1IYIA

Crystal structure of hematopoietic prostaglandin d synthase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
publication title Mechanism of metal activation of human hematopoietic prostaglandin D synthase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1iyiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1iyiA01
1K3LA 3H79A 2HZFA 3TDGA 1F9MA 1M0UA 2YWOA 4O5RA 2VL3A 2IMFA 1OVNA 3L0HA 2WGRA 2L4CA 2M80A 1XFLA 1S3CA 5EPFA 3I69A 4TR0A 5D8IA 4HZ2A 2EIQA 2N5BA 1XZOA 1DBYA 3CBUA 1K3YA 5LD0A 1V2AA 2VM1A 5IMCA 2FHEA 4DSSA 3VWVA 1AIUA 2TRXA 4PQIA 1JZOA 3UBLA 1NM3A 2ES7A 5LCZA 3C7MA 4E8HA 5D9VA 2H1BA 3HKRA 2JSZA 1A2LA 3ZZXA 4QL7A 1TU8A 1VF2A 3GV1A 2P0GA 2G0FA 2PERA 1SYRA 1PL2A 4GCIA 2H0GA 5E59A 2H66A 3TGZA 5DCHA 2ZNMA 3GFKA 4HEA2 1LBKA 2V2GA 2JADA 1DE2A 3Q19A 4WBRD 4FYCA 3KTLA 3HJMA 1XWBA 4ZB6A 1O7UA 2EIOA 2XPDA 1MTCA 1T7PB 2C4JA 1WWJA 4XTSA 3HY2A 2VL9A 4O32A 2VD0A 5H5RA 4O92A 2GT5A 3KMNA 2QGVA 5B6MA 5DJLA 3NIVA 4KX4A 5HR1A 1GSEA 6GSSA 3UMAA 3M3MA 4GLTA 2L5LA 4ZL7A 3IE3A 1U88A 1T8EB 2FCHA 1YEPA 1TP9A 2VL2A 2I1UA 1X5DA 1GSQA 4POKA 4PURA 3HD5A 3P7XA 1B48A 3EU3A 4PXOA 1VF4A 3GX8A 4JR4A 1IYHA 2H6ZA 4LA1A 2IMIA 10GSA 5HR0A 4ECBA 4ECIA 5JWQB 4HQZA 3TRPA 2F8AA 5KN0A 5GSTA 3E9JB 3C71A 3IBHA 5CP1A 3GH9A 1PD21 2DJJA 3KH9A 2J9HA 1JZRA 3CTFA 2A2RA 2GSTA 4BVYA 4DVCA 5E4WA 3KJYA 1SJZA 4MH2A 1ZOFA 2IMEA 3Q6OA 3M1GA 2DJ3A 4HU7A 3GL5A 3WYWA 2LNSA 2HQTA 3FR9A 3DWVA 6GSTA 1ERVA 5B8BA 2YWMA 2VO4A 3U5RE 4MF6A 3KZQA 1NSWA 1ERWA 2F9SA 2H6YA 1J9BA 4MCUA 5BMUA 1ZZYA 2WS2A 4IELA 2OA7A 2XHFA 1XVQA 4RQRA 5KN2A 1O85A 3W8JA 2ZUPA 8GSSA 4GXZA 4KSMA 4D73B 5KEJA 1XW9A 3DVWA 3NOFA 2GT6A 2F51A 4KGIA 2LQOA 4CW9A 1M9BA 1LU4A 2LRNA 2M72A 2B6MA 4TN8A 4IN0A 5KN1A 1X9SB 20GSA 2YWIA 1IYIA 5ECSA 2B1KA 1Y6EA 1WOUA 1B9YC 3KP9A 3LEFA 3P8WA 2JZRA 4RQXA 3GTUB 4WETA 5IMZA 5JCGA 3QPMA 1QMVA 2BTOT 1ABAA 5EY6A 3PH9A 3CRUA 1OC9B 1XCCA 2O85A 1RW1A 3TKSE 3HJOA 2AAWA 1JHBA 2B7JA 1FVKA 4N0VA 1X5CA 1EZKA 1SL0B 2GGTA 3UEMA 5J4UA 1YDKA 2H1GA 5AGYA 12GSA 3RBTA 3US3A 1Z5YE 3ED3A 3TKSA 2C0FA 4F82A 1BQ7A 1TW9A 2DMMA 2CX4A 1OE7A 3M0FA 3GIXA 4WKWA 2PPTA 2RIIA 5AIVA 4GRFA 3TKPA 1PSQA 4BPYA 3CSHA 2H8LA 2GSQA 2GSRA 1PX7A 1KTEA 5F0GA 2LTKA 4ML1A 3IK9A 1AQXA 1UC7A 3QOUA 4MP4A 2CVKA 1SD9A 2NTOA 1SJ6A 3IHQA 4F0BA 2VLVA 3FR6A 1RQMA 3O76A 3GKMA 1GSDA 1XBSA 1SK1A 2WB9A 1OKTA 2V6KA 3ZFBA 3ZVJA 4FO5A 5F8BA 2HRAA 1F3BA 3GH6A 2B1LA 4WF5A 1SK2A 1DE1A 2ALBA 1Z7RA 4ECCA 2E0QA 2LJKA 2HZEA 2LJRA 3FZ4A 1BEDA 1W4VA 2PWJA 1R4WA 1ILOA 4KCEA 1YJ6A 3DRNA 3VPTA 1EP7A 3KIJA 1OC3A 2DMLA 1UVZA 2CAIA 5DCGA 2M46A 1GLPA 5GAPD 4PQ1A 2LSTA 3QD9A 4F2IA 7GSSA 2C0EA 4XS1A 1EOGA 2YP6A 5J9CA 1SKWB 5IM9A 1QUWA 4TXOB 4POMA 3EU4A 2KP1A 2AV4A 1FW1A 3TUEA 3H93A 3QMXA 3DYRA 2VLTA 1AQWA 4NHWA 3EYTA 4NWYA 2FD3A 4IKHA 1TJDA 2R6KA 3TKQA 3UBKA 1Y25A 2CV4A 1NW2A 1GULA 4EL1A 2R2JA 3Q18A 2K18A 4IP6A 5EVOA 2PN8A 1XPVA 3SBCA 2XPEA 5DQSA 4IGJA 1K0DA 2HFDA 2F8FA 3CSIA 3R2QA 2IIYA 2MYGA 4RUVA 1H4OA 1EGOA 3FY7A 1PL1A 4K7IA 4EE0A 2FGXA 1XOBA 2GZZA 1G7EA 4GTUA 1GH2A 1GUKA 4YQMA 1FG4A 4G0LA 3GURA 2HYXA 3NZNA 2LJAA 1TK5B 1XIYA 13GSA 2CVBA 1F2EA 4ZL8A 3IR4A 4V1Ap 3MWHA 3LQ7A 3HDCA 3KEBA 3TCOA 5HR2A 4RI7A 5GAND 2RM6A 3BCIA 3HHVA 2DC5A 1SL1B 2KOKA 3GKNA 3WT2A 1K0NA 4MPGA 2H76A 2OE0A 1B9XC 4GQFA 3D4MA 4MZBA 2N5AA 1GTUA 1V98A 4K0NA 3BJ5A 4EC0A 3UVHA 2GZPA 2GVPA 3TRXA 3VK9A 2HSMA 2LRTA 1I9DA 3TOTA 4XHMA 4DSSB 2KHPA 3HXSA 3QAVA 1NHOA 2OE3A 4YAPA 4F9ZA 3ZVJD 1MD3A 3BBYA 2K6VA 2L4QA 2CQ9A 2X8CA 2H75A 4YAVA 4ISDA 1K0MA 4G9HA 2KP2A 2G2QA 4MDCA 4BWSA 3QAWA 3KP8A 3VI5A 1X0RA 4WR5A 3GMFA 3HYPA 4K8MA 3FEUA 4H86A 4V2MA 3GKKA 1GRXA 5JWRB 1OYJA 17GSA 4PQHA 3I9V2 4AJ8A 3MAKA 4PNGA 3VWUA 5DJMA 2LV3A 1GSSA 4I97A 19GSA 2GQMA 2IJYA 3A2XA 2PMTA 4KUNA 2YNXA 2JZTA 3D6IA 4OCFA 5CYYA 1GSFA 2GTUA 3HCZA 2YJHA 4TR3A 4JU5A 2X8HA 3GUSA 4WBJA 4DSRA 1EOHA 2HRKA 4NHZA 3DVXA 3KTBA 2NBSA 3FW2A 4MJEA 4NV5A 4ZBDA 5IPGA 3CSJA 1YF0A 4OMVA 1QXHA 4WF4A 2HSHA 4OO4A 4AGSA 4EXJA 2BJXA 3F8UA 1PRXA 1AXDA 4IQAA 3LG6A 4XS6A 5AISA 3J7Yb 3CMIA 5G2ZA 3TB2A 4PUAA 4NPBA 1URMA 3UAPA 3KGKA 4LMVA 3QFAC 1VF1A 3PPUA 2P5RA 4FH8A 4XRDA 4ULXA 4BVYB 2HRFA 2VCXA 4EVMA 3F4SA 3RAZA 3LGCA 3DXBA 4BA7A 1J0FA 1R26A 2PGTA 4MJCA 5ELAA 5FWGA 5ECPB 3UIWA 4ZB8A 2E7PA 2VCZA 5AN1A 2YWNA 1TRVA 2UZ8A 3R3EA 5D93A 5ECOB 1X5EA 2AB6A 1KEBA 3H4KA 5D9TA 3GSSA 2N5FA 2V1MA 5C04A 2MMAA 1GSUA 4NXIA 1U3IA 3S9FA 2B5YA 1XWAA 1VRSD 2H70A 1EV4A 3FYGA 2LNTA 4KE3A 2H1AA 1T1VA 2GDRA 3C8EA 4HU9A 5ECHB 3EURA 2C3NA 3F3QA 4XCSA 4L0WA 3VPQA 3A3TA 2B3SA 2X64A 3CRTA 5DALA 3APQA 1OKDA 2H0HA 4ECJA 3A2VA 3W8SA 1U3AA 3IA1A 3WD6A 3VFIA 3IRAA 2TIRA 3V1WA 4K2DA 3G7JA 2I81A 3M8NA 14GSA 3WGEA 4MZWA 2ON7A 2O8VB 4ZXGA 1GNEA 1Z7PA 2B5XA 1XWCA 1GTAA 1EV9A 1R5AA 1HNAA 6GSYA 1AAZA 4E8EA 1MDKA 2AYTA 4MABA 1YY7A 1G7OA 4LL1B 5A4WA 2VM2A 1G6YA 3SWLA 1TK0B 5HFIA 4BL7A 4Q5FA 1O81A 2VUPA 3EMXA 1K0BA 4POLA 2MMZA 1N8JA 2IMKA 1FO5A 3UOMA 1BG5A 1Q4JA 1E6BA 3EVIA 1QK8A 3DD3A 4MJAA 3HJPA 1FAAA 3TJGA 4L5LA 4WR4A 2GS3A 4N11A 3APOA 2FWFA 1HNCA 1C72A 5IMFA 1EGRA 3ZLPA 2FWGA 3UVTA 2HSYA 2R4VA 2WDUA 1B4QA 1SKRB 1I5GA 2QKEA 3CYNA 2VOCA 3J7Yk 4BVXA 4HUAA 1YF1A 3IDVA 4F03A 5IO0A 16GSA 2P31A 4LLRA 3D21A 4MJBA 4XIHA 2JU5A 2Z9SA 2LKUA 1G6WA 2I4AA 3I43A 3EC3A 2IPAA 3TRQA 2HZEB 1A8YA 3RDWA 4HJMA 1V40A 2H01A 3DIEA 3ZYWA 4KDXA 2OJLA 4J57E 4PUFC 4N10A 1PN9A 3IK7A 4LMWA 4I6XA 1K0CA 4KA0A 1MD4A 5DDLA 2H6XA 3KD0A 3ZREA 1A23A 1U87A 5ELGA 3IPZA 5KN3A 1ERTA 1TK8B 5JCUA 2LUSA 2FNOA 5COHA 5D96A 2K8SA 3HZ4A 2XC2A 4HI7A 2JACA 4GSNA 4GQCA 1V9WA 1T00A 3HZ8A 3GHAA 1JLWA 2A2SA 6GSVA 4JE1A 2VIMA 5JWOB 2F3MA 5D9WA 2WCIA 1A24A 2H73A 3TKRA 4L8EA 1SYXA 3ERWA 2PVOC 4IBPA 2H72A 1G0TA 3F4TA 1ZL9A 2NVLA 3LSZA 1O8XA 4NAXA 4PGTA 4XS4A 2FY6A 2DLXA 3GRXA 1K3OA 3GA4A 1OE8A 3VI7A 4NV2A 2HLSA 1PX6A 4MMMA 2E2MA 1QQ2A 2IFQA 1GUHA 4EDYA 3ZIVA 6GSUA 3MDKA 1XXUA 3GKXA 1YZXA 2QSIA 4YQUA 5IMDA 1TOFA 2P5QA 4IVFA 5ECKB 2R5GA 1THOA 1OC8A 5HFKA 2WJUA 5IOWA 1SD8A 4PNFA 2LRCA 2VCTA 3FRCA 1SK0A 1FOVA 5HFGA 2YOIA 1X9WB 3L9VA 5IO2A 5DAKA 2LQQA 4V2NA 5ABRA 3KH7A 2HE3A 4KF9A 4ZIJA 5F05A 4AF2A 4JZQA 1AQVA 2OBIA 1M2DA 2HSMB 1VGLA 1MDJA 2EIRA 2LS5A 1A0FA 1WMJA 2HNLA 3ZITA 4RI6A 4I5QA 1BYEA 4HQSA 1UA5A 4TW5A 3CTGA 2VCVA 3D5JA 3WGDA 3CXGA 3RPNA 2VD1A 3GSTA 1ERUA 4GWRA 1N2AA 2JL4A 2DJKA 2I3YA 1JFUA 3QDNA 2ZCTA 2PUKC 1GUMA 5B6NA 3DKSA 4J56E 4ZBBA 3U6VA 1RK4A 1FHEA 2AHEA 3RHBA 1SKSB 2B7KA 3FR3A 2MBTA 3HVSA 2CVDA 1U6TA 5ECRB 5G5EA 1W89A 3BD2A 3ZRDA 5H5QA 4ACSA 2VLUA 1JZWA 2ON5A 4CHSA 2C1YA 2L5OA 1CQGA 4I2UA 4IW9A 4EUYA 3GL3A 3FZ5A 2X99A 1FB6A 3TOUA 1XWGA 1F6MC 1YEXA 3L9UA 5FHIA 3GYKA 3AY8A 3O6TA 5HQPA 4KSOA 4TR1A 3KCMA 2R37A 4HDEA 1GTBA 2C3TA 2HRKB 2DIYA 3FZ9A 5ID2A 5CREA 2KUCA 5J41A 5CNWA 5B8AA 2RUEA 5DVBA 3PR8A 2A4VA 5F07A 4DSQA 2WULA 5HR3A 4X43A 1BAYA 1R5PA 2CZ3A 1ST9A 1CQHA 3O3TA 3RPPA 4X0XA 1TI3A 4LL4B 2DJ1A 4MZCA 3UJ1A 3VWWA 4TKYA 1GSYA 11GSA 1YKAA 1BX9A 1GLQA 1PMTA 3VWXA 1H75A 2RUFA 2YZUA 5J9BA 1AW9A 3LXTA 3I6AA 5CRGA 4X1UA 5G1LA 3F0IA 1Z9HA 5LNKe 9GSSA 4G0IA 2O87A 2WFCA 4MH3A 5CRDA 3UARA 1Z6MA 4V2LA 5G30A 2O89A 4USSA 2CAQA 2HT9A 1EEJA 3FHKA 1ZMAA 1B8XA 4PTSA 2DJ2A 2IMDA 1XVWA 1BJXA 4KDUA 5IMVA 3LYKA 2FA8A 1WE0A 3L9SA 2D2ZA 1A8LA 2J23A 1WPIA 1ON4A 5G1KA 2IWTA 5B7CA 3D22A 1TI1A 1A2JA 3KMOA 3N9JA 3N5OA 2YV9A 3DGQA 1LJRA 3RHCA 4L5OA 2MZCA 2K9FA 3JCML 2JZSA 2V6OA 4FYUA 4IS0A 2C0DA 4OFNA 3A5WA 1TKDB 5CO3A 3M9JA 2FUG2 1ZYQB 2CT6A 5DBQA 4MA9A 1YKCA 3QFBC 5ECNB 4G10A 5DALB 1T3BA 3L78A 4V1Ag 3G7IA 2R3XA 4JEDA 2GQKA 2NPBA 3UL3A 3Q74A 2OADA 2DJ0A 6GSXA 4POBA 2DIZA 3D4TA 1MDIA 3LFLA 4TXVA 2YV7A 3WGXA 2E2GA 1ZGNA 2VL2C 5IMAA 5IPHA 3GN3A 2L57A 3IAM2 3APSA 4TR4A 3D0ZA 3HVVA 3A2WA 4FIWA 1NHYA 2VAFA 3H8QA 3P90A 4KH7A 4N0ZA 4BL7B 2AUVA 3TJKA 3E3EA 4TOPA 4IQ1A 2X8GA 2FLSA 4WEYA 1USBA 4GSTA 4J2FA 2C3QA 6GSWA 3TJJA 3EWLA 1M9AA 3OR5A 1HD2A 2H19A 5FT3A 3ERGA 4NMUA 3LJRA 2C0GA 2OE1A 1WP0A 3ISOA 3BCKA 5INYA 2I9HA 3ME8A 5G5FA 4ZB9A 4DEJA 1O73A 3LYPA 4FQUA 4BVXB 2HI7A 2V41A 4ZL9A 3EMPA 22GSA 1PQNA 2H74A 2QC7A 2YANA 1Z3EA 2L6CA 2LEGA 3PINA 4K1FA 3E0UA 4OWYA 1TU7A 4KDYA 3DEXA 1ZYEA 4QQ7A 1FB0A 3C1RA 4TVEA 3BOAA 1AUCA 2GSSA 1O6JA 4AJ6A 2YN1A 4G2EA 5D9XA 1ZCPA 4FYBA 3G7YA 4Z7XA 2YPMA 1ML6A 1T4ZA 1GNWA 3TJBA 4F0CA 2CA8A 1DUGA 2IN3A 3HVXA 3QR6A 1SU9A 4G19A 2PU9C 1KNGA 4ILFA 4K0GA 1HYUA 2XBIA 5C00A 5ECLB 4ZILA 5F06A 2FA4A 3MSZA 4MF5A 4D73A 4IHUA 4GF0A 2MBSA 4OO5A 4TRXA 1TXXA 2RLIA 3TKSC 2K8VA 1F37A 1K0OA 4I2TA 3ZIJA 3IAS2 3LORA 5IOXA 2HRNA 3WT1A 5D73A 1M2AA 1Z6NA 4KAEA 2YZHA 4XRAA 4MLYA 2FWHA 1V58A 3IXRA 3F6DA 1HNBA 4MPFA 1EEMA 4XS4B 3L4NA 1M2BA 3EE2A 3GTUA 3M9KA 3VLNA 3HA9A 5JCWA 4EDZA 5CRHA 2H71A 2VCWA 4OCEA 4IP1A 1OC9A 1YQ1A 1J08A 1F3AA 1OAZA 1WJKA 2VCQA 3GX0A 5A4UA 4P3YB 3GNJA 4OD7A 2IFQB 2HXKA 1SJIA 3KXOA 3F6FA 3IOSA 4K7NA 4K7OA 2CX3A 1TDIA 4N30A 2XBQA 2IL3A 1DSBA 1Q98A 4HOJA 1T4YA 1GTIA 2EC4A 2GZYA 3IC4A 4HJ2A 3ZMLA 2WZ9A 5ECIB 1K0AA 1TRSA 5DAKB 4KNDA 1WRYA 2V32A 2O7KA 1EWXA 3C1SA 4O7HA 2FWEA 2C8UA 1GWCA 5AIXA 2BMXA 3TJFA 3IC8A 1JLVA 1TRWA 1EP8A 1FVJA 2GQLA 2AJQB 2L59A 4JR6A 1R7HA 2HSNB 4JRRA 2NDOA 2DBCA 4HS1A 1A0RP 1AC1A 1JZDA 4K9ZA 3IV4A 1VF3A 2REMA 2CZ2A 2H1DA 3LXZA 18GSA 1HQOA 3LWAA 2MMOA 5L71A 2H30A 5G31A 4OFMA 3ZTLA 3QCPA 3P2AA 1M7TA 4CDOA 1PKWA 4ML6A 4AJ7A 4G0KA 3QAGA 4ID0A 4EO3A 4Q5RA 4JBBA 1V57A 5DQYA 3W6GA 4HZ4A 5A4VA 2JSYA 2C80A 4BWQA 4L0UA 4KCAA 5GZZB 2OBKA 4KW6A 1A2MA 4QL9A 2L6DA 4K6XA 3ZL5A 1E2YA 5A5KA 5IIZA 1O8WA 2KLXA 3FKFA 4I8BA 4IJIA 4TXOA 2B5EA 3FK8A 1B4PA 4TR1B 1THXA 1ACVA 1M99A 1WIKA 3MNGA 1QGVA 4YQVA 2YJ7A 1KBNA 5ID2B 4YH2A 2GLRA 4ZBAA 3FZAA 3EINA 3F9UA 1GP1A 4IJ3A 1X9MB 2WRTA 1PA3A 5H5SA 5GSSA 4MF7A 2MMNA 3ZFLA 1GL8A 3F63A 5ECQB 3H1NA 2TRCP 3C73A 4EKZA 3PGTA 1PKZA 4Q5QA 5CRWA 2PBJA 5J5NA 2PVQA 4EF0A 2OKAA 1PGTA 3G9BA 1QFNA 2OACA 4PX1A 2DSAA 3F4RA 3ERFA 4KB3A 5CAXA 4MK3A 1XW6A 2H0IA 1XW5A 1SENA 4OFTA 4Q5NA 1TRUA 3ZMKA 1S3AA 1TTZA 3F3RA 3K8NA 2YCDA 4GSSA 2RM5A 4WXTA 5ENUA 5IQYA 5J3RA 1S3DA 3DMLA 1UN2A 1XOAA 1SL2B 5ECMB 3VURA 1XWKA 5EL8A 1MEKA 3ME7A 3KM6A
