1IYIA

Crystal structure of hematopoietic prostaglandin d synthase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of metal activation of human hematopoietic prostaglandin D synthase
pubmed doi rcsb
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
source organism Homo sapiens
molecule tags Isomerase
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1iyiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1iyiA01
2LS5A 2DJJA 2PU9C 5IPHA 4GWRA 4L5OA 1F6MC 2WS2A 4HDEA 4MABA 5KN3A 8GSSA 20GSA 1XVQA 4V1Ap 2MMNA 1GUMA 4FIWA 4WR5A 2AV4A 1T3BA 2FUG2 3PR8A 3M0FA 2K8SA 2GTUA 1PKWA 1MDIA 4MMMA 5H5SA 2HZEA 1HQOA 3D6IA 2G0FA 1V2AA 3UIWA 1ACVA 3EMPA 3LXZA 3TOUA 4DSRA 4O5RA 3CRTA 5AIVA 4JR4A 5EL8A 5BMUA 3D21A 4OCEA 1EGRA 2BJXA 1BAYA 2WCIA 2PPTA 2R2JA 3NZNA 4NPBA 1XW6A 4K8MA 4LA1A 4NAXA 3GHAA 2MMOA 1HNCA 3D4TA 3KTBA 1PL2A 5LNKe 3QD9A 2A4VA 2WZ9A 4AF2A 1PSQA 4ZILA 1GSFA 1BG5A 1M2AA 3QAGA 1Z6MA 1KTEA 2C0GA 4BL7A 2IIYA 4HI7A 2C0FA 2K6VA 1FW1A 2DIZA 1EOHA 4ZB9A 3C7MA 2F8AA 2VCVA 1N2AA 3UVHA 4GTUA 2DC5A 4H86A 4MJEA 4OFMA 2JZSA 2DJKA 2ALBA 3GMFA 1MDJA 5CNWA 2GSRA 2V6KA 2ON7A 1ST9A 3DKSA 3FYGA 1FHEA 1GNEA 2O7KA 2DMMA 4MH3A 2I81A 2YV9A 4KSOA 3GV1A 1M9BA 1VF1A 4N30A 4NV2A 5EPFA 3GFKA 3ZLPA 4USSA 1WRYA 1G7OA 2HRKA 3WT2A 4KCAA 5JWQB 2H66A 3D0ZA 4V2NA 3RDWA 2C3QA 3TRQA 4BPYA 2PBJA 1TOFA 3KEBA 1Z7RA 3LORA 3LQ7A 4K2DA 4EE0A 2IN3A 2BMXA 1BYEA 4E8HA 2M46A 3EU3A 1XIYA 2RUFA 1PN9A 17GSA 4MPFA 3IRAA 3VWUA 2MYGA 4DVCA 1EEMA 1H75A 1IYHA 4PURA 1MEKA 1PX6A 4IW9A 1GNWA 4PX1A 1ABAA 5KN2A 2VD0A 1A0RP 1SYXA 3TOTA 2HNLA 3RAZA 2FWEA 2OE0A 3BOAA 1T00A 1U6TA 4I5QA 5FWGA 1V98A 3IAS2 2DBCA 1F9MA 2YN1A 1WJKA 5J4UA 3ME8A 5ABRA 3GSTA 1M2BA 4MJCA 1HNAA 4J2FA 4XIHA 4K9ZA 5F07A 3HXSA 4MZBA 1GTAA 3UEMA 1DSBA 4F0CA 5ECHB 2VLVA 1K3YA 1YEXA 1TTZA 4I6XA 2I4AA 2KUCA 4IHUA 1TRWA 5CRGA 1NM3A 3Q74A 3CBUA 2AB6A 4QL7A 1TK0B 1GULA 3HVSA 2DIYA 1EEJA 1JZOA 2VCXA 2I3YA 4BL7B 4ACSA 4GQCA 13GSA 2CAIA 2CZ3A 3C1RA 3MNGA 2CVDA 2ES7A 3KH7A 4FYUA 1JZDA 2H71A 2LJKA 4KDYA 3S9FA 4GSSA 1YF1A 2NVLA 3HZ8A 3IDVA 2LSTA 4MA9A 1KEBA 1TI3A 3MWHA 2AYTA 2C8UA 3VK9A 3FZ4A 1UVZA 4AJ7A 5D73A 3F3RA 1KBNA 1X5EA 4LMWA 4KCEA 2GT6A 4K0GA 4EKZA 3ZFLA 5DCHA 2GZPA 4KUNA 3QFAC 2MBSA 1OKDA 3HVXA 4Q5QA 3IK7A 1GTIA 2HRKB 1K0OA 3Q19A 2FCHA 6GSUA 2F3MA 2PERA 1GSSA 5CREA 2HSNB 4ID0A 2H75A 1WIKA 2LV3A 3PGTA 3F63A 4Z7XA 4TR1A 3TRXA 11GSA 1YF0A 1I5GA 4V2LA 3RHCA 4EC0A 1K0AA 1AW9A 2H30A 2OADA 3EE2A 5J9CA 5ECPB 5AIXA 5DVBA 3HA9A 2C1YA 2H1BA 2FA8A 4GXZA 4TR0A 3VWWA 1YQ1A 5FHIA 1X5DA 4KW6A 3H79A 1TRSA 2XBIA 4L0WA 2FGXA 4MZCA 2TIRA 3CTGA 2AHEA 4POMA 1ML6A 2ZUPA 3CMIA 2LRNA 5D9XA 2DJ1A 2BTOT 3L9VA 4JRRA 4NMUA 3GA4A 4N10A 3GH6A 3G7JA 5AISA 5HFIA 1QMVA 1NHOA 1RW1A 4YQVA 4RQXA 2VLUA 4I97A 3VPTA 1QQ2A 4NHZA 4N11A 5ELGA 3KCMA 4F2IA 1XFLA 1TI1A 2EIRA 2YCDA 2QC7A 2JZTA 3ERFA 3VI7A 4TRXA 4XS6A 1XXUA 2B1LA 4I2TA 5IOXA 1VF3A 5DALA 2H6ZA 2OA7A 3P90A 1DBYA 6GSXA 2LJAA 5E4WA 1JZRA 3R3EA 2B7KA 3HDCA 1QGVA 2NTOA 1JZWA 1THXA 2I9HA 3I9V2 5ECOB 1XWBA 2L4QA 1C72A 4DEJA 3QCPA 1ZCPA 3DVWA 2VCTA 1OC9A 1R5AA 4TW5A 2JU5A 2VM1A 3A2XA 1MDKA 4DSQA 1CQGA 3O76A 3IK9A 3WT1A 4GRFA 4RUVA 4Q5FA 2HSMA 2L4CA 1SENA 3ZIVA 3G7YA 3CTFA 4ECCA 1Z9HA 3D4MA 2FWFA 3GKNA 1K3LA 1EWXA 3NIVA 1SK1A 4G9HA 4XRAA 2N5FA 4BVXA 2DJ0A 1F37A 4FH8A 3M1GA 4BWQA 5AGYA 1ERWA 4EL1A 1XZOA 4F82A 5HFGA 4G0KA 1QFNA 4YAVA 1ZGNA 3R2QA 4IBPA 3ERWA 4BWSA 3ED3A 4NV5A 3GTUB 1G6WA 1VF2A 2P31A 4N0VA 3FR9A 3UARA 6GSYA 4ZB6A 4OFTA 4HU7A 3DXBA 3TCOA 2HXKA 4XTSA 3RPPA 5G5FA 4GSNA 2HLSA 4ZL9A 1K3OA 1JLWA 1OAZA 1PA3A 2YWNA 3TKRA 1A0FA 4ECIA 1S3DA 3F4RA 1F3BA 5DBQA 3G9BA 3L0HA 1URMA 4TR1B 5IMVA 3QAWA 4HU9A 2B6MA 2VUPA 5ENUA 2DLXA 5KN0A 1A23A 3UVTA 1HNBA 1PKZA 5A4VA 7GSSA 5KEJA 3KD0A 3IE3A 3GH9A 22GSA 2HRFA 5G1LA 3VWVA 4KDXA 1GLQA 5CRDA 1RQMA 2JZRA 3GX8A 1A2LA 5F05A 1Y25A 2E0QA 2P0GA 2YV7A 3V1WA 2IMKA 4F03A 5A5KA 1TDIA 2PUKC 1ZOFA 4RI7A 4XS4A 2YJHA 1PQNA 4X1UA 4KNDA 1GUHA 2GLRA 2VO4A 3SWLA 3TGZA 5B8BA 3DYRA 3CSJA 2N5AA 2B5YA 18GSA 2HQTA 2VD1A 5DALB 5DQYA 3IPZA 1LJRA 2MBTA 3U5RE 1TK5B 4EDYA 4MF6A 2FLSA 4ECJA 3EU4A 14GSA 2NPBA 2XHFA 3OR5A 4CDOA 1MD4A 1MD3A 2G2QA 2YJ7A 3GYKA 3F6DA 3IOSA 1K0BA 2H19A 1AXDA 5CAXA 4WBJA 2GS3A 3IR4A 4KGIA 3ZRDA 4BVYB 5KN1A 2CX4A 4I8BA 4XS1A 4ZB8A 3FKFA 1B9YC 2A2SA 4TR4A 2HSMB 1O81A 1SKWB 1B9XC 1ZYQB 1ILOA 5GZZB 4WKWA 2PMTA 5JCWA 5J9BA 4JU5A 1ON4A 4ZBDA 1Z5YE 5ECMB 5IMDA 3A2WA 1AQXA 3TDGA 1AC1A 1JFUA 1SYRA 2L6DA 2H76A 4PUFC 4KX4A 4HUAA 1NHYA 4YAPA 1V40A 2VCWA 2EIQA 1S3AA 3BCIA 2LEGA 3SBCA 2WFCA 1F2EA 4AJ6A 2ZNMA 1DE2A 4TXOA 3IC8A 2O85A 1OKTA 2C0DA 2GQKA 2OBKA 1Z7PA 4IQAA 1B48A 2I1UA 1AUCA 2DSAA 4HS1A 2RUEA 1XWCA 4G0IA 5CO3A 2C4JA 3GKKA 5IO2A 5D96A 4NXIA 2PN8A 3F4TA 4MP4A 2HI7A 2X99A 2H8LA 3TUEA 2K18A 4QQ7A 2HZEB 5D9VA 1SD9A 4J57E 1JLVA 3APOA 3I69A 2VOCA 1TU8A 3KM6A 3IV4A 1U3AA 1PL1A 2NBSA 3LWAA 3GL3A 4HZ4A 3LGCA 4WR4A 5B7CA 2EIOA 1XPVA 2WGRA 3KMNA 4OMVA 1GSDA 1J08A 4KH7A 4PGTA 1FB6A 5IPGA 5ECRB 4IP6A 3RHBA 2E2GA 3VLNA 1UN2A 1XWKA 4X0XA 5J5NA 2P5QA 3PINA 1VGLA 3FR6A 1T8EB 3W8SA 2OJLA 9GSSA 4EO3A 16GSA 1WP0A 5A4WA 1XCCA 1U87A 4K0NA 1X5CA 1EV4A 2FWGA 4G2EA 3ZITA 5A4UA 1GP1A 1W4VA 2IMDA 1YEPA 4IJ3A 2M80A 4V1Ag 3J7Yb 1SK2A 1YDKA 3FW2A 2X8HA 5JCUA 3ZFBA 2LTKA 5DJMA 2H73A 4CW9A 4IJIA 1O85A 2V6OA 2VL2A 4QL9A 3C73A 3LYPA 3WD6A 5IO0A 2YOIA 6GSSA 3E3EA 2VLTA 2P5RA 4GLTA 1XWAA 4K7NA 1SK0A 2L57A 5H5QA 3EVIA 3U6VA 1ERTA 4IQ1A 2YWOA 2FNOA 3KJYA 1EZKA 3KP8A 3FHKA 3TKSA 2CA8A 2TRXA 5DAKA 2V32A 4PUAA 1T4ZA 2YZUA 1GRXA 2RM5A 3HJOA 2H0IA 3GKMA 4TVEA 2D2ZA 4WBRD 3D5JA 2B5EA 3UL3A 3US3A 1RK4A 5DDLA 2RLIA 3G7IA 4POLA 1Z3EA 4IP1A 3LXTA 5C00A 3ZVJA 2GSQA 3Q6OA 2VCQA 5H5RA 4ILFA 2F9SA 3DRNA 4D73A 4IGJA 3CYNA 3GX0A 4HJ2A 1OC8A 1YZXA 5HR2A 3VWXA 4TKYA 1SKSB 3APQA 5G30A 3F3QA 3O3TA 4MK3A 1A8YA 1FO5A 4PQIA 2N5BA 2X64A 3EINA 4POKA 5JWRB 1YY7A 4OWYA 5ID2A 4XHMA 4MCUA 4ULXA 2DMLA 5F0GA 3N9JA 2H0GA 5GAPD 3A2VA 3LG6A 1HYUA 5AN1A 3TJJA 1X9SB 1N8JA 4LL4B 1X9WB 5B6NA 3HD5A 3CSHA 3L9SA 2O8VB 3DEXA 2WJUA 2XBQA 1R4WA 4Q5NA 2JACA 2LKUA 4OCFA 1T1VA 3RBTA 5E59A 3TJFA 2ON5A 1A2MA 6GSVA 2XPDA 5COHA 1K0CA 2O87A 2OE3A 2CT6A 1H4OA 3D22A 1YJ6A 12GSA 2H72A 2LUSA 2LQOA 1X0RA 3GURA 1FB0A 2LRTA 2PVQA 4MPGA 4GF0A 3W6GA 3FZAA 1Q98A 4K6XA 5J3RA 3GIXA 3TKQA 2M72A 3P8WA 3HZ4A 2LNTA 2JADA 2WB9A 5D8IA 3TRPA 1TU7A 3M8NA 1EP8A 2C0EA 2HRNA 5GAND 2B3SA 4FYCA 3HJMA 2AJQB 3I43A 3QDNA 4ZBAA 1AQVA 3GNJA 5HR3A 1GSUA 3KTLA 4GQFA 2GDRA 4MH2A 5JCGA 1EP7A 4PQ1A 3IA1A 5C04A 1USBA 2KHPA 1R7HA 3HHVA 1FOVA 4PNFA 2AUVA 3I6AA 1HD2A 2HSYA 2Z9SA 2HE3A 5IMCA 4HEA2 1R5PA 2YP6A 1AAZA 3F0IA 4ISDA 4F0BA 4Q5RA 1BJXA 3VURA 4CHSA 1SJIA 2WDUA 1TP9A 1SU9A 2IJYA 1PMTA 5J41A 5HFKA 4KA0A 5DAKB 4MJBA 1ERUA 1GWCA 1DUGA 1SKRB 4G0LA 5F06A 3VPQA 1BQ7A 5IMZA 1PX7A 1YKAA 5D9WA 1QUWA 1B4QA 4AJ8A 4J56E 3FZ9A 1PRXA 2GVPA 3BD2A 3EC3A 4KAEA 3CRUA 1J0FA 3UMAA 1FG4A 4WEYA 1NSWA 2GZZA 3FRCA 1OE7A 4PTSA 1FAAA 4HOJA 4D73B 3BCKA 5D93A 3F8UA 2AAWA 3J7Yk 3IAM2 3DIEA 4HQZA 4ZBBA 1YKCA 4MLYA 2V1MA 5G31A 4FQUA 1ZZYA 3KIJA 5ID2B 1XW5A 4MF7A 3VFIA 3M9JA 2A2RA 2E2MA 2L5OA 2QKEA 3N5OA 1PGTA 2HRAA 5FT3A 2CAQA 1DE1A 3TKPA 4KB3A 1A2JA 3QMXA 3HYPA 4L0UA 1Z6NA 4MDCA 6GSWA 3E9JB 1UC7A 1XVWA 2J23A 3QPMA 4MF5A 5IIZA 6GSTA 1V58A 2JSYA 1SL0B 3F6FA 1G6YA 2CV4A 3NOFA 2UZ8A 2DJ3A 4G19A 1PD21 2FWHA 3VI5A 1OVNA 3LYKA 3W8JA 2VL2C 2VCZA 1E2YA 5ECNB 1UA5A 3UOMA 1Q4JA 1LU4A 3TJKA 4XCSA 5HR1A 4WF5A 1OC9B 2YANA 2ZCTA 4YH2A 1GLPA 1F3AA 1U88A 1QK8A 2IFQA 4TR3A 1AIUA 3HVVA 2NDOA 3HKRA 3MDKA 4KSMA 19GSA 4IVFA 2WRTA 2X8GA 5G2ZA 2KLXA 4I2UA 3F4SA 3TKSC 3ZTLA 3FY7A 4ZL8A 2H70A 4BVXB 1EGOA 4DSSA 1O8XA 4PXOA 1GUKA 1R26A 3MSZA 3PPUA 2VM2A 4KDUA 1I9DA 4F9ZA 3A3TA 5B6MA 4EDZA 2TRCP 3GN3A 3GRXA 3CXGA 2CZ2A 1VF4A 5ECQB 2EC4A 4ZIJA 2MMZA 3TJBA 2HYXA 4POBA 1WWJA 2JSZA 2IWTA 4JZQA 3DMLA 4X43A 5IMAA 2VIMA 2REMA 1GTUA 2PVOC 5CRHA 2K8VA 5GSTA 3QAVA 2F51A 4BA7A 3KZQA 3DWVA 3ME7A 4EUYA 5ECKB 2OKAA 3EURA 4WETA 4WF4A 1SL2B 4JEDA 1GH2A 1K0DA 2B1KA 5IMFA 3Q18A 4EXJA 3UBLA 2QSIA 3F9UA 3EWLA 1XOBA 4HQSA 3HY2A 3AY8A 4ML6A 1M2DA 5INYA 3TJGA 3C8EA 1GSEA 3IBHA 1GSYA 2V2GA 1T4YA 1WOUA 3LEFA 3H8QA 3KH9A 5IM9A 2JL4A 4YQUA 1BX9A 1V57A 4O32A 1TXXA 2MMAA 4XS4B 1GTBA 2H01A 1G0TA 4V2MA 4WXTA 2OBIA 2IPAA 4TOPA 5DQSA 2LNSA 2GZYA 3FK8A 3K8NA 2R37A 1B4PA 1ERVA 4K7OA 2KP1A 4FO5A 2B5XA 2CX3A 2K9FA 4AGSA 2VL9A 3UJ1A 3L9UA 3WGXA 4RQRA 2PWJA 4PQHA 5HR0A 4N0ZA 10GSA 3RPNA 2KOKA 2H6XA 3HJPA 4E8EA 4IN0A 3TKSE 3ZYWA 2H0HA 3DGQA 3QR6A 1WPIA 5ECIB 2GQMA 2XPEA 4ZL7A 3H93A 3ERGA 4JBBA 4XRDA 1EV9A 2V41A 2IFQB 4O7HA 1IYIA 3EMXA 5EVOA 3IC4A 3PH9A 3M3MA 1TK8B 2QGVA 5EY6A 4NHWA 2HZFA 2E7PA 4KF9A 4OFNA 5IOWA 2H1AA 3WGEA 1S3CA 1BEDA 2R4VA 1LBKA 2C80A 4DSSB 1SD8A 3EYTA 3ZZXA 2OACA 3HCZA 1TKDB 4O92A 3GTUA 4GSTA 1O6JA 3GUSA 1U3IA 1OC3A 5CRWA 3MAKA 4K7IA 2CVKA 3H4KA 3O6TA 4YQMA 2FD3A 5HQPA 1XW9A 2RM6A 4TXOB 2YPMA 1K0NA 2VAFA 1X9MB 1A24A 5L71A 3LFLA 4ML1A 3ZVJD 3ZL5A 5G1KA 1M9AA 1XWGA 4LMVA 4EF0A 4JE1A 2IMIA 3GKXA 1B8XA 3LSZA 1W89A 1O8WA 3L78A 4LL1B 4NWYA 3WGDA 1O7UA 3CSIA 4G10A 1M7TA 1XBSA 2GGTA 1TRUA 2L59A 2H6YA 3L4NA 1WMJA 4JR6A 3JCML 4HJMA 5B8AA 3BBYA 2F8FA 3QFBC 2GSSA 1GL8A 2R3XA 3TB2A 1OE8A 1G7EA 4RI6A 1EOGA 4MJAA 4TXVA 5LCZA 2H1GA 4L8EA 1A8LA 2LJRA 2XC2A 3GSSA 2YNXA 5GSSA 2GT5A 5D9TA 5G5EA 1QXHA 5IQYA 1WE0A 4OD7A 2FA4A 1MTCA 2R6KA 2YWIA 3M9KA 3APSA 2CVBA 3ZREA 4ECBA 4GCIA 3BJ5A 3KMOA 2L6CA 3A5WA 2C3TA 3DD3A 5F8BA 3DVXA 1CQHA 3ZMKA 2FY6A 3UBKA 1O73A 1KNGA 2VL3A 1ZL9A 4HZ2A 2B7JA 3QOUA 1FVKA 3KXOA 3FR3A 1VRSD 1M99A 1M0UA 1NW2A 3UAPA 4L5LA 4IS0A 1SJ6A 1ZYEA 2YZHA 1TJDA 3P7XA 1TRVA 1K0MA 3KP9A 3WYWA 2WULA 2HSHA 2H74A 1AQWA 2LQQA 4OO4A 2LRCA 3E0UA 2HT9A 2IMFA 1SJZA 4P3YB 1ZMAA 2GQLA 4BVYA 2J9HA 3ZMLA 4TN8A 2PGTA 2L5LA 4FYBA 4IELA 5ECSA 4KE3A 2OE1A 1THOA 2O89A 1JHBA 1E6BA 2KP2A 1TW9A 5ELAA 2GSTA 1GSQA 4IKHA 3IHQA 3H1NA 1V9WA 3C1SA 2FHEA 3GL5A 2MZCA 1FVJA 3IXRA 1Y6EA 5JWOB 4MZWA 3ISOA 3KGKA 2X8CA 2C3NA 2DJ2A 2IMEA 3FZ5A 5ECLB 4OO5A 1T7PB 2HFDA 5DCGA 1SL1B 5CP1A 5CYYA 2CQ9A 5LD0A 2YWMA 4K1FA 1J9BA 1XOAA 4EVMA 4LLRA 5DJLA 2R5GA 2RIIA 3FEUA 2IL3A 2H1DA 4ZXGA 4PNGA 3P2AA 3LJRA 1OYJA 3ZIJA 3C71A
