1YVL A;  5ECR B;  2H1G A;  5FT3 A;  3LW9 A;  5J4U A;  5IMC A;  2YCD A;  2HFD A;  3U5R E;  1YF1 A;  5JWO B;  2HRN A;  4JBB A;  3NOF A;  1A24 A;  2XPE A;  3RBT A;  1Z6N A;  4PNF A;  1RQM A;  1AQW A;  4P3Y B;  2HSH A;  5ECH B;  4AJ7 A;  3Q74 A;  4HOJ A;  3P90 A;  1USB A;  5IPH A;  3WYW A;  1XVW A;  2C0G A;  1TI1 A;  1XXU A;  4BL7 A;  2QC7 A;  4BVY B;  1GUL A;  2EFH A;  3RPN A;  4KH7 A;  3UL3 A;  1LU4 A;  5J40 A;  1S3C A;  3GN3 A;  1TW9 A;  1B9X C;  1Q4J A;  1FW1 A;  4O5R A;  2L6D A;  2FY6 A;  5IOW A;  1MTC A;  3UVT A;  2R0P A;  3FHK A;  5G1L A;  3IC4 A;  3GH6 A;  18GS A;  1R4W A;  4MDC A;  4K1F A;  4IEL A;  1HNC A;  3SBC A;  4KB3 A;  3UBK A;  4POM A;  2GZP A;  3IOS A;  1X5E A;  4H86 A;  4JE1 A;  3IRA A;  5LNK e;  3D4T A;  2HSM B;  4NPB A;  2PUK C;  4TRX A;  2WW3 A;  4IHU A;  1BQ7 A;  1H75 A;  5GZZ B;  3TJF A;  4G0K A;  2AUV A;  2RLI A;  3GUR A;  1SVL A;  1EP8 A;  3CBU A;  2B5E A;  2L59 A;  4Q5F A;  3HCZ A;  4ZL7 A;  4JU5 A;  2PMT A;  1SJ6 A;  1M7T A;  5DQS A;  2HLS A;  5BRT A;  3TU3 B;  1EP7 A;  2VL9 A;  4K2D A;  2JSY A;  3LXT A;  4MZW A;  3EYT A;  3KP9 A;  4IQA A;  2DBC A;  1T3B A;  1PD2 1;  4GTU A;  1TP9 A;  4GDF A;  4GQC A;  2KHP A;  3DVX A;  3JCM L;  2LS5 A;  3ZFB A;  3BBY A;  4MCU A;  3EPT A;  3HD5 A;  2CVB A;  5J3R A;  2DJJ A;  5J47 A;  2QKE A;  1OVN A;  2H0G A;  1JZO A;  2ON5 A;  1DBY A;  2WVX B;  3I69 A;  1G7E A;  4I6X A;  3FK8 A;  3HYP A;  2RM6 A;  1DUG A;  1ZYQ B;  1X9M B;  1N25 A;  3UIW A;  5KN0 A;  2HSN A;  4GWR A;  2BJX A;  1ZMA A;  2V6K A;  3QOU A;  3WT1 A;  2N5F A;  5F0G A;  5HFI A;  3GMF A;  2M80 A;  5LCZ A;  3VI7 A;  4KAE A;  4MPG A;  2VCT A;  1F3B A;  1DE2 A;  1PRX A;  5HFG A;  4Q5R A;  1HNB A;  2P5R A;  1O7U A;  1XPV A;  3HVX A;  3F3Q A;  3GA4 A;  1JLV A;  4POK A;  4IBP A;  4D73 A;  2X8C A;  3H79 A;  1N2A A;  2C3Q A;  1T7P B;  1AAZ A;  2L4Q A; 
#chains in the Genus database with same CATH homology