chains in the Genus database with same CATH superfamily
1K3LA 3H79A 2HZFA 3TDGA 1F9MA 1M0UA 2YWOA 4O5RA 2VL3A 2IMFA 1OVNA 3L0HA 2WGRA 2L4CA 2M80A 1XFLA 1S3CA 5EPFA 3I69A 4TR0A 5D8IA 4HZ2A 2EIQA 2N5BA 1XZOA 1DBYA 3CBUA 1K3YA 5LD0A 1V2AA 2VM1A 5IMCA 2FHEA 4DSSA 3VWVA 2DKIA 5A5HA 1AIUA 2TRXA 4PQIA 1JZOA 3UBLA 1NM3A 2ES7A 5LCZA 3C7MA 4E8HA 5D9VA 2H1BA 3HKRA 2JSZA 1A2LA 3ZZXA 4QL7A 1TU8A 1VF2A 3GV1A 2P0GA 2G0FA 2PERA 1SYRA 1PL2A 4GCIA 2H0GA 5E59A 2H66A 3TGZA 5DCHA 2ZNMA 3GFKA 4HEA2 1LBKA 2V2GA 2JADA 1DE2A 3Q19A 4WBRD 4FYCA 3KTLA 3HJMA 1XWBA 4ZB6A 1O7UA 2EIOA 2XPDA 1MTCA 1T7PB 2C4JA 2R0GA 1WWJA 4BIKA 4XTSA 3HY2A 2VL9A 4O32A 2VD0A 4G01A 5H5RA 4O92A 2GT5A 3KMNA 2QGVA 1ZYPA 5B6MA 5DJLA 3NIVA 4KX4A 5J40A 5HR1A 1GSEA 6GSSA 3UMAA 3M3MA 4GLTA 2L5LA 4ZL7A 3IE3A 1U88A 1T8EB 2FCHA 1YEPA 1TP9A 2VL2A 2I1UA 1X5DA 1GSQA 3MIXA 4POKA 2DKHA 4PURA 3HD5A 3P7XA 1B48A 3EU3A 4PXOA 1VF4A 3GX8A 5A1NB 4JR4A 1IYHA 2H6ZA 4LA1A 2IMIA 10GSA 5HR0A 4ECBA 4FXYP 2WW3A 4ECIA 5JWQB 4HQZA 3TRPA 2F8AA 5KN0A 5GSTA 3E9JB 3C71A 3IBHA 5CP1A 3GH9A 1PD21 2DJJA 3KH9A 2J9HA 1JZRA 3CWGA 3CTFA 2A2RA 2GSTA 4BVYA 4DVCA 5E4WA 3KJYA 1SJZA 4MH2A 1ZOFA 2IMEA 3Q6OA 3M1GA 2DJ3A 4HU7A 3GL5A 1S4BP 3WYWA 2LNSA 2HQTA 3FR9A 3DWVA 6GSTA 1ERVA 5B8BA 2YWMA 2VO4A 3U5RE 4MF6A 3KZQA 1NSWA 1ERWA 2F9SA 2H6YA 1J9BA 4MCUA 5BMUA 1ZZYA 2WS2A 4IELA 2OA7A 2XHFA 1XVQA 4RQRA 5KN2A 1O85A 3W8JA 2ZUPA 8GSSA 4GXZA 2EFEA 4KSMA 4D73B 5KEJA 1XW9A 3DVWA 3NOFA 2GT6A 2F51A 4KGIA 2LQOA 4CW9A 1M9BA 1LU4A 2LRNA 2M72A 2B6MA 4TN8A 4IN0A 5KN1A 1X9SB 20GSA 2YWIA 1IYIA 5ECSA 2B1KA 1Y6EA 1WOUA 1B9YC 3KP9A 3LEFA 3P8WA 2JZRA 4RQXA 3GTUB 4WETA 5IMZA 5JCGA 3QPMA 1QMVA 2BTOT 1ABAA 5EY6A 3PH9A 3CRUA 1OC9B 1XCCA 2O85A 1RW1A 3TKSE 3HJOA 2AAWA 1JHBA 2B7JA 1FVKA 4N0VA 1X5CA 1EZKA 1SL0B 2GGTA 3UEMA 5J4UA 1YDKA 2H1GA 5AGYA 5BRTA 12GSA 3RBTA 3US3A 1Z5YE 3ED3A 3TKSA 2C0FA 4F82A 1BQ7A 1TW9A 2DMMA 2CX4A 1OE7A 3M0FA 3GIXA 4WKWA 2PPTA 2RIIA 5AIVA 4GRFA 3TKPA 1PSQA 4BPYA 3CSHA 2H8LA 2GSQA 2GSRA 1PX7A 1KTEA 5F0GA 2LTKA 4ML1A 3IK9A 1AQXA 1UC7A 2EFDA 3QOUA 4MP4A 2CVKA 1SD9A 2NTOA 1SJ6A 3IHQA 4W66A 4F0BA 2VLVA 3FR6A 1RQMA 3O76A 3GKMA 1GSDA 1XBSA 1SK1A 2WB9A 1OKTA 2V6KA 3ZFBA 3ZVJA 4FO5A 5F8BA 2HRAA 1F3BA 3GH6A 2B1LA 4WF5A 1SK2A 1DE1A 2ALBA 1Z7RA 4ECCA 1SVLA 2E0QA 2LJKA 2HZEA 2LJRA 3FZ4A 1BEDA 1W4VA 2PWJA 1R4WA 1ILOA 4KCEA 1YJ6A 3DRNA 3VPTA 1EP7A 3KIJA 1OC3A 2DMLA 1UVZA 2CAIA 5DCGA 2M46A 1GLPA 5GAPD 4PQ1A 2LSTA 3QD9A 4F2IA 7GSSA 2C0EA 4XS1A 1EOGA 2YP6A 5J9CA 1SKWB 5IM9A 1QUWA 4TXOB 4POMA 3EU4A 1BG1A 2KP1A 2AV4A 4YKFA 1FW1A 2O36A 3TUEA 3H93A 3QMXA 3DYRA 2VLTA 1AQWA 4NHWA 3EYTA 1S3RA 4NWYA 2FD3A 4IKHA 5A34B 1TJDA 2R6KA 3TKQA 3UBKA 1Y25A 2CV4A 1NW2A 1GULA 4EL1A 2R2JA 3Q18A 2K18A 4IP6A 5EVOA 2PN8A 1XPVA 3SBCA 2XPEA 5DQSA 4IGJA 1K0DA 2HFDA 2F8FA 3CSIA 3R2QA 2IIYA 2MYGA 4RUVA 2EFHA 1H4OA 1EGOA 3FY7A 1PL1A 4K7IA 4EE0A 2FGXA 1XOBA 2GZZA 1G7EA 4GTUA 1GH2A 1GUKA 4YQMA 1FG4A 4G0LA 1TXUA 3GURA 2HYXA 3NZNA 2LJAA 1TK5B 1XIYA 13GSA 2CVBA 1F2EA 4ZL8A 3IR4A 4V1Ap 3MWHA 3LQ7A 3HDCA 3KEBA 3TCOA 5HR2A 4RI7A 5GAND 2RM6A 3BCIA 3HHVA 2DC5A 1SL1B 2KOKA 3GKNA 3WT2A 1K0NA 4MPGA 2H76A 2OE0A 1B9XC 4GQFA 3D4MA 4MZBA 2N5AA 1GTUA 1Y1UA 4K0NA 1V98A 3BJ5A 4EC0A 3UVHA 2GZPA 2GVPA 1XG8A 3TRXA 3VK9A 2HSMA 2LRTA 4K5RA 1I9DA 3TOTA 4XHMA 4DSSB 2KHPA 3HXSA 3QAVA 1NHOA 2OE3A 4YAPA 5A5HB 2A4HA 4F9ZA 3ZVJD 4Z2RA 1MD3A 3BBYA 2K6VA 2L4QA 2CQ9A 1ZYNA 4ICYA 2X8CA 2H75A 4YAVA 4ISDA 1K0MA 2VKZG 4G9HA 2KP2A 2G2QA 4MDCA 4BWSA 3QAWA 3KP8A 3VI5A 1X0RA 4WR5A 3GMFA 3HYPA 1M3JA 4K8MA 3FEUA 4H86A 4V2MA 3GKKA 1GRXA 5JWRB 1OYJA 17GSA 4PQHA 3I9V2 4AJ8A 3MAKA 4PNGA 4YKGA 3VWUA 5DJMA 2LV3A 1GSSA 4I97A 19GSA 2GQMA 2IJYA 3A2XA 2X4AA 5KOWA 2PMTA 4KUNA 2YNXA 2JZTA 3D6IA 4OCFA 5CYYA 4AKIA 1GSFA 2GTUA 3HCZA 2YJHA 4TR3A 4JU5A 2X8HA 3GUSA 4WBJA 4DSRA 1EOHA 3RGBC 2HRKA 4NHZA 3DVXA 3KTBA 2NBSA 3FW2A 4Z2TA 4MJEA 4NV5A 4ZBDA 5IPGA 3CSJA 1YF0A 4OMVA 1QXHA 4WF4A 5KOXA 2HSHA 4MNNA 4OO4A 4AGSA 4EXJA 2BJXA 3F8UA 1PRXA 1AXDA 4IQAA 3LG6A 4XS6A 5AISA 3J7Yb 3CMIA 5G2ZA 3TB2A 4PUAA 4NPBA 1URMA 3UAPA 1M3IA 3KGKA 4AI6A 4LMVA 4O5QA 3QFAC 1VF1A 3PPUA 2P5RA 4FH8A 4XRDA 4ULXA 4BVYB 2HRFA 2VCXA 4EVMA 3F4SA 3RAZA 3LGCA 3DXBA 4BA7A 1J0FA 1R26A 2PGTA 4MJCA 2O3EA 5ELAA 5FWGA 5ECPB 3UIWA 4ZB8A 2E7PA 1SVMA 2VCZA 5AN1A 2YWNA 5BMUB 1TRVA 2UZ8A 3R3EA 5D93A 5ECOB 3RFRC 1X5EA 2AB6A 1KEBA 3H4KA 5D9TA 3GSSA 2N5FA 2V1MA 5C04A 2MMAA 1GSUA 4EIPA 4NXIA 1U3IA 3S9FA 2B5YA 1XWAA 1VRSD 2H70A 2UV8G 3FYGA 1EV4A 2LNTA 4KE3A 2H1AA 1T1VA 2GDRA 3C8EA 4HU9A 5ECHB 3EURA 2C3NA 2WVZA 3F3QA 4XCSA 4L0WA 3VPQA 3A3TA 2B3SA 2X64A 3CRTA 5DALA 3APQA 1OKDA 2H0HA 4ECJA 3A2VA 3W8SA 1U3AA 3IA1A 3WD6A 3VFIA 4X4JA 3IRAA 2TIRA 3V1WA 4K2DA 3G7JA 2I81A 3M8NA 14GSA 3WGEA 4MZWA 2ON7A 2O8VB 4ZXGA 1GNEA 1Z7PA 2B5XA 1XWCA 1GTAA 3IHGA 1EV9A 1R5AA 1HNAA 6GSYA 1AAZA 4E8EA 1MDKA 2AYTA 4MABA 1YY7A 1G7OA 4LL1B 5A4WA 2VM2A 1G6YA 3SWLA 1TK0B 5HFIA 4BL7A 4Q5FA 1O81A 2VUPA 3EMXA 2WZSA 1K0BA 4POLA 2MMZA 1N8JA 2IMKA 1FO5A 3UOMA 1BG5A 1Q4JA 1E6BA 3EVIA 1QK8A 3DD3A 4MJAA 3HJPA 1FAAA 3TJGA 4L5LA 4WR4A 2GS3A 4N11A 2QA2A 3APOA 2FWFA 1HNCA 1C72A 5IMFA 1EGRA 3ZLPA 2FWGA 3UVTA 2HSYA 2R4VA 2WDUA 2QA1A 1B4QA 1SKRB 1I5GA 2QKEA 3CYNA 2VOCA 3J7Yk 4BVXA 4HUAA 1YF1A 3IDVA 4F03A 5IO0A 16GSA 2P31A 4LLRA 3D21A 4MJBA 4XIHA 2JU5A 2Z9SA 2LKUA 1G6WA 2I4AA 3I43A 3EC3A 2IPAA 3TRQA 2HZEB 1A8YA 3RDWA 4HJMA 1V40A 2H01A 3DIEA 3ZYWA 4KDXA 2OJLA 4J57E 4K5SA 4PUFC 4N10A 1PN9A 3IK7A 4LMWA 4I6XA 1K0CA 4KA0A 1MD4A 5DDLA 4AKHA 2H6XA 3KD0A 3ZREA 1A23A 1U87A 4PI2C 5ELGA 3IPZA 5KN3A 1ERTA 1TK8B 5JCUA 2LUSA 2FNOA 5COHA 5D96A 2K8SA 3HZ4A 2XC2A 4HI7A 2JACA 4GSNA 4GQCA 1V9WA 1T00A 3HZ8A 3GHAA 1JLWA 2A2SA 6GSVA 4JE1A 2VIMA 5JWOB 2F3MA 5D9WA 2WCIA 1A24A 3HMJG 2H73A 3TKRA 4L8EA 1SYXA 3ERWA 2PVOC 4IBPA 2H72A 1G0TA 3F4TA 1ZL9A 2NVLA 3LSZA 1O8XA 4NAXA 4PGTA 4XS4A 2FY6A 2DLXA 4CY6A 3GRXA 1K3OA 3GA4A 1OE8A 3VI7A 4NV2A 2HLSA 1PX6A 4MMMA 2E2MA 1QQ2A 2IFQA 1GUHA 1FOHA 4EDYA 3ZIVA 6GSUA 3MDKA 1XXUA 1PFOA 3GKXA 1YZXA 2QSIA 4YQUA 5IMDA 1TOFA 2P5QA 4IVFA 5ECKB 2R5GA 1THOA 1OC8A 5HFKA 2WJUA 5IOWA 1SD8A 4PNFA 2LRCA 2VCTA 3FRCA 1SK0A 1FOVA 5HFGA 2YOIA 1X9WB 3L9VA 5IO2A 5DAKA 2LQQA 4V2NA 5ABRA 3KH7A 2HE3A 4KF9A 4ZIJA 5F05A 4AF2A 4JZQA 1AQVA 2OBIA 1M2DA 2HSMB 1VGLA 1MDJA 2EIRA 2LS5A 1A0FA 1WMJA 2HNLA 3ZITA 4RI6A 4I5QA 1BYEA 4HQSA 1UA5A 2HSNA 1I1IP 4TW5A 3CTGA 2VCVA 3D5JA 3WGDA 3CXGA 3RPNA 2VD1A 3GSTA 1ERUA 4GWRA 1N2AA 2JL4A 2DJKA 2I3YA 1JFUA 3QDNA 2ZCTA 2PUKC 1GUMA 5B6NA 3DKSA 4J56E 4ZBBA 3U6VA 3EPTA 1RK4A 1FHEA 2AHEA 3RHBA 1SKSB 2B7KA 3FR3A 2MBTA 3HVSA 2CVDA 5J4VA 5J4YA 1N25A 1U6TA 5ECRB 5G5EA 4O5UA 1W89A 3BD2A 3ZRDA 5H5QA 4ACSA 2VLUA 1JZWA 4N3ZA 2ON5A 4CHSA 2C1YA 2L5OA 1CQGA 4I2UA 4IW9A 4EUYA 3A5IA 3GL3A 3FZ5A 2X99A 1FB6A 3TOUA 1XWGA 2WVXA 4ZB7A 1F6MC 2X49A 1YEXA 3L9UA 5FHIA 3GYKA 3AY8A 3O6TA 5HQPA 4KSOA 4TR1A 3KCMA 2R37A 4HDEA 1GTBA 2C3TA 2HRKB 2DIYA 3FZ9A 4EIQA 5ID2A 5CREA 2KUCA 5J41A 5CNWA 5B8AA 2RUEA 4K2XA 5DVBA 3PR8A 2A4VA 5F07A 4DSQA 2WULA 5HR3A 4X43A 1BAYA 1R5PA 2CZ3A 1ST9A 3FMWA 1CQHA 3O3TA 3RPPA 4X0XA 1TI3A 4AKXB 4LL4B 2H1LA 2DJ1A 4MZCA 3UJ1A 3VWWA 4TKYA 1GSYA 11GSA 1YKAA 1BX9A 1GLQA 1PMTA 3VWXA 1H75A 2RUFA 2YZUA 5J9BA 1AW9A 3LXTA 3I6AA 5CRGA 4X1UA 5G1LA 3F0IA 1Z9HA 5LNKe 9GSSA 4G0IA 2O87A 2WFCA 4MH3A 5CRDA 3UARA 1Z6MA 4V2LA 5G30A 2O89A 4USSA 2CAQA 2R0PA 4PHZC 2HT9A 1EEJA 3FHKA 1ZMAA 3TU3B 1B8XA 4PTSA 2DJ2A 2IMDA 1XVWA 1BJXA 4KDUA 5IMVA 3LYKA 2FA8A 1WE0A 3L9SA 2D2ZA 1A8LA 2J23A 1WPIA 1ON4A 5G1KA 2IWTA 5B7CA 3D22A 1TI1A 1A2JA 3MYDA 3KMOA 4CY8A 3N9JA 3N5OA 2YV9A 3DGQA 1LJRA 3RHCA 4L5OA 2MZCA 2K9FA 3JCML 2JZSA 2V6OA 2WVYA 4FYUA 4IS0A 4A5PA 2C0DA 4OFNA 3A5WA 1TKDB 5CO3A 3M9JA 2FUG2 1ZYQB 2CT6A 1SVOA 5DBQA 4MA9A 1YKCA 3QFBC 5ECNB 4G10A 5DALB 1T3BA 3L78A 4V1Ag 3G7IA 2R3XA 4JEDA 2GQKA 3LW9A 2NPBA 3UL3A 2OADA 3Q74A 2DJ0A 6GSXA 4POBA 2DIZA 3D4TA 1MDIA 3LFLA 4TXVA 2YV7A 3WGXA 2E2GA 1ZGNA 2VL2C 5IMAA 5IPHA 3GN3A 4HSCX 2L57A 3IAM2 3APSA 4TR4A 3D0ZA 3HVVA 3A2WA 4FIWA 1NHYA 2VAFA 3H8QA 3P90A 4KH7A 4N0ZA 4BL7B 2AUVA 3TJKA 3E3EA 4TOPA 4IQ1A 2X8GA 2FLSA 4WEYA 1USBA 4GSTA 4J2FA 2C3QA 6GSWA 3TJJA 1PN0A 3EWLA 1M9AA 5J47A 3OR5A 1HD2A 1YVLA 2H19A 5FT3A 3ERGA 4NMUA 3LJRA 2C0GA 2OE1A 1WP0A 3ISOA 3BCKA 5INYA 2I9HA 3ME8A 5G5FA 4ZB9A 4DEJA 1O73A 3LYPA 4FQUA 1BF5A 4BVXB 2HI7A 2V41A 4ZL9A 3EMPA 22GSA 1PQNA 2H74A 5A1NA 3CQFA 2QC7A 2YANA 1Z3EA 2L6CA 4E68A 2LEGA 3PINA 4K1FA 3E0UA 4OWYA 1TU7A 4KDYA 3DEXA 1ZYEA 4QQ7A 1FB0A 3C1RA 4TVEA 3BOAA 1AUCA 2GSSA 1O6JA 4AJ6A 2YN1A 4G2EA 5D9XA 1ZCPA 4FYBA 3G7YA 4Z7XA 2YPMA 1ML6A 1T4ZA 4Z2UA 1GNWA 3TJBA 4F0CA 2CA8A 1DUGA 2IN3A 3HVXA 3QR6A 1SU9A 4G19A 2PU9C 1KNGA 4ILFA 4K0GA 1HYUA 2XBIA 5C00A 5ECLB 4ZILA 5F06A 2FA4A 3MSZA 4MF5A 4D73A 4IHUA 4GF0A 2MBSA 4OO5A 4TRXA 1TXXA 2RLIA 3TKSC 2K8VA 1F37A 1K0OA 4I2TA 3ZIJA 3IAS2 3LORA 5IOXA 2HRNA 3WT1A 5D73A 1M2AA 1Z6NA 4KAEA 2YZHA 4XRAA 4MLYA 2FWHA 1V58A 3IXRA 3F6DA 1HNBA 4MPFA 1EEMA 4XS4B 3L4NA 1M2BA 3EE2A 3GTUA 3M9KA 4PI0C 3VLNA 3HA9A 5JCWA 4EDZA 5CRHA 2H71A 2VCWA 4OCEA 4IP1A 1OC9A 1YQ1A 1J08A 1F3AA 1OAZA 1WJKA 2VCQA 3GX0A 5A4UA 4P3YB 3GNJA 4OD7A 2IFQB 2HXKA 1SJIA 3KXOA 3F6FA 3CHXC 3IOSA 4K7NA 4K7OA 2CX3A 1TDIA 4N30A 2XBQA 2IL3A 2WW1A 1DSBA 1Q98A 4HOJA 1T4YA 1GTIA 2EC4A 2GZYA 3IC4A 4HJ2A 3ZMLA 2WZ9A 5ECIB 1K0AA 1TRSA 5DAKB 4KNDA 1WRYA 2V32A 2O7KA 1EWXA 3C1SA 4O7HA 2FWEA 2C8UA 1GWCA 5AIXA 4AKGA 2BMXA 3TJFA 3IC8A 1JLVA 1TRWA 4QMKA 1EP8A 1FVJA 2GQLA 2AJQB 2L59A 4JR6A 1R7HA 2HSNB 2R0CA 4JRRA 2NDOA 2DBCA 4HS1A 1A0RP 1AC1A 1JZDA 4K9ZA 3IV4A 1VF3A 2REMA 2CZ2A 2H1DA 3LXZA 18GSA 1HQOA 3LWAA 2MMOA 5L71A 2H30A 5G31A 4OFMA 3ZTLA 3QCPA 3P2AA 1M7TA 4CDOA 1PKWA 4ML6A 4AJ7A 4G0KA 3QAGA 4ID0A 4EO3A 4Q5RA 4JBBA 1V57A 5DQYA 3W6GA 2OT3A 4HZ4A 5A4VA 4GDFA 2JSYA 2C80A 4BWQA 4L0UA 4KCAA 5GZZB 2OBKA 4KW6A 1A2MA 4QL9A 2L6DA 4K6XA 3ZL5A 1E2YA 5A5KA 5IIZA 1O8WA 2KLXA 3FKFA 2WVXB 4I8BA 4IJIA 4TXOA 2B5EA 3FK8A 1B4PA 4TR1B 1THXA 1ACVA 1M99A 1WIKA 3MNGA 1QGVA 4YQVA 2YJ7A 1KBNA 5ID2B 4YH2A 2GLRA 4ZBAA 3FZAA 5A34A 3EINA 3F9UA 1GP1A 4IJ3A 1X9MB 2WRTA 1PA3A 5H5SA 5GSSA 4MF7A 2MMNA 3ZFLA 1GL8A 3F63A 5ECQB 3H1NA 2TRCP 3C73A 4EKZA 3PGTA 1PKZA 4Q5QA 5CRWA 2PBJA 5J5NA 2PVQA 4EF0A 2OKAA 1PGTA 3G9BA 1QFNA 2OACA 4PX1A 2DSAA 3F4RA 3ERFA 4KB3A 5CAXA 4MK3A 1XW6A 2H0IA 2A2PA 1XW5A 2O5VA 3HVNA 1SENA 4OFTA 4Q5NA 1TRUA 3ZMKA 1S3AA 1TTZA 3F3RA 3K8NA 2WW0A 2YCDA 4GSSA 2RM5A 4WXTA 5ENUA 5IQYA 5J3RA 1S3DA 3DMLA 1UN2A 1XOAA 1SL2B 5ECMB 2WW2A 3VURA 1XWKA 1YEWC 5EL8A 2EFCA 1MEKA 3ME7A 3KM6A