chains in the Genus database with same CATH superfamily
2LS5A 2DJJA 2PU9C 4K2XA 5IPHA 4GWRA 4L5OA 1F6MC 2WS2A 4HDEA 4MABA 5KN3A 8GSSA 20GSA 1XVQA 4V1Ap 2MMNA 1GUMA 4FIWA 4WR5A 2AV4A 1T3BA 2FUG2 3PR8A 3M0FA 2K8SA 2GTUA 1PKWA 1MDIA 4MMMA 5H5SA 2HZEA 1HQOA 3D6IA 2G0FA 1V2AA 3UIWA 1ACVA 2R0CA 3EMPA 1BG1A 3LXZA 3TOUA 4DSRA 4O5RA 3CRTA 4Z2TA 5AIVA 4JR4A 5EL8A 5BMUA 3D21A 4OCEA 1EGRA 2BJXA 1BAYA 2WCIA 2PPTA 2R2JA 3NZNA 4NPBA 4N3ZA 1XW6A 4K8MA 5J4YA 4LA1A 4AKIA 4NAXA 3GHAA 1Y1UA 2MMOA 1HNCA 3D4TA 3KTBA 1PL2A 5LNKe 3QD9A 2A4VA 2WZ9A 4AF2A 1PSQA 4ZILA 1GSFA 1BG5A 1M2AA 3QAGA 1Z6MA 1KTEA 2C0GA 4BL7A 2IIYA 4HI7A 2C0FA 2K6VA 1FW1A 2DIZA 1EOHA 4ZB9A 3C7MA 2F8AA 2VCVA 1N2AA 3UVHA 4GTUA 4A5PA 2DC5A 4H86A 4MJEA 4OFMA 2JZSA 2DJKA 2ALBA 3GMFA 1MDJA 5CNWA 2GSRA 2V6KA 2ON7A 1ST9A 5KOWA 3DKSA 3FYGA 1FHEA 1GNEA 2O7KA 2DMMA 5A34A 4MH3A 2I81A 2YV9A 4KSOA 3GV1A 1M9BA 1VF1A 4N30A 4NV2A 5EPFA 3GFKA 3ZLPA 4USSA 1WRYA 1G7OA 2HRKA 3WT2A 4KCAA 5JWQB 2QA2A 2H66A 3D0ZA 4V2NA 3RDWA 2HSNA 2C3QA 3TRQA 4BPYA 2PBJA 1TOFA 3KEBA 1Z7RA 3LORA 3LQ7A 4K2DA 4EE0A 2IN3A 2BMXA 1BYEA 1PN0A 4E8HA 2M46A 3EU3A 1XIYA 2RUFA 1PN9A 17GSA 4MPFA 3IRAA 3VWUA 2MYGA 4DVCA 1EEMA 1H75A 1IYHA 4PURA 1MEKA 1PX6A 4IW9A 4PHZC 1GNWA 2EFCA 4PX1A 1ABAA 5KN2A 2VD0A 1A0RP 1SYXA 3TOTA 2HNLA 3RAZA 2FWEA 2OE0A 3BOAA 1T00A 1U6TA 4I5QA 5FWGA 1V98A 3IAS2 2A4HA 2DBCA 1F9MA 2YN1A 1WJKA 5J4UA 3ME8A 5ABRA 3GSTA 1M2BA 4MJCA 1HNAA 4J2FA 4XIHA 4K9ZA 5F07A 3HXSA 4MZBA 1GTAA 3UEMA 1DSBA 4F0CA 5ECHB 2VLVA 1K3YA 1YEXA 1TTZA 4I6XA 2I4AA 2KUCA 4IHUA 1TRWA 5CRGA 1NM3A 3Q74A 3CBUA 2AB6A 4QL7A 1TK0B 1GULA 4PI2C 3MIXA 2UV8G 3HVSA 2DIYA 1EEJA 1JZOA 2VCXA 2I3YA 4Z2RA 4BL7B 4ACSA 4GQCA 13GSA 2CAIA 2CZ3A 3C1RA 3MNGA 2CVDA 2ES7A 3KH7A 4FYUA 1JZDA 1BF5A 2H71A 2LJKA 4KDYA 2A2PA 3S9FA 4GSSA 1YF1A 2NVLA 3HZ8A 3IDVA 2LSTA 4MA9A 1KEBA 1TI3A 3MWHA 2AYTA 2C8UA 3VK9A 3FZ4A 1UVZA 4AJ7A 5D73A 3F3RA 1KBNA 1X5EA 4LMWA 4KCEA 2GT6A 4K0GA 4EKZA 3ZFLA 5DCHA 2GZPA 4KUNA 3QFAC 2MBSA 1OKDA 3HVXA 4Q5QA 3IK7A 3MYDA 1GTIA 2HRKB 1K0OA 3Q19A 2FCHA 6GSUA 2F3MA 2PERA 2DKIA 1GSSA 5CREA 2HSNB 4ID0A 2H75A 1WIKA 2LV3A 1TXUA 3PGTA 3F63A 4Z7XA 4TR1A 3TRXA 11GSA 1YF0A 1I5GA 4V2LA 3RHCA 4EC0A 1K0AA 1AW9A 2H30A 2OADA 3EE2A 5J9CA 5ECPB 5AIXA 5DVBA 3HA9A 2C1YA 2H1BA 2FA8A 4GXZA 4TR0A 3VWWA 1YQ1A 5FHIA 1X5DA 4KW6A 3H79A 1TRSA 2XBIA 4L0WA 2FGXA 4MZCA 2TIRA 4MNNA 3CTGA 2AHEA 4POMA 1ML6A 2ZUPA 3CMIA 2LRNA 5D9XA 2DJ1A 2BTOT 3L9VA 4JRRA 4NMUA 3GA4A 4N10A 3GH6A 3G7JA 5AISA 5HFIA 1QMVA 1NHOA 1RW1A 4YQVA 4RQXA 2VLUA 4I97A 3VPTA 1QQ2A 4NHZA 4N11A 5ELGA 3HVNA 3KCMA 4F2IA 1XFLA 1TI1A 2EIRA 2YCDA 2QC7A 2JZTA 3ERFA 3VI7A 4TRXA 4XS6A 1XXUA 2B1LA 4I2TA 5IOXA 1VF3A 5DALA 2H6ZA 2OA7A 3P90A 1DBYA 4O5UA 6GSXA 2LJAA 5E4WA 1JZRA 3R3EA 2B7KA 3HDCA 1QGVA 2NTOA 1JZWA 1THXA 2I9HA 3I9V2 5ECOB 1XWBA 2L4QA 1C72A 4DEJA 3QCPA 1ZCPA 3DVWA 2VCTA 1OC9A 1R5AA 4TW5A 2JU5A 2VM1A 3A2XA 1MDKA 4DSQA 1CQGA 3O76A 3IK9A 3WT1A 4GRFA 4RUVA 4Q5FA 2HSMA 2WZSA 5BRTA 2L4CA 1SENA 3ZIVA 3G7YA 4FXYP 3CTFA 4ECCA 1Z9HA 3D4MA 2FWFA 2EFHA 3GKNA 1K3LA 1EWXA 3NIVA 1SK1A 4G9HA 4XRAA 2N5FA 4BVXA 2DJ0A 1F37A 4FH8A 3M1GA 4BWQA 5AGYA 1ERWA 4EL1A 1XZOA 4F82A 5HFGA 4G0KA 1QFNA 4YAVA 1ZGNA 3R2QA 4IBPA 3EPTA 3ERWA 4BWSA 3ED3A 4NV5A 3GTUB 1G6WA 2WVXA 1VF2A 2P31A 4N0VA 3FR9A 3UARA 6GSYA 4ZB6A 4OFTA 4YKGA 4HU7A 3DXBA 3TCOA 2HXKA 4XTSA 3RPPA 3FMWA 5G5FA 4GSNA 2HLSA 4ZL9A 1K3OA 1JLWA 1OAZA 1PA3A 2YWNA 3TKRA 1A0FA 4ECIA 1S3DA 3F4RA 1F3BA 5DBQA 3G9BA 3L0HA 1URMA 4TR1B 5IMVA 3QAWA 4HU9A 2B6MA 1XG8A 2VUPA 5ENUA 2DLXA 2X4AA 5KN0A 1A23A 3UVTA 1HNBA 1PKZA 4EIPA 5A4VA 7GSSA 5KEJA 3KD0A 3IE3A 3GH9A 22GSA 2HRFA 5G1LA 3VWVA 4KDXA 1S4BP 5KOXA 1GLQA 5CRDA 1RQMA 2JZRA 3GX8A 1A2LA 5F05A 1Y25A 2E0QA 2P0GA 2YV7A 3V1WA 2IMKA 4F03A 5A5KA 1TDIA 2PUKC 1ZOFA 4RI7A 4XS4A 2YJHA 1PQNA 4X1UA 4KNDA 1GUHA 2GLRA 2VO4A 3SWLA 3TGZA 5B8BA 3DYRA 3CSJA 2N5AA 2B5YA 18GSA 2HQTA 2VD1A 5DALB 5DQYA 3IPZA 1LJRA 2MBTA 3U5RE 1TK5B 4EDYA 4MF6A 2FLSA 4ECJA 3EU4A 14GSA 2NPBA 2XHFA 3OR5A 4CDOA 1MD4A 1MD3A 1YVLA 2G2QA 2YJ7A 3GYKA 3F6DA 3IOSA 1K0BA 2H19A 1AXDA 5CAXA 4WBJA 2GS3A 3IR4A 4KGIA 3ZRDA 4BVYB 1FOHA 5KN1A 2CX4A 4I8BA 4XS1A 4ZB8A 3FKFA 1B9YC 2A2SA 4TR4A 2HSMB 1O81A 1SKWB 1B9XC 1ZYQB 1ILOA 5GZZB 4WKWA 2PMTA 5JCWA 5J9BA 4JU5A 1ON4A 4ZBDA 1Z5YE 5ECMB 5IMDA 3A2WA 1AQXA 3TDGA 1AC1A 1JFUA 1SYRA 2L6DA 5A1NA 2H76A 4PUFC 4KX4A 4HUAA 1NHYA 4YAPA 1V40A 2VCWA 2EIQA 1S3AA 3BCIA 2LEGA 3SBCA 2WFCA 1F2EA 4AJ6A 2ZNMA 1DE2A 4TXOA 3IC8A 4AI6A 2O85A 1OKTA 2C0DA 2GQKA 2OBKA 1S3RA 2R0GA 2WW2A 1Z7PA 4IQAA 1B48A 2I1UA 2R0PA 1AUCA 2DSAA 4HS1A 2RUEA 1XWCA 4G0IA 4ZB7A 5CO3A 2C4JA 3GKKA 5IO2A 5D96A 4NXIA 2PN8A 3F4TA 4MP4A 2HI7A 2X99A 2H8LA 3TUEA 2K18A 4QQ7A 2HZEB 5D9VA 1SD9A 4J57E 1JLVA 3APOA 3I69A 2VOCA 1TU8A 1M3JA 3KM6A 1N25A 3IV4A 1U3AA 1PL1A 2NBSA 3LWAA 3GL3A 4HZ4A 5BMUB 3LGCA 4WR4A 5B7CA 2EIOA 1XPVA 4W66A 2WGRA 3KMNA 4OMVA 1GSDA 1J08A 4KH7A 4PGTA 1FB6A 5IPGA 5ECRB 4IP6A 3RHBA 2E2GA 3VLNA 1UN2A 1XWKA 4X0XA 5J5NA 2P5QA 3PINA 1VGLA 3FR6A 1T8EB 3W8SA 2OJLA 9GSSA 4EO3A 16GSA 1WP0A 5A4WA 1XCCA 1U87A 4K0NA 1X5CA 1EV4A 2FWGA 4G2EA 3ZITA 5A4UA 1SVOA 1GP1A 1W4VA 2IMDA 1YEPA 4IJ3A 2M80A 4V1Ag 3J7Yb 4K5SA 1SK2A 4GDFA 1YDKA 3FW2A 2X8HA 5JCUA 3ZFBA 2LTKA 5DJMA 2H73A 4CW9A 4IJIA 4O5QA 1O85A 2V6OA 2VL2A 4QL9A 3C73A 3LYPA 3WD6A 5IO0A 4AKGA 2YOIA 6GSSA 3E3EA 2VLTA 2P5RA 4GLTA 1XWAA 4K7NA 1SK0A 2L57A 5H5QA 3EVIA 3U6VA 1ERTA 5A34B 4IQ1A 2YWOA 2FNOA 3KJYA 3CWGA 1EZKA 3KP8A 3FHKA 3TKSA 2CA8A 2TRXA 5DAKA 2V32A 1ZYPA 4PUAA 1T4ZA 2YZUA 1GRXA 2RM5A 3HJOA 2O3EA 2H0IA 3GKMA 4TVEA 2D2ZA 4WBRD 3D5JA 2B5EA 3UL3A 3US3A 1RK4A 5DDLA 2RLIA 3G7IA 4POLA 1Z3EA 4IP1A 3LXTA 5C00A 3ZVJA 2GSQA 3Q6OA 2VCQA 5H5RA 5J4VA 4ILFA 2F9SA 3DRNA 4D73A 4IGJA 3CYNA 3GX0A 4HJ2A 1OC8A 1YZXA 5HR2A 3VWXA 4TKYA 1SKSB 3APQA 5G30A 3F3QA 3O3TA 4MK3A 1A8YA 1FO5A 4PQIA 2N5BA 2X64A 3EINA 4POKA 5JWRB 1YY7A 4OWYA 5ID2A 4XHMA 4MCUA 2O5VA 4ULXA 2DMLA 5F0GA 3N9JA 2H0GA 5GAPD 3A2VA 3LG6A 1HYUA 5AN1A 3TJJA 1X9SB 1N8JA 4LL4B 1X9WB 5B6NA 3HD5A 3CSHA 3L9SA 2O8VB 1YEWC 2WVZA 3DEXA 2WJUA 2XBQA 1R4WA 4Q5NA 2JACA 2LKUA 4OCFA 1T1VA 3RBTA 5E59A 3TJFA 2ON5A 1A2MA 6GSVA 2XPDA 5COHA 1K0CA 2O87A 2OE3A 1PFOA 2CT6A 1H4OA 3D22A 1YJ6A 12GSA 2H72A 2LUSA 2LQOA 1X0RA 3GURA 1FB0A 2LRTA 2PVQA 3RGBC 4MPGA 4GF0A 3W6GA 3FZAA 1Q98A 4K6XA 5J3RA 3GIXA 3TKQA 2M72A 3P8WA 3HZ4A 2LNTA 2JADA 2WB9A 5D8IA 3TRPA 1TU7A 3M8NA 1EP8A 2C0EA 2HRNA 5GAND 2B3SA 4FYCA 3HJMA 2AJQB 1ZYNA 3I43A 3QDNA 4ZBAA 1AQVA 3GNJA 4BIKA 5HR3A 1GSUA 3KTLA 4GQFA 2GDRA 4MH2A 5JCGA 1EP7A 4PQ1A 3IA1A 5C04A 1USBA 2KHPA 1R7HA 3HHVA 2H1LA 5J47A 1FOVA 4PNFA 2AUVA 4X4JA 3I6AA 1HD2A 2HSYA 2Z9SA 2HE3A 5IMCA 4HEA2 1R5PA 2YP6A 1AAZA 1M3IA 3F0IA 4ISDA 4F0BA 4Q5RA 1BJXA 3VURA 4CHSA 4QMKA 1SJIA 2WDUA 1TP9A 3TU3B 1SU9A 2IJYA 1PMTA 5J41A 5HFKA 4KA0A 5DAKB 2EFDA 4MJBA 1ERUA 1GWCA 1DUGA 1SKRB 4G0LA 5F06A 3VPQA 1BQ7A 2X49A 5IMZA 1PX7A 1YKAA 5D9WA 1QUWA 1B4QA 4AJ8A 4J56E 3FZ9A 1PRXA 2GVPA 3BD2A 3EC3A 4KAEA 3CRUA 1J0FA 3UMAA 1FG4A 4WEYA 1NSWA 2GZZA 3FRCA 1OE7A 4PTSA 1FAAA 4HOJA 4D73B 3BCKA 1SVMA 5D93A 3F8UA 4HSCX 2AAWA 3J7Yk 3IAM2 3DIEA 4HQZA 4ZBBA 1YKCA 4MLYA 2V1MA 4K5RA 5G31A 4FQUA 1ZZYA 3KIJA 5ID2B 1XW5A 4MF7A 3VFIA 3M9JA 2A2RA 2E2MA 2L5OA 2QKEA 3N5OA 3IHGA 1PGTA 2HRAA 5FT3A 2CAQA 1DE1A 3TKPA 4KB3A 1A2JA 3QMXA 3HYPA 4L0UA 1Z6NA 4MDCA 6GSWA 3E9JB 1UC7A 1XVWA 2J23A 3QPMA 4MF5A 5IIZA 6GSTA 1V58A 2JSYA 1SL0B 3F6FA 1G6YA 2CV4A 3NOFA 2UZ8A 2DJ3A 4G19A 1PD21 2FWHA 3VI5A 1OVNA 3LYKA 3W8JA 2VL2C 2VCZA 1E2YA 5ECNB 1UA5A 3UOMA 5J40A 1Q4JA 1LU4A 3TJKA 4XCSA 5HR1A 4WF5A 1OC9B 2YANA 2ZCTA 4YH2A 1GLPA 1F3AA 1U88A 1QK8A 2IFQA 4EIQA 4TR3A 1AIUA 3RFRC 3HVVA 2NDOA 3HKRA 3MDKA 4KSMA 19GSA 4IVFA 2WRTA 2X8GA 5G2ZA 2KLXA 4I2UA 3A5IA 3F4SA 3TKSC 3ZTLA 3FY7A 4ZL8A 2H70A 4BVXB 1EGOA 4DSSA 1O8XA 2VKZG 4PXOA 1GUKA 1R26A 3MSZA 3PPUA 2VM2A 4KDUA 1I9DA 2EFEA 4F9ZA 3A3TA 5B6MA 4EDZA 2TRCP 2WVXB 3GN3A 3GRXA 3CXGA 2CZ2A 1VF4A 4G01A 5ECQB 2EC4A 4ZIJA 2MMZA 3TJBA 2HYXA 4POBA 1WWJA 2JSZA 2IWTA 4JZQA 3DMLA 4X43A 5IMAA 5A5HA 2VIMA 2REMA 1GTUA 2PVOC 5CRHA 2K8VA 5GSTA 3QAVA 2F51A 4BA7A 3KZQA 3DWVA 3ME7A 4EUYA 5ECKB 2OKAA 3EURA 4WETA 4WF4A 1SL2B 4JEDA 2DKHA 1GH2A 1K0DA 2B1KA 5IMFA 3Q18A 4EXJA 3UBLA 2QSIA 3F9UA 3EWLA 1XOBA 4HQSA 3HY2A 3AY8A 2WVYA 4ML6A 1M2DA 5INYA 3TJGA 3C8EA 1GSEA 3IBHA 1GSYA 2V2GA 1T4YA 1WOUA 3LEFA 3H8QA 3KH9A 5IM9A 2JL4A 4YQUA 1BX9A 1V57A 4O32A 1TXXA 2MMAA 4ICYA 4XS4B 1GTBA 2H01A 1G0TA 2WW0A 4V2MA 4WXTA 2OBIA 2IPAA 4TOPA 5DQSA 2LNSA 2GZYA 3FK8A 3K8NA 2R37A 1B4PA 1ERVA 4K7OA 2KP1A 4FO5A 2B5XA 2CX3A 2K9FA 4AGSA 4AKHA 2VL9A 3UJ1A 3L9UA 3WGXA 4RQRA 4Z2UA 2PWJA 4PQHA 4YKFA 5HR0A 4N0ZA 10GSA 3RPNA 2KOKA 2H6XA 3HJPA 4E8EA 4IN0A 3TKSE 3ZYWA 2H0HA 3DGQA 3QR6A 1WPIA 5ECIB 2GQMA 2XPEA 4ZL7A 3H93A 3ERGA 4JBBA 4XRDA 1EV9A 2V41A 2IFQB 4O7HA 1IYIA 3EMXA 5EVOA 3IC4A 3PH9A 3M3MA 1TK8B 2QGVA 5EY6A 4NHWA 2OT3A 2HZFA 2E7PA 4KF9A 4OFNA 5IOWA 2H1AA 3WGEA 1S3CA 5A1NB 1BEDA 2R4VA 1LBKA 2C80A 4DSSB 1SD8A 3EYTA 3ZZXA 2OACA 3HCZA 1TKDB 4O92A 3GTUA 4GSTA 1O6JA 3GUSA 1U3IA 