 1AQX A;  1X5D A;  2HI7 A;  2AB6 A;  2E7P A;  3IA1 A;  4ZB7 A;  3HMJ G;  5C04 A;  2GZY A;  4ECI A;  3GKK A;  2GT6 A;  3WGX A;  4L5O A;  1A8Y A;  2P31 A;  4ECB A;  3ERF A;  1V57 A;  2VM1 A;  2HZE B;  1FO5 A;  4Z2U A;  1PX7 A;  3ZYW A;  1Z6M A;  2CV4 A;  4OFT A;  5ID2 B;  4NMU A;  2XHF A;  1W4V A;  3MIX A;  1TJD A;  1X9W B;  1VRS D;  5IMV A;  2OJL A;  1K3L A;  1TOF A;  3MDK A;  4MZC A;  4EDZ A;  2IFQ A;  4MMM A;  4MA9 A;  4BL7 B;  1EEM A;  3D21 A;  3IPZ A;  5J5N A;  4ZBD A;  2ZCT A;  4KF9 A;  1K3O A;  2BMX A;  3KZQ A;  3DYR A;  2R3X A;  3LOR A;  2GST A;  3KJY A;  2OAC A;  2DSA A;  2LQQ A;  1S3A A;  1HNA A;  3G7J A;  2LJR A;  3R2Q A;  2FHE A;  3EC3 A;  3VWU A;  2C4J A;  2OAD A;  3LXZ A;  2PGT A;  2O85 A;  7GSS A;  5ECK B;  3FMW A;  3CRU A;  4K5R A;  2J23 A;  1GUH A;  1KEB A;  6GSX A;  1E2Y A;  3MNG A;  3A2V A;  5H5S A;  1ZYP A;  3KEB A;  2VUP A;  3ME8 A;  1BF5 A;  3UAR A;  4F03 A;  1WOU A;  2YAN A;  12GS A;  3VI5 A;  3D22 A;  3GUS A;  4OCF A;  3FKF A;  3LYP A;  5D93 A;  1TI3 A;  1OE7 A;  2H76 A;  3GRX A;  2A2R A;  4YQU A;  1ERW A;  5DAL A;  5A5K A;  1BAY A;  3QR6 A;  1QGV A;  4POB A;  4RQR A;  3H4K A;  5IMA A;  1PKW A;  2NDO A;  4AI6 A;  4AKX B;  2IMK A;  1EZK A;  2YZH A;  5FHI A;  1LJR A;  2DIY A;  4JR6 A;  5G30 A;  1F6M C;  3F4R A;  4Z7X A;  4YAP A;  2PU9 C;  1SU9 A;  8GSS A;  1A2J A;  1GTI A;  3GX8 A;  2X8H A;  4QQ7 A;  4KSO A;  5JWQ B;  2DMM A;  2X49 A;  1JFU A;  2F3M A;  1K0D A;  3WT2 A;  4TR3 A;  4TW5 A;  1XWB A;  2JZS A;  1AW9 A;  2C3T A;  1PKZ A;  3GL3 A;  1ST9 A;  4KCE A;  2G0F A;  3IHQ A;  3A2X A;  3EU4 A;  1AQV A;  4YH2 A;  1FB0 A;  4G9H A;  1M9B A;  3A2W A;  20GS A;  2H8L A;  4ML6 A;  5CRD A;  2VCZ A;  2HSY A;  2R0C A;  3KP8 A;  2H1L A;  2HSN B;  4G19 A;  4FQU A;  2QGV A;  5F07 A;  3DEX A;  1XW6 A;  4NV5 A;  3PR8 A;  3VWX A;  2G2Q A;  5EY6 A;  1TXX A;  4KDU A;  1VF3 A;  3DWV A;  2KP1 A;  1FVK A;  2XBI A;  1RW1 A;  3RDW A;  2JU5 A;  3FZ4 A;  5DAK A;  4GCI A;  4QMK A;  4LA1 A;  4EIQ A;  4AJ8 A;  3BOA A;  1IYH A;  4FIW A;  3DRN A;  2ZNM A;  2B7J A;  2YP6 A;  5DDL A;  1PL1 A;  4D73 B;  1U3I A;  1XW5 A;  4I8B A;  5J4V A;  2JZR A;  3TKR A;  1UC7 A;  4MPF A;  4MJE A;  4AGS A;  2D2Z A;  1GRX A;  1T8E B;  17GS A;  2YPM A;  1JHB A;  1XWG A;  2H74 A;  3N5O A;  4I2U A;  4MH3 A;  2CVD A;  1T00 A;  2DC5 A;  1WPI A;  1J08 A;  3TRP A;  