chains in the Genus database with same CATH topology
1K3LA 3H79A 2HZFA 3TDGA 1F9MA 1M0UA 2YWOA 4O5RA 2VL3A 2IMFA 1OVNA 3L0HA 2WGRA 2L4CA 2M80A 1XFLA 1S3CA 5EPFA 3I69A 4TR0A 5D8IA 4HZ2A 2EIQA 2N5BA 1XZOA 1DBYA 3CBUA 1K3YA 5LD0A 1V2AA 2VM1A 5IMCA 2FHEA 4DSSA 3VWVA 2DKIA 5A5HA 1AIUA 2TRXA 4PQIA 1JZOA 3UBLA 1NM3A 2ES7A 5LCZA 3C7MA 4E8HA 5D9VA 2H1BA 3HKRA 2JSZA 1A2LA 3ZZXA 4QL7A 1TU8A 1VF2A 3GV1A 2P0GA 2G0FA 2PERA 1SYRA 1PL2A 4GCIA 2H0GA 5E59A 2H66A 3TGZA 5DCHA 2ZNMA 3GFKA 4HEA2 1LBKA 2V2GA 2JADA 1DE2A 3Q19A 4WBRD 4FYCA 3KTLA 3HJMA 1XWBA 4ZB6A 1O7UA 2EIOA 2XPDA 1MTCA 1T7PB 2C4JA 2R0GA 1WWJA 4XTSA 3HY2A 2VL9A 4O32A 2VD0A 4G01A 5H5RA 4O92A 2GT5A 3KMNA 2QGVA 1ZYPA 5B6MA 5DJLA 3NIVA 4KX4A 5J40A 5HR1A 1GSEA 6GSSA 3UMAA 3M3MA 4GLTA 2L5LA 4ZL7A 3IE3A 1U88A 1T8EB 2FCHA 1YEPA 1TP9A 2VL2A 2I1UA 1X5DA 1GSQA 3MIXA 4POKA 2DKHA 4PURA 3HD5A 3P7XA 1B48A 3EU3A 4PXOA 1VF4A 3GX8A 5A1NB 4JR4A 1IYHA 2H6ZA 4LA1A 2IMIA 10GSA 5HR0A 4ECBA 4ECIA 5JWQB 4HQZA 3TRPA 2F8AA 5KN0A 5GSTA 3E9JB 3C71A 3IBHA 5CP1A 3GH9A 1PD21 2DJJA 3KH9A 2J9HA 1JZRA 3CWGA 3CTFA 2A2RA 2GSTA 4BVYA 4DVCA 5E4WA 3KJYA 1SJZA 4MH2A 1ZOFA 2IMEA 3Q6OA 3M1GA 2DJ3A 4HU7A 3GL5A 3WYWA 2LNSA 2HQTA 3FR9A 3DWVA 6GSTA 1ERVA 5B8BA 2YWMA 2VO4A 3U5RE 4MF6A 3KZQA 1NSWA 1ERWA 2F9SA 2H6YA 1J9BA 4MCUA 5BMUA 1ZZYA 2WS2A 4IELA 2OA7A 2XHFA 1XVQA 4RQRA 5KN2A 1O85A 3W8JA 2ZUPA 8GSSA 4GXZA 2EFEA 4KSMA 4D73B 5KEJA 1XW9A 3DVWA 3NOFA 2GT6A 2F51A 4KGIA 2LQOA 4CW9A 1M9BA 1LU4A 2LRNA 2M72A 2B6MA 4TN8A 4IN0A 5KN1A 1X9SB 20GSA 2YWIA 1IYIA 5ECSA 2B1KA 1Y6EA 1WOUA 1B9YC 3KP9A 3LEFA 3P8WA 2JZRA 4RQXA 3GTUB 4WETA 5IMZA 5JCGA 3QPMA 1QMVA 2BTOT 1ABAA 5EY6A 3PH9A 3CRUA 1OC9B 1XCCA 2O85A 1RW1A 3TKSE 3HJOA 2AAWA 1JHBA 2B7JA 1FVKA 4N0VA 1X5CA 1EZKA 1SL0B 2GGTA 3UEMA 5J4UA 1YDKA 2H1GA 5AGYA 5BRTA 12GSA 3RBTA 3US3A 1Z5YE 3ED3A 3TKSA 2C0FA 4F82A 1BQ7A 1TW9A 2DMMA 2CX4A 1OE7A 3M0FA 3GIXA 4WKWA 2PPTA 2RIIA 5AIVA 4GRFA 3TKPA 1PSQA 4BPYA 3CSHA 2H8LA 2GSQA 2GSRA 1PX7A 1KTEA 5F0GA 2LTKA 4ML1A 3IK9A 1AQXA 1UC7A 2EFDA 3QOUA 4MP4A 2CVKA 1SD9A 2NTOA 1SJ6A 3IHQA 4W66A 4F0BA 2VLVA 3FR6A 1RQMA 3O76A 3GKMA 1GSDA 1XBSA 1SK1A 2WB9A 1OKTA 2V6KA 3ZFBA 3ZVJA 4FO5A 5F8BA 2HRAA 1F3BA 3GH6A 2B1LA 4WF5A 1SK2A 1DE1A 2ALBA 1Z7RA 4ECCA 1SVLA 2E0QA 2LJKA 2HZEA 2LJRA 3FZ4A 1BEDA 1W4VA 2PWJA 1R4WA 1ILOA 4KCEA 1YJ6A 3DRNA 3VPTA 1EP7A 3KIJA 1OC3A 2DMLA 1UVZA 2CAIA 5DCGA 2M46A 1GLPA 5GAPD 4PQ1A 2LSTA 3QD9A 4F2IA 7GSSA 2C0EA 4XS1A 1EOGA 2YP6A 5J9CA 1SKWB 5IM9A 1QUWA 4TXOB 4POMA 3EU4A 1BG1A 2KP1A 2AV4A 4YKFA 1FW1A 3TUEA 3H93A 3QMXA 3DYRA 2VLTA 1AQWA 4NHWA 3EYTA 4NWYA 2FD3A 4IKHA 5A34B 1TJDA 2R6KA 3TKQA 3UBKA 1Y25A 2CV4A 1NW2A 1GULA 4EL1A 2R2JA 3Q18A 2K18A 4IP6A 5EVOA 2PN8A 1XPVA 3SBCA 2XPEA 5DQSA 4IGJA 1K0DA 2HFDA 2F8FA 3CSIA 3R2QA 2IIYA 2MYGA 4RUVA 2EFHA 1H4OA 1EGOA 3FY7A 1PL1A 4K7IA 4EE0A 2FGXA 1XOBA 2GZZA 1G7EA 4GTUA 1GH2A 1GUKA 4YQMA 1FG4A 4G0LA 1TXUA 3GURA 2HYXA 3NZNA 2LJAA 1TK5B 1XIYA 13GSA 2CVBA 1F2EA 4ZL8A 3IR4A 4V1Ap 3MWHA 3LQ7A 3HDCA 3KEBA 3TCOA 5HR2A 4RI7A 5GAND 2RM6A 3BCIA 3HHVA 2DC5A 1SL1B 2KOKA 3GKNA 3WT2A 1K0NA 4MPGA 2H76A 2OE0A 1B9XC 4GQFA 3D4MA 4MZBA 2N5AA 1GTUA 1Y1UA 4K0NA 1V98A 3BJ5A 4EC0A 3UVHA 2GZPA 2GVPA 3TRXA 3VK9A 2HSMA 2LRTA 4K5RA 1I9DA 3TOTA 4XHMA 4DSSB 2KHPA 3HXSA 3QAVA 1NHOA 2OE3A 4YAPA 5A5HB 2A4HA 4F9ZA 3ZVJD 4Z2RA 1MD3A 3BBYA 2K6VA 2L4QA 2CQ9A 1ZYNA 4ICYA 2X8CA 2H75A 4YAVA 4ISDA 1K0MA 2VKZG 4G9HA 2KP2A 2G2QA 4MDCA 4BWSA 3QAWA 3KP8A 3VI5A 1X0RA 4WR5A 3GMFA 3HYPA 4K8MA 3FEUA 4H86A 4V2MA 3GKKA 1GRXA 5JWRB 1OYJA 17GSA 4PQHA 3I9V2 4AJ8A 3MAKA 4PNGA 4YKGA 3VWUA 5DJMA 2LV3A 1GSSA 4I97A 19GSA 2GQMA 2IJYA 3A2XA 2X4AA 5KOWA 2PMTA 4KUNA 2YNXA 2JZTA 3D6IA 4OCFA 5CYYA 4AKIA 1GSFA 2GTUA 3HCZA 2YJHA 4TR3A 4JU5A 2X8HA 3GUSA 4WBJA 4DSRA 1EOHA 2HRKA 4NHZA 3DVXA 3KTBA 2NBSA 3FW2A 4Z2TA 4MJEA 4NV5A 4ZBDA 5IPGA 3CSJA 1YF0A 4OMVA 1QXHA 4WF4A 5KOXA 2HSHA 4MNNA 4OO4A 4AGSA 4EXJA 2BJXA 3F8UA 1PRXA 1AXDA 4IQAA 3LG6A 4XS6A 5AISA 3J7Yb 3CMIA 5G2ZA 3TB2A 4PUAA 4NPBA 1URMA 3UAPA 3KGKA 4AI6A 4LMVA 4O5QA 3QFAC 1VF1A 3PPUA 2P5RA 4FH8A 4XRDA 4ULXA 4BVYB 2HRFA 2VCXA 4EVMA 3F4SA 3RAZA 3LGCA 3DXBA 4BA7A 1J0FA 1R26A 2PGTA 4MJCA 5ELAA 5FWGA 5ECPB 3UIWA 4ZB8A 2E7PA 1SVMA 2VCZA 5AN1A 2YWNA 5BMUB 1TRVA 2UZ8A 3R3EA 5D93A 5ECOB 1X5EA 2AB6A 1KEBA 3H4KA 5D9TA 3GSSA 2N5FA 2V1MA 5C04A 2MMAA 1GSUA 4EIPA 4NXIA 1U3IA 3S9FA 2B5YA 1XWAA 1VRSD 2H70A 2UV8G 1EV4A 3FYGA 2LNTA 4KE3A 2H1AA 1T1VA 2GDRA 3C8EA 4HU9A 5ECHB 3EURA 2C3NA 3F3QA 4XCSA 4L0WA 3VPQA 3A3TA 2B3SA 2X64A 3CRTA 5DALA 3APQA 1OKDA 2H0HA 4ECJA 3A2VA 3W8SA 1U3AA 3IA1A 3WD6A 3VFIA 4X4JA 3IRAA 2TIRA 3V1WA 4K2DA 3G7JA 2I81A 3M8NA 14GSA 3WGEA 4MZWA 2ON7A 2O8VB 4ZXGA 1GNEA 1Z7PA 2B5XA 1XWCA 1GTAA 3IHGA 1EV9A 1R5AA 1HNAA 6GSYA 1AAZA 4E8EA 1MDKA 2AYTA 4MABA 1YY7A 1G7OA 4LL1B 5A4WA 2VM2A 1G6YA 3SWLA 1TK0B 5HFIA 4BL7A 4Q5FA 1O81A 2VUPA 3EMXA 1K0BA 4POLA 2MMZA 1N8JA 2IMKA 1FO5A 3UOMA 1BG5A 1Q4JA 1E6BA 3EVIA 1QK8A 3DD3A 4MJAA 3HJPA 1FAAA 3TJGA 4L5LA 4WR4A 2GS3A 4N11A 2QA2A 3APOA 2FWFA 1HNCA 1C72A 5IMFA 1EGRA 3ZLPA 2FWGA 3UVTA 2HSYA 2R4VA 2WDUA 2QA1A 1B4QA 1SKRB 1I5GA 2QKEA 3CYNA 2VOCA 3J7Yk 4BVXA 4HUAA 1YF1A 3IDVA 4F03A 5IO0A 16GSA 2P31A 4LLRA 3D21A 4MJBA 4XIHA 2JU5A 2Z9SA 2LKUA 1G6WA 2I4AA 3I43A 3EC3A 2IPAA 3TRQA 2HZEB 1A8YA 3RDWA 4HJMA 1V40A 2H01A 3DIEA 3ZYWA 4KDXA 2OJLA 4J57E 4K5SA 4PUFC 4N10A 1PN9A 3IK7A 4LMWA 4I6XA 1K0CA 4KA0A 1MD4A 5DDLA 4AKHA 2H6XA 3KD0A 3ZREA 1A23A 1U87A 5ELGA 3IPZA 5KN3A 1ERTA 1TK8B 5JCUA 2LUSA 2FNOA 5COHA 5D96A 2K8SA 3HZ4A 2XC2A 4HI7A 2JACA 4GSNA 4GQCA 1V9WA 1T00A 3HZ8A 3GHAA 1JLWA 2A2SA 6GSVA 4JE1A 2VIMA 5JWOB 2F3MA 5D9WA 2WCIA 1A24A 3HMJG 2H73A 3TKRA 4L8EA 1SYXA 3ERWA 2PVOC 4IBPA 2H72A 1G0TA 3F4TA 1ZL9A 2NVLA 3LSZA 1O8XA 4NAXA 4PGTA 4XS4A 2FY6A 2DLXA 4CY6A 3GRXA 1K3OA 3GA4A 1OE8A 3VI7A 4NV2A 2HLSA 1PX6A 4MMMA 2E2MA 1QQ2A 2IFQA 1GUHA 1FOHA 4EDYA 3ZIVA 6GSUA 3MDKA 1XXUA 3GKXA 1YZXA 2QSIA 4YQUA 5IMDA 1TOFA 2P5QA 4IVFA 5ECKB 2R5GA 1THOA 1OC8A 5HFKA 2WJUA 5IOWA 1SD8A 4PNFA 2LRCA 2VCTA 3FRCA 1SK0A 1FOVA 5HFGA 2YOIA 1X9WB 3L9VA 5IO2A 5DAKA 2LQQA 4V2NA 5ABRA 3KH7A 2HE3A 4KF9A 4ZIJA 5F05A 4AF2A 4JZQA 1AQVA 2OBIA 1M2DA 2HSMB 1VGLA 1MDJA 2EIRA 2LS5A 1A0FA 1WMJA 2HNLA 3ZITA 4RI6A 4I5QA 1BYEA 4HQSA 1UA5A 2HSNA 4TW5A 3CTGA 2VCVA 3D5JA 3WGDA 3CXGA 3RPNA 2VD1A 3GSTA 1ERUA 4GWRA 1N2AA 2JL4A 2DJKA 2I3YA 1JFUA 3QDNA 2ZCTA 2PUKC 1GUMA 5B6NA 3DKSA 4J56E 4ZBBA 3U6VA 3EPTA 1RK4A 1FHEA 2AHEA 3RHBA 1SKSB 2B7KA 3FR3A 2MBTA 3HVSA 2CVDA 5J4VA 5J4YA 1N25A 1U6TA 5ECRB 5G5EA 4O5UA 1W89A 3BD2A 3ZRDA 5H5QA 4ACSA 2VLUA 1JZWA 4N3ZA 2ON5A 4CHSA 2C1YA 2L5OA 1CQGA 4I2UA 4IW9A 4EUYA 3A5IA 3GL3A 3FZ5A 2X99A 1FB6A 3TOUA 1XWGA 4ZB7A 1F6MC 2X49A 1YEXA 3L9UA 5FHIA 3GYKA 3AY8A 3O6TA 5HQPA 4KSOA 4TR1A 3KCMA 2R37A 4HDEA 1GTBA 2C3TA 2HRKB 2DIYA 3FZ9A 4EIQA 5ID2A 5CREA 2KUCA 5J41A 5CNWA 5B8AA 2RUEA 4K2XA 5DVBA 3PR8A 2A4VA 5F07A 4DSQA 2WULA 5HR3A 4X43A 1BAYA 1R5PA 2CZ3A 1ST9A 3FMWA 1CQHA 3O3TA 3RPPA 4X0XA 1TI3A 4AKXB 4LL4B 2H1LA 2DJ1A 4MZCA 3UJ1A 3VWWA 4TKYA 1GSYA 11GSA 1YKAA 1BX9A 1GLQA 1PMTA 3VWXA 1H75A 2RUFA 2YZUA 5J9BA 1AW9A 3LXTA 3I6AA 5CRGA 4X1UA 5G1LA 3F0IA 1Z9HA 5LNKe 9GSSA 4G0IA 2O87A 2WFCA 4MH3A 5CRDA 3UARA 1Z6MA 4V2LA 5G30A 2O89A 4USSA 2CAQA 2R0PA 2HT9A 1EEJA 3FHKA 1ZMAA 3TU3B 1B8XA 4PTSA 2DJ2A 2IMDA 1XVWA 1BJXA 4KDUA 5IMVA 3LYKA 2FA8A 1WE0A 3L9SA 2D2ZA 1A8LA 2J23A 1WPIA 1ON4A 5G1KA 2IWTA 5B7CA 3D22A 1TI1A 1A2JA 3MYDA 3KMOA 4CY8A 3N9JA 3N5OA 2YV9A 3DGQA 1LJRA 3RHCA 4L5OA 2MZCA 2K9FA 3JCML 2JZSA 2V6OA 4FYUA 4IS0A 4A5PA 2C0DA 4OFNA 3A5WA 1TKDB 5CO3A 3M9JA 2FUG2 1ZYQB 2CT6A 1SVOA 5DBQA 4MA9A 1YKCA 3QFBC 5ECNB 4G10A 5DALB 1T3BA 3L78A 4V1Ag 3G7IA 2R3XA 4JEDA 2GQKA 3LW9A 2NPBA 3UL3A 2OADA 3Q74A 2DJ0A 6GSXA 4POBA 2DIZA 3D4TA 1MDIA 3LFLA 4TXVA 2YV7A 3WGXA 2E2GA 1ZGNA 2VL2C 5IMAA 5IPHA 3GN3A 2L57A 3IAM2 3APSA 4TR4A 3D0ZA 3HVVA 3A2WA 4FIWA 1NHYA 2VAFA 3H8QA 3P90A 4KH7A 4N0ZA 4BL7B 2AUVA 3TJKA 3E3EA 4TOPA 4IQ1A 2X8GA 2FLSA 4WEYA 1USBA 4GSTA 4J2FA 2C3QA 6GSWA 3TJJA 1PN0A 3EWLA 1M9AA 5J47A 3OR5A 1HD2A 1YVLA 2H19A 5FT3A 3ERGA 4NMUA 3LJRA 2C0GA 2OE1A 1WP0A 3ISOA 3BCKA 5INYA 2I9HA 3ME8A 5G5FA 4ZB9A 4DEJA 1O73A 3LYPA 4FQUA 1BF5A 4BVXB 2HI7A 2V41A 4ZL9A 3EMPA 