1OC3A 5CRWA 3MAKA 4K7IA 2CVKA 3H4KA 3O6TA 1I1IP 4YQMA 2FD3A 5HQPA 1XW9A 2RM6A 4TXOB 2YPMA 1K0NA 2VAFA 1X9MB 1A24A 5L71A 3LFLA 4ML1A 3ZVJD 3ZL5A 3LW9A 5G1KA 1M9AA 1XWGA 4LMVA 4EF0A 4JE1A 2IMIA 3GKXA 1B8XA 3LSZA 1W89A 1O8WA 3L78A 4LL1B 4NWYA 3WGDA 5A5HB 1O7UA 3CSIA 4G10A 1SVLA 1M7TA 1XBSA 2GGTA 1TRUA 2L59A 2H6YA 3L4NA 1WMJA 4JR6A 3JCML 2WW3A 4HJMA 5B8AA 3BBYA 2F8FA 3QFBC 2GSSA 1GL8A 2R3XA 3TB2A 1OE8A 1G7EA 4RI6A 1EOGA 4MJAA 4TXVA 5LCZA 2H1GA 4L8EA 1A8LA 2LJRA 2XC2A 3GSSA 2YNXA 5GSSA 2GT5A 5D9TA 5G5EA 1QXHA 5IQYA 1WE0A 4OD7A 2FA4A 3HMJG 1MTCA 2R6KA 2YWIA 3M9KA 3APSA 2CVBA 3ZREA 4ECBA 4GCIA 3BJ5A 3KMOA 2L6CA 3A5WA 2C3TA 3DD3A 5F8BA 3DVXA 1CQHA 3ZMKA 2FY6A 2O36A 3UBKA 1O73A 1KNGA 2VL3A 1ZL9A 4HZ2A 2B7JA 3QOUA 1FVKA 3KXOA 3FR3A 1VRSD 1M99A 1M0UA 4PI0C 1NW2A 3UAPA 4L5LA 4IS0A 1SJ6A 1ZYEA 2YZHA 1TJDA 3P7XA 1TRVA 3CQFA 1K0MA 3KP9A 3WYWA 2WULA 2HSHA 2H74A 1AQWA 2LQQA 4OO4A 2LRCA 3E0UA 2HT9A 2IMFA 1SJZA 2QA1A 4P3YB 1ZMAA 2GQLA 4BVYA 4AKXB 2J9HA 3ZMLA 4TN8A 2PGTA 2L5LA 4FYBA 4IELA 5ECSA 4KE3A 2OE1A 1THOA 2O89A 1JHBA 1E6BA 2KP2A 1TW9A 5ELAA 2GSTA 1GSQA 4IKHA 3IHQA 3H1NA 1V9WA 3C1SA 2FHEA 3CHXC 4CY8A 3GL5A 2MZCA 1FVJA 3IXRA 2WW1A 1Y6EA 5JWOB 4MZWA 3ISOA 3KGKA 2X8CA 2C3NA 4E68A 2DJ2A 2IMEA 3FZ5A 5ECLB 4OO5A 1T7PB 2HFDA 4CY6A 5DCGA 1SL1B 5CP1A 5CYYA 2CQ9A 5LD0A 2YWMA 4K1FA 1J9BA 1XOAA 4EVMA 4LLRA 5DJLA 2R5GA 2RIIA 3FEUA 2IL3A 2H1DA 4ZXGA 4PNGA 3P2AA 3LJRA 1OYJA 3ZIJA 3C71A
chains in the Genus database with same CATH topology
2LS5A 2DJJA 2PU9C 4K2XA 5IPHA 4GWRA 4L5OA 1F6MC 2WS2A 4HDEA 4MABA 5KN3A 8GSSA 20GSA 1XVQA 4V1Ap 2MMNA 1GUMA 4FIWA 4WR5A 2AV4A 1T3BA 2FUG2 3PR8A 3M0FA 2K8SA 2GTUA 1PKWA 1MDIA 4MMMA 5H5SA 2HZEA 1HQOA 3D6IA 2G0FA 1V2AA 3UIWA 1ACVA 2R0CA 3EMPA 1BG1A 3LXZA 3TOUA 4DSRA 4O5RA 3CRTA 4Z2TA 5AIVA 4JR4A 5EL8A 5BMUA 3D21A 4OCEA 1EGRA 2BJXA 1BAYA 2WCIA 2PPTA 2R2JA 3NZNA 4NPBA 4N3ZA 1XW6A 4K8MA 5J4YA 4LA1A 4AKIA 4NAXA 3GHAA 1Y1UA 2MMOA 1HNCA 3D4TA 3KTBA 1PL2A 5LNKe 3QD9A 2A4VA 2WZ9A 4AF2A 1PSQA 4ZILA 1GSFA 1BG5A 1M2AA 3QAGA 1Z6MA 1KTEA 2C0GA 4BL7A 2IIYA 4HI7A 2C0FA 2K6VA 1FW1A 2DIZA 1EOHA 4ZB9A 3C7MA 2F8AA 2VCVA 1N2AA 3UVHA 4GTUA 4A5PA 2DC5A 4H86A 4MJEA 4OFMA 2JZSA 2DJKA 2ALBA 3GMFA 1MDJA 5CNWA 2GSRA 2V6KA 2ON7A 1ST9A 5KOWA 3DKSA 3FYGA 1FHEA 1GNEA 2O7KA 2DMMA 5A34A 4MH3A 2I81A 2YV9A 4KSOA 3GV1A 1M9BA 1VF1A 4N30A 4NV2A 5EPFA 3GFKA 3ZLPA 4USSA 1WRYA 1G7OA 2HRKA 3WT2A 4KCAA 5JWQB 2QA2A 2H66A 3D0ZA 4V2NA 3RDWA 2HSNA 2C3QA 3TRQA 4BPYA 2PBJA 1TOFA 3KEBA 1Z7RA 3LORA 3LQ7A 4K2DA 4EE0A 2IN3A 2BMXA 1BYEA 1PN0A 4E8HA 2M46A 3EU3A 1XIYA 2RUFA 1PN9A 17GSA 4MPFA 3IRAA 3VWUA 2MYGA 4DVCA 1EEMA 1H75A 1IYHA 4PURA 1MEKA 1PX6A 4IW9A 1GNWA 2EFCA 4PX1A 1ABAA 5KN2A 2VD0A 1A0RP 1SYXA 3TOTA 2HNLA 3RAZA 2FWEA 2OE0A 3BOAA 1T00A 1U6TA 4I5QA 5FWGA 1V98A 3IAS2 2A4HA 2DBCA 1F9MA 2YN1A 1WJKA 5J4UA 3ME8A 5ABRA 3GSTA 1M2BA 4MJCA 1HNAA 4J2FA 4XIHA 4K9ZA 5F07A 3HXSA 4MZBA 1GTAA 3UEMA 1DSBA 4F0CA 5ECHB 2VLVA 1K3YA 1YEXA 1TTZA 4I6XA 2I4AA 2KUCA 4IHUA 1TRWA 5CRGA 1NM3A 3Q74A 3CBUA 2AB6A 4QL7A 1TK0B 1GULA 3MIXA 2UV8G 3HVSA 2DIYA 1EEJA 1JZOA 2VCXA 2I3YA 4Z2RA 4BL7B 4ACSA 4GQCA 13GSA 2CAIA 2CZ3A 3C1RA 3MNGA 2CVDA 2ES7A 3KH7A 4FYUA 1JZDA 1BF5A 2H71A 2LJKA 4KDYA 2A2PA 3S9FA 4GSSA 1YF1A 2NVLA 3HZ8A 3IDVA 2LSTA 4MA9A 1KEBA 1TI3A 3MWHA 2AYTA 2C8UA 3VK9A 3FZ4A 1UVZA 4AJ7A 5D73A 3F3RA 1KBNA 1X5EA 4LMWA 4KCEA 2GT6A 4K0GA 4EKZA 3ZFLA 5DCHA 2GZPA 4KUNA 3QFAC 2MBSA 1OKDA 3HVXA 4Q5QA 3IK7A 3MYDA 1GTIA 2HRKB 1K0OA 3Q19A 2FCHA 6GSUA 2F3MA 2PERA 2DKIA 1GSSA 5CREA 2HSNB 4ID0A 2H75A 1WIKA 2LV3A 1TXUA 3PGTA 3F63A 4Z7XA 4TR1A 3TRXA 11GSA 1YF0A 1I5GA 4V2LA 3RHCA 4EC0A 1K0AA 1AW9A 2H30A 2OADA 3EE2A 5J9CA 5ECPB 5AIXA 5DVBA 3HA9A 2C1YA 2H1BA 2FA8A 4GXZA 4TR0A 3VWWA 1YQ1A 5FHIA 1X5DA 4KW6A 3H79A 1TRSA 2XBIA 4L0WA 2FGXA 4MZCA 2TIRA 4MNNA 3CTGA 2AHEA 4POMA 1ML6A 2ZUPA 3CMIA 2LRNA 5D9XA 2DJ1A 2BTOT 3L9VA 4JRRA 4NMUA 3GA4A 4N10A 3GH6A 3G7JA 5AISA 5HFIA 1QMVA 1NHOA 1RW1A 4YQVA 4RQXA 2VLUA 4I97A 3VPTA 1QQ2A 4NHZA 4N11A 5ELGA 3KCMA 4F2IA 1XFLA 1TI1A 2EIRA 2YCDA 2QC7A 2JZTA 3ERFA 3VI7A 4TRXA 4XS6A 1XXUA 2B1LA 4I2TA 5IOXA 1VF3A 5DALA 2H6ZA 2OA7A 3P90A 1DBYA 4O5UA 6GSXA 2LJAA 5E4WA 1JZRA 3R3EA 2B7KA 3HDCA 1QGVA 2NTOA 1JZWA 1THXA 2I9HA 3I9V2 5ECOB 1XWBA 2L4QA 1C72A 4DEJA 3QCPA 1ZCPA 3DVWA 2VCTA 1OC9A 1R5AA 4TW5A 2JU5A 2VM1A 3A2XA 1MDKA 4DSQA 1CQGA 3O76A 3IK9A 3WT1A 4GRFA 4RUVA 4Q5FA 2HSMA 5BRTA 2L4CA 1SENA 3ZIVA 3G7YA 3CTFA 4ECCA 1Z9HA 3D4MA 2FWFA 2EFHA 3GKNA 1K3LA 1EWXA 3NIVA 1SK1A 4G9HA 4XRAA 2N5FA 4BVXA 2DJ0A 1F37A 4FH8A 3M1GA 4BWQA 5AGYA 1ERWA 4EL1A 1XZOA 4F82A 5HFGA 4G0KA 1QFNA 4YAVA 1ZGNA 3R2QA 4IBPA 3EPTA 3ERWA 4BWSA 3ED3A 4NV5A 3GTUB 1G6WA 1VF2A 2P31A 4N0VA 3FR9A 3UARA 6GSYA 4ZB6A 4OFTA 4YKGA 4HU7A 3DXBA 3TCOA 2HXKA 4XTSA 3RPPA 3FMWA 5G5FA 4GSNA 2HLSA 4ZL9A 1K3OA 1JLWA 1OAZA 1PA3A 2YWNA 3TKRA 1A0FA 4ECIA 1S3DA 3F4RA 1F3BA 5DBQA 3G9BA 3L0HA 1URMA 4TR1B 5IMVA 3QAWA 4HU9A 2B6MA 2VUPA 5ENUA 2DLXA 2X4AA 5KN0A 1A23A 3UVTA 1HNBA 1PKZA 4EIPA 5A4VA 7GSSA 5KEJA 3KD0A 3IE3A 3GH9A 22GSA 2HRFA 5G1LA 3VWVA 4KDXA 5KOXA 1GLQA 5CRDA 1RQMA 2JZRA 3GX8A 1A2LA 5F05A 1Y25A 2E0QA 2P0GA 2YV7A 3V1WA 2IMKA 4F03A 5A5KA 1TDIA 2PUKC 1ZOFA 4RI7A 4XS4A 2YJHA 1PQNA 4X1UA 4KNDA 1GUHA 2GLRA 2VO4A 3SWLA 3TGZA 5B8BA 3DYRA 3CSJA 2N5AA 2B5YA 18GSA 2HQTA 2VD1A 5DALB 5DQYA 3IPZA 1LJRA 2MBTA 3U5RE 1TK5B 4EDYA 4MF6A 2FLSA 4ECJA 3EU4A 14GSA 2NPBA 2XHFA 3OR5A 4CDOA 1MD4A 1MD3A 1YVLA 2G2QA 2YJ7A 3GYKA 3F6DA 3IOSA 1K0BA 2H19A 1AXDA 5CAXA 4WBJA 2GS3A 3IR4A 4KGIA 3ZRDA 4BVYB 1FOHA 5KN1A 2CX4A 4I8BA 4XS1A 4ZB8A 3FKFA 1B9YC 2A2SA 4TR4A 2HSMB 1O81A 1SKWB 1B9XC 1ZYQB 1ILOA 5GZZB 4WKWA 2PMTA 5JCWA 5J9BA 4JU5A 1ON4A 4ZBDA 1Z5YE 5ECMB 5IMDA 3A2WA 1AQXA 3TDGA 1AC1A 1JFUA 1SYRA 2L6DA 5A1NA 2H76A 4PUFC 4KX4A 4HUAA 1NHYA 4YAPA 1V40A 2VCWA 2EIQA 1S3AA 3BCIA 2LEGA 3SBCA 2WFCA 1F2EA 4AJ6A 2ZNMA 1DE2A 4TXOA 3IC8A 4AI6A 2O85A 1OKTA 2C0DA 2GQKA 2OBKA 2R0GA 1Z7PA 4IQAA 1B48A 2I1UA 2R0PA 1AUCA 2DSAA 4HS1A 2RUEA 1XWCA 4G0IA 4ZB7A 5CO3A 2C4JA 3GKKA 5IO2A 5D96A 4NXIA 2PN8A 3F4TA 4MP4A 2HI7A 2X99A 2H8LA 3TUEA 2K18A 4QQ7A 2HZEB 5D9VA 1SD9A 4J57E 1JLVA 3APOA 3I69A 2VOCA 1TU8A 3KM6A 1N25A 3IV4A 1U3AA 1PL1A 2NBSA 3LWAA 3GL3A 4HZ4A 5BMUB 3LGCA 4WR4A 5B7CA 2EIOA 1XPVA 4W66A 2WGRA 3KMNA 4OMVA 1GSDA 1J08A 4KH7A 4PGTA 1FB6A 5IPGA 5ECRB 4IP6A 3RHBA 2E2GA 3VLNA 1UN2A 1XWKA 4X0XA 5J5NA 2P5QA 3PINA 1VGLA 3FR6A 1T8EB 3W8SA 2OJLA 9GSSA 4EO3A 16GSA 1WP0A 5A4WA 1XCCA 1U87A 4K0NA 1X5CA 1EV4A 2FWGA 4G2EA 3ZITA 5A4UA 1SVOA 1GP1A 1W4VA 2IMDA 1YEPA 4IJ3A 2M80A 4V1Ag 3J7Yb 4K5SA 1SK2A 4GDFA 1YDKA 3FW2A 2X8HA 5JCUA 3ZFBA 2LTKA 5DJMA 2H73A 4CW9A 4IJIA 4O5QA 1O85A 2V6OA 2VL2A 4QL9A 3C73A 3LYPA 3WD6A 5IO0A 4AKGA 2YOIA 6GSSA 3E3EA 2VLTA 2P5RA 4GLTA 1XWAA 4K7NA 1SK0A 2L57A 5H5QA 3EVIA 3U6VA 1ERTA 5A34B 4IQ1A 2YWOA 2FNOA 3KJYA 3CWGA 1EZKA 3KP8A 3FHKA 3TKSA 2CA8A 2TRXA 5DAKA 2V32A 1ZYPA 4PUAA 1T4ZA 2YZUA 1GRXA 2RM5A 3HJOA 2H0IA 3GKMA 4TVEA 2D2ZA 4WBRD 3D5JA 2B5EA 3UL3A 3US3A 1RK4A 5DDLA 2RLIA 3G7IA 4POLA 1Z3EA 4IP1A 3LXTA 5C00A 3ZVJA 2GSQA 3Q6OA 2VCQA 5H5RA 5J4VA 4ILFA 2F9SA 3DRNA 4D73A 4IGJA 3CYNA 3GX0A 4HJ2A 1OC8A 1YZXA 5HR2A 3VWXA 4TKYA 1SKSB 3APQA 5G30A 3F3QA 3O3TA 4MK3A 1A8YA 1FO5A 4PQIA 2N5BA 2X64A 3EINA 4POKA 5JWRB 1YY7A 4OWYA 5ID2A 4XHMA 4MCUA 2O5VA 4ULXA 2DMLA 5F0GA 3N9JA 2H0GA 5GAPD 3A2VA 3LG6A 1HYUA 5AN1A 3TJJA 1X9SB 1N8JA 4LL4B 1X9WB 5B6NA 3HD5A 3CSHA 3L9SA 2O8VB 3DEXA 2WJUA 2XBQA 1R4WA 4Q5NA 2JACA 2LKUA 4OCFA 1T1VA 3RBTA 5E59A 3TJFA 2ON5A 1A2MA 6GSVA 2XPDA 5COHA 1K0CA 2O87A 2OE3A 2CT6A 1H4OA 3D22A 1YJ6A 12GSA 2H72A 2LUSA 2LQOA 1X0RA 3GURA 1FB0A 2LRTA 2PVQA 4MPGA 4GF0A 3W6GA 3FZAA 1Q98A 4K6XA 5J3RA 3GIXA 3TKQA 2M72A 3P8WA 3HZ4A 2LNTA 2JADA 2WB9A 5D8IA 3TRPA 1TU7A 3M8NA 1EP8A 2C0EA 2HRNA 5GAND 2B3SA 4FYCA 3HJMA 2AJQB 1ZYNA 3I43A 3QDNA 4ZBAA 1AQVA 3GNJA 5HR3A 1GSUA 3KTLA 4GQFA 2GDRA 4MH2A 5JCGA 1EP7A 4PQ1A 3IA1A 5C04A 1USBA 2KHPA 1R7HA 3HHVA 2H1LA 5J47A 1FOVA 4PNFA 2AUVA 4X4JA 3I6AA 1HD2A 2HSYA 2Z9SA 2HE3A 5IMCA 4HEA2 1R5PA 2YP6A 1AAZA 3F0IA 4ISDA 4F0BA 4Q5RA 1BJXA 3VURA 4CHSA 4QMKA 1SJIA 2WDUA 1TP9A 3TU3B 1SU9A 2IJYA 1PMTA 5J41A 5HFKA 4KA0A 5DAKB 2EFDA 4MJBA 1ERUA 1GWCA 1DUGA 1SKRB 4G0LA 5F06A 3VPQA 1BQ7A 2X49A 5IMZA 1PX7A 1YKAA 5D9WA 1QUWA 1B4QA 4AJ8A 4J56E 3FZ9A 1PRXA 2GVPA 3BD2A 3EC3A 4KAEA 3CRUA 1J0FA 3UMAA 1FG4A 4WEYA 1NSWA 2GZZA 3FRCA 1OE7A 4PTSA 1FAAA 4HOJA 4D73B 3BCKA 1SVMA 5D93A 3F8UA 2AAWA 3J7Yk 3IAM2 3DIEA 4HQZA 4ZBBA 1YKCA 4MLYA 2V1MA 4K5RA 5G31A 4FQUA 1ZZYA 3KIJA 5ID2B 1XW5A 4MF7A 3VFIA 3M9JA 2A2RA 2E2MA 2L5OA 2QKEA 3N5OA 3IHGA 1PGTA 2HRAA 5FT3A 2CAQA 1DE1A 3TKPA 4KB3A 1A2JA 3QMXA 3HYPA 4L0UA 1Z6NA 4MDCA 6GSWA 3E9JB 1UC7A 1XVWA 2J23A 3QPMA 4MF5A 5IIZA 6GSTA 1V58A 2JSYA 1SL0B 3F6FA 1G6YA 2CV4A 3NOFA 2UZ8A 2DJ3A 4G19A 1PD21 2FWHA 3VI5A 1OVNA 3LYKA 3W8JA 2VL2C 2VCZA 1E2YA 5ECNB 1UA5A 3UOMA 5J40A 1Q4JA 1LU4A 3TJKA 4XCSA 5HR1A 4WF5A 1OC9B 2YANA 2ZCTA 4YH2A 1GLPA 1F3AA 1U88A 1QK8A 2IFQA 4EIQA 4TR3A 1AIUA 3HVVA 2NDOA 3HKRA 3MDKA 4KSMA 19GSA 4IVFA 2WRTA 2X8GA 5G2ZA 2KLXA 4I2UA 3A5IA 3F4SA 3TKSC 3ZTLA 3FY7A 4ZL8A 2H70A 4BVXB 1EGOA 4DSSA 1O8XA 2VKZG 4PXOA 1GUKA 1R26A 3MSZA 3PPUA 2VM2A 4KDUA 1I9DA 2EFEA 4F9ZA 3A3TA 5B6MA 4EDZA 2TRCP 3GN3A 3GRXA 3CXGA 2CZ2A 1VF4A 4G01A 5ECQB 2EC4A 4ZIJA 2MMZA 3TJBA 2HYXA 4POBA 1WWJA 2JSZA 2IWTA 4JZQA 3DMLA 4X43A 5IMAA 5A5HA 2VIMA 2REMA 1GTUA 2PVOC 5CRHA 2K8VA 5GSTA 3QAVA 2F51A 4BA7A 3KZQA 3DWVA 3ME7A 4EUYA 5ECKB 2OKAA 3EURA 4WETA 4WF4A 1SL2B 4JEDA 2DKHA 1GH2A 1K0DA 2B1KA 5IMFA 3Q18A 4EXJA 3UBLA 2QSIA 3F9UA 3EWLA 1XOBA 4HQSA 3HY2A 3AY8A 4ML6A 