1V2A A;  1YJ6 A;  4PX1 A;  1GSY A;  1OKT A;  2LTK A;  2PWJ A;  2KLX A;  2IWT A;  5KOX A;  1O6J A;  1XW9 A;  4N30 A;  4OFN A;  1SL1 B;  2EFE A;  2IFQ B;  3IR4 A;  1ZOF A;  1PA3 A;  4XS1 A;  4DEJ A;  4XIH A;  4K5S A;  13GS A;  2HE3 A;  2NBS A;  5ECQ B;  3GX0 A;  2FWG A;  16GS A;  6GSW A;  1U6T A;  2IMI A;  2PPT A;  4RQX A;  2WB9 A;  2VCQ A;  1Y6E A;  3CYN A;  5EPF A;  3NIV A;  2HXK A;  4ULX A;  4AKG A;  5DQY A;  4FO5 A;  3E0U A;  3Q19 A;  3DML A;  2H6Y A;  3HVV A;  14GS A;  5L71 A;  1MDK A;  1ZZY A;  2H6X A;  3I6A A;  5JWR B;  4G2E A;  3GSS A;  1YY7 A;  4KX4 A;  1URM A;  4MH2 A;  2RUE A;  4MJB A;  2KOK A;  4EF0 A;  2DJ0 A;  1KNG A;  3IDV A;  2LV3 A;  5DAL B;  1B4P A;  1A0F A;  2ES7 A;  2YWI A;  2IJY A;  4QL9 A;  1CQG A;  3TRX A;  3CSI A;  1GWC A;  2EFD A;  2VAF A;  1DE1 A;  3CMI A;  3L4N A;  4W66 A;  3O76 A;  3ERW A;  3HKR A;  2R37 A;  2VD1 A;  2JSZ A;  4KA0 A;  1X5C A;  1QXH A;  4E68 A;  3PH9 A;  2MYG A;  2LQO A;  4TOP A;  3TKP A;  2YWN A;  4GSN A;  4TXO A;  2DLX A;  5IMF A;  1SL2 B;  1TU8 A;  2KP2 A;  1XWK A;  2YV9 A;  5ECN B;  3ZLP A;  5IMZ A;  1U88 A;  3ZZX A;  3TJJ A;  1EV9 A;  1G7O A;  2RII A;  4WET A;  4CW9 A;  4BWS A;  6GST A;  3EE2 A;  3TDG A;  1B4Q A;  2PER A;  4V1A p;  5DBQ A;  4TVE A;  1BED A;  3IHG A;  2GTU A;  1A0R P;  2OKA A;  3HZ4 A;  4FYU A;  3AY8 A;  4N11 A;  1GSF A;  2NPB A;  2YJ7 A;  5CAX A;  3FR6 A;  4PQ1 A;  3IK7 A;  1M99 A;  2XBQ A;  4Q5N A;  2C80 A;  3H1N A;  3ERG A;  5A5H B;  4N0Z A;  4CHS A;  4MJC A;  3EMX A;  4V1A g;  2LNT A;  1T1V A;  2UZ8 A;  1WRY A;  3EVI A;  3FRC A;  5D9V A;  1M2D A;  1O8W A;  2H0I A;  3GST A;  2F8A A;  5DAK B;  4G0L A;  2CAI A;  2NVL A;  3A5W A;  4MK3 A;  4NAX A;  2YNX A;  5CRW A;  5CNW A;  2DKI A;  3M0F A;  2WGR A;  4N10 A;  4TR1 A;  5KN3 A;  5HQP A;  5IO0 A;  5B7C A;  5ABR A;  3D0Z A;  3KTB A;  4X4J A;  1B48 A;  1MDI A;  3RHB A;  5AGY A;  6GSS A;  3A5I A;  3D5J A;  3E9J B;  5A34 A;  5ECO B;  1ZYE A;  2H1D A;  1TU7 A;  1CQH A;  3ZVJ D;  4ZBA A;  4HZ4 A;  1OC8 A;  3M1G A;  2P0G A;  4IJ3 A;  3HDC A;  3LGC A;  1SEN A;  1BX9 A;  5G1K A;  1UVZ A;  3M9K A;  4V2N A;  3WGD A;  4Q5Q