22GSA 1PQNA 2H74A 5A1NA 2QC7A 2YANA 1Z3EA 2L6CA 4E68A 2LEGA 3PINA 4K1FA 3E0UA 4OWYA 1TU7A 4KDYA 3DEXA 1ZYEA 4QQ7A 1FB0A 3C1RA 4TVEA 3BOAA 1AUCA 2GSSA 1O6JA 4AJ6A 2YN1A 4G2EA 5D9XA 1ZCPA 4FYBA 3G7YA 4Z7XA 2YPMA 1ML6A 1T4ZA 4Z2UA 1GNWA 3TJBA 4F0CA 2CA8A 1DUGA 2IN3A 3HVXA 3QR6A 1SU9A 4G19A 2PU9C 1KNGA 4ILFA 4K0GA 1HYUA 2XBIA 5C00A 5ECLB 4ZILA 5F06A 2FA4A 3MSZA 4MF5A 4D73A 4IHUA 4GF0A 2MBSA 4OO5A 4TRXA 1TXXA 2RLIA 3TKSC 2K8VA 1F37A 1K0OA 4I2TA 3ZIJA 3IAS2 3LORA 5IOXA 2HRNA 3WT1A 5D73A 1M2AA 1Z6NA 4KAEA 2YZHA 4XRAA 4MLYA 2FWHA 1V58A 3IXRA 3F6DA 1HNBA 4MPFA 1EEMA 4XS4B 3L4NA 1M2BA 3EE2A 3GTUA 3M9KA 3VLNA 3HA9A 5JCWA 4EDZA 5CRHA 2H71A 2VCWA 4OCEA 4IP1A 1OC9A 1YQ1A 1J08A 1F3AA 1OAZA 1WJKA 2VCQA 3GX0A 5A4UA 4P3YB 3GNJA 4OD7A 2IFQB 2HXKA 1SJIA 3KXOA 3F6FA 3IOSA 4K7NA 4K7OA 2CX3A 1TDIA 4N30A 2XBQA 2IL3A 1DSBA 1Q98A 4HOJA 1T4YA 1GTIA 2EC4A 2GZYA 3IC4A 4HJ2A 3ZMLA 2WZ9A 5ECIB 1K0AA 1TRSA 5DAKB 4KNDA 1WRYA 2V32A 2O7KA 1EWXA 3C1SA 4O7HA 2FWEA 2C8UA 1GWCA 5AIXA 4AKGA 2BMXA 3TJFA 3IC8A 1JLVA 1TRWA 4QMKA 1EP8A 1FVJA 2GQLA 2AJQB 2L59A 4JR6A 1R7HA 2HSNB 2R0CA 4JRRA 2NDOA 2DBCA 4HS1A 1A0RP 1AC1A 1JZDA 4K9ZA 3IV4A 1VF3A 2REMA 2CZ2A 2H1DA 3LXZA 18GSA 1HQOA 3LWAA 2MMOA 5L71A 2H30A 5G31A 4OFMA 3ZTLA 3QCPA 3P2AA 1M7TA 4CDOA 1PKWA 4ML6A 4AJ7A 4G0KA 3QAGA 4ID0A 4EO3A 4Q5RA 4JBBA 1V57A 5DQYA 3W6GA 2OT3A 4HZ4A 5A4VA 4GDFA 2JSYA 2C80A 4BWQA 4L0UA 4KCAA 5GZZB 2OBKA 4KW6A 1A2MA 4QL9A 2L6DA 4K6XA 3ZL5A 1E2YA 5A5KA 5IIZA 1O8WA 2KLXA 3FKFA 4I8BA 4IJIA 4TXOA 2B5EA 3FK8A 1B4PA 4TR1B 1THXA 1ACVA 1M99A 1WIKA 3MNGA 1QGVA 4YQVA 2YJ7A 1KBNA 5ID2B 4YH2A 2GLRA 4ZBAA 3FZAA 5A34A 3EINA 3F9UA 1GP1A 4IJ3A 1X9MB 2WRTA 1PA3A 5H5SA 5GSSA 4MF7A 2MMNA 3ZFLA 1GL8A 3F63A 5ECQB 3H1NA 2TRCP 3C73A 4EKZA 3PGTA 1PKZA 4Q5QA 5CRWA 2PBJA 5J5NA 2PVQA 4EF0A 2OKAA 1PGTA 3G9BA 1QFNA 2OACA 4PX1A 2DSAA 3F4RA 3ERFA 4KB3A 5CAXA 4MK3A 1XW6A 2H0IA 2A2PA 1XW5A 2O5VA 1SENA 4OFTA 4Q5NA 1TRUA 3ZMKA 1S3AA 1TTZA 3F3RA 3K8NA 2YCDA 4GSSA 2RM5A 4WXTA 5ENUA 5IQYA 5J3RA 1S3DA 3DMLA 1UN2A 1XOAA 1SL2B 5ECMB 3VURA 1XWKA 5EL8A 2EFCA 1MEKA 3ME7A 3KM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3L A;  3H79 A;  2HZF A;  3TDG A;  1F9M A;  1M0U A;  2YWO A;  4O5R A;  2VL3 A;  2IMF A;  1OVN A;  3L0H A;  2WGR A;  2L4C A;  2M80 A;  1XFL A;  1S3C A;  5EPF A;  3I69 A;  4TR0 A;  5D8I A;  4HZ2 A;  2EIQ A;  2N5B A;  1XZO A;  1DBY A;  3CBU A;  1K3Y A;  5LD0 A;  1V2A A;  2VM1 A;  5IMC A;  2FHE A;  4DSS A;  3VWV A;  1AIU A;  2TRX A;  4PQI A;  1JZO A;  3UBL A;  1NM3 A;  2ES7 A;  5LCZ A;  3C7M A;  4E8H A;  5D9V A;  2H1B A;  3HKR A;  2JSZ A;  1A2L A;  3ZZX A;  4QL7 A;  1TU8 A;  1VF2 A;  3GV1 A;  2P0G A;  2G0F A;  2PER A;  1SYR A;  1PL2 A;  4GCI A;  2H0G A;  5E59 A;  2H66 A;  3TGZ A;  5DCH A;  2ZNM A;  3GFK A;  4HEA 2;  1LBK A;  2V2G A;  2JAD A;  1DE2 A;  3Q19 A;  4WBR D;  4FYC A;  3KTL A;  3HJM A;  1XWB A;  4ZB6 A;  1O7U A;  2EIO A;  2XPD A;  1MTC A;  1T7P B;  2C4J A;  1WWJ A;  4XTS A;  3HY2 A;  2VL9 A;  4O32 A;  2VD0 A;  5H5R A;  4O92 A;  2GT5 A;  3KMN A;  2QGV A;  5B6M A;  5DJL A;  3NIV A;  4KX4 A;  5HR1 A;  1GSE A;  6GSS A;  3UMA A;  3M3M A;  4GLT A;  2L5L A;  4ZL7 A;  3IE3 A;  1U88 A;  1T8E B;  2FCH A;  1YEP A;  1TP9 A;  2VL2 A;  2I1U A;  1X5D A;  1GSQ A;  4POK A;  4PUR A;  3HD5 A;  3P7X A;  1B48 A;  3EU3 A;  4PXO A;  1VF4 A;  3GX8 A;  4JR4 A;  1IYH A;  2H6Z A;  4LA1 A;  2IMI A;  10GS A;  5HR0 A;  4ECB A;  4ECI A;  5JWQ B;  4HQZ A;  3TRP A;  2F8A A;  5KN0 A;  5GST A;  3E9J B;  3C71 A;  3IBH A;  5CP1 A;  3GH9 A;  1PD2 1;  2DJJ A;  3KH9 A;  2J9H A;  1JZR A;  3CTF A;  2A2R A;  2GST A;  4BVY A;  4DVC A;  5E4W A;  3KJY A;  1SJZ A;  4MH2 A;  1ZOF A;  2IME A;  3Q6O A;  3M1G A;  2DJ3 A;  4HU7 A;  3GL5 A;  3WYW A;  2LNS A;  2HQT A;  3FR9 A;  3DWV A;  6GST A;  1ERV A;  5B8B A;  2YWM A;  2VO4 A;  3U5R E;  4MF6 A;  3KZQ A;  1NSW A;  1ERW A;  2F9S A;  2H6Y A;  1J9B A;  4MCU A;  5BMU A;  1ZZY A;  2WS2 A;  4IEL A;  2OA7 A;  2XHF A;  1XVQ A;  4RQR A;  5KN2 A;  1O85 A;  3W8J A;  2ZUP A;  8GSS A;  4GXZ A;  4KSM A;  4D73 B;  5KEJ A;  1XW9 A;  3DVW A;  3NOF A;  2GT6 A;  2F51 A;  4KGI A;  2LQO A;  4CW9 A;  1M9B A;  1LU4 A;  2LRN A;  2M72 A;  2B6M A;  4TN8 A;  4IN0 A;  5KN1 A;  1X9S B;  20GS A;  2YWI A;  1IYI A;  5ECS A;  2B1K A;  1Y6E A;  1WOU A;  1B9Y C;  3KP9 A;  3LEF A;  3P8W A;  2JZR A;  4RQX A;  3GTU B;  4WET A;  5IMZ A;  5JCG A;  3QPM A;  1QMV A;  2BTO T;  1ABA A;  5EY6 A;  3PH9 A;  3CRU A;  1OC9 B;  1XCC A;  2O85 A;  1RW1 A;  3TKS E;  3HJO A;  2AAW A;  1JHB A;  2B7J A;  1FVK A;  4N0V A;  1X5C A;  1EZK A;  1SL0 B;  2GGT A;  3UEM A;  5J4U A;  1YDK A;  2H1G A;  5AGY A;  12GS A;  3RBT A;  3US3 A;  1Z5Y E;  3ED3 A;  3TKS A;  2C0F A;  4F82 A;  1BQ7 A;  1TW9 A;  2DMM A;  2CX4 A;  1OE7 A;  3M0F A;  3GIX A;  4WKW A;  2PPT A;  2RII A;  5AIV A;  4GRF A;  3TKP A;  1PSQ A;  4BPY A;  3CSH A;  2H8L A;  2GSQ A;  2GSR A;  1PX7 A;  1KTE A;  5F0G A;  2LTK A;  4ML1 A;  3IK9 A;  1AQX A;  1UC7 A;  3QOU A;  4MP4 A;  2CVK A;  1SD9 A;  2NTO A;  1SJ6 A;  3IHQ A;  4F0B A;  2VLV A;  3FR6 A;  1RQM A;  3O76 A;  3GKM A;  1GSD A;  1XBS A;  1SK1 A;  2WB9 A;  1OKT A;  2V6K A;  3ZFB A;  3ZVJ A;  4FO5 A;  5F8B A;  2HRA A;  1F3B A;  3GH6 A;  2B1L A;  4WF5 A;  1SK2 A;  1DE1 A;  2ALB A;  1Z7R A;  4ECC A;  2E0Q A;  2LJK A;  2HZE A;  2LJR A;  3FZ4 A;  1BED A;  1W4V A;  2PWJ A;  1R4W A;  1ILO A;  4KCE A;  1YJ6 A;  3DRN A;  3VPT A;  1EP7 A;  3KIJ A;  1OC3 A;  2DML A;  1UVZ A;  2CAI A;  5DCG A;  2M46 A;  1GLP A;  5GAP D;  4PQ1 A;  2LST A;  3QD9 A;  4F2I A;  7GSS A;  2C0E A;  4XS1 A;  1EOG A;  2YP6 A;  5J9C A;  1SKW B;  5IM9 A;  1QUW A;  4TXO B;  4POM A;  3EU4 A;  2KP1 A;  2AV4 A;  1FW1 A;  3TUE A;  3H93 A;  3QMX A;  3DYR A;  2VLT A;  1AQW A;  4NHW A;  3EYT A;  4NWY A;  2FD3 A;  4IKH A;  1TJD A;  2R6K A;  3TKQ A;  3UBK A;  1Y25 A;  2CV4 A;  1NW2 A;  1GUL A;  4EL1 A;  2R2J A;  3Q18 A;  2K18 A;  4IP6 A;  5EVO A;  2PN8 A;  1XPV A;  3SBC A;  2XPE A;  5DQS A;  4IGJ A;  1K0D A;  2HFD A;  2F8F A;  3CSI A;  3R2Q A;  2IIY A;  2MYG A;  4RUV A;  1H4O A;  1EGO A;  3FY7 A;  1PL1 A;  4K7I A;  4EE0 A;  2FGX A;  1XOB A;  2GZZ A;  1G7E A;  4GTU A;  1GH2 A;  1GUK A;  4YQM A;  1FG4 A;  4G0L A;  3GUR A;  2HYX A;  3NZN A;  2LJA A;  1TK5 B;  1XIY A;  13GS A;  2CVB A;  1F2E A;  4ZL8 A;  3IR4 A;  4V1A p;  3MWH A;  3LQ7 A;  3HDC A;  3KEB A;  3TCO A;  5HR2 A;  4RI7 A;  5GAN D;  2RM6 A;  3BCI A;  3HHV A;  2DC5 A;  1SL1 B;  2KOK A;  3GKN A;  3WT2 A;  1K0N A;  4MPG A;  2H76 A;  2OE0 A;  1B9X C;  4GQF A;  3D4M A;  4MZB A;  2N5A A;  1GTU A;  1V98 A;  4K0N A;  3BJ5 A;  4EC0 A;  3UVH A;  2GZP A;  2GVP A;  3TRX A;  3VK9 A;  2HSM A;  2LRT A;  1I9D A;  3TOT A;  4XHM A;  4DSS B;  2KHP A;  3HXS A;  3QAV A;  1NHO A;  2OE3 A;  4YAP A;  4F9Z A;  3ZVJ D;  1MD3 A;  3BBY A;  2K6V A;  2L4Q A;  2CQ9 A;  2X8C A;  2H75 A;  4YAV A;  4ISD A;  1K0M A;  4G9H A;  2KP2 A;  2G2Q A;  4MDC A;  4BWS A;  3QAW A;  3KP8 A;  3VI5 A;  1X0R A;  4WR5 A;  3GMF A;  3HYP A;  4K8M A;  3FEU A;  4H86 A;  4V2M A;  3GKK A;  1GRX A;  5JWR B;  1OYJ A;  17GS A;  4PQH A;  3I9V 2;  4AJ8 A;  3MAK A;  4PNG A;  3VWU A;  5DJM A;  2LV3 A;  1GSS A;  4I97 A;  19GS A;  2GQM A;  2IJY A;  3A2X A;  2PMT A;  4KUN A;  2YNX A;  2JZT A;  3D6I A;  4OCF A;  5CYY A;  1GSF A;  2GTU A;  3HCZ A;  2YJH A;  4TR3 A;  4JU5 A;  2X8H A;  3GUS A;  4WBJ A;  4DSR A;  1EOH A;  2HRK A;  4NHZ A;  3DVX A;  3KTB A;  2NBS A;  3FW2 A;  4MJE A;  4NV5 A;  4ZBD A;  5IPG A;  3CSJ A;  1YF0 A;  4OMV A;  1QXH A;  4WF4 A;  2HSH A;  4OO4 A;  4AGS A;  4EXJ A;  2BJX A;  3F8U A;  1PRX A;  1AXD A;  4IQA A;  3LG6 A;  4XS6 A;  5AIS A;  3J7Y b;  3CMI A;  5G2Z A;  3TB2 A;  4PUA A;  4NPB A;  1URM A;  3UAP A;  3KGK A;  4LMV A;  3QFA C;  1VF1 A;  3PPU A;  2P5R A;  4FH8 A;  4XRD A;  4ULX A;  4BVY B;  2HRF A;  2VCX A;  4EVM A;  3F4S A;  3RAZ A;  3LGC A;  3DXB A;  4BA7 A;  1J0F A;  1R26 A;  2PGT A;  4MJC A;  5ELA A;  5FWG A;  5ECP B;  3UIW A;  4ZB8 A;  2E7P A;  2VCZ A;  5AN1 A;  2YWN A;  1TRV A;  2UZ8 A;  3R3E A;  5D93 A;  5ECO B;  1X5E A;  2AB6 A;  1KEB A;  3H4K A;  5D9T A;  3GSS A;  2N5F A;  2V1M A;  5C04 A;  2MMA A;  1GSU A;  4NXI A;  1U3I A;  3S9F A;  2B5Y A;  1XWA A;  1VRS D;  2H70 A;  1EV4 A;  3FYG A;  2LNT A;  4KE3 A;  2H1A A;  1T1V A;  2GDR A;  3C8E A;  4HU9 A;  5ECH B;  3EUR A;  2C3N A;  3F3Q A;  4XCS A;  4L0W A;  3VPQ A;  3A3T A;  2B3S A;  2X64 A;  3CRT A;  5DAL A;  3APQ A;  1OKD A;  2H0H A;  4ECJ A;  3A2V A;  3W8S A;  1U3A A;  3IA1 A;  3WD6 A;  3VFI A;  3IRA A;  2TIR A;  3V1W A;  4K2D A;  3G7J A;  2I81 A;  3M8N A;  14GS A;  3WGE A;  4MZW A;  2ON7 A;  2O8V B;  4ZXG A;  1GNE A;  1Z7P A;  2B5X A;  1XWC A;  1GTA A;  1EV9 A;  1R5A A;  1HNA A;  6GSY A;  1AAZ A;  4E8E A;  1MDK A;  2AYT A;  4MAB A;  1YY7 A;  1G7O A;  4LL1 B;  5A4W A;  2VM2 A;  1G6Y A;  3SWL A;  1TK0 B;  5HFI A;  4BL7 A;  4Q5F A;  1O81 A;  2VUP A;  3EMX A;  1K0B A;  4POL A;  2MMZ A;  1N8J A;  2IMK A;  1FO5 A;  3UOM A;  1BG5 A;  1Q4J A;  1E6B A;  3EVI A;  1QK8 A;  3DD3 A;  4MJA A;  3HJP A;  1FAA A;  3TJG A;  4L5L A;  4WR4 A;  2GS3 A;  4N11 A;  3APO A;  2FWF A;  1HNC A;  1C72 A;  5IMF A;  1EGR A;  3ZLP A;  2FWG A;  3UVT A;  2HSY A;  2R4V A;  2WDU A;  1B4Q A;  1SKR B;  1I5G A;  2QKE A;  3CYN A;  2VOC A;  3J7Y k;  4BVX A;  4HUA A;  1YF1 A;  3IDV A;  4F03 A;  5IO0 A;  16GS A;  2P31 A;  4LLR A;  3D21 A;  4MJB A;  4XIH A;  2JU5 A;  2Z9S A;  2LKU A;  1G6W A;  2I4A A;  3I43 A;  3EC3 A;  2IPA A;  3TRQ A;  2HZE B;  1A8Y A;  3RDW A;  