1M2DA 5INYA 3TJGA 3C8EA 1GSEA 3IBHA 1GSYA 2V2GA 1T4YA 1WOUA 3LEFA 3H8QA 3KH9A 5IM9A 2JL4A 4YQUA 1BX9A 1V57A 4O32A 1TXXA 2MMAA 4ICYA 4XS4B 1GTBA 2H01A 1G0TA 4V2MA 4WXTA 2OBIA 2IPAA 4TOPA 5DQSA 2LNSA 2GZYA 3FK8A 3K8NA 2R37A 1B4PA 1ERVA 4K7OA 2KP1A 4FO5A 2B5XA 2CX3A 2K9FA 4AGSA 4AKHA 2VL9A 3UJ1A 3L9UA 3WGXA 4RQRA 4Z2UA 2PWJA 4PQHA 4YKFA 5HR0A 4N0ZA 10GSA 3RPNA 2KOKA 2H6XA 3HJPA 4E8EA 4IN0A 3TKSE 3ZYWA 2H0HA 3DGQA 3QR6A 1WPIA 5ECIB 2GQMA 2XPEA 4ZL7A 3H93A 3ERGA 4JBBA 4XRDA 1EV9A 2V41A 2IFQB 4O7HA 1IYIA 3EMXA 5EVOA 3IC4A 3PH9A 3M3MA 1TK8B 2QGVA 5EY6A 4NHWA 2OT3A 2HZFA 2E7PA 4KF9A 4OFNA 5IOWA 2H1AA 3WGEA 1S3CA 5A1NB 1BEDA 2R4VA 1LBKA 2C80A 4DSSB 1SD8A 3EYTA 3ZZXA 2OACA 3HCZA 1TKDB 4O92A 3GTUA 4GSTA 1O6JA 3GUSA 1U3IA 1OC3A 5CRWA 3MAKA 4K7IA 2CVKA 3H4KA 3O6TA 4YQMA 2FD3A 5HQPA 1XW9A 2RM6A 4TXOB 2YPMA 1K0NA 2VAFA 1X9MB 1A24A 5L71A 3LFLA 4ML1A 3ZVJD 3ZL5A 3LW9A 5G1KA 1M9AA 1XWGA 4LMVA 4EF0A 4JE1A 2IMIA 3GKXA 1B8XA 3LSZA 1W89A 1O8WA 3L78A 4LL1B 4NWYA 3WGDA 5A5HB 1O7UA 3CSIA 4G10A 1SVLA 1M7TA 1XBSA 2GGTA 1TRUA 2L59A 2H6YA 3L4NA 1WMJA 4JR6A 3JCML 4HJMA 5B8AA 3BBYA 2F8FA 3QFBC 2GSSA 1GL8A 2R3XA 3TB2A 1OE8A 1G7EA 4RI6A 1EOGA 4MJAA 4TXVA 5LCZA 2H1GA 4L8EA 1A8LA 2LJRA 2XC2A 3GSSA 2YNXA 5GSSA 2GT5A 5D9TA 5G5EA 1QXHA 5IQYA 1WE0A 4OD7A 2FA4A 3HMJG 1MTCA 2R6KA 2YWIA 3M9KA 3APSA 2CVBA 3ZREA 4ECBA 4GCIA 3BJ5A 3KMOA 2L6CA 3A5WA 2C3TA 3DD3A 5F8BA 3DVXA 1CQHA 3ZMKA 2FY6A 3UBKA 1O73A 1KNGA 2VL3A 1ZL9A 4HZ2A 2B7JA 3QOUA 1FVKA 3KXOA 3FR3A 1VRSD 1M99A 1M0UA 1NW2A 3UAPA 4L5LA 4IS0A 1SJ6A 1ZYEA 2YZHA 1TJDA 3P7XA 1TRVA 1K0MA 3KP9A 3WYWA 2WULA 2HSHA 2H74A 1AQWA 2LQQA 4OO4A 2LRCA 3E0UA 2HT9A 2IMFA 1SJZA 2QA1A 4P3YB 1ZMAA 2GQLA 4BVYA 4AKXB 2J9HA 3ZMLA 4TN8A 2PGTA 2L5LA 4FYBA 4IELA 5ECSA 4KE3A 2OE1A 1THOA 2O89A 1JHBA 1E6BA 2KP2A 1TW9A 5ELAA 2GSTA 1GSQA 4IKHA 3IHQA 3H1NA 1V9WA 3C1SA 2FHEA 4CY8A 3GL5A 2MZCA 1FVJA 3IXRA 1Y6EA 5JWOB 4MZWA 3ISOA 3KGKA 2X8CA 2C3NA 4E68A 2DJ2A 2IMEA 3FZ5A 5ECLB 4OO5A 1T7PB 2HFDA 4CY6A 5DCGA 1SL1B 5CP1A 5CYYA 2CQ9A 5LD0A 2YWMA 4K1FA 1J9BA 1XOAA 4EVMA 4LLRA 5DJLA 2R5GA 2RIIA 3FEUA 2IL3A 2H1DA 4ZXGA 4PNGA 3P2AA 3LJRA 1OYJA 3ZIJA 3C71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LS5 A;  2DJJ A;  2PU9 C;  5IPH A;  4GWR A;  4L5O A;  1F6M C;  2WS2 A;  4HDE A;  4MAB A;  5KN3 A;  8GSS A;  20GS A;  1XVQ A;  4V1A p;  2MMN A;  1GUM A;  4FIW A;  4WR5 A;  2AV4 A;  1T3B A;  2FUG 2;  3PR8 A;  3M0F A;  2K8S A;  2GTU A;  1PKW A;  1MDI A;  4MMM A;  5H5S A;  2HZE A;  1HQO A;  3D6I A;  2G0F A;  1V2A A;  3UIW A;  1ACV A;  3EMP A;  3LXZ A;  3TOU A;  4DSR A;  4O5R A;  3CRT A;  5AIV A;  4JR4 A;  5EL8 A;  5BMU A;  3D21 A;  4OCE A;  1EGR A;  2BJX A;  1BAY A;  2WCI A;  2PPT A;  2R2J A;  3NZN A;  4NPB A;  1XW6 A;  4K8M A;  4LA1 A;  4NAX A;  3GHA A;  2MMO A;  1HNC A;  3D4T A;  3KTB A;  1PL2 A;  5LNK e;  3QD9 A;  2A4V A;  2WZ9 A;  4AF2 A;  1PSQ A;  4ZIL A;  1GSF A;  1BG5 A;  1M2A A;  3QAG A;  1Z6M A;  1KTE A;  2C0G A;  4BL7 A;  2IIY A;  4HI7 A;  2C0F A;  2K6V A;  1FW1 A;  2DIZ A;  1EOH A;  4ZB9 A;  3C7M A;  2F8A A;  2VCV A;  1N2A A;  3UVH A;  4GTU A;  2DC5 A;  4H86 A;  4MJE A;  4OFM A;  2JZS A;  2DJK A;  2ALB A;  3GMF A;  1MDJ A;  5CNW A;  2GSR A;  2V6K A;  2ON7 A;  1ST9 A;  3DKS A;  3FYG A;  1FHE A;  1GNE A;  2O7K A;  2DMM A;  4MH3 A;  2I81 A;  2YV9 A;  4KSO A;  3GV1 A;  1M9B A;  1VF1 A;  4N30 A;  4NV2 A;  5EPF A;  3GFK A;  3ZLP A;  4USS A;  1WRY A;  1G7O A;  2HRK A;  3WT2 A;  4KCA A;  5JWQ B;  2H66 A;  3D0Z A;  4V2N A;  3RDW A;  2C3Q A;  3TRQ A;  4BPY A;  2PBJ A;  1TOF A;  3KEB A;  1Z7R A;  3LOR A;  3LQ7 A;  4K2D A;  4EE0 A;  2IN3 A;  2BMX A;  1BYE A;  4E8H A;  2M46 A;  3EU3 A;  1XIY A;  2RUF A;  1PN9 A;  17GS A;  4MPF A;  3IRA A;  3VWU A;  2MYG A;  4DVC A;  1EEM A;  1H75 A;  1IYH A;  4PUR A;  1MEK A;  1PX6 A;  4IW9 A;  1GNW A;  4PX1 A;  1ABA A;  5KN2 A;  2VD0 A;  1A0R P;  1SYX A;  3TOT A;  2HNL A;  3RAZ A;  2FWE A;  2OE0 A;  3BOA A;  1T00 A;  1U6T A;  4I5Q A;  5FWG A;  1V98 A;  3IAS 2;  2DBC A;  1F9M A;  2YN1 A;  1WJK A;  5J4U A;  3ME8 A;  5ABR A;  3GST A;  1M2B A;  4MJC A;  1HNA A;  4J2F A;  4XIH A;  4K9Z A;  5F07 A;  3HXS A;  4MZB A;  1GTA A;  3UEM A;  1DSB A;  4F0C A;  5ECH B;  2VLV A;  1K3Y A;  1YEX A;  1TTZ A;  4I6X A;  2I4A A;  2KUC A;  4IHU A;  1TRW A;  5CRG A;  1NM3 A;  3Q74 A;  3CBU A;  2AB6 A;  4QL7 A;  1TK0 B;  1GUL A;  3HVS A;  2DIY A;  1EEJ A;  1JZO A;  2VCX A;  2I3Y A;  4BL7 B;  4ACS A;  4GQC A;  13GS A;  2CAI A;  2CZ3 A;  3C1R A;  3MNG A;  2CVD A;  2ES7 A;  3KH7 A;  4FYU A;  1JZD A;  2H71 A;  2LJK A;  4KDY A;  3S9F A;  4GSS A;  1YF1 A;  2NVL A;  3HZ8 A;  3IDV A;  2LST A;  4MA9 A;  1KEB A;  1TI3 A;  3MWH A;  2AYT A;  2C8U A;  3VK9 A;  3FZ4 A;  1UVZ A;  4AJ7 A;  5D73 A;  3F3R A;  1KBN A;  1X5E A;  4LMW A;  4KCE A;  2GT6 A;  4K0G A;  4EKZ A;  3ZFL A;  5DCH A;  2GZP A;  4KUN A;  3QFA C;  2MBS A;  1OKD A;  3HVX A;  4Q5Q A;  3IK7 A;  1GTI A;  2HRK B;  1K0O A;  3Q19 A;  2FCH A;  6GSU A;  2F3M A;  2PER A;  1GSS A;  5CRE A;  2HSN B;  4ID0 A;  2H75 A;  1WIK A;  2LV3 A;  3PGT A;  3F63 A;  4Z7X A;  4TR1 A;  3TRX A;  11GS A;  1YF0 A;  1I5G A;  4V2L A;  3RHC A;  4EC0 A;  1K0A A;  1AW9 A;  2H30 A;  2OAD A;  3EE2 A;  5J9C A;  5ECP B;  5AIX A;  5DVB A;  3HA9 A;  2C1Y A;  2H1B A;  2FA8 A;  4GXZ A;  4TR0 A;  3VWW A;  1YQ1 A;  5FHI A;  1X5D A;  4KW6 A;  3H79 A;  1TRS A;  2XBI A;  4L0W A;  2FGX A;  4MZC A;  2TIR A;  3CTG A;  2AHE A;  4POM A;  1ML6 A;  2ZUP A;  3CMI A;  2LRN A;  5D9X A;  2DJ1 A;  2BTO T;  3L9V A;  4JRR A;  4NMU A;  3GA4 A;  4N10 A;  3GH6 A;  3G7J A;  5AIS A;  5HFI A;  1QMV A;  1NHO A;  1RW1 A;  4YQV A;  4RQX A;  2VLU A;  4I97 A;  3VPT A;  1QQ2 A;  4NHZ A;  4N11 A;  5ELG A;  3KCM A;  4F2I A;  1XFL A;  1TI1 A;  2EIR A;  2YCD A;  2QC7 A;  2JZT A;  3ERF A;  3VI7 A;  4TRX A;  4XS6 A;  1XXU A;  2B1L A;  4I2T A;  5IOX A;  1VF3 A;  5DAL A;  2H6Z A;  2OA7 A;  3P90 A;  1DBY A;  6GSX A;  2LJA A;  5E4W A;  1JZR A;  3R3E A;  2B7K A;  3HDC A;  1QGV A;  2NTO A;  1JZW A;  1THX A;  2I9H A;  3I9V 2;  5ECO B;  1XWB A;  2L4Q A;  1C72 A;  4DEJ A;  3QCP A;  1ZCP A;  3DVW A;  2VCT A;  1OC9 A;  1R5A A;  4TW5 A;  2JU5 A;  2VM1 A;  3A2X A;  1MDK A;  4DSQ A;  1CQG A;  3O76 A;  3IK9 A;  3WT1 A;  4GRF A;  4RUV A;  4Q5F A;  2HSM A;  2L4C A;  1SEN A;  3ZIV A;  3G7Y A;  3CTF A;  4ECC A;  1Z9H A;  3D4M A;  2FWF A;  3GKN A;  1K3L A;  1EWX A;  3NIV A;  1SK1 A;  4G9H A;  4XRA A;  2N5F A;  4BVX A;  2DJ0 A;  1F37 A;  4FH8 A;  3M1G A;  4BWQ A;  5AGY A;  1ERW A;  4EL1 A;  1XZO A;  4F82 A;  5HFG A;  4G0K A;  1QFN A;  4YAV A;  1ZGN A;  3R2Q A;  4IBP A;  3ERW A;  4BWS A;  3ED3 A;  4NV5 A;  3GTU B;  1G6W A;  1VF2 A;  2P31 A;  4N0V A;  3FR9 A;  3UAR A;  6GSY A;  4ZB6 A;  4OFT A;  4HU7 A;  3DXB A;  3TCO A;  2HXK A;  4XTS A;  3RPP A;  5G5F A;  4GSN A;  2HLS A;  4ZL9 A;  1K3O A;  1JLW A;  1OAZ A;  1PA3 A;  2YWN A;  3TKR A;  1A0F A;  4ECI A;  1S3D A;  3F4R A;  1F3B A;  5DBQ A;  3G9B A;  3L0H A;  1URM A;  4TR1 B;  5IMV A;  3QAW A;  4HU9 A;  2B6M A;  2VUP A;  5ENU A;  2DLX A;  5KN0 A;  1A23 A;  3UVT A;  1HNB A;  1PKZ A;  5A4V A;  7GSS A;  5KEJ A;  3KD0 A;  3IE3 A;  3GH9 A;  22GS A;  2HRF A;  5G1L A;  3VWV A;  4KDX A;  1GLQ A;  5CRD A;  1RQM A;  2JZR A;  3GX8 A;  1A2L A;  5F05 A;  1Y25 A;  2E0Q A;  2P0G A;  2YV7 A;  3V1W A;  2IMK A;  4F03 A;  5A5K A;  1TDI A;  2PUK C;  1ZOF A;  4RI7 A;  4XS4 A;  2YJH A;  1PQN A;  4X1U A;  4KND A;  1GUH A;  2GLR A;  2VO4 A;  3SWL A;  3TGZ A;  5B8B A;  3DYR A;  3CSJ A;  2N5A A;  2B5Y A;  18GS A;  2HQT A;  2VD1 A;  5DAL B;  5DQY A;  3IPZ A;  1LJR A;  2MBT A;  3U5R E;  1TK5 B;  4EDY A;  4MF6 A;  2FLS A;  4ECJ A;  3EU4 A;  14GS A;  2NPB A;  2XHF A;  3OR5 A;  4CDO A;  1MD4 A;  1MD3 A;  2G2Q A;  2YJ7 A;  3GYK A;  3F6D A;  3IOS A;  1K0B A;  2H19 A;  1AXD A;  5CAX A;  4WBJ A;  2GS3 A;  3IR4 A;  4KGI A;  3ZRD A;  4BVY B;  5KN1 A;  2CX4 A;  4I8B A;  4XS1 A;  4ZB8 A;  3FKF A;  1B9Y C;  2A2S A;  4TR4 A;  2HSM B;  1O81 A;  1SKW B;  1B9X C;  1ZYQ B;  1ILO A;  5GZZ B;  4WKW A;  2PMT A;  5JCW A;  5J9B A;  4JU5 A;  1ON4 A;  4ZBD A;  1Z5Y E;  5ECM B;  5IMD A;  3A2W A;  1AQX A;  3TDG A;  1AC1 A;  1JFU A;  1SYR A;  2L6D A;  2H76 A;  4PUF C;  4KX4 A;  4HUA A;  1NHY A;  4YAP A;  1V40 A;  2VCW A;  2EIQ A;  1S3A A;  3BCI A;  2LEG A;  3SBC A;  2WFC A;  1F2E A;  4AJ6 A;  2ZNM A;  1DE2 A;  4TXO A;  3IC8 A;  2O85 A;  1OKT A;  2C0D A;  2GQK A;  2OBK A;  1Z7P A;  4IQA A;  1B48 A;  2I1U A;  1AUC A;  2DSA A;  4HS1 A;  2RUE A;  1XWC A;  4G0I A;  5CO3 A;  2C4J A;  3GKK A;  5IO2 A;  5D96 A;  4NXI A;  2PN8 A;  3F4T A;  4MP4 A;  2HI7 A;  2X99 A;  2H8L A;  3TUE A;  2K18 A;  4QQ7 A;  2HZE B;  5D9V A;  1SD9 A;  4J57 E;  1JLV A;  3APO A;  3I69 A;  2VOC A;  1TU8 A;  3KM6 A;  3IV4 A;  1U3A A;  1PL1 A;  2NBS A;  3LWA A;  3GL3 A;  4HZ4 A;  3LGC A;  4WR4 A;  5B7C A;  2EIO A;  1XPV A;  2WGR A;  3KMN A;  4OMV A;  1GSD A;  1J08 A;  4KH7 A;  4PGT A;  1FB6 A;  5IPG A;  5ECR B;  4IP6 A;  3RHB A;  2E2G A;  3VLN A;  1UN2 A;  1XWK A;  4X0X A;  5J5N A;  2P5Q A;  3PIN A;  1VGL A;  3FR6 A;  1T8E B;  3W8S A;  2OJL A;  9GSS A;  4EO3 A;  16GS A;  1WP0 A;  5A4W A;  1XCC A;  1U87 A;  4K0N A;  1X5C A;  1EV4 A;  2FWG A;  4G2E A;  3ZIT A;  5A4U A;  1GP1 A;  1W4V A;  2IMD A;  1YEP A;  4IJ3 A;  2M80 A;  4V1A g;  3J7Y b;  1SK2 A;  1YDK A;  3FW2 A;  2X8H A;  5JCU A;  3ZFB A;  2LTK A;  5DJM A;  2H73 A;  4CW9 A;  4IJI A;  1O85 A;  2V6O A;  2VL2 A;  4QL9 A;  3C73 A;  3LYP A;  3WD6 A;  5IO0 A;  2YOI A;  6GSS A;  3E3E A;  2VLT