A;  3K8N A;  5ELG A;  2CX4 A;  1JLW A;  3WD6 A;  3KCM A;  2YOI A;  4KCA A;  2H0H A;  4FYB A;  4HU9 A;  3IBH A;  3S9F A;  4G0I A;  1SK2 A;  3TKS A;  1U87 A;  2HRA A;  2L5O A;  2F9S A;  3QD9 A;  4EDY A;  3KH9 A;  1PSQ A;  2YWM A;  4DSS A;  1V98 A;  2XPD A;  2H1B A;  2EIQ A;  3VPT A;  4K0G A;  4K2X A;  4OO5 A;  1TRS A;  4RUV A;  3W6G A;  2H1A A;  3FZ9 A;  2H75 A;  3APO A;  4V2L A;  3KD0 A;  2QSI A;  1ABA A;  5BMU A;  5JCW A;  5IM9 A;  2E2M A;  5CO3 A;  4ILF A;  2K8S A;  4YQM A;  3HJM A;  4HUA A;  4PUR A;  1MEK A;  3KH7 A;  1XWC A;  1ZCP A;  5AIV A;  4I97 A;  5ECI B;  3I43 A;  5A1N B;  2H19 A;  4OO4 A;  3EMP A;  2V41 A;  1MDJ A;  1PN9 A;  2O7K A;  4OMV A;  3ME7 A;  3DGQ A;  3HJO A;  3W8J A;  4WBJ A;  2CAQ A;  3FY7 A;  19GS A;  4YKG A;  1XOB A;  1ACV A;  4PQH A;  4J2F A;  4WF5 A;  2K9F A;  2LRN A;  1Q98 A;  1O81 A;  5IOX A;  4MF6 A;  1TDI A;  4G01 A;  2CZ3 A;  1VGL A;  5DCG A;  4BVX A;  9GSS A;  1A2L A;  1YKC A;  2IMD A;  2XC2 A;  1PL2 A;  4EUY A;  1XBS A;  2LJK A;  4JED A;  3LFL A;  4ZL9 A;  4GSS A;  3VUR A;  2CX3 A;  1O8X A;  4CY8 A;  4TXO B;  1GSS A;  1X0R A;  5LD0 A;  3GKN A;  5IO2 A;  1TRU A;  3ZIT A;  1EGO A;  4MJA A;  2LST A;  2CVK A;  3PIN A;  4OD7 A;  4I2T A;  4MF7 A;  2IPA A;  4DSQ A;  3CXG A;  4E8H A;  6GSU A;  1VF2 A;  1GNE A;  2FCH A;  4EC0 A;  2LKU A;  1YQ1 A;  2O5V A;  4POL A;  2B3S A;  5D96 A;  3LQ7 A;  3L78 A;  1T4Z A;  1ZYN A;  2H71 A;  4O92 A;  2E2G A;  4XRD A;  3GNJ A;  4PXO A;  2FWH A;  2HNL A;  4ID0 A;  4LMV A;  3KXO A;  10GS A;  3GV1 A;  4IJI A;  2WRT A;  3J7Y b;  3F4T A;  4ZXG A;  1FOH A;  4F82 A;  5HFK A;  4KND A;  2C1Y A;  4ECJ A;  4ZL8 A;  5F06 A;  3O3T A;  1GP1 A;  5G31 A;  4HJ2 A;  2DKH A;  2KUC A;  4QL7 A;  2B1K A;  4TR4 A;  1BJX A;  4JRR A;  2CA8 A;  4ECC A;  3TRQ A;  2R4V A;  2C0F A;  4ZIJ A;  3UVH A;  1MD4 A;  1F3A A;  4KW6 A;  1AXD A;  2VOC A;  4TR1 B;  2GZZ A;  4GLT A;  3ZVJ A;  5D9X A;  1GUM A;  2X99 A;  3G9B A;  2IMF A;  4WR4 A;  1M9A A;  5ELA A;  5KOW A;  4NWY A;  2VCX A;  3DXB A;  3GKX A;  3TOT A;  3C73 A;  2GSS A;  4X0X A;  4KDX A;  2AHE A;  5A34 B;  1A23 A;  4TR0 A;  3M3M A;  3QAW A;  