4HJM A;  1V40 A;  2H01 A;  3DIE A;  3ZYW A;  4KDX A;  2OJL A;  4J57 E;  4PUF C;  4N10 A;  1PN9 A;  3IK7 A;  4LMW A;  4I6X A;  1K0C A;  4KA0 A;  1MD4 A;  5DDL A;  2H6X A;  3KD0 A;  3ZRE A;  1A23 A;  1U87 A;  5ELG A;  3IPZ A;  5KN3 A;  1ERT A;  1TK8 B;  5JCU A;  2LUS A;  2FNO A;  5COH A;  5D96 A;  2K8S A;  3HZ4 A;  2XC2 A;  4HI7 A;  2JAC A;  4GSN A;  4GQC A;  1V9W A;  1T00 A;  3HZ8 A;  3GHA A;  1JLW A;  2A2S A;  6GSV A;  4JE1 A;  2VIM A;  5JWO B;  2F3M A;  5D9W A;  2WCI A;  1A24 A;  2H73 A;  3TKR A;  4L8E A;  1SYX A;  3ERW A;  2PVO C;  4IBP A;  2H72 A;  1G0T A;  3F4T A;  1ZL9 A;  2NVL A;  3LSZ A;  1O8X A;  4NAX A;  4PGT A;  4XS4 A;  2FY6 A;  2DLX A;  3GRX A;  1K3O A;  3GA4 A;  1OE8 A;  3VI7 A;  4NV2 A;  2HLS A;  1PX6 A;  4MMM A;  2E2M A;  1QQ2 A;  2IFQ A;  1GUH A;  4EDY A;  3ZIV A;  6GSU A;  3MDK A;  1XXU A;  3GKX A;  1YZX A;  2QSI A;  4YQU A;  5IMD A;  1TOF A;  2P5Q A;  4IVF A;  5ECK B;  2R5G A;  1THO A;  1OC8 A;  5HFK A;  2WJU A;  5IOW A;  1SD8 A;  4PNF A;  2LRC A;  2VCT A;  3FRC A;  1SK0 A;  1FOV A;  5HFG A;  2YOI A;  1X9W B;  3L9V A;  5IO2 A;  5DAK A;  2LQQ A;  4V2N A;  5ABR A;  3KH7 A;  2HE3 A;  4KF9 A;  4ZIJ A;  5F05 A;  4AF2 A;  4JZQ A;  1AQV A;  2OBI A;  1M2D A;  2HSM B;  1VGL A;  1MDJ A;  2EIR A;  2LS5 A;  1A0F A;  1WMJ A;  2HNL A;  3ZIT A;  4RI6 A;  4I5Q A;  1BYE A;  4HQS A;  1UA5 A;  4TW5 A;  3CTG A;  2VCV A;  3D5J A;  3WGD A;  3CXG A;  3RPN A;  2VD1 A;  3GST A;  1ERU A;  4GWR A;  1N2A A;  2JL4 A;  2DJK A;  2I3Y A;  1JFU A;  3QDN A;  2ZCT A;  2PUK C;  1GUM A;  5B6N A;  3DKS A;  4J56 E;  4ZBB A;  3U6V A;  1RK4 A;  1FHE A;  2AHE A;  3RHB A;  1SKS B;  2B7K A;  3FR3 A;  2MBT A;  3HVS A;  2CVD A;  1U6T A;  5ECR B;  5G5E A;  1W89 A;  3BD2 A;  3ZRD A;  5H5Q A;  4ACS A;  2VLU A;  1JZW A;  2ON5 A;  4CHS A;  2C1Y A;  2L5O A;  1CQG A;  4I2U A;  4IW9 A;  4EUY A;  3GL3 A;  3FZ5 A;  2X99 A;  1FB6 A;  3TOU A;  1XWG A;  1F6M C;  1YEX A;  3L9U A;  5FHI A;  3GYK A;  3AY8 A;  3O6T A;  5HQP A;  4KSO A;  4TR1 A;  3KCM A;  2R37 A;  4HDE A;  1GTB A;  2C3T A;  2HRK B;  2DIY A;  3FZ9 A;  5ID2 A;  5CRE A;  2KUC A;  5J41 A;  5CNW A;  5B8A A;  2RUE A;  5DVB A;  3PR8 A;  2A4V A;  5F07 A;  4DSQ A;  2WUL A;  5HR3 A;  4X43 A;  1BAY A;  1R5P A;  2CZ3 A;  1ST9 A;  1CQH A;  3O3T A;  3RPP A;  4X0X A;  1TI3 A;  4LL4 B;  2DJ1 A;  4MZC A;  3UJ1 A;  3VWW A;  4TKY A;  1GSY A;  11GS A;  1YKA A;  1BX9 A;  1GLQ A;  1PMT A;  3VWX A;  1H75 A;  2RUF A;  2YZU A;  5J9B A;  1AW9 A;  3LXT A;  3I6A A;  5CRG A;  4X1U A;  5G1L A;  3F0I A;  1Z9H A;  5LNK e;  9GSS A;  4G0I A;  2O87 A;  2WFC A;  4MH3 A;  5CRD A;  3UAR A;  1Z6M A;  4V2L A;  5G30 A;  2O89 A;  4USS A;  2CAQ A;  2HT9 A;  1EEJ A;  3FHK A;  1ZMA A;  1B8X A;  4PTS A;  2DJ2 A;  2IMD A;  1XVW A;  1BJX A;  4KDU A;  5IMV A;  3LYK A;  2FA8 A;  1WE0 A;  3L9S A;  2D2Z A;  1A8L A;  2J23 A;  1WPI A;  1ON4 A;  5G1K A;  2IWT A;  5B7C A;  3D22 A;  1TI1 A;  1A2J A;  3KMO A;  3N9J A;  3N5O A;  2YV9 A;  3DGQ A;  1LJR A;  3RHC A;  4L5O A;  2MZC A;  2K9F A;  3JCM L;  2JZS A;  2V6O A;  4FYU A;  4IS0 A;  2C0D A;  4OFN A;  3A5W A;  1TKD B;  5CO3 A;  3M9J A;  2FUG 2;  1ZYQ B;  2CT6 A;  5DBQ A;  4MA9 A;  1YKC A;  3QFB C;  5ECN B;  4G10 A;  5DAL B;  1T3B A;  3L78 A;  4V1A g;  3G7I A;  2R3X A;  4JED A;  2GQK A;  2NPB A;  3UL3 A;  3Q74 A;  2OAD A;  2DJ0 A;  6GSX A;  4POB A;  2DIZ A;  3D4T A;  1MDI A;  3LFL A;  4TXV A;  2YV7 A;  3WGX A;  2E2G A;  1ZGN A;  2VL2 C;  5IMA A;  5IPH A;  3GN3 A;  2L57 A;  3IAM 2;  3APS A;  4TR4 A;  3D0Z A;  3HVV A;  3A2W A;  4FIW A;  1NHY A;  2VAF A;  3H8Q A;  3P90 A;  4KH7 A;  4N0Z A;  4BL7 B;  2AUV A;  3TJK A;  3E3E A;  4TOP A;  4IQ1 A;  2X8G A;  2FLS A;  4WEY A;  1USB A;  4GST A;  4J2F A;  2C3Q A;  6GSW A;  3TJJ A;  3EWL A;  1M9A A;  3OR5 A;  1HD2 A;  2H19 A;  5FT3 A;  3ERG A;  4NMU A;  3LJR A;  2C0G A;  2OE1 A;  1WP0 A;  3ISO A;  3BCK A;  5INY A;  2I9H A;  3ME8 A;  5G5F A;  4ZB9 A;  4DEJ A;  1O73 A;  3LYP A;  4FQU A;  4BVX B;  2HI7 A;  2V41 A;  4ZL9 A;  3EMP A;  22GS A;  1PQN A;  2H74 A;  2QC7 A;  2YAN A;  1Z3E A;  2L6C A;  2LEG A;  3PIN A;  4K1F A;  3E0U A;  4OWY A;  1TU7 A;  4KDY A;  3DEX A;  1ZYE A;  4QQ7 A;  1FB0 A;  3C1R A;  4TVE A;  3BOA A;  1AUC A;  2GSS A;  1O6J A;  4AJ6 A;  2YN1 A;  4G2E A;  5D9X A;  1ZCP A;  4FYB A;  3G7Y A;  4Z7X A;  2YPM A;  1ML6 A;  1T4Z A;  1GNW A;  3TJB A;  4F0C A;  2CA8 A;  1DUG A;  2IN3 A;  3HVX A;  3QR6 A;  1SU9 A;  4G19 A;  2PU9 C;  1KNG A;  4ILF A;  4K0G A;  1HYU A;  2XBI A;  5C00 A;  5ECL B;  4ZIL A;  5F06 A;  2FA4 A;  3MSZ A;  4MF5 A;  4D73 A;  4IHU A;  4GF0 A;  2MBS A;  4OO5 A;  4TRX A;  1TXX A;  2RLI A;  3TKS C;  2K8V A;  1F37 A;  1K0O A;  4I2T A;  3ZIJ A;  3IAS 2;  3LOR A;  5IOX A;  2HRN A;  3WT1 A;  5D73 A;  1M2A A;  1Z6N A;  4KAE A;  2YZH A;  4XRA A;  4MLY A;  2FWH A;  1V58 A;  3IXR A;  3F6D A;  1HNB A;  4MPF A;  1EEM A;  4XS4 B;  3L4N A;  1M2B A;  3EE2 A;  3GTU A;  3M9K A;  3VLN A;  3HA9 A;  5JCW A;  4EDZ A;  5CRH A;  2H71 A;  2VCW A;  4OCE A;  4IP1 A;  1OC9 A;  1YQ1 A;  1J08 A;  1F3A A;  1OAZ A;  1WJK A;  2VCQ A;  3GX0 A;  5A4U A;  4P3Y B;  3GNJ A;  4OD7 A;  2IFQ B;  2HXK A;  1SJI A;  3KXO A;  3F6F A;  3IOS A;  4K7N A;  4K7O A;  2CX3 A;  1TDI A;  4N30 A;  2XBQ A;  2IL3 A;  1DSB A;  1Q98 A;  4HOJ A;  1T4Y A;  1GTI A;  2EC4 A;  2GZY A;  3IC4 A;  4HJ2 A;  3ZML A;  2WZ9 A;  5ECI B;  1K0A A;  1TRS A;  5DAK B;  4KND A;  1WRY A;  2V32 A;  2O7K A;  1EWX A;  3C1S A;  4O7H A;  2FWE A;  2C8U A;  1GWC A;  5AIX A;  2BMX A;  3TJF A;  3IC8 A;  1JLV A;  1TRW A;  1EP8 A;  1FVJ A;  2GQL A;  2AJQ B;  2L59 A;  4JR6 A;  1R7H A;  2HSN B;  4JRR A;  2NDO A;  2DBC A;  4HS1 A;  1A0R P;  1AC1 A;  1JZD A;  4K9Z A;  3IV4 A;  1VF3 A;  2REM A;  2CZ2 A;  2H1D A;  3LXZ A;  18GS A;  1HQO A;  3LWA A;  2MMO A;  5L71 A;  2H30 A;  5G31 A;  4OFM A;  3ZTL A;  3QCP A;  3P2A A;  1M7T A;  4CDO A;  1PKW A;  4ML6 A;  4AJ7 A;  4G0K A;  3QAG A;  4ID0 A;  4EO3 A;  4Q5R A;  4JBB A;  1V57 A;  5DQY A;  3W6G A;  4HZ4 A;  5A4V A;  2JSY A;  2C80 A;  4BWQ A;  4L0U A;  4KCA A;  5GZZ B;  2OBK A;  4KW6 A;  1A2M A;  4QL9 A;  2L6D A;  4K6X A;  3ZL5 A;  1E2Y A;  5A5K A;  5IIZ A;  1O8W A;  2KLX A;  3FKF A;  4I8B A;  4IJI A;  4TXO A;  2B5E A;  3FK8 A;  1B4P A;  4TR1 B;  1THX A;  1ACV A;  1M99 A;  1WIK A;  3MNG A;  1QGV A;  4YQV A;  2YJ7 A;  1KBN A;  5ID2 B;  4YH2 A;  2GLR A;  4ZBA A;  3FZA A;  3EIN A;  3F9U A;  1GP1 A;  4IJ3 A;  1X9M B;  2WRT A;  1PA3 A;  5H5S A;  5GSS A;  4MF7 A;  2MMN A;  3ZFL A;  1GL8 A;  3F63 A;  5ECQ B;  3H1N A;  2TRC P;  3C73 A;  4EKZ A;  3PGT A;  1PKZ A;  4Q5Q A;  5CRW A;  2PBJ A;  5J5N A;  2PVQ A;  4EF0 A;  2OKA A;  1PGT A;  3G9B A;  1QFN A;  2OAC A;  4PX1 A;  2DSA A;  3F4R A;  3ERF A;  4KB3 A;  5CAX A;  4MK3 A;  1XW6 A;  2H0I A;  1XW5 A;  1SEN A;  4OFT A;  4Q5N A;  1TRU A;  3ZMK A;  1S3A A;  1TTZ A;  3F3R A;  3K8N A;  2YCD A;  4GSS A;  2RM5 A;  4WXT A;  5ENU A;  5IQY A;  5J3R A;  1S3D A;  3DML A;  1UN2 A;  1XOA A;  1SL2 B;  5ECM B;  3VUR A;  1XWK A;  5EL8 A;  1MEK A;  3ME7 A;  3KM6 A; 
#chains in the Genus database with same CATH topology
 1K3L A;  3H79 A;  2HZF A;  3TDG A;  1F9M A;  1M0U A;  2YWO A;  4O5R A;  2VL3 A;  2IMF A;  1OVN A;  3L0H A;  2WGR A;  2L4C A;  2M80 A;  1XFL A;  1S3C A;  5EPF A;  3I69 A;  4TR0 A;  5D8I A;  4HZ2 A;  2EIQ A;  2N5B A;  1XZO A;  1DBY A;  3CBU A;  1K3Y A;  5LD0 A;  1V2A A;  2VM1 A;  5IMC A;  2FHE A;  4DSS A;  3VWV A;  2DKI A;  5A5H A;  1AIU A;  2TRX A;  4PQI A;  1JZO A;  3UBL A;  1NM3 A;  2ES7 A;  5LCZ A;  3C7M A;  4E8H A;  5D9V A;  2H1B A;  3HKR A;  2JSZ A;  1A2L A;  3ZZX A;  4QL7 A;  1TU8 A;  1VF2 A;  3GV1 A;  2P0G A;  2G0F A;  2PER A;  1SYR A;  1PL2 A;  4GCI A;  2H0G A;  5E59 A;  2H66 A;  3TGZ A;  5DCH A;  2ZNM A;  3GFK A;  4HEA 2;  1LBK A;  2V2G A;  2JAD A;  1DE2 A;  3Q19 A;  4WBR D;  4FYC A;  3KTL A;  3HJM A;  1XWB A;  4ZB6 A;  1O7U A;  2EIO A;  2XPD A;  1MTC A;  1T7P B;  2C4J A;  2R0G A;  1WWJ A;  4BIK A;  4XTS A;  3HY2 A;  2VL9 A;  4O32 A;  2VD0 A;  4G01 A;  5H5R A;  4O92 A;  2GT5 A;  3KMN A;  2QGV A;  1ZYP A;  5B6M A;  5DJL A;  3NIV A;  4KX4 A;  5J40 A;  5HR1 A;  1GSE A;  6GSS A;  3UMA A;  3M3M A;  4GLT A;  2L5L A;  4ZL7 A;  3IE3 A;  1U88 A;  1T8E B;  2FCH A;  1YEP A;  1TP9 A;  2VL2 A;  2I1U A;  1X5D A;  1GSQ A;  3MIX A;  4POK A;  2DKH A;  4PUR A;  3HD5 A;  3P7X A;  1B48 A;  3EU3 A;  4PXO A;  1VF4 A;  3GX8 A;  5A1N B;  4JR4 A;  1IYH A;  2H6Z A;  4LA1 A;  2IMI A;  10GS A;  5HR0 A;  4ECB A;  4FXY P;  2WW3 A;  4ECI A;  5JWQ B;  4HQZ A;  3TRP A;  2F8A A;  5KN0 A;  5GST A;  3E9J B;  3C71 A;  3IBH A;  5CP1 A;  3GH9 A;  1PD2 1;  2DJJ A;  3KH9 A;  2J9H A;  1JZR A;  3CWG A;  3CTF A;  2A2R A;  2GST A;  4BVY A;  4DVC A;  5E4W A;  3KJY A;  1SJZ A;  4MH2 A;  1ZOF A;  2IME A;  3Q6O A;  3M1G A;  2DJ3 A;  4HU7 A;  3GL5 A;  1S4B P;  3WYW A;  2LNS A;  2HQT A;  3FR9 A;  3DWV A;  6GST A;  1ERV A;  5B8B A;  2YWM A;  2VO4 A;  3U5R E;  4MF6 A;  3KZQ A;  1NSW A;  1ERW A;  2F9S A;  2H6Y A;  1J9B A;  4MCU A;  5BMU A;  1ZZY A;  2WS2 A;  4IEL A;  2OA7 A;  2XHF A;  1XVQ A;  4RQR A;  5KN2 A;  1O85 A;  3W8J A;  2ZUP A;  8GSS A;  4GXZ A;  2EFE A;  4KSM A;  4D73 B;  5KEJ A;  1XW9 A;  3DVW A;  3NOF A;  2GT6 A;  2F51 A;  4KGI A;  2LQO A;  4CW9 A;  1M9B A;  1LU4 A;  2LRN A;  2M72 A;  2B6M A;  4TN8 A;  4IN0 A;  5KN1 A;  1X9S B;  20GS A;  2YWI A;  1IYI A;  5ECS A;  2B1K A;  1Y6E A;  1WOU A;  1B9Y C;  3KP9 A;  3LEF A;  3P8W A;  2JZR A;  4RQX A;  3GTU B;  4WET A;  5IMZ A;  