A;  2P5R A;  4GLT A;  1XWA A;  4K7N A;  1SK0 A;  2L57 A;  5H5Q A;  3EVI A;  3U6V A;  1ERT A;  4IQ1 A;  2YWO A;  2FNO A;  3KJY A;  1EZK A;  3KP8 A;  3FHK A;  3TKS A;  2CA8 A;  2TRX A;  5DAK A;  2V32 A;  4PUA A;  1T4Z A;  2YZU A;  1GRX A;  2RM5 A;  3HJO A;  2H0I A;  3GKM A;  4TVE A;  2D2Z A;  4WBR D;  3D5J A;  2B5E A;  3UL3 A;  3US3 A;  1RK4 A;  5DDL A;  2RLI A;  3G7I A;  4POL A;  1Z3E A;  4IP1 A;  3LXT A;  5C00 A;  3ZVJ A;  2GSQ A;  3Q6O A;  2VCQ A;  5H5R A;  4ILF A;  2F9S A;  3DRN A;  4D73 A;  4IGJ A;  3CYN A;  3GX0 A;  4HJ2 A;  1OC8 A;  1YZX A;  5HR2 A;  3VWX A;  4TKY A;  1SKS B;  3APQ A;  5G30 A;  3F3Q A;  3O3T A;  4MK3 A;  1A8Y A;  1FO5 A;  4PQI A;  2N5B A;  2X64 A;  3EIN A;  4POK A;  5JWR B;  1YY7 A;  4OWY A;  5ID2 A;  4XHM A;  4MCU A;  4ULX A;  2DML A;  5F0G A;  3N9J A;  2H0G A;  5GAP D;  3A2V A;  3LG6 A;  1HYU A;  5AN1 A;  3TJJ A;  1X9S B;  1N8J A;  4LL4 B;  1X9W B;  5B6N A;  3HD5 A;  3CSH A;  3L9S A;  2O8V B;  3DEX A;  2WJU A;  2XBQ A;  1R4W A;  4Q5N A;  2JAC A;  2LKU A;  4OCF A;  1T1V A;  3RBT A;  5E59 A;  3TJF A;  2ON5 A;  1A2M A;  6GSV A;  2XPD A;  5COH A;  1K0C A;  2O87 A;  2OE3 A;  2CT6 A;  1H4O A;  3D22 A;  1YJ6 A;  12GS A;  2H72 A;  2LUS A;  2LQO A;  1X0R A;  3GUR A;  1FB0 A;  2LRT A;  2PVQ A;  4MPG A;  4GF0 A;  3W6G A;  3FZA A;  1Q98 A;  4K6X A;  5J3R A;  3GIX A;  3TKQ A;  2M72 A;  3P8W A;  3HZ4 A;  2LNT A;  2JAD A;  2WB9 A;  5D8I A;  3TRP A;  1TU7 A;  3M8N A;  1EP8 A;  2C0E A;  2HRN A;  5GAN D;  2B3S A;  4FYC A;  3HJM A;  2AJQ B;  3I43 A;  3QDN A;  4ZBA A;  1AQV A;  3GNJ A;  5HR3 A;  1GSU A;  3KTL A;  4GQF A;  2GDR A;  4MH2 A;  5JCG A;  1EP7 A;  4PQ1 A;  3IA1 A;  5C04 A;  1USB A;  2KHP A;  1R7H A;  3HHV A;  1FOV A;  4PNF A;  2AUV A;  3I6A A;  1HD2 A;  2HSY A;  2Z9S A;  2HE3 A;  5IMC A;  4HEA 2;  1R5P A;  2YP6 A;  1AAZ A;  3F0I A;  4ISD A;  4F0B A;  4Q5R A;  1BJX A;  3VUR A;  4CHS A;  1SJI A;  2WDU A;  1TP9 A;  1SU9 A;  2IJY A;  1PMT A;  5J41 A;  5HFK A;  4KA0 A;  5DAK B;  4MJB A;  1ERU A;  1GWC A;  1DUG A;  1SKR B;  4G0L A;  5F06 A;  3VPQ A;  1BQ7 A;  5IMZ A;  1PX7 A;  1YKA A;  5D9W A;  1QUW A;  1B4Q A;  4AJ8 A;  4J56 E;  3FZ9 A;  1PRX A;  2GVP A;  3BD2 A;  3EC3 A;  4KAE A;  3CRU A;  1J0F A;  3UMA A;  1FG4 A;  4WEY A;  1NSW A;  2GZZ A;  3FRC A;  1OE7 A;  4PTS A;  1FAA A;  4HOJ A;  4D73 B;  3BCK A;  5D93 A;  3F8U A;  2AAW A;  3J7Y k;  3IAM 2;  3DIE A;  4HQZ A;  4ZBB A;  1YKC A;  4MLY A;  2V1M A;  5G31 A;  4FQU A;  1ZZY A;  3KIJ A;  5ID2 B;  1XW5 A;  4MF7 A;  3VFI A;  3M9J A;  2A2R A;  2E2M A;  2L5O A;  2QKE A;  3N5O A;  1PGT A;  2HRA A;  5FT3 A;  2CAQ A;  1DE1 A;  3TKP A;  4KB3 A;  1A2J A;  3QMX A;  3HYP A;  4L0U A;  1Z6N A;  4MDC A;  6GSW A;  3E9J B;  1UC7 A;  1XVW A;  2J23 A;  3QPM A;  4MF5 A;  5IIZ A;  6GST A;  1V58 A;  2JSY A;  1SL0 B;  3F6F A;  1G6Y A;  2CV4 A;  3NOF A;  2UZ8 A;  2DJ3 A;  4G19 A;  1PD2 1;  2FWH A;  3VI5 A;  1OVN A;  3LYK A;  3W8J A;  2VL2 C;  2VCZ A;  1E2Y A;  5ECN B;  1UA5 A;  3UOM A;  1Q4J A;  1LU4 A;  3TJK A;  4XCS A;  5HR1 A;  4WF5 A;  1OC9 B;  2YAN A;  2ZCT A;  4YH2 A;  1GLP A;  1F3A A;  1U88 A;  1QK8 A;  2IFQ A;  4TR3 A;  1AIU A;  3HVV A;  2NDO A;  3HKR A;  3MDK A;  4KSM A;  19GS A;  4IVF A;  2WRT A;  2X8G A;  5G2Z A;  2KLX A;  4I2U A;  3F4S A;  3TKS C;  3ZTL A;  3FY7 A;  4ZL8 A;  2H70 A;  4BVX B;  1EGO A;  4DSS A;  1O8X A;  4PXO A;  1GUK A;  1R26 A;  3MSZ A;  3PPU A;  2VM2 A;  4KDU A;  1I9D A;  4F9Z A;  3A3T A;  5B6M A;  4EDZ A;  2TRC P;  3GN3 A;  3GRX A;  3CXG A;  2CZ2 A;  1VF4 A;  5ECQ B;  2EC4 A;  4ZIJ A;  2MMZ A;  3TJB A;  2HYX A;  4POB A;  1WWJ A;  2JSZ A;  2IWT A;  4JZQ A;  3DML A;  4X43 A;  5IMA A;  2VIM A;  2REM A;  1GTU A;  2PVO C;  5CRH A;  2K8V A;  5GST A;  3QAV A;  2F51 A;  4BA7 A;  3KZQ A;  3DWV A;  3ME7 A;  4EUY A;  5ECK B;  2OKA A;  3EUR A;  4WET A;  4WF4 A;  1SL2 B;  4JED A;  1GH2 A;  1K0D A;  2B1K A;  5IMF A;  3Q18 A;  4EXJ A;  3UBL A;  2QSI A;  3F9U A;  3EWL A;  1XOB A;  4HQS A;  3HY2 A;  3AY8 A;  4ML6 A;  1M2D A;  5INY A;  3TJG A;  3C8E A;  1GSE A;  3IBH A;  1GSY A;  2V2G A;  1T4Y A;  1WOU A;  3LEF A;  3H8Q A;  3KH9 A;  5IM9 A;  2JL4 A;  4YQU A;  1BX9 A;  1V57 A;  4O32 A;  1TXX A;  2MMA A;  4XS4 B;  1GTB A;  2H01 A;  1G0T A;  4V2M A;  4WXT A;  2OBI A;  2IPA A;  4TOP A;  5DQS A;  2LNS A;  2GZY A;  3FK8 A;  3K8N A;  2R37 A;  1B4P A;  1ERV A;  4K7O A;  2KP1 A;  4FO5 A;  2B5X A;  2CX3 A;  2K9F A;  4AGS A;  2VL9 A;  3UJ1 A;  3L9U A;  3WGX A;  4RQR A;  2PWJ A;  4PQH A;  5HR0 A;  4N0Z A;  10GS A;  3RPN A;  2KOK A;  2H6X A;  3HJP A;  4E8E A;  4IN0 A;  3TKS E;  3ZYW A;  2H0H A;  3DGQ A;  3QR6 A;  1WPI A;  5ECI B;  2GQM A;  2XPE A;  4ZL7 A;  3H93 A;  3ERG A;  4JBB A;  4XRD A;  1EV9 A;  2V41 A;  2IFQ B;  4O7H A;  1IYI A;  3EMX A;  5EVO A;  3IC4 A;  3PH9 A;  3M3M A;  1TK8 B;  2QGV A;  5EY6 A;  4NHW A;  2HZF A;  2E7P A;  4KF9 A;  4OFN A;  5IOW A;  2H1A A;  3WGE A;  1S3C A;  1BED A;  2R4V A;  1LBK A;  2C80 A;  4DSS B;  1SD8 A;  3EYT A;  3ZZX A;  2OAC A;  3HCZ A;  1TKD B;  4O92 A;  3GTU A;  4GST A;  1O6J A;  3GUS A;  1U3I A;  1OC3 A;  5CRW A;  3MAK A;  4K7I A;  2CVK A;  3H4K A;  3O6T A;  4YQM A;  2FD3 A;  5HQP A;  1XW9 A;  2RM6 A;  4TXO B;  2YPM A;  1K0N A;  2VAF A;  1X9M B;  1A24 A;  5L71 A;  3LFL A;  4ML1 A;  3ZVJ D;  3ZL5 A;  5G1K A;  1M9A A;  1XWG A;  4LMV A;  4EF0 A;  4JE1 A;  2IMI A;  3GKX A;  1B8X A;  3LSZ A;  1W89 A;  1O8W A;  3L78 A;  4LL1 B;  4NWY A;  3WGD A;  1O7U A;  3CSI A;  4G10 A;  1M7T A;  1XBS A;  2GGT A;  1TRU A;  2L59 A;  2H6Y A;  3L4N A;  1WMJ A;  4JR6 A;  3JCM L;  4HJM A;  5B8A A;  3BBY A;  2F8F A;  3QFB C;  2GSS A;  1GL8 A;  2R3X A;  3TB2 A;  1OE8 A;  1G7E A;  4RI6 A;  1EOG A;  4MJA A;  4TXV A;  5LCZ A;  2H1G A;  4L8E A;  1A8L A;  2LJR A;  2XC2 A;  3GSS A;  2YNX A;  5GSS A;  2GT5 A;  5D9T A;  5G5E A;  1QXH A;  5IQY A;  1WE0 A;  4OD7 A;  2FA4 A;  1MTC A;  2R6K A;  2YWI A;  3M9K A;  3APS A;  2CVB A;  3ZRE A;  4ECB A;  4GCI A;  3BJ5 A;  3KMO A;  2L6C A;  3A5W A;  2C3T A;  3DD3 A;  5F8B A;  3DVX A;  1CQH A;  3ZMK A;  2FY6 A;  3UBK A;  1O73 A;  1KNG A;  2VL3 A;  1ZL9 A;  4HZ2 A;  2B7J A;  3QOU A;  1FVK A;  3KXO A;  3FR3 A;  1VRS D;  1M99 A;  1M0U A;  1NW2 A;  3UAP A;  4L5L A;  4IS0 A;  1SJ6 A;  1ZYE A;  2YZH A;  1TJD A;  3P7X A;  1TRV A;  1K0M A;  3KP9 A;  3WYW A;  2WUL A;  2HSH A;  2H74 A;  1AQW A;  2LQQ A;  4OO4 A;  2LRC A;  3E0U A;  2HT9 A;  2IMF A;  1SJZ A;  4P3Y B;  1ZMA A;  2GQL A;  4BVY A;  2J9H A;  3ZML A;  4TN8 A;  2PGT A;  2L5L A;  4FYB A;  4IEL A;  5ECS A;  4KE3 A;  2OE1 A;  1THO A;  2O89 A;  1JHB A;  1E6B A;  2KP2 A;  1TW9 A;  5ELA A;  2GST A;  1GSQ A;  4IKH A;  3IHQ A;  3H1N A;  1V9W A;  3C1S A;  2FHE A;  3GL5 A;  2MZC A;  1FVJ A;  3IXR A;  1Y6E A;  5JWO B;  4MZW A;  3ISO A;  3KGK A;  2X8C A;  2C3N A;  2DJ2 A;  2IME A;  3FZ5 A;  5ECL B;  4OO5 A;  1T7P B;  2HFD A;  5DCG A;  1SL1 B;  5CP1 A;  5CYY A;  2CQ9 A;  5LD0 A;  2YWM A;  4K1F A;  1J9B A;  1XOA A;  4EVM A;  4LLR A;  5DJL A;  2R5G A;  2RII A;  3FEU A;  2IL3 A;  2H1D A;  4ZXG A;  4PNG A;  3P2A A;  3LJR A;  1OYJ A;  3ZIJ A;  3C71 A; 
#chains in the Genus database with same CATH topology
 2LS5 A;  2DJJ A;  2PU9 C;  4K2X A;  5IPH A;  4GWR A;  4L5O A;  1F6M C;  2WS2 A;  4HDE A;  4MAB A;  5KN3 A;  8GSS A;  20GS A;  1XVQ A;  4V1A p;  2MMN A;  1GUM A;  4FIW A;  4WR5 A;  2AV4 A;  1T3B A;  2FUG 2;  3PR8 A;  3M0F A;  2K8S A;  2GTU A;  1PKW A;  1MDI A;  4MMM A;  5H5S A;  2HZE A;  1HQO A;  3D6I A;  2G0F A;  1V2A A;  3UIW A;  1ACV A;  2R0C A;  3EMP A;  1BG1 A;  3LXZ A;  3TOU A;  4DSR A;  4O5R A;  3CRT A;  4Z2T A;  5AIV A;  4JR4 A;  5EL8 A;  5BMU A;  3D21 A;  4OCE A;  1EGR A;  2BJX A;  1BAY A;  2WCI A;  2PPT A;  2R2J A;  3NZN A;  4NPB A;  4N3Z A;  1XW6 A;  4K8M A;  5J4Y A;  4LA1 A;  4AKI A;  4NAX A;  3GHA A;  1Y1U A;  2MMO A;  1HNC A;  3D4T A;  3KTB A;  1PL2 A;  5LNK e;  3QD9 A;  2A4V A;  2WZ9 A;  4AF2 A;  1PSQ A;  4ZIL A;  1GSF A;  1BG5 A;  1M2A A;  3QAG A;  1Z6M A;  1KTE A;  2C0G A;  4BL7 A;  2IIY A;  4HI7 A;  2C0F A;  2K6V A;  1FW1 A;  2DIZ A;  1EOH A;  4ZB9 A;  3C7M A;  2F8A A;  2VCV A;  1N2A A;  3UVH A;  4GTU A;  4A5P A;  2DC5 A;  4H86 A;  4MJE A;  4OFM A;  2JZS A;  2DJK A;  2ALB A;  3GMF A;  1MDJ A;  5CNW A;  2GSR A;  2V6K A;  2ON7 A;  1ST9 A;  5KOW A;  3DKS A;  3FYG A;  1FHE A;  1GNE A;  2O7K A;  2DMM A;  5A34 A;  4MH3 A;  2I81 A;  2YV9 A;  4KSO A;  3GV1 A;  1M9B A;  1VF1 A;  4N30 A;  4NV2 A;  5EPF A;  3GFK A;  3ZLP A;  4USS A;  1WRY A;  1G7O A;  2HRK A;  3WT2 A;  4KCA A;  5JWQ B;  2QA2 A;  2H66 A;  3D0Z A;  4V2N A;  3RDW A;  2HSN A;  2C3Q A;  3TRQ A;  4BPY A;  2PBJ A;  1TOF A;  3KEB A;  1Z7R A;  3LOR A;  3LQ7 A;  4K2D A;  4EE0 A;  2IN3 A;  2BMX A;  1BYE A;  1PN0 A;  4E8H A;  2M46 A;  3EU3 A;  1XIY A;  2RUF A;  1PN9 A;  17GS A;  4MPF A;  3IRA A;  3VWU A;  2MYG A;  4DVC A;  1EEM A;  1H75 A;  1IYH A;  4PUR A;  1MEK A;  1PX6 A;  4IW9 A;  4PHZ C;  1GNW A;  2EFC A;  4PX1 A;  1ABA A;  5KN2 A;  2VD0 A;  1A0R P;  1SYX A;  3TOT A;  2HNL A;  3RAZ A;  2FWE A;  2OE0 A;  3BOA A;  1T00 A;  1U6T A;  4I5Q A;  5FWG A;  1V98 A;  3IAS 2;  2A4H A;  2DBC A;  1F9M A;  2YN1 A;  1WJK A;  5J4U A;  3ME8 A;  5ABR A;  3GST A;  1M2B A;  4MJC A;  1HNA A;  4J2F A;  4XIH A;  4K9Z A;  5F07 A;  3HXS A;  4MZB A;  1GTA A;  3UEM A;  1DSB A;  4F0C A;  5ECH B;  2VLV A;  1K3Y A;  1YEX A;  1TTZ A;  4I6X A;  2I4A A;  2KUC A;  4IHU A;  1TRW A;  5CRG A;  1NM3 A;  3Q74 A;  3CBU A;  2AB6 A;  4QL7 A;  1TK0 B;  1GUL A;  4PI2 C;  3MIX A;  