3BJ5 A;  2V2G A;  3EUR A;  3GH9 A;  1TK5 B;  3IV4 A;  2TRC P;  2VL2 A;  1Y25 A;  1ERV A;  3RAZ A;  2DML A;  2B1L A;  1EWX A;  2OE1 A;  2R6K A;  3UAP A;  1Y1U A;  2OBI A;  3TUE A;  1AUC A;  2YWO A;  1RK4 A;  4BVY A;  2CT6 A;  3IAM 2;  3US3 A;  5FWG A;  3MSZ A;  4MAB A;  3ZL5 A;  1SKW B;  3BCK A;  3F0I A;  4K7I A;  3LJR A;  3TOU A;  4IN0 A;  1GSE A;  4PQI A;  2FWF A;  3DKS A;  1PX6 A;  2GVP A;  3TKQ A;  4DSR A;  2MMZ A;  3LYK A;  5J9B A;  5G5F A;  1G0T A;  1TXU A;  4HEA 2;  2B6M A;  4BA7 A;  2VLV A;  1K3Y A;  5E59 A;  3MYD A;  3APS A;  4TXV A;  4ZB9 A;  4HQZ A;  4ISD A;  5BMU B;  3EU3 A;  2EIR A;  4XS6 A;  2CZ2 A;  4YAV A;  2C0D A;  1F37 A;  3GFK A;  2N5B A;  3ZIV A;  4IQ1 A;  1A2M A;  5INY A;  3ZMK A;  4L0W A;  2N5A A;  4L0U A;  1YZX A;  3IE3 A;  1OYJ A;  3HHV A;  3EIN A;  4JR4 A;  1HYU A;  3L9U A;  4K8M A;  1SK1 A;  3OR5 A;  4PUF C;  2FUG 2;  2R5G A;  2H70 A;  22GS A;  2AJQ B;  5DJL A;  3LEF A;  3R3E A;  4IKH A;  1V58 A;  4X43 A;  3F6D A;  3TJK A;  2FA4 A;  1B8X A;  4WEY A;  1M2A A;  4O7H A;  4CDO A;  4BVX B;  1Z7R A;  1WWJ A;  2DIZ A;  2FD3 A;  2R0G A;  4MP4 A;  1EOH A;  4GST A;  2FLS A;  1R26 A;  4HZ2 A;  1OC9 A;  4NV2 A;  2H30 A;  5B8A A;  4X1U A;  2HQT A;  4HDE A;  2HZF A;  3VFI A;  2VL3 A;  3UJ1 A;  2VCW A;  3KTL A;  4HJM A;  1G6Y A;  1GTB A;  3V1W A;  1SD9 A;  4AJ6 A;  5CP1 A;  5E4W A;  1XIY A;  3CSH A;  2VLT A;  1O73 A;  3KGK A;  1KBN A;  2PVQ A;  3F9U A;  4KDY A;  3APQ A;  3G7I A;  3W8S A;  4L5L A;  4OCE A;  4I5Q A;  1SVO A;  1PGT A;  4XTS A;  3LSZ A;  1EEJ A;  5J9C A;  2DJ1 A;  4KE3 A;  3IXR A;  4PUA A;  3LWA A;  3VLN A;  2WCI A;  1GTU A;  1ERT A;  1QK8 A;  4ML1 A;  1SKS B;  4OFM A;  4NXI A;  4GF0 A;  2PVO C;  2L6C A;  3QAV A;  1ON4 A;  2LNS A;  1R5P A;  4ICY A;  3UEM A;  3TKS C;  3HA9 A;  2EIO A;  1JZR A;  3FEU A;  4LMW A;  5ECS A;  2K6V A;  2HYX A;  4PGT A;  1GLQ A;  3LG6 A;  2HZE A;  4A5P A;  2JAD A;  2ALB A;  1GL8 A;  4IGJ A;  1ZGN A;  3F3R A;  1YF0 A;  2MMO A;  3GTU A;  2DJK A;  2CQ9 A;  5ECL B;  1AIU A;  5H5Q A;  2R2J A;  5ID2 A;  2AYT A;  3FR3 A;  1R7H A;  2IIY A;  3F8U A;  2GDR A;  1N8J A;  4IP6 A;  4RI7 A;  