5JCG A;  3QPM A;  1QMV A;  2BTO T;  1ABA A;  5EY6 A;  3PH9 A;  3CRU A;  1OC9 B;  1XCC A;  2O85 A;  1RW1 A;  3TKS E;  3HJO A;  2AAW A;  1JHB A;  2B7J A;  1FVK A;  4N0V A;  1X5C A;  1EZK A;  1SL0 B;  2GGT A;  3UEM A;  5J4U A;  1YDK A;  2H1G A;  5AGY A;  5BRT A;  12GS A;  3RBT A;  3US3 A;  1Z5Y E;  3ED3 A;  3TKS A;  2C0F A;  4F82 A;  1BQ7 A;  1TW9 A;  2DMM A;  2CX4 A;  1OE7 A;  3M0F A;  3GIX A;  4WKW A;  2PPT A;  2RII A;  5AIV A;  4GRF A;  3TKP A;  1PSQ A;  4BPY A;  3CSH A;  2H8L A;  2GSQ A;  2GSR A;  1PX7 A;  1KTE A;  5F0G A;  2LTK A;  4ML1 A;  3IK9 A;  1AQX A;  1UC7 A;  2EFD A;  3QOU A;  4MP4 A;  2CVK A;  1SD9 A;  2NTO A;  1SJ6 A;  3IHQ A;  4W66 A;  4F0B A;  2VLV A;  3FR6 A;  1RQM A;  3O76 A;  3GKM A;  1GSD A;  1XBS A;  1SK1 A;  2WB9 A;  1OKT A;  2V6K A;  3ZFB A;  3ZVJ A;  4FO5 A;  5F8B A;  2HRA A;  1F3B A;  3GH6 A;  2B1L A;  4WF5 A;  1SK2 A;  1DE1 A;  2ALB A;  1Z7R A;  4ECC A;  1SVL A;  2E0Q A;  2LJK A;  2HZE A;  2LJR A;  3FZ4 A;  1BED A;  1W4V A;  2PWJ A;  1R4W A;  1ILO A;  4KCE A;  1YJ6 A;  3DRN A;  3VPT A;  1EP7 A;  3KIJ A;  1OC3 A;  2DML A;  1UVZ A;  2CAI A;  5DCG A;  2M46 A;  1GLP A;  5GAP D;  4PQ1 A;  2LST A;  3QD9 A;  4F2I A;  7GSS A;  2C0E A;  4XS1 A;  1EOG A;  2YP6 A;  5J9C A;  1SKW B;  5IM9 A;  1QUW A;  4TXO B;  4POM A;  3EU4 A;  1BG1 A;  2KP1 A;  2AV4 A;  4YKF A;  1FW1 A;  2O36 A;  3TUE A;  3H93 A;  3QMX A;  3DYR A;  2VLT A;  1AQW A;  4NHW A;  3EYT A;  1S3R A;  4NWY A;  2FD3 A;  4IKH A;  5A34 B;  1TJD A;  2R6K A;  3TKQ A;  3UBK A;  1Y25 A;  2CV4 A;  1NW2 A;  1GUL A;  4EL1 A;  2R2J A;  3Q18 A;  2K18 A;  4IP6 A;  5EVO A;  2PN8 A;  1XPV A;  3SBC A;  2XPE A;  5DQS A;  4IGJ A;  1K0D A;  2HFD A;  2F8F A;  3CSI A;  3R2Q A;  2IIY A;  2MYG A;  4RUV A;  2EFH A;  1H4O A;  1EGO A;  3FY7 A;  1PL1 A;  4K7I A;  4EE0 A;  2FGX A;  1XOB A;  2GZZ A;  1G7E A;  4GTU A;  1GH2 A;  1GUK A;  4YQM A;  1FG4 A;  4G0L A;  1TXU A;  3GUR A;  2HYX A;  3NZN A;  2LJA A;  1TK5 B;  1XIY A;  13GS A;  2CVB A;  1F2E A;  4ZL8 A;  3IR4 A;  4V1A p;  3MWH A;  3LQ7 A;  3HDC A;  3KEB A;  3TCO A;  5HR2 A;  4RI7 A;  5GAN D;  2RM6 A;  3BCI A;  3HHV A;  2DC5 A;  1SL1 B;  2KOK A;  3GKN A;  3WT2 A;  1K0N A;  4MPG A;  2H76 A;  2OE0 A;  1B9X C;  4GQF A;  3D4M A;  4MZB A;  2N5A A;  1GTU A;  1Y1U A;  4K0N A;  1V98 A;  3BJ5 A;  4EC0 A;  3UVH A;  2GZP A;  2GVP A;  1XG8 A;  3TRX A;  3VK9 A;  2HSM A;  2LRT A;  4K5R A;  1I9D A;  3TOT A;  4XHM A;  4DSS B;  2KHP A;  3HXS A;  3QAV A;  1NHO A;  2OE3 A;  4YAP A;  5A5H B;  2A4H A;  4F9Z A;  3ZVJ D;  4Z2R A;  1MD3 A;  3BBY A;  2K6V A;  2L4Q A;  2CQ9 A;  1ZYN A;  4ICY A;  2X8C A;  2H75 A;  4YAV A;  4ISD A;  1K0M A;  2VKZ G;  4G9H A;  2KP2 A;  2G2Q A;  4MDC A;  4BWS A;  3QAW A;  3KP8 A;  3VI5 A;  1X0R A;  4WR5 A;  3GMF A;  3HYP A;  1M3J A;  4K8M A;  3FEU A;  4H86 A;  4V2M A;  3GKK A;  1GRX A;  5JWR B;  1OYJ A;  17GS A;  4PQH A;  3I9V 2;  4AJ8 A;  3MAK A;  4PNG A;  4YKG A;  3VWU A;  5DJM A;  2LV3 A;  1GSS A;  4I97 A;  19GS A;  2GQM A;  2IJY A;  3A2X A;  2X4A A;  5KOW A;  2PMT A;  4KUN A;  2YNX A;  2JZT A;  3D6I A;  4OCF A;  5CYY A;  4AKI A;  1GSF A;  2GTU A;  3HCZ A;  2YJH A;  4TR3 A;  4JU5 A;  2X8H A;  3GUS A;  4WBJ A;  4DSR A;  1EOH A;  3RGB C;  2HRK A;  4NHZ A;  3DVX A;  3KTB A;  2NBS A;  3FW2 A;  4Z2T A;  4MJE A;  4NV5 A;  4ZBD A;  5IPG A;  3CSJ A;  1YF0 A;  4OMV A;  1QXH A;  4WF4 A;  5KOX A;  2HSH A;  4MNN A;  4OO4 A;  4AGS A;  4EXJ A;  2BJX A;  3F8U A;  1PRX A;  1AXD A;  4IQA A;  3LG6 A;  4XS6 A;  5AIS A;  3J7Y b;  3CMI A;  5G2Z A;  3TB2 A;  4PUA A;  4NPB A;  1URM A;  3UAP A;  1M3I A;  3KGK A;  4AI6 A;  4LMV A;  4O5Q A;  3QFA C;  1VF1 A;  3PPU A;  2P5R A;  4FH8 A;  4XRD A;  4ULX A;  4BVY B;  2HRF A;  2VCX A;  4EVM A;  3F4S A;  3RAZ A;  3LGC A;  3DXB A;  4BA7 A;  1J0F A;  1R26 A;  2PGT A;  4MJC A;  2O3E A;  5ELA A;  5FWG A;  5ECP B;  3UIW A;  4ZB8 A;  2E7P A;  1SVM A;  2VCZ A;  5AN1 A;  2YWN A;  5BMU B;  1TRV A;  2UZ8 A;  3R3E A;  5D93 A;  5ECO B;  3RFR C;  1X5E A;  2AB6 A;  1KEB A;  3H4K A;  5D9T A;  3GSS A;  2N5F A;  2V1M A;  5C04 A;  2MMA A;  1GSU A;  4EIP A;  4NXI A;  1U3I A;  3S9F A;  2B5Y A;  1XWA A;  1VRS D;  2H70 A;  2UV8 G;  3FYG A;  1EV4 A;  2LNT A;  4KE3 A;  2H1A A;  1T1V A;  2GDR A;  3C8E A;  4HU9 A;  5ECH B;  3EUR A;  2C3N A;  2WVZ A;  3F3Q A;  4XCS A;  4L0W A;  3VPQ A;  3A3T A;  2B3S A;  2X64 A;  3CRT A;  5DAL A;  3APQ A;  1OKD A;  2H0H A;  4ECJ A;  3A2V A;  3W8S A;  1U3A A;  3IA1 A;  3WD6 A;  3VFI A;  4X4J A;  3IRA A;  2TIR A;  3V1W A;  4K2D A;  3G7J A;  2I81 A;  3M8N A;  14GS A;  3WGE A;  4MZW A;  2ON7 A;  2O8V B;  4ZXG A;  1GNE A;  1Z7P A;  2B5X A;  1XWC A;  1GTA A;  3IHG A;  1EV9 A;  1R5A A;  1HNA A;  6GSY A;  1AAZ A;  4E8E A;  1MDK A;  2AYT A;  4MAB A;  1YY7 A;  1G7O A;  4LL1 B;  5A4W A;  2VM2 A;  1G6Y A;  3SWL A;  1TK0 B;  5HFI A;  4BL7 A;  4Q5F A;  1O81 A;  2VUP A;  3EMX A;  2WZS A;  1K0B A;  4POL A;  2MMZ A;  1N8J A;  2IMK A;  1FO5 A;  3UOM A;  1BG5 A;  1Q4J A;  1E6B A;  3EVI A;  1QK8 A;  3DD3 A;  4MJA A;  3HJP A;  1FAA A;  3TJG A;  4L5L A;  4WR4 A;  2GS3 A;  4N11 A;  2QA2 A;  3APO A;  2FWF A;  1HNC A;  1C72 A;  5IMF A;  1EGR A;  3ZLP A;  2FWG A;  3UVT A;  2HSY A;  2R4V A;  2WDU A;  2QA1 A;  1B4Q A;  1SKR B;  1I5G A;  2QKE A;  3CYN A;  2VOC A;  3J7Y k;  4BVX A;  4HUA A;  1YF1 A;  3IDV A;  4F03 A;  5IO0 A;  16GS A;  2P31 A;  4LLR A;  3D21 A;  4MJB A;  4XIH A;  2JU5 A;  2Z9S A;  2LKU A;  1G6W A;  2I4A A;  3I43 A;  3EC3 A;  2IPA A;  3TRQ A;  2HZE B;  1A8Y A;  3RDW A;  4HJM A;  1V40 A;  2H01 A;  3DIE A;  3ZYW A;  4KDX A;  2OJL A;  4J57 E;  4K5S A;  4PUF C;  4N10 A;  1PN9 A;  3IK7 A;  4LMW A;  4I6X A;  1K0C A;  4KA0 A;  1MD4 A;  5DDL A;  4AKH A;  2H6X A;  3KD0 A;  3ZRE A;  1A23 A;  1U87 A;  4PI2 C;  5ELG A;  3IPZ A;  5KN3 A;  1ERT A;  1TK8 B;  5JCU A;  2LUS A;  2FNO A;  5COH A;  5D96 A;  2K8S A;  3HZ4 A;  2XC2 A;  4HI7 A;  2JAC A;  4GSN A;  4GQC A;  1V9W A;  1T00 A;  3HZ8 A;  3GHA A;  1JLW A;  2A2S A;  6GSV A;  4JE1 A;  2VIM A;  5JWO B;  2F3M A;  5D9W A;  2WCI A;  1A24 A;  3HMJ G;  2H73 A;  3TKR A;  4L8E A;  1SYX A;  3ERW A;  2PVO C;  4IBP A;  2H72 A;  1G0T A;  3F4T A;  1ZL9 A;  2NVL A;  3LSZ A;  1O8X A;  4NAX A;  4PGT A;  4XS4 A;  2FY6 A;  2DLX A;  4CY6 A;  3GRX A;  1K3O A;  3GA4 A;  1OE8 A;  3VI7 A;  4NV2 A;  2HLS A;  1PX6 A;  4MMM A;  2E2M A;  1QQ2 A;  2IFQ A;  1GUH A;  1FOH A;  4EDY A;  3ZIV A;  6GSU A;  3MDK A;  1XXU A;  1PFO A;  3GKX A;  1YZX A;  2QSI A;  4YQU A;  5IMD A;  1TOF A;  2P5Q A;  4IVF A;  5ECK B;  2R5G A;  1THO A;  1OC8 A;  5HFK A;  2WJU A;  5IOW A;  1SD8 A;  4PNF A;  2LRC A;  2VCT A;  3FRC A;  1SK0 A;  1FOV A;  5HFG A;  2YOI A;  1X9W B;  3L9V A;  5IO2 A;  5DAK A;  2LQQ A;  4V2N A;  5ABR A;  3KH7 A;  2HE3 A;  4KF9 A;  4ZIJ A;  5F05 A;  4AF2 A;  4JZQ A;  1AQV A;  2OBI A;  1M2D A;  2HSM B;  1VGL A;  1MDJ A;  2EIR A;  2LS5 A;  1A0F A;  1WMJ A;  2HNL A;  3ZIT A;  4RI6 A;  4I5Q A;  1BYE A;  4HQS A;  1UA5 A;  2HSN A;  1I1I P;  4TW5 A;  3CTG A;  2VCV A;  3D5J A;  3WGD A;  3CXG A;  3RPN A;  2VD1 A;  3GST A;  1ERU A;  4GWR A;  1N2A A;  2JL4 A;  2DJK A;  2I3Y A;  1JFU A;  3QDN A;  2ZCT A;  2PUK C;  1GUM A;  5B6N A;  3DKS A;  4J56 E;  4ZBB A;  3U6V A;  3EPT A;  1RK4 A;  1FHE A;  2AHE A;  3RHB A;  1SKS B;  2B7K A;  3FR3 A;  2MBT A;  3HVS A;  2CVD A;  5J4V A;  5J4Y A;  1N25 A;  1U6T A;  5ECR B;  5G5E A;  4O5U A;  1W89 A;  3BD2 A;  3ZRD A;  5H5Q A;  4ACS A;  2VLU A;  1JZW A;  4N3Z A;  2ON5 A;  4CHS A;  2C1Y A;  2L5O A;  1CQG A;  4I2U A;  4IW9 A;  4EUY A;  3A5I A;  3GL3 A;  3FZ5 A;  2X99 A;  1FB6 A;  3TOU A;  1XWG A;  2WVX A;  4ZB7 A;  1F6M C;  2X49 A;  1YEX A;  3L9U A;  5FHI A;  3GYK A;  3AY8 A;  3O6T A;  5HQP A;  4KSO A;  4TR1 A;  3KCM A;  2R37 A;  4HDE A;  1GTB A;  2C3T A;  2HRK B;  2DIY A;  3FZ9 A;  4EIQ A;  5ID2 A;  5CRE A;  2KUC A;  5J41 A;  5CNW A;  5B8A A;  2RUE A;  4K2X A;  5DVB A;  3PR8 A;  2A4V A;  5F07 A;  4DSQ A;  2WUL A;  5HR3 A;  4X43 A;  1BAY A;  1R5P A;  2CZ3 A;  1ST9 A;  3FMW A;  1CQH A;  3O3T A;  3RPP A;  4X0X A;  1TI3 A;  4AKX B;  4LL4 B;  2H1L A;  2DJ1 A;  4MZC A;  3UJ1 A;  3VWW A;  4TKY A;  1GSY A;  11GS A;  1YKA A;  1BX9 A;  1GLQ A;  1PMT A;  3VWX A;  1H75 A;  2RUF A;  2YZU A;  5J9B A;  1AW9 A;  3LXT A;  3I6A A;  5CRG A;  4X1U A;  5G1L A;  3F0I A;  1Z9H A;  5LNK e;  9GSS A;  4G0I A;  2O87 A;  2WFC A;  4MH3 A;  5CRD A;  3UAR A;  1Z6M A;  4V2L A;  5G30 A;  2O89 A;  4USS A;  2CAQ A;  2R0P A;  4PHZ C;  2HT9 A;  1EEJ A;  3FHK A;  1ZMA A;  3TU3 B;  1B8X A;  4PTS A;  2DJ2 A;  2IMD A;  1XVW A;  1BJX A;  4KDU A;  5IMV A;  3LYK A;  2FA8 A;  1WE0 A;  3L9S A;  2D2Z A;  1A8L A;  2J23 A;  1WPI A;  1ON4 A;  5G1K A;  2IWT A;  5B7C A;  3D22 A;  1TI1 A;  1A2J A;  3MYD A;  3KMO A;  4CY8 A;  3N9J A;  3N5O A;  2YV9 A;  3DGQ A;  1LJR A;  3RHC A;  4L5O A;  2MZC A;  2K9F A;  3JCM L;  2JZS A;  2V6O A;  2WVY A;  4FYU A;  4IS0 A;  4A5P A;  2C0D A;  4OFN A;  3A5W A;  1TKD B;  5CO3 A;  3M9J A;  2FUG 2;  1ZYQ B;  2CT6 A;  1SVO A;  5DBQ A;  4MA9 A;  1YKC A;  3QFB C;  5ECN B;  4G10 A;  5DAL B;  1T3B A;  3L78 A;  4V1A g;  3G7I A;  2R3X A;  4JED A;  2GQK A;  3LW9 A;  2NPB A;  3UL3 A;  2OAD A;  3Q74 A;  2DJ0 A;  6GSX A;  4POB A;  2DIZ A;  3D4T A;  1MDI A;  3LFL A;  4TXV A;  2YV7 A;  3WGX A;  2E2G A;  1ZGN A;  2VL2 C;  5IMA A;  5IPH A;  3GN3 A;  4HSC X;  2L57 A;  3IAM 2;  3APS A;  4TR4 A;  3D0Z A;  3HVV A;  3A2W A;  4FIW A;  1NHY A;  2VAF A;  3H8Q A;  3P90 A;  4KH7 A;  4N0Z A;  4BL7 B;  2AUV A;  