2UV8 G;  3HVS A;  2DIY A;  1EEJ A;  1JZO A;  2VCX A;  2I3Y A;  4Z2R A;  4BL7 B;  4ACS A;  4GQC A;  13GS A;  2CAI A;  2CZ3 A;  3C1R A;  3MNG A;  2CVD A;  2ES7 A;  3KH7 A;  4FYU A;  1JZD A;  1BF5 A;  2H71 A;  2LJK A;  4KDY A;  2A2P A;  3S9F A;  4GSS A;  1YF1 A;  2NVL A;  3HZ8 A;  3IDV A;  2LST A;  4MA9 A;  1KEB A;  1TI3 A;  3MWH A;  2AYT A;  2C8U A;  3VK9 A;  3FZ4 A;  1UVZ A;  4AJ7 A;  5D73 A;  3F3R A;  1KBN A;  1X5E A;  4LMW A;  4KCE A;  2GT6 A;  4K0G A;  4EKZ A;  3ZFL A;  5DCH A;  2GZP A;  4KUN A;  3QFA C;  2MBS A;  1OKD A;  3HVX A;  4Q5Q A;  3IK7 A;  3MYD A;  1GTI A;  2HRK B;  1K0O A;  3Q19 A;  2FCH A;  6GSU A;  2F3M A;  2PER A;  2DKI A;  1GSS A;  5CRE A;  2HSN B;  4ID0 A;  2H75 A;  1WIK A;  2LV3 A;  1TXU A;  3PGT A;  3F63 A;  4Z7X A;  4TR1 A;  3TRX A;  11GS A;  1YF0 A;  1I5G A;  4V2L A;  3RHC A;  4EC0 A;  1K0A A;  1AW9 A;  2H30 A;  2OAD A;  3EE2 A;  5J9C A;  5ECP B;  5AIX A;  5DVB A;  3HA9 A;  2C1Y A;  2H1B A;  2FA8 A;  4GXZ A;  4TR0 A;  3VWW A;  1YQ1 A;  5FHI A;  1X5D A;  4KW6 A;  3H79 A;  1TRS A;  2XBI A;  4L0W A;  2FGX A;  4MZC A;  2TIR A;  4MNN A;  3CTG A;  2AHE A;  4POM A;  1ML6 A;  2ZUP A;  3CMI A;  2LRN A;  5D9X A;  2DJ1 A;  2BTO T;  3L9V A;  4JRR A;  4NMU A;  3GA4 A;  4N10 A;  3GH6 A;  3G7J A;  5AIS A;  5HFI A;  1QMV A;  1NHO A;  1RW1 A;  4YQV A;  4RQX A;  2VLU A;  4I97 A;  3VPT A;  1QQ2 A;  4NHZ A;  4N11 A;  5ELG A;  3HVN A;  3KCM A;  4F2I A;  1XFL A;  1TI1 A;  2EIR A;  2YCD A;  2QC7 A;  2JZT A;  3ERF A;  3VI7 A;  4TRX A;  4XS6 A;  1XXU A;  2B1L A;  4I2T A;  5IOX A;  1VF3 A;  5DAL A;  2H6Z A;  2OA7 A;  3P90 A;  1DBY A;  4O5U A;  6GSX A;  2LJA A;  5E4W A;  1JZR A;  3R3E A;  2B7K A;  3HDC A;  1QGV A;  2NTO A;  1JZW A;  1THX A;  2I9H A;  3I9V 2;  5ECO B;  1XWB A;  2L4Q A;  1C72 A;  4DEJ A;  3QCP A;  1ZCP A;  3DVW A;  2VCT A;  1OC9 A;  1R5A A;  4TW5 A;  2JU5 A;  2VM1 A;  3A2X A;  1MDK A;  4DSQ A;  1CQG A;  3O76 A;  3IK9 A;  3WT1 A;  4GRF A;  4RUV A;  4Q5F A;  2HSM A;  2WZS A;  5BRT A;  2L4C A;  1SEN A;  3ZIV A;  3G7Y A;  4FXY P;  3CTF A;  4ECC A;  1Z9H A;  3D4M A;  2FWF A;  2EFH A;  3GKN A;  1K3L A;  1EWX A;  3NIV A;  1SK1 A;  4G9H A;  4XRA A;  2N5F A;  4BVX A;  2DJ0 A;  1F37 A;  4FH8 A;  3M1G A;  4BWQ A;  5AGY A;  1ERW A;  4EL1 A;  1XZO A;  4F82 A;  5HFG A;  4G0K A;  1QFN A;  4YAV A;  1ZGN A;  3R2Q A;  4IBP A;  3EPT A;  3ERW A;  4BWS A;  3ED3 A;  4NV5 A;  3GTU B;  1G6W A;  2WVX A;  1VF2 A;  2P31 A;  4N0V A;  3FR9 A;  3UAR A;  6GSY A;  4ZB6 A;  4OFT A;  4YKG A;  4HU7 A;  3DXB A;  3TCO A;  2HXK A;  4XTS A;  3RPP A;  3FMW A;  5G5F A;  4GSN A;  2HLS A;  4ZL9 A;  1K3O A;  1JLW A;  1OAZ A;  1PA3 A;  2YWN A;  3TKR A;  1A0F A;  4ECI A;  1S3D A;  3F4R A;  1F3B A;  5DBQ A;  3G9B A;  3L0H A;  1URM A;  4TR1 B;  5IMV A;  3QAW A;  4HU9 A;  2B6M A;  1XG8 A;  2VUP A;  5ENU A;  2DLX A;  2X4A A;  5KN0 A;  1A23 A;  3UVT A;  1HNB A;  1PKZ A;  4EIP A;  5A4V A;  7GSS A;  5KEJ A;  3KD0 A;  3IE3 A;  3GH9 A;  22GS A;  2HRF A;  5G1L A;  3VWV A;  4KDX A;  1S4B P;  5KOX A;  1GLQ A;  5CRD A;  1RQM A;  2JZR A;  3GX8 A;  1A2L A;  5F05 A;  1Y25 A;  2E0Q A;  2P0G A;  2YV7 A;  3V1W A;  2IMK A;  4F03 A;  5A5K A;  1TDI A;  2PUK C;  1ZOF A;  4RI7 A;  4XS4 A;  2YJH A;  1PQN A;  4X1U A;  4KND A;  1GUH A;  2GLR A;  2VO4 A;  3SWL A;  3TGZ A;  5B8B A;  3DYR A;  3CSJ A;  2N5A A;  2B5Y A;  18GS A;  2HQT A;  2VD1 A;  5DAL B;  5DQY A;  3IPZ A;  1LJR A;  2MBT A;  3U5R E;  1TK5 B;  4EDY A;  4MF6 A;  2FLS A;  4ECJ A;  3EU4 A;  14GS A;  2NPB A;  2XHF A;  3OR5 A;  4CDO A;  1MD4 A;  1MD3 A;  1YVL A;  2G2Q A;  2YJ7 A;  3GYK A;  3F6D A;  3IOS A;  1K0B A;  2H19 A;  1AXD A;  5CAX A;  4WBJ A;  2GS3 A;  3IR4 A;  4KGI A;  3ZRD A;  4BVY B;  1FOH A;  5KN1 A;  2CX4 A;  4I8B A;  4XS1 A;  4ZB8 A;  3FKF A;  1B9Y C;  2A2S A;  4TR4 A;  2HSM B;  1O81 A;  1SKW B;  1B9X C;  1ZYQ B;  1ILO A;  5GZZ B;  4WKW A;  2PMT A;  5JCW A;  5J9B A;  4JU5 A;  1ON4 A;  4ZBD A;  1Z5Y E;  5ECM B;  5IMD A;  3A2W A;  1AQX A;  3TDG A;  1AC1 A;  1JFU A;  1SYR A;  2L6D A;  5A1N A;  2H76 A;  4PUF C;  4KX4 A;  4HUA A;  1NHY A;  4YAP A;  1V40 A;  2VCW A;  2EIQ A;  1S3A A;  3BCI A;  2LEG A;  3SBC A;  2WFC A;  1F2E A;  4AJ6 A;  2ZNM A;  1DE2 A;  4TXO A;  3IC8 A;  4AI6 A;  2O85 A;  1OKT A;  2C0D A;  2GQK A;  2OBK A;  1S3R A;  2R0G A;  2WW2 A;  1Z7P A;  4IQA A;  1B48 A;  2I1U A;  2R0P A;  1AUC A;  2DSA A;  4HS1 A;  2RUE A;  1XWC A;  4G0I A;  4ZB7 A;  5CO3 A;  2C4J A;  3GKK A;  5IO2 A;  5D96 A;  4NXI A;  2PN8 A;  3F4T A;  4MP4 A;  2HI7 A;  2X99 A;  2H8L A;  3TUE A;  2K18 A;  4QQ7 A;  2HZE B;  5D9V A;  1SD9 A;  4J57 E;  1JLV A;  3APO A;  3I69 A;  2VOC A;  1TU8 A;  1M3J A;  3KM6 A;  1N25 A;  3IV4 A;  1U3A A;  1PL1 A;  2NBS A;  3LWA A;  3GL3 A;  4HZ4 A;  5BMU B;  3LGC A;  4WR4 A;  5B7C A;  2EIO A;  1XPV A;  4W66 A;  2WGR A;  3KMN A;  4OMV A;  1GSD A;  1J08 A;  4KH7 A;  4PGT A;  1FB6 A;  5IPG A;  5ECR B;  4IP6 A;  3RHB A;  2E2G A;  3VLN A;  1UN2 A;  1XWK A;  4X0X A;  5J5N A;  2P5Q A;  3PIN A;  1VGL A;  3FR6 A;  1T8E B;  3W8S A;  2OJL A;  9GSS A;  4EO3 A;  16GS A;  1WP0 A;  5A4W A;  1XCC A;  1U87 A;  4K0N A;  1X5C A;  1EV4 A;  2FWG A;  4G2E A;  3ZIT A;  5A4U A;  1SVO A;  1GP1 A;  1W4V A;  2IMD A;  1YEP A;  4IJ3 A;  2M80 A;  4V1A g;  3J7Y b;  4K5S A;  1SK2 A;  4GDF A;  1YDK A;  3FW2 A;  2X8H A;  5JCU A;  3ZFB A;  2LTK A;  5DJM A;  2H73 A;  4CW9 A;  4IJI A;  4O5Q A;  1O85 A;  2V6O A;  2VL2 A;  4QL9 A;  3C73 A;  3LYP A;  3WD6 A;  5IO0 A;  4AKG A;  2YOI A;  6GSS A;  3E3E A;  2VLT A;  2P5R A;  4GLT A;  1XWA A;  4K7N A;  1SK0 A;  2L57 A;  5H5Q A;  3EVI A;  3U6V A;  1ERT A;  5A34 B;  4IQ1 A;  2YWO A;  2FNO A;  3KJY A;  3CWG A;  1EZK A;  3KP8 A;  3FHK A;  3TKS A;  2CA8 A;  2TRX A;  5DAK A;  2V32 A;  1ZYP A;  4PUA A;  1T4Z A;  2YZU A;  1GRX A;  2RM5 A;  3HJO A;  2O3E A;  2H0I A;  3GKM A;  4TVE A;  2D2Z A;  4WBR D;  3D5J A;  2B5E A;  3UL3 A;  3US3 A;  1RK4 A;  5DDL A;  2RLI A;  3G7I A;  4POL A;  1Z3E A;  4IP1 A;  3LXT A;  5C00 A;  3ZVJ A;  2GSQ A;  3Q6O A;  2VCQ A;  5H5R A;  5J4V A;  4ILF A;  2F9S A;  3DRN A;  4D73 A;  4IGJ A;  3CYN A;  3GX0 A;  4HJ2 A;  1OC8 A;  1YZX A;  5HR2 A;  3VWX A;  4TKY A;  1SKS B;  3APQ A;  5G30 A;  3F3Q A;  3O3T A;  4MK3 A;  1A8Y A;  1FO5 A;  4PQI A;  2N5B A;  2X64 A;  3EIN A;  4POK A;  5JWR B;  1YY7 A;  4OWY A;  5ID2 A;  4XHM A;  4MCU A;  2O5V A;  4ULX A;  2DML A;  5F0G A;  3N9J A;  2H0G A;  5GAP D;  3A2V A;  3LG6 A;  1HYU A;  5AN1 A;  3TJJ A;  1X9S B;  1N8J A;  4LL4 B;  1X9W B;  5B6N A;  3HD5 A;  3CSH A;  3L9S A;  2O8V B;  1YEW C;  2WVZ A;  3DEX A;  2WJU A;  2XBQ A;  1R4W A;  4Q5N A;  2JAC A;  2LKU A;  4OCF A;  1T1V A;  3RBT A;  5E59 A;  3TJF A;  2ON5 A;  1A2M A;  6GSV A;  2XPD A;  5COH A;  1K0C A;  2O87 A;  2OE3 A;  1PFO A;  2CT6 A;  1H4O A;  3D22 A;  1YJ6 A;  12GS A;  2H72 A;  2LUS A;  2LQO A;  1X0R A;  3GUR A;  1FB0 A;  2LRT A;  2PVQ A;  3RGB C;  4MPG A;  4GF0 A;  3W6G A;  3FZA A;  1Q98 A;  4K6X A;  5J3R A;  3GIX A;  3TKQ A;  2M72 A;  3P8W A;  3HZ4 A;  2LNT A;  2JAD A;  2WB9 A;  5D8I A;  3TRP A;  1TU7 A;  3M8N A;  1EP8 A;  2C0E A;  2HRN A;  5GAN D;  2B3S A;  4FYC A;  3HJM A;  2AJQ B;  1ZYN A;  3I43 A;  3QDN A;  4ZBA A;  1AQV A;  3GNJ A;  4BIK A;  5HR3 A;  1GSU A;  3KTL A;  4GQF A;  2GDR A;  4MH2 A;  5JCG A;  1EP7 A;  4PQ1 A;  3IA1 A;  5C04 A;  1USB A;  2KHP A;  1R7H A;  3HHV A;  2H1L A;  5J47 A;  1FOV A;  4PNF A;  2AUV A;  4X4J A;  3I6A A;  1HD2 A;  2HSY A;  2Z9S A;  2HE3 A;  5IMC A;  4HEA 2;  1R5P A;  2YP6 A;  1AAZ A;  1M3I A;  3F0I A;  4ISD A;  4F0B A;  4Q5R A;  1BJX A;  3VUR A;  4CHS A;  4QMK A;  1SJI A;  2WDU A;  1TP9 A;  3TU3 B;  1SU9 A;  2IJY A;  1PMT A;  5J41 A;  5HFK A;  4KA0 A;  5DAK B;  2EFD A;  4MJB A;  1ERU A;  1GWC A;  1DUG A;  1SKR B;  4G0L A;  5F06 A;  3VPQ A;  1BQ7 A;  2X49 A;  5IMZ A;  1PX7 A;  1YKA A;  5D9W A;  1QUW A;  1B4Q A;  4AJ8 A;  4J56 E;  3FZ9 A;  1PRX A;  2GVP A;  3BD2 A;  3EC3 A;  4KAE A;  3CRU A;  1J0F A;  3UMA A;  1FG4 A;  4WEY A;  1NSW A;  2GZZ A;  3FRC A;  1OE7 A;  4PTS A;  1FAA A;  4HOJ A;  4D73 B;  3BCK A;  1SVM A;  5D93 A;  3F8U A;  4HSC X;  2AAW A;  3J7Y k;  3IAM 2;  3DIE A;  4HQZ A;  4ZBB A;  1YKC A;  4MLY A;  2V1M A;  4K5R A;  5G31 A;  4FQU A;  1ZZY A;  3KIJ A;  5ID2 B;  1XW5 A;  4MF7 A;  3VFI A;  3M9J A;  2A2R A;  2E2M A;  2L5O A;  2QKE A;  3N5O A;  3IHG A;  1PGT A;  2HRA A;  5FT3 A;  2CAQ A;  1DE1 A;  3TKP A;  4KB3 A;  1A2J A;  3QMX A;  3HYP A;  4L0U A;  1Z6N A;  4MDC A;  6GSW A;  3E9J B;  1UC7 A;  1XVW A;  2J23 A;  3QPM A;  4MF5 A;  5IIZ A;  6GST A;  1V58 A;  2JSY A;  1SL0 B;  3F6F A;  1G6Y A;  2CV4 A;  3NOF A;  2UZ8 A;  2DJ3 A;  4G19 A;  1PD2 1;  2FWH A;  3VI5 A;  1OVN A;  3LYK A;  3W8J A;  2VL2 C;  2VCZ A;  1E2Y A;  5ECN B;  1UA5 A;  3UOM A;  5J40 A;  1Q4J A;  1LU4 A;  3TJK A;  4XCS A;  5HR1 A;  4WF5 A;  1OC9 B;  2YAN A;  2ZCT A;  4YH2 A;  1GLP A;  1F3A A;  1U88 A;  1QK8 A;  2IFQ A;  4EIQ A;  4TR3 A;  1AIU A;  3RFR C;  3HVV A;  2NDO A;  3HKR A;  3MDK A;  4KSM A;  19GS A;  4IVF A;  2WRT A;  2X8G A;  5G2Z A;  2KLX A;  4I2U A;  3A5I A;  3F4S A;  3TKS C;  3ZTL A;  3FY7 A;  4ZL8 A;  2H70 A;  4BVX B;  1EGO A;  4DSS A;  1O8X A;  2VKZ G;  4PXO A;  1GUK A;  1R26 A;  3MSZ A;  3PPU A;  2VM2 A;  4KDU A;  1I9D A;  2EFE A;  4F9Z A;  3A3T A;  5B6M A;  4EDZ A;  2TRC P;  2WVX B;  3GN3 A;  3GRX A;  3CXG A;  2CZ2 A;  1VF4 A;  4G01 A;  5ECQ B;  2EC4 A;  4ZIJ A;  2MMZ A;  3TJB A;  2HYX A;  4POB A;  1WWJ A;  2JSZ A;  2IWT A;  4JZQ A;  3DML A;  4X43 A;  5IMA A;  5A5H