5AIS A;  3QCP A;  1J9B A;  2F8F A;  1WMJ A;  4NHW A;  2QA1 A;  3GIX A;  3EWL A;  2YN1 A;  5CRH A;  1K0A A;  3IC8 A;  3VWW A;  1K0B A;  2I9H A;  4WBR D;  2LRT A;  4GQF A;  1V40 A;  1GSQ A;  3GHA A;  5D73 A;  5JCG A;  3CWG A;  2IME A;  3G7Y A;  2JL4 A;  3ZTL A;  2A2S A;  1S3D A;  1Z3E A;  3TJG A;  1NM3 A;  4FYC A;  4BPY A;  3RPP A;  2JZT A;  1QMV A;  1FVJ A;  3FZ5 A;  2GS3 A;  1R5A A;  2GQM A;  1F9M A;  5HR3 A;  3J7Y k;  1I5G A;  1QUW A;  4G10 A;  1EV4 A;  3KIJ A;  1TRV A;  1SD8 A;  1THX A;  4AKI A;  1UA5 A;  3PPU A;  3DD3 A;  4HQS A;  4EE0 A;  3BD2 A;  5IPG A;  3VWV A;  4NHZ A;  5ENU A;  3ED3 A;  5GAN D;  3QDN A;  4AKH A;  3QPM A;  3UBL A;  4AF2 A;  2GT5 A;  2EFC A;  2I4A A;  2VKZ G;  4KUN A;  5CRE A;  2I1U A;  4USS A;  5B6N A;  1E6B A;  3F4S A;  4EIP A;  1BG5 A;  2I81 A;  3GYK A;  2LUS A;  4ZB8 A;  5GST A;  4HU7 A;  2H6Z A;  4K6X A;  2WJU A;  4EVM A;  4EKZ A;  1PMT A;  2X4A A;  2WFC A;  4V2M A;  5EL8 A;  2MBT A;  4J57 E;  3ZFL A;  1K0N A;  3C7M A;  1TTZ A;  1ML6 A;  5HR0 A;  1WE0 A;  1NW2 A;  3QAG A;  2JAC A;  3H8Q A;  2YV7 A;  4CY6 A;  1TK8 B;  2I3Y A;  1Z9H A;  3CTF A;  4K0N A;  1KTE A;  2BTO T;  5B8B A;  1OC9 B;  2IN3 A;  2P5Q A;  2GSQ A;  2J9H A;  1GTA A;  1M0U A;  4XS4 A;  1IYI A;  2YZU A;  4KSM A;  4RI6 A;  4TN8 A;  1XVQ A;  2MMA A;  5COH A;  1ILO A;  1F2E A;  4HS1 A;  1GLP A;  3ZRE A;  5B6M A;  5F05 A;  2OA7 A;  1QFN A;  4MLY A;  6GSY A;  1FB6 A;  3TGZ A;  1XOA A;  1DSB A;  1EOG A;  5H5R A;  2NTO A;  3GKM A;  5D9W A;  5KN2 A;  2K8V A;  4IS0 A;  1TKD B;  2TRX A;  3RHC A;  5DJM A;  1SJZ A;  2YJH A;  1AC1 A;  1SYX A;  2MBS A;  3D4M A;  2VL2 C;  2GQK A;  2OBK A;  1XZO A;  4WKW A;  4LL1 B;  5ECM B;  4XRA A;  2B7K A;  2HRK A;  5JCU A;  2A4V A;  4E8E A;  4EL1 A;  2OE0 A;  2TIR A;  3Q6O A;  1GH2 A;  2H73 A;  4F0B A;  5J41 A;  4WXT A;  1TRW A;  3L9S A;  2O8V B;  2RUF A;  2DJ2 A;  1GSD A;  1M2B A;  4Z2R A;  3GTU B;  3I9V 2;  1MD3 A;  3O6T A;  2V32 A;  2OT3 A;  3DVW A;  2WS2 A;  5KEJ A;  1I9D A;  3L0H A;  1X9S B;  2LRC A;  2H72 A;  1SVM A;  2FNO A;  4IP1 A;  4O32 A;  1SK0 A;  5AN1 A;  3QFB C;  1NHY A;  1SL0 B;  1YKA A;  4ACS