3TJK A;  3E3E A;  4TOP A;  4IQ1 A;  2X8G A;  2FLS A;  4WEY A;  1USB A;  4GST A;  4J2F A;  2C3Q A;  6GSW A;  3TJJ A;  1PN0 A;  3EWL A;  1M9A A;  5J47 A;  3OR5 A;  1HD2 A;  1YVL A;  2H19 A;  5FT3 A;  3ERG A;  4NMU A;  3LJR A;  2C0G A;  2OE1 A;  1WP0 A;  3ISO A;  3BCK A;  5INY A;  2I9H A;  3ME8 A;  5G5F A;  4ZB9 A;  4DEJ A;  1O73 A;  3LYP A;  4FQU A;  1BF5 A;  4BVX B;  2HI7 A;  2V41 A;  4ZL9 A;  3EMP A;  22GS A;  1PQN A;  2H74 A;  5A1N A;  3CQF A;  2QC7 A;  2YAN A;  1Z3E A;  2L6C A;  4E68 A;  2LEG A;  3PIN A;  4K1F A;  3E0U A;  4OWY A;  1TU7 A;  4KDY A;  3DEX A;  1ZYE A;  4QQ7 A;  1FB0 A;  3C1R A;  4TVE A;  3BOA A;  1AUC A;  2GSS A;  1O6J A;  4AJ6 A;  2YN1 A;  4G2E A;  5D9X A;  1ZCP A;  4FYB A;  3G7Y A;  4Z7X A;  2YPM A;  1ML6 A;  1T4Z A;  4Z2U A;  1GNW A;  3TJB A;  4F0C A;  2CA8 A;  1DUG A;  2IN3 A;  3HVX A;  3QR6 A;  1SU9 A;  4G19 A;  2PU9 C;  1KNG A;  4ILF A;  4K0G A;  1HYU A;  2XBI A;  5C00 A;  5ECL B;  4ZIL A;  5F06 A;  2FA4 A;  3MSZ A;  4MF5 A;  4D73 A;  4IHU A;  4GF0 A;  2MBS A;  4OO5 A;  4TRX A;  1TXX A;  2RLI A;  3TKS C;  2K8V A;  1F37 A;  1K0O A;  4I2T A;  3ZIJ A;  3IAS 2;  3LOR A;  5IOX A;  2HRN A;  3WT1 A;  5D73 A;  1M2A A;  1Z6N A;  4KAE A;  2YZH A;  4XRA A;  4MLY A;  2FWH A;  1V58 A;  3IXR A;  3F6D A;  1HNB A;  4MPF A;  1EEM A;  4XS4 B;  3L4N A;  1M2B A;  3EE2 A;  3GTU A;  3M9K A;  4PI0 C;  3VLN A;  3HA9 A;  5JCW A;  4EDZ A;  5CRH A;  2H71 A;  2VCW A;  4OCE A;  4IP1 A;  1OC9 A;  1YQ1 A;  1J08 A;  1F3A A;  1OAZ A;  1WJK A;  2VCQ A;  3GX0 A;  5A4U A;  4P3Y B;  3GNJ A;  4OD7 A;  2IFQ B;  2HXK A;  1SJI A;  3KXO A;  3F6F A;  3CHX C;  3IOS A;  4K7N A;  4K7O A;  2CX3 A;  1TDI A;  4N30 A;  2XBQ A;  2IL3 A;  2WW1 A;  1DSB A;  1Q98 A;  4HOJ A;  1T4Y A;  1GTI A;  2EC4 A;  2GZY A;  3IC4 A;  4HJ2 A;  3ZML A;  2WZ9 A;  5ECI B;  1K0A A;  1TRS A;  5DAK B;  4KND A;  1WRY A;  2V32 A;  2O7K A;  1EWX A;  3C1S A;  4O7H A;  2FWE A;  2C8U A;  1GWC A;  5AIX A;  4AKG A;  2BMX A;  3TJF A;  3IC8 A;  1JLV A;  1TRW A;  4QMK A;  1EP8 A;  1FVJ A;  2GQL A;  2AJQ B;  2L59 A;  4JR6 A;  1R7H A;  2HSN B;  2R0C A;  4JRR A;  2NDO A;  2DBC A;  4HS1 A;  1A0R P;  1AC1 A;  1JZD A;  4K9Z A;  3IV4 A;  1VF3 A;  2REM A;  2CZ2 A;  2H1D A;  3LXZ A;  18GS A;  1HQO A;  3LWA A;  2MMO A;  5L71 A;  2H30 A;  5G31 A;  4OFM A;  3ZTL A;  3QCP A;  3P2A A;  1M7T A;  4CDO A;  1PKW A;  4ML6 A;  4AJ7 A;  4G0K A;  3QAG A;  4ID0 A;  4EO3 A;  4Q5R A;  4JBB A;  1V57 A;  5DQY A;  3W6G A;  2OT3 A;  4HZ4 A;  5A4V A;  4GDF A;  2JSY A;  2C80 A;  4BWQ A;  4L0U A;  4KCA A;  5GZZ B;  2OBK A;  4KW6 A;  1A2M A;  4QL9 A;  2L6D A;  4K6X A;  3ZL5 A;  1E2Y A;  5A5K A;  5IIZ A;  1O8W A;  2KLX A;  3FKF A;  2WVX B;  4I8B A;  4IJI A;  4TXO A;  2B5E A;  3FK8 A;  1B4P A;  4TR1 B;  1THX A;  1ACV A;  1M99 A;  1WIK A;  3MNG A;  1QGV A;  4YQV A;  2YJ7 A;  1KBN A;  5ID2 B;  4YH2 A;  2GLR A;  4ZBA A;  3FZA A;  5A34 A;  3EIN A;  3F9U A;  1GP1 A;  4IJ3 A;  1X9M B;  2WRT A;  1PA3 A;  5H5S A;  5GSS A;  4MF7 A;  2MMN A;  3ZFL A;  1GL8 A;  3F63 A;  5ECQ B;  3H1N A;  2TRC P;  3C73 A;  4EKZ A;  3PGT A;  1PKZ A;  4Q5Q A;  5CRW A;  2PBJ A;  5J5N A;  2PVQ A;  4EF0 A;  2OKA A;  1PGT A;  3G9B A;  1QFN A;  2OAC A;  4PX1 A;  2DSA A;  3F4R A;  3ERF A;  4KB3 A;  5CAX A;  4MK3 A;  1XW6 A;  2H0I A;  2A2P A;  1XW5 A;  2O5V A;  3HVN A;  1SEN A;  4OFT A;  4Q5N A;  1TRU A;  3ZMK A;  1S3A A;  1TTZ A;  3F3R A;  3K8N A;  2WW0 A;  2YCD A;  4GSS A;  2RM5 A;  4WXT A;  5ENU A;  5IQY A;  5J3R A;  1S3D A;  3DML A;  1UN2 A;  1XOA A;  1SL2 B;  5ECM B;  2WW2 A;  3VUR A;  1XWK A;  1YEW C;  5EL8 A;  2EFC A;  1MEK A;  3ME7 A;  3KM6 A; 
#chains in the Genus database with same CATH homology
 1K3L A;  3H79 A;  2HZF A;  3TDG A;  1F9M A;  1M0U A;  2YWO A;  4O5R A;  2VL3 A;  2IMF A;  1OVN A;  3L0H A;  2WGR A;  2L4C A;  2M80 A;  1XFL A;  1S3C A;  5EPF A;  3I69 A;  4TR0 A;  5D8I A;  4HZ2 A;  2EIQ A;  2N5B A;  1XZO A;  1DBY A;  3CBU A;  1K3Y A;  5LD0 A;  1V2A A;  2VM1 A;  5IMC A;  2FHE A;  4DSS A;  3VWV A;  2DKI A;  5A5H A;  1AIU A;  2TRX A;  4PQI A;  1JZO A;  3UBL A;  1NM3 A;  2ES7 A;  5LCZ A;  3C7M A;  4E8H A;  5D9V A;  2H1B A;  3HKR A;  2JSZ A;  1A2L A;  3ZZX A;  4QL7 A;  1TU8 A;  1VF2 A;  3GV1 A;  2P0G A;  2G0F A;  2PER A;  1SYR A;  1PL2 A;  4GCI A;  2H0G A;  5E59 A;  2H66 A;  3TGZ A;  5DCH A;  2ZNM A;  3GFK A;  4HEA 2;  1LBK A;  2V2G A;  2JAD A;  1DE2 A;  3Q19 A;  4WBR D;  4FYC A;  3KTL A;  3HJM A;  1XWB A;  4ZB6 A;  1O7U A;  2EIO A;  2XPD A;  1MTC A;  1T7P B;  2C4J A;  2R0G A;  1WWJ A;  4XTS A;  3HY2 A;  2VL9 A;  4O32 A;  2VD0 A;  4G01 A;  5H5R A;  4O92 A;  2GT5 A;  3KMN A;  2QGV A;  1ZYP A;  5B6M A;  5DJL A;  3NIV A;  4KX4 A;  5J40 A;  5HR1 A;  1GSE A;  6GSS A;  3UMA A;  3M3M A;  4GLT A;  2L5L A;  4ZL7 A;  3IE3 A;  1U88 A;  1T8E B;  2FCH A;  1YEP A;  1TP9 A;  2VL2 A;  2I1U A;  1X5D A;  1GSQ A;  3MIX A;  4POK A;  2DKH A;  4PUR A;  3HD5 A;  3P7X A;  1B48 A;  3EU3 A;  4PXO A;  1VF4 A;  3GX8 A;  5A1N B;  4JR4 A;  1IYH A;  2H6Z A;  4LA1 A;  2IMI A;  10GS A;  5HR0 A;  4ECB A;  4ECI A;  5JWQ B;  4HQZ A;  3TRP A;  2F8A A;  5KN0 A;  5GST A;  3E9J B;  3C71 A;  3IBH A;  5CP1 A;  3GH9 A;  1PD2 1;  2DJJ A;  3KH9 A;  2J9H A;  1JZR A;  3CWG A;  3CTF A;  2A2R A;  2GST A;  4BVY A;  4DVC A;  5E4W A;  3KJY A;  1SJZ A;  4MH2 A;  1ZOF A;  2IME A;  3Q6O A;  3M1G A;  2DJ3 A;  4HU7 A;  3GL5 A;  3WYW A;  2LNS A;  2HQT A;  3FR9 A;  3DWV A;  6GST A;  1ERV A;  5B8B A;  2YWM A;  2VO4 A;  3U5R E;  4MF6 A;  3KZQ A;  1NSW A;  1ERW A;  2F9S A;  2H6Y A;  1J9B A;  4MCU A;  5BMU A;  1ZZY A;  2WS2 A;  4IEL A;  2OA7 A;  2XHF A;  1XVQ A;  4RQR A;  5KN2 A;  1O85 A;  3W8J A;  2ZUP A;  8GSS A;  4GXZ A;  2EFE A;  4KSM A;  4D73 B;  5KEJ A;  1XW9 A;  3DVW A;  3NOF A;  2GT6 A;  2F51 A;  4KGI A;  2LQO A;  4CW9 A;  1M9B A;  1LU4 A;  2LRN A;  2M72 A;  2B6M A;  4TN8 A;  4IN0 A;  5KN1 A;  1X9S B;  20GS A;  2YWI A;  1IYI A;  5ECS A;  2B1K A;  1Y6E A;  1WOU A;  1B9Y C;  3KP9 A;  3LEF A;  3P8W A;  2JZR A;  4RQX A;  3GTU B;  4WET A;  5IMZ A;  5JCG A;  3QPM A;  1QMV A;  2BTO T;  1ABA A;  5EY6 A;  3PH9 A;  3CRU A;  1OC9 B;  1XCC A;  2O85 A;  1RW1 A;  3TKS E;  3HJO A;  2AAW A;  1JHB A;  2B7J A;  1FVK A;  4N0V A;  1X5C A;  1EZK A;  1SL0 B;  2GGT A;  3UEM A;  5J4U A;  1YDK A;  2H1G A;  5AGY A;  5BRT A;  12GS A;  3RBT A;  3US3 A;  1Z5Y E;  3ED3 A;  3TKS A;  2C0F A;  4F82 A;  1BQ7 A;  1TW9 A;  2DMM A;  2CX4 A;  1OE7 A;  3M0F A;  3GIX A;  4WKW A;  2PPT A;  2RII A;  5AIV A;  4GRF A;  3TKP A;  1PSQ A;  4BPY A;  3CSH A;  2H8L A;  2GSQ A;  2GSR A;  1PX7 A;  1KTE A;  5F0G A;  2LTK A;  4ML1 A;  3IK9 A;  1AQX A;  1UC7 A;  2EFD A;  3QOU A;  4MP4 A;  2CVK A;  1SD9 A;  2NTO A;  1SJ6 A;  3IHQ A;  4W66 A;  4F0B A;  2VLV A;  3FR6 A;  1RQM A;  3O76 A;  3GKM A;  1GSD A;  1XBS A;  1SK1 A;  2WB9 A;  1OKT A;  2V6K A;  3ZFB A;  3ZVJ A;  4FO5 A;  5F8B A;  2HRA A;  1F3B A;  3GH6 A;  2B1L A;  4WF5 A;  1SK2 A;  1DE1 A;  2ALB A;  1Z7R A;  4ECC A;  1SVL A;  2E0Q A;  2LJK A;  2HZE A;  2LJR A;  3FZ4 A;  1BED A;  1W4V A;  2PWJ A;  1R4W A;  1ILO A;  4KCE A;  1YJ6 A;  3DRN A;  3VPT A;  1EP7 A;  3KIJ A;  1OC3 A;  2DML A;  1UVZ A;  2CAI A;  5DCG A;  2M46 A;  1GLP A;  5GAP D;  4PQ1 A;  2LST A;  3QD9 A;  4F2I A;  7GSS A;  2C0E A;  4XS1 A;  1EOG A;  2YP6 A;  5J9C A;  1SKW B;  5IM9 A;  1QUW A;  4TXO B;  4POM A;  3EU4 A;  1BG1 A;  2KP1 A;  2AV4 A;  4YKF A;  1FW1 A;  3TUE A;  3H93 A;  3QMX A;  3DYR A;  2VLT A;  1AQW A;  4NHW A;  3EYT A;  4NWY A;  2FD3 A;  4IKH A;  5A34 B;  1TJD A;  2R6K A;  3TKQ A;  3UBK A;  1Y25 A;  2CV4 A;  1NW2 A;  1GUL A;  4EL1 A;  2R2J A;  3Q18 A;  2K18 A;  4IP6 A;  5EVO A;  2PN8 A;  1XPV A;  3SBC A;  2XPE A;  5DQS A;  4IGJ A;  1K0D A;  2HFD A;  2F8F A;  3CSI A;  3R2Q A;  2IIY A;  2MYG A;  4RUV A;  2EFH A;  1H4O A;  1EGO A;  3FY7 A;  1PL1 A;  4K7I A;  4EE0 A;  2FGX A;  1XOB A;  2GZZ A;  1G7E A;  4GTU A;  1GH2 A;  1GUK A;  4YQM A;  1FG4 A;  4G0L A;  1TXU A;  3GUR A;  2HYX A;  3NZN A;  2LJA A;  1TK5 B;  1XIY A;  13GS A;  2CVB A;  1F2E A;  4ZL8 A;  3IR4 A;  4V1A p;  3MWH A;  3LQ7 A;  3HDC A;  3KEB A;  3TCO A;  5HR2 A;  4RI7 A;  5GAN D;  2RM6 A;  3BCI A;  3HHV A;  2DC5 A;  1SL1 B;  2KOK A;  3GKN A;  3WT2 A;  1K0N A;  4MPG A;  2H76 A;  2OE0 A;  1B9X C;  4GQF A;  3D4M A;  4MZB A;  2N5A A;  1GTU A;  1Y1U A;  4K0N A;  1V98 A;  3BJ5 A;  4EC0 A;  3UVH A;  2GZP A;  2GVP A;  3TRX A;  3VK9 A;  2HSM A;  2LRT A;  4K5R A;  1I9D A;  3TOT A;  4XHM A;  4DSS B;  2KHP A;  3HXS A;  3QAV A;  1NHO A;  2OE3 A;  4YAP A;  5A5H B;  2A4H A;  4F9Z A;  3ZVJ D;  4Z2R A;  1MD3 A;  3BBY A;  2K6V A;  2L4Q A;  2CQ9 A;  1ZYN A;  4ICY A;  2X8C A;  2H75 A;  4YAV A;  4ISD A;  1K0M A;  2VKZ G;  4G9H A;  2KP2 A;  2G2Q A;  4MDC A;  4BWS A;  3QAW A;  3KP8 A;  3VI5 A;  1X0R A;  4WR5 A;  3GMF A;  3HYP A;  4K8M A;  3FEU A;  4H86 A;  4V2M A;  3GKK A;  1GRX A;  5JWR B;  1OYJ A;  17GS A;  4PQH A;  3I9V 2;  4AJ8 A;  3MAK A;  4PNG A;  4YKG A;  3VWU A;  5DJM A;  2LV3 A;  1GSS A;  4I97 A;  19GS A;  2GQM A;  2IJY A;  3A2X A;  2X4A A;  5KOW A;  2PMT A;  4KUN A;  2YNX A;  2JZT A;  3D6I A;  4OCF A;  5CYY A;  4AKI A;  1GSF A;  2GTU A;  3HCZ A;  2YJH A;  4TR3 A;  4JU5 A;  2X8H A;  3GUS A;  4WBJ A;  4DSR A;  1EOH A;  2HRK A;  4NHZ A;  3DVX A;  3KTB A;  2NBS A;  3FW2 A;  4Z2T A;  4MJE A;  4NV5 A;  4ZBD A;  5IPG A;  3CSJ A;  1YF0 A;  4OMV A;  1QXH A;  4WF4 A;  5KOX A;  2HSH A;  4MNN A;  4OO4 A;  4AGS A;  4EXJ A;  2BJX A;  3F8U A;  1PRX A;  1AXD A;  4IQA A;  3LG6 