A;  2VIM A;  2REM A;  1GTU A;  2PVO C;  5CRH A;  2K8V A;  5GST A;  3QAV A;  2F51 A;  4BA7 A;  3KZQ A;  3DWV A;  3ME7 A;  4EUY A;  5ECK B;  2OKA A;  3EUR A;  4WET A;  4WF4 A;  1SL2 B;  4JED A;  2DKH A;  1GH2 A;  1K0D A;  2B1K A;  5IMF A;  3Q18 A;  4EXJ A;  3UBL A;  2QSI A;  3F9U A;  3EWL A;  1XOB A;  4HQS A;  3HY2 A;  3AY8 A;  2WVY A;  4ML6 A;  1M2D A;  5INY A;  3TJG A;  3C8E A;  1GSE A;  3IBH A;  1GSY A;  2V2G A;  1T4Y A;  1WOU A;  3LEF A;  3H8Q A;  3KH9 A;  5IM9 A;  2JL4 A;  4YQU A;  1BX9 A;  1V57 A;  4O32 A;  1TXX A;  2MMA A;  4ICY A;  4XS4 B;  1GTB A;  2H01 A;  1G0T A;  2WW0 A;  4V2M A;  4WXT A;  2OBI A;  2IPA A;  4TOP A;  5DQS A;  2LNS A;  2GZY A;  3FK8 A;  3K8N A;  2R37 A;  1B4P A;  1ERV A;  4K7O A;  2KP1 A;  4FO5 A;  2B5X A;  2CX3 A;  2K9F A;  4AGS A;  4AKH A;  2VL9 A;  3UJ1 A;  3L9U A;  3WGX A;  4RQR A;  4Z2U A;  2PWJ A;  4PQH A;  4YKF A;  5HR0 A;  4N0Z A;  10GS A;  3RPN A;  2KOK A;  2H6X A;  3HJP A;  4E8E A;  4IN0 A;  3TKS E;  3ZYW A;  2H0H A;  3DGQ A;  3QR6 A;  1WPI A;  5ECI B;  2GQM A;  2XPE A;  4ZL7 A;  3H93 A;  3ERG A;  4JBB A;  4XRD A;  1EV9 A;  2V41 A;  2IFQ B;  4O7H A;  1IYI A;  3EMX A;  5EVO A;  3IC4 A;  3PH9 A;  3M3M A;  1TK8 B;  2QGV A;  5EY6 A;  4NHW A;  2OT3 A;  2HZF A;  2E7P A;  4KF9 A;  4OFN A;  5IOW A;  2H1A A;  3WGE A;  1S3C A;  5A1N B;  1BED A;  2R4V A;  1LBK A;  2C80 A;  4DSS B;  1SD8 A;  3EYT A;  3ZZX A;  2OAC A;  3HCZ A;  1TKD B;  4O92 A;  3GTU A;  4GST A;  1O6J A;  3GUS A;  1U3I A;  1OC3 A;  5CRW A;  3MAK A;  4K7I A;  2CVK A;  3H4K A;  3O6T A;  1I1I P;  4YQM A;  2FD3 A;  5HQP A;  1XW9 A;  2RM6 A;  4TXO B;  2YPM A;  1K0N A;  2VAF A;  1X9M B;  1A24 A;  5L71 A;  3LFL A;  4ML1 A;  3ZVJ D;  3ZL5 A;  3LW9 A;  5G1K A;  1M9A A;  1XWG A;  4LMV A;  4EF0 A;  4JE1 A;  2IMI A;  3GKX A;  1B8X A;  3LSZ A;  1W89 A;  1O8W A;  3L78 A;  4LL1 B;  4NWY A;  3WGD A;  5A5H B;  1O7U A;  3CSI A;  4G10 A;  1SVL A;  1M7T A;  1XBS A;  2GGT A;  1TRU A;  2L59 A;  2H6Y A;  3L4N A;  1WMJ A;  4JR6 A;  3JCM L;  2WW3 A;  4HJM A;  5B8A A;  3BBY A;  2F8F A;  3QFB C;  2GSS A;  1GL8 A;  2R3X A;  3TB2 A;  1OE8 A;  1G7E A;  4RI6 A;  1EOG A;  4MJA A;  4TXV A;  5LCZ A;  2H1G A;  4L8E A;  1A8L A;  2LJR A;  2XC2 A;  3GSS A;  2YNX A;  5GSS A;  2GT5 A;  5D9T A;  5G5E A;  1QXH A;  5IQY A;  1WE0 A;  4OD7 A;  2FA4 A;  3HMJ G;  1MTC A;  2R6K A;  2YWI A;  3M9K A;  3APS A;  2CVB A;  3ZRE A;  4ECB A;  4GCI A;  3BJ5 A;  3KMO A;  2L6C A;  3A5W A;  2C3T A;  3DD3 A;  5F8B A;  3DVX A;  1CQH A;  3ZMK A;  2FY6 A;  2O36 A;  3UBK A;  1O73 A;  1KNG A;  2VL3 A;  1ZL9 A;  4HZ2 A;  2B7J A;  3QOU A;  1FVK A;  3KXO A;  3FR3 A;  1VRS D;  1M99 A;  1M0U A;  4PI0 C;  1NW2 A;  3UAP A;  4L5L A;  4IS0 A;  1SJ6 A;  1ZYE A;  2YZH A;  1TJD A;  3P7X A;  1TRV A;  3CQF A;  1K0M A;  3KP9 A;  3WYW A;  2WUL A;  2HSH A;  2H74 A;  1AQW A;  2LQQ A;  4OO4 A;  2LRC A;  3E0U A;  2HT9 A;  2IMF A;  1SJZ A;  2QA1 A;  4P3Y B;  1ZMA A;  2GQL A;  4BVY A;  4AKX B;  2J9H A;  3ZML A;  4TN8 A;  2PGT A;  2L5L A;  4FYB A;  4IEL A;  5ECS A;  4KE3 A;  2OE1 A;  1THO A;  2O89 A;  1JHB A;  1E6B A;  2KP2 A;  1TW9 A;  5ELA A;  2GST A;  1GSQ A;  4IKH A;  3IHQ A;  3H1N A;  1V9W A;  3C1S A;  2FHE A;  3CHX C;  4CY8 A;  3GL5 A;  2MZC A;  1FVJ A;  3IXR A;  2WW1 A;  1Y6E A;  5JWO B;  4MZW A;  3ISO A;  3KGK A;  2X8C A;  2C3N A;  4E68 A;  2DJ2 A;  2IME A;  3FZ5 A;  5ECL B;  4OO5 A;  1T7P B;  2HFD A;  4CY6 A;  5DCG A;  1SL1 B;  5CP1 A;  5CYY A;  2CQ9 A;  5LD0 A;  2YWM A;  4K1F A;  1J9B A;  1XOA A;  4EVM A;  4LLR A;  5DJL A;  2R5G A;  2RII A;  3FEU A;  2IL3 A;  2H1D A;  4ZXG A;  4PNG A;  3P2A A;  3LJR A;  1OYJ A;  3ZIJ A;  3C71 A; 
#chains in the Genus database with same CATH homology
 2LS5 A;  2DJJ A;  2PU9 C;  4K2X A;  5IPH A;  4GWR A;  4L5O A;  1F6M C;  2WS2 A;  4HDE A;  4MAB A;  5KN3 A;  8GSS A;  20GS A;  1XVQ A;  4V1A p;  2MMN A;  1GUM A;  4FIW A;  4WR5 A;  2AV4 A;  1T3B A;  2FUG 2;  3PR8 A;  3M0F A;  2K8S A;  2GTU A;  1PKW A;  1MDI A;  4MMM A;  5H5S A;  2HZE A;  1HQO A;  3D6I A;  2G0F A;  1V2A A;  3UIW A;  1ACV A;  2R0C A;  3EMP A;  1BG1 A;  3LXZ A;  3TOU A;  4DSR A;  4O5R A;  3CRT A;  4Z2T A;  5AIV A;  4JR4 A;  5EL8 A;  5BMU A;  3D21 A;  4OCE A;  1EGR A;  2BJX A;  1BAY A;  2WCI A;  2PPT A;  2R2J A;  3NZN A;  4NPB A;  4N3Z A;  1XW6 A;  4K8M A;  5J4Y A;  4LA1 A;  4AKI A;  4NAX A;  3GHA A;  1Y1U A;  2MMO A;  1HNC A;  3D4T A;  3KTB A;  1PL2 A;  5LNK e;  3QD9 A;  2A4V A;  2WZ9 A;  4AF2 A;  1PSQ A;  4ZIL A;  1GSF A;  1BG5 A;  1M2A A;  3QAG A;  1Z6M A;  1KTE A;  2C0G A;  4BL7 A;  2IIY A;  4HI7 A;  2C0F A;  2K6V A;  1FW1 A;  2DIZ A;  1EOH A;  4ZB9 A;  3C7M A;  2F8A A;  2VCV A;  1N2A A;  3UVH A;  4GTU A;  4A5P A;  2DC5 A;  4H86 A;  4MJE A;  4OFM A;  2JZS A;  2DJK A;  2ALB A;  3GMF A;  1MDJ A;  5CNW A;  2GSR A;  2V6K A;  2ON7 A;  1ST9 A;  5KOW A;  3DKS A;  3FYG A;  1FHE A;  1GNE A;  2O7K A;  2DMM A;  5A34 A;  4MH3 A;  2I81 A;  2YV9 A;  4KSO A;  3GV1 A;  1M9B A;  1VF1 A;  4N30 A;  4NV2 A;  5EPF A;  3GFK A;  3ZLP A;  4USS A;  1WRY A;  1G7O A;  2HRK A;  3WT2 A;  4KCA A;  5JWQ B;  2QA2 A;  2H66 A;  3D0Z A;  4V2N A;  3RDW A;  2HSN A;  2C3Q A;  3TRQ A;  4BPY A;  2PBJ A;  1TOF A;  3KEB A;  1Z7R A;  3LOR A;  3LQ7 A;  4K2D A;  4EE0 A;  2IN3 A;  2BMX A;  1BYE A;  1PN0 A;  4E8H A;  2M46 A;  3EU3 A;  1XIY A;  2RUF A;  1PN9 A;  17GS A;  4MPF A;  3IRA A;  3VWU A;  2MYG A;  4DVC A;  1EEM A;  1H75 A;  1IYH A;  4PUR A;  1MEK A;  1PX6 A;  4IW9 A;  1GNW A;  2EFC A;  4PX1 A;  1ABA A;  5KN2 A;  2VD0 A;  1A0R P;  1SYX A;  3TOT A;  2HNL A;  3RAZ A;  2FWE A;  2OE0 A;  3BOA A;  1T00 A;  1U6T A;  4I5Q A;  5FWG A;  1V98 A;  3IAS 2;  2A4H A;  2DBC A;  1F9M A;  2YN1 A;  1WJK A;  5J4U A;  3ME8 A;  5ABR A;  3GST A;  1M2B A;  4MJC A;  1HNA A;  4J2F A;  4XIH A;  4K9Z A;  5F07 A;  3HXS A;  4MZB A;  1GTA A;  3UEM A;  1DSB A;  4F0C A;  5ECH B;  2VLV A;  1K3Y A;  1YEX A;  1TTZ A;  4I6X A;  2I4A A;  2KUC A;  4IHU A;  1TRW A;  5CRG A;  1NM3 A;  3Q74 A;  3CBU A;  2AB6 A;  4QL7 A;  1TK0 B;  1GUL A;  3MIX A;  2UV8 G;  3HVS A;  2DIY A;  1EEJ A;  1JZO A;  2VCX A;  2I3Y A;  4Z2R A;  4BL7 B;  4ACS A;  4GQC A;  13GS A;  2CAI A;  2CZ3 A;  3C1R A;  3MNG A;  2CVD A;  2ES7 A;  3KH7 A;  4FYU A;  1JZD A;  1BF5 A;  2H71 A;  2LJK A;  4KDY A;  2A2P A;  3S9F A;  4GSS A;  1YF1 A;  2NVL A;  3HZ8 A;  3IDV A;  2LST A;  4MA9 A;  1KEB A;  1TI3 A;  3MWH A;  2AYT A;  2C8U A;  3VK9 A;  3FZ4 A;  1UVZ A;  4AJ7 A;  5D73 A;  3F3R A;  1KBN A;  1X5E A;  4LMW A;  4KCE A;  2GT6 A;  4K0G A;  4EKZ A;  3ZFL A;  5DCH A;  2GZP A;  4KUN A;  3QFA C;  2MBS A;  1OKD A;  3HVX A;  4Q5Q A;  3IK7 A;  3MYD A;  1GTI A;  2HRK B;  1K0O A;  3Q19 A;  2FCH A;  6GSU A;  2F3M A;  2PER A;  2DKI A;  1GSS A;  5CRE A;  2HSN B;  4ID0 A;  2H75 A;  1WIK A;  2LV3 A;  1TXU A;  3PGT A;  3F63 A;  4Z7X A;  4TR1 A;  3TRX A;  11GS A;  1YF0 A;  1I5G A;  4V2L A;  3RHC A;  4EC0 A;  1K0A A;  1AW9 A;  2H30 A;  2OAD A;  3EE2 A;  5J9C A;  5ECP B;  5AIX A;  5DVB A;  3HA9 A;  2C1Y A;  2H1B A;  2FA8 A;  4GXZ A;  4TR0 A;  3VWW A;  1YQ1 A;  5FHI A;  1X5D A;  4KW6 A;  3H79 A;  1TRS A;  2XBI A;  4L0W A;  2FGX A;  4MZC A;  2TIR A;  4MNN A;  3CTG A;  2AHE A;  4POM A;  1ML6 A;  2ZUP A;  3CMI A;  2LRN A;  5D9X A;  2DJ1 A;  2BTO T;  3L9V A;  4JRR A;  4NMU A;  3GA4 A;  4N10 A;  3GH6 A;  3G7J A;  5AIS A;  5HFI A;  1QMV A;  1NHO A;  1RW1 A;  4YQV A;  4RQX A;  2VLU A;  4I97 A;  3VPT A;  1QQ2 A;  4NHZ A;  4N11 A;  5ELG A;  3KCM A;  4F2I A;  1XFL A;  1TI1 A;  2EIR A;  2YCD A;  2QC7 A;  2JZT A;  3ERF A;  3VI7 A;  4TRX A;  4XS6 A;  1XXU A;  2B1L A;  4I2T A;  5IOX A;  1VF3 A;  5DAL A;  2H6Z A;  2OA7 A;  3P90 A;  1DBY A;  4O5U A;  6GSX A;  2LJA A;  5E4W A;  1JZR A;  3R3E A;  2B7K A;  3HDC A;  1QGV A;  2NTO A;  1JZW A;  1THX A;  2I9H A;  3I9V 2;  5ECO B;  1XWB A;  2L4Q A;  1C72 A;  4DEJ A;  3QCP A;  1ZCP A;  3DVW A;  2VCT A;  1OC9 A;  1R5A A;  4TW5 A;  2JU5 A;  2VM1 A;  3A2X A;  1MDK A;  4DSQ A;  1CQG A;  3O76 A;  3IK9 A;  3WT1 A;  4GRF A;  4RUV A;  4Q5F A;  2HSM A;  5BRT A;  2L4C A;  1SEN A;  3ZIV A;  3G7Y A;  3CTF A;  4ECC A;  1Z9H A;  3D4M A;  2FWF A;  2EFH A;  3GKN A;  1K3L A;  1EWX A;  3NIV A;  1SK1 A;  4G9H A;  4XRA A;  2N5F A;  4BVX A;  2DJ0 A;  1F37 A;  4FH8 A;  3M1G A;  4BWQ A;  5AGY A;  1ERW A;  4EL1 A;  1XZO A;  4F82 A;  5HFG A;  4G0K A;  1QFN A;  4YAV A;  1ZGN A;  3R2Q A;  4IBP A;  3EPT A;  3ERW A;  4BWS A;  3ED3 A;  4NV5 A;  3GTU B;  1G6W A;  1VF2 A;  2P31 A;  4N0V A;  3FR9 A;  3UAR A;  6GSY A;  4ZB6 A;  4OFT A;  4YKG A;  4HU7 A;  3DXB A;  3TCO A;  2HXK A;  4XTS A;  3RPP A;  3FMW A;  5G5F A;  4GSN A;  2HLS A;  4ZL9 A;  1K3O A;  1JLW A;  1OAZ A;  1PA3 A;  2YWN A;  3TKR A;  1A0F A;  4ECI A;  1S3D A;  3F4R A;  1F3B A;  5DBQ A;  3G9B A;  3L0H A;  1URM A;  4TR1 B;  5IMV A;  3QAW A;  4HU9 A;  2B6M A;  2VUP A;  5ENU A;  2DLX A;  2X4A A;  5KN0 A;  1A23 A;  3UVT A;  1HNB A;  1PKZ A;  4EIP A;  5A4V A;  7GSS A;  5KEJ A;  3KD0 A;  3IE3 A;  3GH9 A;  22GS A;  2HRF A;  5G1L A;  3VWV A;  4KDX A;  5KOX A;  1GLQ A;  5CRD A;  1RQM A;  2JZR A;  3GX8 A;  1A2L A;  5F05 A;  1Y25 A;  2E0Q A;  2P0G A;  2YV7 A;  3V1W A;  2IMK A;  4F03 A;  5A5K A;  1TDI A;  2PUK C;  1ZOF A;  4RI7 A;  4XS4 A;  2YJH A;  1PQN A;  4X1U A;  4KND A;  1GUH A;  2GLR A;  2VO4 A;  3SWL A;  3TGZ A;  5B8B A;  3DYR A;  3CSJ A;  2N5A A;  2B5Y A;  18GS A;  2HQT A;  2VD1 A;  5DAL B;  5DQY A;  3IPZ A;  1LJR A;  2MBT A;  3U5R E;  1TK5 B;  4EDY A;  4MF6 A;  2FLS A;  4ECJ A;  3EU4 A;  14GS A;  