A;  2MMN A;  1YEX A;  2WUL A;  4Z2T A;  5GAP D;  1ZL9 A;  2AAW A;  3C71 A;  3PGT A;  2HRF A;  4ZBB A;  2C0E A;  2LEG A;  3TB2 A;  1B9Y C;  5F8B A;  4TKY A;  1JZW A;  3C1R A;  5HR2 A;  1FG4 A;  3M9J A;  3VPQ A;  2OE3 A;  11GS A;  2GQL A;  3WGE A;  3P8W A;  2MZC A;  3C1S A;  5IQY A;  5J4Y A;  1OKD A;  3F63 A;  2K18 A;  5AIX A;  2M72 A;  3ZRD A;  3KM6 A;  3SWL A;  2A4H A;  2EC4 A;  4MNN A;  2C3N A;  2IL3 A;  4F9Z A;  4O5U A;  4JZQ A;  3C8E A;  5DCH A;  3FR9 A;  3MAK A;  2ON7 A;  5DVB A;  3HJP A;  2FWE A;  2L57 A;  5C00 A;  1OAZ A;  3GL5 A;  4L8E A;  1SKR B;  3UMA A;  1LBK A;  5GSS A;  3F6F A;  1U3A A;  5A4U A;  4F2I A;  3QMX A;  3IK9 A;  1GSU A;  1PQN A;  1TK0 B;  4MF5 A;  3D6I A;  3HZ8 A;  3QFA C;  2ZUP A;  3CTG A;  1EGR A;  4YQV A;  2O89 A;  2VLU A;  2A2P A;  3KMN A;  3HXS A;  2FA8 A;  1ERU A;  5ECP B;  2H01 A;  3E3E A;  4DVC A;  3VK9 A;  3IAS 2;  2L4C A;  1Z5Y E;  5KN1 A;  4DSS B;  4N0V A;  4XS4 B;  4BWQ A;  3KMO A;  1VF4 A;  3ZML A;  3HY2 A;  3DIE A;  1THO A;  2GSR A;  3H93 A;  2L5L A;  2GLR A;  3U6V A;  4O5Q A;  1OC3 A;  2VO4 A;  2X64 A;  5CYY A;  2B5Y A;  2VD0 A;  2WZ9 A;  2RM5 A;  4MZB A;  2Z9S A;  1A8L A;  5A5H A;  2PN8 A;  1WJK A;  1PN0 A;  1GUK A;  3HVS A;  4IW9 A;  1J0F A;  2V6O A;  1YEP A;  4LL4 B;  3CSJ A;  2VIM A;  3P2A A;  1WIK A;  2HSM A;  2QA2 A;  1YDK A;  2HT9 A;  5EVO A;  2C8U A;  4K7N A;  1V9W A;  1XCC A;  3M8N A;  2V1M A;  4LLR A;  4PNG A;  2B5X A;  1H4O A;  3FW2 A;  6GSV A;  1C72 A;  4IVF A;  1K0M A;  3UOM A;  3ISO A;  3A3T A;  2HRK B;  2LJA A;  2O87 A;  2PBJ A;  3TJB A;  1OE8 A;  5CRG A;  3FZA A;  2X8G A;  4K7O A;  2F51 A;  2M46 A;  5A4V A;  4XHM A;  5D9T A;  2FGX A;  5G2Z A;  4EO3 A;  1K0O A;  5A4W A;  4F0C A;  3L9V A;  1UN2 A;  1XWA A;  1BG1 A;  1Z7P A;  4N3Z A;  3N9J A;  2REM A;  4WR5 A;  1WP0 A;  1QQ2 A;  1O85 A;  3TKS E;  1SJI A;  4K9Z A;  4OWY A;  2E0Q A;  2AV4 A;  4ZB6 A;  3P7X A;  1SYR A;  3NZN A;  1XFL A;  1VF1 A;  4J56 E;  1FHE A;  1T4Y A;  5IIZ A;  5IMD A;  1NSW A;  2GGT A;  4FH8 A;  2DJ3 A;  5G5E A;  4YKF A;  3TCO A;  4XCS A;  3BCI A;  1FOV A;  1FAA A;  2H66 A;  4KGI A;  3MWH A;  4PTS A;  