A;  4XS6 A;  5AIS A;  3J7Y b;  3CMI A;  5G2Z A;  3TB2 A;  4PUA A;  4NPB A;  1URM A;  3UAP A;  3KGK A;  4AI6 A;  4LMV A;  4O5Q A;  3QFA C;  1VF1 A;  3PPU A;  2P5R A;  4FH8 A;  4XRD A;  4ULX A;  4BVY B;  2HRF A;  2VCX A;  4EVM A;  3F4S A;  3RAZ A;  3LGC A;  3DXB A;  4BA7 A;  1J0F A;  1R26 A;  2PGT A;  4MJC A;  5ELA A;  5FWG A;  5ECP B;  3UIW A;  4ZB8 A;  2E7P A;  1SVM A;  2VCZ A;  5AN1 A;  2YWN A;  5BMU B;  1TRV A;  2UZ8 A;  3R3E A;  5D93 A;  5ECO B;  1X5E A;  2AB6 A;  1KEB A;  3H4K A;  5D9T A;  3GSS A;  2N5F A;  2V1M A;  5C04 A;  2MMA A;  1GSU A;  4EIP A;  4NXI A;  1U3I A;  3S9F A;  2B5Y A;  1XWA A;  1VRS D;  2H70 A;  2UV8 G;  1EV4 A;  3FYG A;  2LNT A;  4KE3 A;  2H1A A;  1T1V A;  2GDR A;  3C8E A;  4HU9 A;  5ECH B;  3EUR A;  2C3N A;  3F3Q A;  4XCS A;  4L0W A;  3VPQ A;  3A3T A;  2B3S A;  2X64 A;  3CRT A;  5DAL A;  3APQ A;  1OKD A;  2H0H A;  4ECJ A;  3A2V A;  3W8S A;  1U3A A;  3IA1 A;  3WD6 A;  3VFI A;  4X4J A;  3IRA A;  2TIR A;  3V1W A;  4K2D A;  3G7J A;  2I81 A;  3M8N A;  14GS A;  3WGE A;  4MZW A;  2ON7 A;  2O8V B;  4ZXG A;  1GNE A;  1Z7P A;  2B5X A;  1XWC A;  1GTA A;  3IHG A;  1EV9 A;  1R5A A;  1HNA A;  6GSY A;  1AAZ A;  4E8E A;  1MDK A;  2AYT A;  4MAB A;  1YY7 A;  1G7O A;  4LL1 B;  5A4W A;  2VM2 A;  1G6Y A;  3SWL A;  1TK0 B;  5HFI A;  4BL7 A;  4Q5F A;  1O81 A;  2VUP A;  3EMX A;  1K0B A;  4POL A;  2MMZ A;  1N8J A;  2IMK A;  1FO5 A;  3UOM A;  1BG5 A;  1Q4J A;  1E6B A;  3EVI A;  1QK8 A;  3DD3 A;  4MJA A;  3HJP A;  1FAA A;  3TJG A;  4L5L A;  4WR4 A;  2GS3 A;  4N11 A;  2QA2 A;  3APO A;  2FWF A;  1HNC A;  1C72 A;  5IMF A;  1EGR A;  3ZLP A;  2FWG A;  3UVT A;  2HSY A;  2R4V A;  2WDU A;  2QA1 A;  1B4Q A;  1SKR B;  1I5G A;  2QKE A;  3CYN A;  2VOC A;  3J7Y k;  4BVX A;  4HUA A;  1YF1 A;  3IDV A;  4F03 A;  5IO0 A;  16GS A;  2P31 A;  4LLR A;  3D21 A;  4MJB A;  4XIH A;  2JU5 A;  2Z9S A;  2LKU A;  1G6W A;  2I4A A;  3I43 A;  3EC3 A;  2IPA A;  3TRQ A;  2HZE B;  1A8Y A;  3RDW A;  4HJM A;  1V40 A;  2H01 A;  3DIE A;  3ZYW A;  4KDX A;  2OJL A;  4J57 E;  4K5S A;  4PUF C;  4N10 A;  1PN9 A;  3IK7 A;  4LMW A;  4I6X A;  1K0C A;  4KA0 A;  1MD4 A;  5DDL A;  4AKH A;  2H6X A;  3KD0 A;  3ZRE A;  1A23 A;  1U87 A;  5ELG A;  3IPZ A;  5KN3 A;  1ERT A;  1TK8 B;  5JCU A;  2LUS A;  2FNO A;  5COH A;  5D96 A;  2K8S A;  3HZ4 A;  2XC2 A;  4HI7 A;  2JAC A;  4GSN A;  4GQC A;  1V9W A;  1T00 A;  3HZ8 A;  3GHA A;  1JLW A;  2A2S A;  6GSV A;  4JE1 A;  2VIM A;  5JWO B;  2F3M A;  5D9W A;  2WCI A;  1A24 A;  3HMJ G;  2H73 A;  3TKR A;  4L8E A;  1SYX A;  3ERW A;  2PVO C;  4IBP A;  2H72 A;  1G0T A;  3F4T A;  1ZL9 A;  2NVL A;  3LSZ A;  1O8X A;  4NAX A;  4PGT A;  4XS4 A;  2FY6 A;  2DLX A;  4CY6 A;  3GRX A;  1K3O A;  3GA4 A;  1OE8 A;  3VI7 A;  4NV2 A;  2HLS A;  1PX6 A;  4MMM A;  2E2M A;  1QQ2 A;  2IFQ A;  1GUH A;  1FOH A;  4EDY A;  3ZIV A;  6GSU A;  3MDK A;  1XXU A;  3GKX A;  1YZX A;  2QSI A;  4YQU A;  5IMD A;  1TOF A;  2P5Q A;  4IVF A;  5ECK B;  2R5G A;  1THO A;  1OC8 A;  5HFK A;  2WJU A;  5IOW A;  1SD8 A;  4PNF A;  2LRC A;  2VCT A;  3FRC A;  1SK0 A;  1FOV A;  5HFG A;  2YOI A;  1X9W B;  3L9V A;  5IO2 A;  5DAK A;  2LQQ A;  4V2N A;  5ABR A;  3KH7 A;  2HE3 A;  4KF9 A;  4ZIJ A;  5F05 A;  4AF2 A;  4JZQ A;  1AQV A;  2OBI A;  1M2D A;  2HSM B;  1VGL A;  1MDJ A;  2EIR A;  2LS5 A;  1A0F A;  1WMJ A;  2HNL A;  3ZIT A;  4RI6 A;  4I5Q A;  1BYE A;  4HQS A;  1UA5 A;  2HSN A;  4TW5 A;  3CTG A;  2VCV A;  3D5J A;  3WGD A;  3CXG A;  3RPN A;  2VD1 A;  3GST A;  1ERU A;  4GWR A;  1N2A A;  2JL4 A;  2DJK A;  2I3Y A;  1JFU A;  3QDN A;  2ZCT A;  2PUK C;  1GUM A;  5B6N A;  3DKS A;  4J56 E;  4ZBB A;  3U6V A;  3EPT A;  1RK4 A;  1FHE A;  2AHE A;  3RHB A;  1SKS B;  2B7K A;  3FR3 A;  2MBT A;  3HVS A;  2CVD A;  5J4V A;  5J4Y A;  1N25 A;  1U6T A;  5ECR B;  5G5E A;  4O5U A;  1W89 A;  3BD2 A;  3ZRD A;  5H5Q A;  4ACS A;  2VLU A;  1JZW A;  4N3Z A;  2ON5 A;  4CHS A;  2C1Y A;  2L5O A;  1CQG A;  4I2U A;  4IW9 A;  4EUY A;  3A5I A;  3GL3 A;  3FZ5 A;  2X99 A;  1FB6 A;  3TOU A;  1XWG A;  4ZB7 A;  1F6M C;  2X49 A;  1YEX A;  3L9U A;  5FHI A;  3GYK A;  3AY8 A;  3O6T A;  5HQP A;  4KSO A;  4TR1 A;  3KCM A;  2R37 A;  4HDE A;  1GTB A;  2C3T A;  2HRK B;  2DIY A;  3FZ9 A;  4EIQ A;  5ID2 A;  5CRE A;  2KUC A;  5J41 A;  5CNW A;  5B8A A;  2RUE A;  4K2X A;  5DVB A;  3PR8 A;  2A4V A;  5F07 A;  4DSQ A;  2WUL A;  5HR3 A;  4X43 A;  1BAY A;  1R5P A;  2CZ3 A;  1ST9 A;  3FMW A;  1CQH A;  3O3T A;  3RPP A;  4X0X A;  1TI3 A;  4AKX B;  4LL4 B;  2H1L A;  2DJ1 A;  4MZC A;  3UJ1 A;  3VWW A;  4TKY A;  1GSY A;  11GS A;  1YKA A;  1BX9 A;  1GLQ A;  1PMT A;  3VWX A;  1H75 A;  2RUF A;  2YZU A;  5J9B A;  1AW9 A;  3LXT A;  3I6A A;  5CRG A;  4X1U A;  5G1L A;  3F0I A;  1Z9H A;  5LNK e;  9GSS A;  4G0I A;  2O87 A;  2WFC A;  4MH3 A;  5CRD A;  3UAR A;  1Z6M A;  4V2L A;  5G30 A;  2O89 A;  4USS A;  2CAQ A;  2R0P A;  2HT9 A;  1EEJ A;  3FHK A;  1ZMA A;  3TU3 B;  1B8X A;  4PTS A;  2DJ2 A;  2IMD A;  1XVW A;  1BJX A;  4KDU A;  5IMV A;  3LYK A;  2FA8 A;  1WE0 A;  3L9S A;  2D2Z A;  1A8L A;  2J23 A;  1WPI A;  1ON4 A;  5G1K A;  2IWT A;  5B7C A;  3D22 A;  1TI1 A;  1A2J A;  3MYD A;  3KMO A;  4CY8 A;  3N9J A;  3N5O A;  2YV9 A;  3DGQ A;  1LJR A;  3RHC A;  4L5O A;  2MZC A;  2K9F A;  3JCM L;  2JZS A;  2V6O A;  4FYU A;  4IS0 A;  4A5P A;  2C0D A;  4OFN A;  3A5W A;  1TKD B;  5CO3 A;  3M9J A;  2FUG 2;  1ZYQ B;  2CT6 A;  1SVO A;  5DBQ A;  4MA9 A;  1YKC A;  3QFB C;  5ECN B;  4G10 A;  5DAL B;  1T3B A;  3L78 A;  4V1A g;  3G7I A;  2R3X A;  4JED A;  2GQK A;  3LW9 A;  2NPB A;  3UL3 A;  2OAD A;  3Q74 A;  2DJ0 A;  6GSX A;  4POB A;  2DIZ A;  3D4T A;  1MDI A;  3LFL A;  4TXV A;  2YV7 A;  3WGX A;  2E2G A;  1ZGN A;  2VL2 C;  5IMA A;  5IPH A;  3GN3 A;  2L57 A;  3IAM 2;  3APS A;  4TR4 A;  3D0Z A;  3HVV A;  3A2W A;  4FIW A;  1NHY A;  2VAF A;  3H8Q A;  3P90 A;  4KH7 A;  4N0Z A;  4BL7 B;  2AUV A;  3TJK A;  3E3E A;  4TOP A;  4IQ1 A;  2X8G A;  2FLS A;  4WEY A;  1USB A;  4GST A;  4J2F A;  2C3Q A;  6GSW A;  3TJJ A;  1PN0 A;  3EWL A;  1M9A A;  5J47 A;  3OR5 A;  1HD2 A;  1YVL A;  2H19 A;  5FT3 A;  3ERG A;  4NMU A;  3LJR A;  2C0G A;  2OE1 A;  1WP0 A;  3ISO A;  3BCK A;  5INY A;  2I9H A;  3ME8 A;  5G5F A;  4ZB9 A;  4DEJ A;  1O73 A;  3LYP A;  4FQU A;  1BF5 A;  4BVX B;  2HI7 A;  2V41 A;  4ZL9 A;  3EMP A;  22GS A;  1PQN A;  2H74 A;  5A1N A;  2QC7 A;  2YAN A;  1Z3E A;  2L6C A;  4E68 A;  2LEG A;  3PIN A;  4K1F A;  3E0U A;  4OWY A;  1TU7 A;  4KDY A;  3DEX A;  1ZYE A;  4QQ7 A;  1FB0 A;  3C1R A;  4TVE A;  3BOA A;  1AUC A;  2GSS A;  1O6J A;  4AJ6 A;  2YN1 A;  4G2E A;  5D9X A;  1ZCP A;  4FYB A;  3G7Y A;  4Z7X A;  2YPM A;  1ML6 A;  1T4Z A;  4Z2U A;  1GNW A;  3TJB A;  4F0C A;  2CA8 A;  1DUG A;  2IN3 A;  3HVX A;  3QR6 A;  1SU9 A;  4G19 A;  2PU9 C;  1KNG A;  4ILF A;  4K0G A;  1HYU A;  2XBI A;  5C00 A;  5ECL B;  4ZIL A;  5F06 A;  2FA4 A;  3MSZ A;  4MF5 A;  4D73 A;  4IHU A;  4GF0 A;  2MBS A;  4OO5 A;  4TRX A;  1TXX A;  2RLI A;  3TKS C;  2K8V A;  1F37 A;  1K0O A;  4I2T A;  3ZIJ A;  3IAS 2;  3LOR A;  5IOX A;  2HRN A;  3WT1 A;  5D73 A;  1M2A A;  1Z6N A;  4KAE A;  2YZH A;  4XRA A;  4MLY A;  2FWH A;  1V58 A;  3IXR A;  3F6D A;  1HNB A;  4MPF A;  1EEM A;  4XS4 B;  3L4N A;  1M2B A;  3EE2 A;  3GTU A;  3M9K A;  3VLN A;  3HA9 A;  5JCW A;  4EDZ A;  5CRH A;  2H71 A;  2VCW A;  4OCE A;  4IP1 A;  1OC9 A;  1YQ1 A;  1J08 A;  1F3A A;  1OAZ A;  1WJK A;  2VCQ A;  3GX0 A;  5A4U A;  4P3Y B;  3GNJ A;  4OD7 A;  2IFQ B;  2HXK A;  1SJI A;  3KXO A;  3F6F A;  3IOS A;  4K7N A;  4K7O A;  2CX3 A;  1TDI A;  4N30 A;  2XBQ A;  2IL3 A;  1DSB A;  1Q98 A;  4HOJ A;  1T4Y A;  1GTI A;  2EC4 A;  2GZY A;  3IC4 A;  4HJ2 A;  3ZML A;  2WZ9 A;  5ECI B;  1K0A A;  1TRS A;  5DAK B;  4KND A;  1WRY A;  2V32 A;  2O7K A;  1EWX A;  3C1S A;  4O7H A;  2FWE A;  2C8U A;  1GWC A;  5AIX A;  4AKG A;  2BMX A;  3TJF A;  3IC8 A;  1JLV A;  1TRW A;  4QMK A;  1EP8 A;  1FVJ A;  2GQL A;  2AJQ B;  2L59 A;  4JR6 A;  1R7H A;  2HSN B;  2R0C A;  4JRR A;  2NDO A;  2DBC A;  4HS1 A;  1A0R P;  1AC1 A;  1JZD A;  4K9Z A;  3IV4 A;  1VF3 A;  2REM A;  2CZ2 A;  2H1D A;  3LXZ A;  18GS A;  1HQO A;  3LWA A;  2MMO A;  5L71 A;  2H30 A;  5G31 A;  4OFM A;  3ZTL A;  3QCP A;  3P2A A;  1M7T A;  4CDO A;  1PKW A;  4ML6 A;  4AJ7 A;  4G0K A;  3QAG A;  4ID0 A;  4EO3 A;  4Q5R A;  4JBB A;  1V57 A;  5DQY A;  3W6G A;  2OT3 A;  4HZ4 A;  5A4V A;  4GDF A;  2JSY A;  2C80 A;  4BWQ A;  4L0U A;  4KCA A;  5GZZ B;  2OBK A;  4KW6 A;  1A2M A;  4QL9 A;  2L6D A;  4K6X A;  3ZL5 A;  1E2Y A;  5A5K A;  5IIZ A;  1O8W A;  2KLX A;  3FKF A;  4I8B A;  4IJI A;  4TXO A;  2B5E A;  3FK8 A;  1B4P A;  4TR1 B;  1THX A;  1ACV A;  1M99 A;  1WIK A;  3MNG A;  1QGV A;  4YQV A;  2YJ7 A;  1KBN A;  5ID2 B;  4YH2 A;  2GLR A;  4ZBA A;  3FZA A;  5A34 A;  3EIN A;  3F9U A;  1GP1 A;  4IJ3 A;  1X9M B;  2WRT A;  1PA3 A;  5H5S A;  5GSS A;  4MF7 A;  2MMN A;  3ZFL A;  1GL8 A;  3F63 A;  5ECQ B;  3H1N A;  2TRC P;  3C73 A;  4EKZ A;  3PGT A;  1PKZ A;  4Q5Q A;  5CRW A;  2PBJ A;  5J5N A;  2PVQ A;  4EF0 A;  2OKA A;  1PGT A;  3G9B A;  1QFN A;  2OAC A;  4PX1 A;  2DSA A;  3F4R A;  3ERF A;  4KB3 A;  5CAX A;  4MK3 A;  1XW6 A;  2H0I A;  2A2P A;  1XW5 A;  2O5V A;  1SEN A;  4OFT A;  4Q5N A;  1TRU A;  3ZMK A;  1S3A A;  1TTZ A;  3F3R A;  3K8N A;  2YCD A;  4GSS A;  2RM5 A;  4WXT A;  5ENU A;  5IQY A;  5J3R A;  1S3D A;  3DML A;  1UN2 A;  1XOA A;  1SL2 B;  5ECM B;  3VUR A;  1XWK A;  5EL8 A;  2EFC A;  1MEK A;  3ME7 A;  3KM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...