2NPB A;  2XHF A;  3OR5 A;  4CDO A;  1MD4 A;  1MD3 A;  1YVL A;  2G2Q A;  2YJ7 A;  3GYK A;  3F6D A;  3IOS A;  1K0B A;  2H19 A;  1AXD A;  5CAX A;  4WBJ A;  2GS3 A;  3IR4 A;  4KGI A;  3ZRD A;  4BVY B;  1FOH A;  5KN1 A;  2CX4 A;  4I8B A;  4XS1 A;  4ZB8 A;  3FKF A;  1B9Y C;  2A2S A;  4TR4 A;  2HSM B;  1O81 A;  1SKW B;  1B9X C;  1ZYQ B;  1ILO A;  5GZZ B;  4WKW A;  2PMT A;  5JCW A;  5J9B A;  4JU5 A;  1ON4 A;  4ZBD A;  1Z5Y E;  5ECM B;  5IMD A;  3A2W A;  1AQX A;  3TDG A;  1AC1 A;  1JFU A;  1SYR A;  2L6D A;  5A1N A;  2H76 A;  4PUF C;  4KX4 A;  4HUA A;  1NHY A;  4YAP A;  1V40 A;  2VCW A;  2EIQ A;  1S3A A;  3BCI A;  2LEG A;  3SBC A;  2WFC A;  1F2E A;  4AJ6 A;  2ZNM A;  1DE2 A;  4TXO A;  3IC8 A;  4AI6 A;  2O85 A;  1OKT A;  2C0D A;  2GQK A;  2OBK A;  2R0G A;  1Z7P A;  4IQA A;  1B48 A;  2I1U A;  2R0P A;  1AUC A;  2DSA A;  4HS1 A;  2RUE A;  1XWC A;  4G0I A;  4ZB7 A;  5CO3 A;  2C4J A;  3GKK A;  5IO2 A;  5D96 A;  4NXI A;  2PN8 A;  3F4T A;  4MP4 A;  2HI7 A;  2X99 A;  2H8L A;  3TUE A;  2K18 A;  4QQ7 A;  2HZE B;  5D9V A;  1SD9 A;  4J57 E;  1JLV A;  3APO A;  3I69 A;  2VOC A;  1TU8 A;  3KM6 A;  1N25 A;  3IV4 A;  1U3A A;  1PL1 A;  2NBS A;  3LWA A;  3GL3 A;  4HZ4 A;  5BMU B;  3LGC A;  4WR4 A;  5B7C A;  2EIO A;  1XPV A;  4W66 A;  2WGR A;  3KMN A;  4OMV A;  1GSD A;  1J08 A;  4KH7 A;  4PGT A;  1FB6 A;  5IPG A;  5ECR B;  4IP6 A;  3RHB A;  2E2G A;  3VLN A;  1UN2 A;  1XWK A;  4X0X A;  5J5N A;  2P5Q A;  3PIN A;  1VGL A;  3FR6 A;  1T8E B;  3W8S A;  2OJL A;  9GSS A;  4EO3 A;  16GS A;  1WP0 A;  5A4W A;  1XCC A;  1U87 A;  4K0N A;  1X5C A;  1EV4 A;  2FWG A;  4G2E A;  3ZIT A;  5A4U A;  1SVO A;  1GP1 A;  1W4V A;  2IMD A;  1YEP A;  4IJ3 A;  2M80 A;  4V1A g;  3J7Y b;  4K5S A;  1SK2 A;  4GDF A;  1YDK A;  3FW2 A;  2X8H A;  5JCU A;  3ZFB A;  2LTK A;  5DJM A;  2H73 A;  4CW9 A;  4IJI A;  4O5Q A;  1O85 A;  2V6O A;  2VL2 A;  4QL9 A;  3C73 A;  3LYP A;  3WD6 A;  5IO0 A;  4AKG A;  2YOI A;  6GSS A;  3E3E A;  2VLT A;  2P5R A;  4GLT A;  1XWA A;  4K7N A;  1SK0 A;  2L57 A;  5H5Q A;  3EVI A;  3U6V A;  1ERT A;  5A34 B;  4IQ1 A;  2YWO A;  2FNO A;  3KJY A;  3CWG A;  1EZK A;  3KP8 A;  3FHK A;  3TKS A;  2CA8 A;  2TRX A;  5DAK A;  2V32 A;  1ZYP A;  4PUA A;  1T4Z A;  2YZU A;  1GRX A;  2RM5 A;  3HJO A;  2H0I A;  3GKM A;  4TVE A;  2D2Z A;  4WBR D;  3D5J A;  2B5E A;  3UL3 A;  3US3 A;  1RK4 A;  5DDL A;  2RLI A;  3G7I A;  4POL A;  1Z3E A;  4IP1 A;  3LXT A;  5C00 A;  3ZVJ A;  2GSQ A;  3Q6O A;  2VCQ A;  5H5R A;  5J4V A;  4ILF A;  2F9S A;  3DRN A;  4D73 A;  4IGJ A;  3CYN A;  3GX0 A;  4HJ2 A;  1OC8 A;  1YZX A;  5HR2 A;  3VWX A;  4TKY A;  1SKS B;  3APQ A;  5G30 A;  3F3Q A;  3O3T A;  4MK3 A;  1A8Y A;  1FO5 A;  4PQI A;  2N5B A;  2X64 A;  3EIN A;  4POK A;  5JWR B;  1YY7 A;  4OWY A;  5ID2 A;  4XHM A;  4MCU A;  2O5V A;  4ULX A;  2DML A;  5F0G A;  3N9J A;  2H0G A;  5GAP D;  3A2V A;  3LG6 A;  1HYU A;  5AN1 A;  3TJJ A;  1X9S B;  1N8J A;  4LL4 B;  1X9W B;  5B6N A;  3HD5 A;  3CSH A;  3L9S A;  2O8V B;  3DEX A;  2WJU A;  2XBQ A;  1R4W A;  4Q5N A;  2JAC A;  2LKU A;  4OCF A;  1T1V A;  3RBT A;  5E59 A;  3TJF A;  2ON5 A;  1A2M A;  6GSV A;  2XPD A;  5COH A;  1K0C A;  2O87 A;  2OE3 A;  2CT6 A;  1H4O A;  3D22 A;  1YJ6 A;  12GS A;  2H72 A;  2LUS A;  2LQO A;  1X0R A;  3GUR A;  1FB0 A;  2LRT A;  2PVQ A;  4MPG A;  4GF0 A;  3W6G A;  3FZA A;  1Q98 A;  4K6X A;  5J3R A;  3GIX A;  3TKQ A;  2M72 A;  3P8W A;  3HZ4 A;  2LNT A;  2JAD A;  2WB9 A;  5D8I A;  3TRP A;  1TU7 A;  3M8N A;  1EP8 A;  2C0E A;  2HRN A;  5GAN D;  2B3S A;  4FYC A;  3HJM A;  2AJQ B;  1ZYN A;  3I43 A;  3QDN A;  4ZBA A;  1AQV A;  3GNJ A;  5HR3 A;  1GSU A;  3KTL A;  4GQF A;  2GDR A;  4MH2 A;  5JCG A;  1EP7 A;  4PQ1 A;  3IA1 A;  5C04 A;  1USB A;  2KHP A;  1R7H A;  3HHV A;  2H1L A;  5J47 A;  1FOV A;  4PNF A;  2AUV A;  4X4J A;  3I6A A;  1HD2 A;  2HSY A;  2Z9S A;  2HE3 A;  5IMC A;  4HEA 2;  1R5P A;  2YP6 A;  1AAZ A;  3F0I A;  4ISD A;  4F0B A;  4Q5R A;  1BJX A;  3VUR A;  4CHS A;  4QMK A;  1SJI A;  2WDU A;  1TP9 A;  3TU3 B;  1SU9 A;  2IJY A;  1PMT A;  5J41 A;  5HFK A;  4KA0 A;  5DAK B;  2EFD A;  4MJB A;  1ERU A;  1GWC A;  1DUG A;  1SKR B;  4G0L A;  5F06 A;  3VPQ A;  1BQ7 A;  2X49 A;  5IMZ A;  1PX7 A;  1YKA A;  5D9W A;  1QUW A;  1B4Q A;  4AJ8 A;  4J56 E;  3FZ9 A;  1PRX A;  2GVP A;  3BD2 A;  3EC3 A;  4KAE A;  3CRU A;  1J0F A;  3UMA A;  1FG4 A;  4WEY A;  1NSW A;  2GZZ A;  3FRC A;  1OE7 A;  4PTS A;  1FAA A;  4HOJ A;  4D73 B;  3BCK A;  1SVM A;  5D93 A;  3F8U A;  2AAW A;  3J7Y k;  3IAM 2;  3DIE A;  4HQZ A;  4ZBB A;  1YKC A;  4MLY A;  2V1M A;  4K5R A;  5G31 A;  4FQU A;  1ZZY A;  3KIJ A;  5ID2 B;  1XW5 A;  4MF7 A;  3VFI A;  3M9J A;  2A2R A;  2E2M A;  2L5O A;  2QKE A;  3N5O A;  3IHG A;  1PGT A;  2HRA A;  5FT3 A;  2CAQ A;  1DE1 A;  3TKP A;  4KB3 A;  1A2J A;  3QMX A;  3HYP A;  4L0U A;  1Z6N A;  4MDC A;  6GSW A;  3E9J B;  1UC7 A;  1XVW A;  2J23 A;  3QPM A;  4MF5 A;  5IIZ A;  6GST A;  1V58 A;  2JSY A;  1SL0 B;  3F6F A;  1G6Y A;  2CV4 A;  3NOF A;  2UZ8 A;  2DJ3 A;  4G19 A;  1PD2 1;  2FWH A;  3VI5 A;  1OVN A;  3LYK A;  3W8J A;  2VL2 C;  2VCZ A;  1E2Y A;  5ECN B;  1UA5 A;  3UOM A;  5J40 A;  1Q4J A;  1LU4 A;  3TJK A;  4XCS A;  5HR1 A;  4WF5 A;  1OC9 B;  2YAN A;  2ZCT A;  4YH2 A;  1GLP A;  1F3A A;  1U88 A;  1QK8 A;  2IFQ A;  4EIQ A;  4TR3 A;  1AIU A;  3HVV A;  2NDO A;  3HKR A;  3MDK A;  4KSM A;  19GS A;  4IVF A;  2WRT A;  2X8G A;  5G2Z A;  2KLX A;  4I2U A;  3A5I A;  3F4S A;  3TKS C;  3ZTL A;  3FY7 A;  4ZL8 A;  2H70 A;  4BVX B;  1EGO A;  4DSS A;  1O8X A;  2VKZ G;  4PXO A;  1GUK A;  1R26 A;  3MSZ A;  3PPU A;  2VM2 A;  4KDU A;  1I9D A;  2EFE A;  4F9Z A;  3A3T A;  5B6M A;  4EDZ A;  2TRC P;  3GN3 A;  3GRX A;  3CXG A;  2CZ2 A;  1VF4 A;  4G01 A;  5ECQ B;  2EC4 A;  4ZIJ A;  2MMZ A;  3TJB A;  2HYX A;  4POB A;  1WWJ A;  2JSZ A;  2IWT A;  4JZQ A;  3DML A;  4X43 A;  5IMA A;  5A5H A;  2VIM A;  2REM A;  1GTU A;  2PVO C;  5CRH A;  2K8V A;  5GST A;  3QAV A;  2F51 A;  4BA7 A;  3KZQ A;  3DWV A;  3ME7 A;  4EUY A;  5ECK B;  2OKA A;  3EUR A;  4WET A;  4WF4 A;  1SL2 B;  4JED A;  2DKH A;  1GH2 A;  1K0D A;  2B1K A;  5IMF A;  3Q18 A;  4EXJ A;  3UBL A;  2QSI A;  3F9U A;  3EWL A;  1XOB A;  4HQS A;  3HY2 A;  3AY8 A;  4ML6 A;  1M2D A;  5INY A;  3TJG A;  3C8E A;  1GSE A;  3IBH A;  1GSY A;  2V2G A;  1T4Y A;  1WOU A;  3LEF A;  3H8Q A;  3KH9 A;  5IM9 A;  2JL4 A;  4YQU A;  1BX9 A;  1V57 A;  4O32 A;  1TXX A;  2MMA A;  4ICY A;  4XS4 B;  1GTB A;  2H01 A;  1G0T A;  4V2M A;  4WXT A;  2OBI A;  2IPA A;  4TOP A;  5DQS A;  2LNS A;  2GZY A;  3FK8 A;  3K8N A;  2R37 A;  1B4P A;  1ERV A;  4K7O A;  2KP1 A;  4FO5 A;  2B5X A;  2CX3 A;  2K9F A;  4AGS A;  4AKH A;  2VL9 A;  3UJ1 A;  3L9U A;  3WGX A;  4RQR A;  4Z2U A;  2PWJ A;  4PQH A;  4YKF A;  5HR0 A;  4N0Z A;  10GS A;  3RPN A;  2KOK A;  2H6X A;  3HJP A;  4E8E A;  4IN0 A;  3TKS E;  3ZYW A;  2H0H A;  3DGQ A;  3QR6 A;  1WPI A;  5ECI B;  2GQM A;  2XPE A;  4ZL7 A;  3H93 A;  3ERG A;  4JBB A;  4XRD A;  1EV9 A;  2V41 A;  2IFQ B;  4O7H A;  1IYI A;  3EMX A;  5EVO A;  3IC4 A;  3PH9 A;  3M3M A;  1TK8 B;  2QGV A;  5EY6 A;  4NHW A;  2OT3 A;  2HZF A;  2E7P A;  4KF9 A;  4OFN A;  5IOW A;  2H1A A;  3WGE A;  1S3C A;  5A1N B;  1BED A;  2R4V A;  1LBK A;  2C80 A;  4DSS B;  1SD8 A;  3EYT A;  3ZZX A;  2OAC A;  3HCZ A;  1TKD B;  4O92 A;  3GTU A;  4GST A;  1O6J A;  3GUS A;  1U3I A;  1OC3 A;  5CRW A;  3MAK A;  4K7I A;  2CVK A;  3H4K A;  3O6T A;  4YQM A;  2FD3 A;  5HQP A;  1XW9 A;  2RM6 A;  4TXO B;  2YPM A;  1K0N A;  2VAF A;  1X9M B;  1A24 A;  5L71 A;  3LFL A;  4ML1 A;  3ZVJ D;  3ZL5 A;  3LW9 A;  5G1K A;  1M9A A;  1XWG A;  4LMV A;  4EF0 A;  4JE1 A;  2IMI A;  3GKX A;  1B8X A;  3LSZ A;  1W89 A;  1O8W A;  3L78 A;  4LL1 B;  4NWY A;  3WGD A;  5A5H B;  1O7U A;  3CSI A;  4G10 A;  1SVL A;  1M7T A;  1XBS A;  2GGT A;  1TRU A;  2L59 A;  2H6Y A;  3L4N A;  1WMJ A;  4JR6 A;  3JCM L;  4HJM A;  5B8A A;  3BBY A;  2F8F A;  3QFB C;  2GSS A;  1GL8 A;  2R3X A;  3TB2 A;  1OE8 A;  1G7E A;  4RI6 A;  1EOG A;  4MJA A;  4TXV A;  5LCZ A;  2H1G A;  4L8E A;  1A8L A;  2LJR A;  2XC2 A;  3GSS A;  2YNX A;  5GSS A;  2GT5 A;  5D9T A;  5G5E A;  1QXH A;  5IQY A;  1WE0 A;  4OD7 A;  2FA4 A;  3HMJ G;  1MTC A;  2R6K A;  2YWI A;  3M9K A;  3APS A;  2CVB A;  3ZRE A;  4ECB A;  4GCI A;  3BJ5 A;  3KMO A;  2L6C A;  3A5W A;  2C3T A;  3DD3 A;  5F8B A;  3DVX A;  1CQH A;  3ZMK A;  2FY6 A;  3UBK A;  1O73 A;  1KNG A;  2VL3 A;  1ZL9 A;  4HZ2 A;  2B7J A;  3QOU A;  1FVK A;  3KXO A;  3FR3 A;  1VRS D;  1M99 A;  1M0U A;  1NW2 A;  3UAP A;  4L5L A;  4IS0 A;  1SJ6 A;  1ZYE A;  2YZH A;  1TJD A;  3P7X A;  1TRV A;  1K0M A;  3KP9 A;  3WYW A;  2WUL A;  2HSH A;  2H74 A;  1AQW A;  2LQQ A;  4OO4 A;  2LRC A;  3E0U A;  2HT9 A;  2IMF A;  1SJZ A;  2QA1 A;  4P3Y B;  1ZMA A;  2GQL A;  4BVY A;  4AKX B;  2J9H A;  3ZML A;  4TN8 A;  2PGT A;  2L5L A;  4FYB A;  4IEL A;  5ECS A;  4KE3 A;  2OE1 A;  1THO A;  2O89 A;  1JHB A;  1E6B A;  2KP2 A;  1TW9 A;  5ELA A;  2GST A;  1GSQ A;  4IKH A;  3IHQ A;  3H1N A;  1V9W A;  3C1S A;  2FHE A;  4CY8 A;  3GL5 A;  2MZC A;  1FVJ A;  3IXR A;  1Y6E A;  5JWO B;  4MZW A;  3ISO A;  3KGK A;  2X8C A;  2C3N A;  4E68 A;  2DJ2 A;  2IME A;  3FZ5 A;  5ECL B;  4OO5 A;  1T7P B;  2HFD A;  4CY6 A;  5DCG A;  1SL1 B;  5CP1 A;  5CYY A;  2CQ9 A;  5LD0 A;  2YWM A;  4K1F A;  1J9B A;  1XOA A;  4EVM A;  4LLR A;  5DJL A;  2R5G A;  2RII A;  3FEU A;  2IL3 A;  2H1D A;  4ZXG A;  4PNG A;  3P2A A;  3LJR A;  1OYJ A;  3ZIJ A;  3C71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...