1BYE A;  4HI7 A;  2VM2 A;  4EXJ A;  3FYG A;  3Q18 A;  1JZD A;  1GNW A;  5A1N A;  3ZIJ A;  4WF4 A;  2UV8 G;  1W89 A;  4ZIL A;  1G6W A;  5HR1 A;  5D8I A;  2WDU A;  1HD2 A;  2VCV A;  4GXZ A;  3CRT A;  1HQO A;  1NHO A;  1K0C A;  4GRF A;  1YVL A;  5ECR B;  2H1G A;  5FT3 A;  3LW9 A;  5J4U A;  5IMC A;  2YCD A;  2HFD A;  3U5R E;  1YF1 A;  5JWO B;  2HRN A;  4JBB A;  3NOF A;  1A24 A;  2XPE A;  3RBT A;  1Z6N A;  4PNF A;  1RQM A;  1AQW A;  4P3Y B;  2HSH A;  5ECH B;  4AJ7 A;  3Q74 A;  4HOJ A;  3P90 A;  1USB A;  5IPH A;  3WYW A;  1XVW A;  2C0G A;  1TI1 A;  1XXU A;  4BL7 A;  2QC7 A;  4BVY B;  1GUL A;  2EFH A;  3RPN A;  4KH7 A;  3UL3 A;  1LU4 A;  5J40 A;  1S3C A;  3GN3 A;  1TW9 A;  1B9X C;  1Q4J A;  1FW1 A;  4O5R A;  2L6D A;  2FY6 A;  5IOW A;  1MTC A;  3UVT A;  2R0P A;  3FHK A;  5G1L A;  3IC4 A;  3GH6 A;  18GS A;  1R4W A;  4MDC A;  4K1F A;  4IEL A;  1HNC A;  3SBC A;  4KB3 A;  3UBK A;  4POM A;  2GZP A;  3IOS A;  1X5E A;  4H86 A;  4JE1 A;  3IRA A;  5LNK e;  3D4T A;  2HSM B;  4NPB A;  2PUK C;  4TRX A;  4IHU A;  1BQ7 A;  1H75 A;  5GZZ B;  3TJF A;  4G0K A;  2AUV A;  2RLI A;  3GUR A;  1SVL A;  1EP8 A;  3CBU A;  2B5E A;  2L59 A;  4Q5F A;  3HCZ A;  4ZL7 A;  4JU5 A;  2PMT A;  1SJ6 A;  1M7T A;  5DQS A;  2HLS A;  5BRT A;  3TU3 B;  1EP7 A;  2VL9 A;  4K2D A;  2JSY A;  3LXT A;  4MZW A;  3EYT A;  3KP9 A;  4IQA A;  2DBC A;  1T3B A;  1PD2 1;  4GTU A;  1TP9 A;  4GDF A;  4GQC A;  2KHP A;  3DVX A;  3JCM L;  2LS5 A;  3ZFB A;  3BBY A;  4MCU A;  3EPT A;  3HD5 A;  2CVB A;  5J3R A;  2DJJ A;  5J47 A;  2QKE A;  1OVN A;  2H0G A;  1JZO A;  2ON5 A;  1DBY A;  3I69 A;  1G7E A;  4I6X A;  3FK8 A;  3HYP A;  2RM6 A;  1DUG A;  1ZYQ B;  1X9M B;  1N25 A;  3UIW A;  5KN0 A;  2HSN A;  4GWR A;  2BJX A;  1ZMA A;  2V6K A;  3QOU A;  3WT1 A;  2N5F A;  5F0G A;  5HFI A;  3GMF A;  2M80 A;  5LCZ A;  3VI7 A;  4KAE A;  4MPG A;  2VCT A;  1F3B A;  1DE2 A;  1PRX A;  5HFG A;  4Q5R A;  1HNB A;  2P5R A;  1O7U A;  1XPV A;  3HVX A;  3F3Q A;  3GA4 A;  1JLV A;  4POK A;  4IBP A;  4D73 A;  2X8C A;  3H79 A;  1N2A A;  2C3Q A;  1T7P B;  1AAZ A;  2L4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...