1IYKA

Crystal structure of candida albicans n-myristoyltransferase with myristoyl-coa and peptidic inhibitor
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
392
structure length
392
Chain Sequence
EGPIDKLKTPEDVPNDPLPLISDFEWSTLDIDDNLQLDELYKLLYDNYVEDIDATFRFKYSHEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVTFKLNKSNKVIDSVEINFLCIHKKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPTPLTTCRYQHRPINWSKLHDVGFSHLPPNQTKSSMVASYTLPNNPKLKGLRPMTGKDVSTVLSLLYKYQERFDIVQLFTEEEFKHWMLGHDENSDSNVVKSYVVEDENGIITDYFSYYLLPFTVLDNAQHDELGIAYLFYYASDSFEKPNYKKRLNELITDALITSKKFGVDVFNCLTCQDNTYFLKDCKFGSGDGFLNYYLFNYRTFPMDGGIDKKTKEVVEDQTSGIGVVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYRISTOYL-COA:PROTEIN N-MYRISTOYLTRANSFERASE
publication title Crystal Structures of Candida albicans N-Myristoyltransferase with Two Distinct Inhibitors
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 117
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iykA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iykA02
2FS5A 3EY5A 4R57A 5KTCA 2VZZA 4H6UA 3E0KA 3ZZIA 4HNYB 2X7BA 4YGOA 2B58A 4EVYA 1XEBA 4KOXA 1S7FA 3PZJA 3QB8A 4OADA 5F49A 1CJWA 3W6SA 1QSOA 1IIDA 1FY7A 2KCWA 1M4GA 4JD6A 3TT2A 4AVCA 5H84A 3W91A 4AVAA 5HH1A 3KKWA 3ZJ0A 2PQ8A 3F5BA 2OH1A 2Z10A 1MJBA 2K5TA 1YVKA 5E96A 2I00A 2GE3A 2Q7BA 4NEXA 4HNWB 2VXKA 4AVBA 2IL4A 4R3LA 3V8IA 1N71A 2OZUA 4LUAA 3SXOA 2PR8A 4JLYA 2HQYA 2QECA 2R1IA 3R96A 4E2AA 3PGPA 1IICA 4H89A 4MY3A 1MK4A 2CNTA 2CNMA 3EC4A 4U5YA 4H6ZA 4U9ZA 4FD5A 3D3SA 4OLLA 4MY0A 2Q4YA 1XE4A 2F5IA 2OZHA 4B5PA 4XPKA 5EC4A 3TTHA 3IWGA 1Z9UA 1P4NA 2J8MA 2VI7A 2CY2A 3EO4A 4BMHA 3EFAA 2AE6A 3LODA 4CRZB 2Q04A 1WWZA 1BO4A 1P0HA 5JPHA 2OB0A 2CNSA 1OZPA 3CXSA 3NE7A 4UBRA 3VWDA 3R9GA 3DNSA 1GHEA 3R9FA 1RXTA 2BL1A 3FXTA 2FSRA 2Y0MA 5I0CA 3EXNA 2GIVA 2Z0ZA 1QSTA 1M4IA 1M4DA 1QSNA 4KUAA 1BOBA 1NE9A 1XIXA 4MHDA 4AB7A 4KOVA 3DDDA 4QUSA 4ORFA 2B3VA 4NCZA 2P6EA 4J3GA 2PSWA 4CAWA 1TIQA 3OWCA 5IB0A 4ONUA 4R87A 3TCVA 2WPWA 2B5GB 3TO9A 1M44A 3P2HA 3I3GA 4FD6A 2ZPAA 2BUEA 2H5MA 4XPDB 2PR1A 4KOUA 4KZTA 4I49A 5CNPA 3IGRA 4LX9A 2FIAA 3P2FA 2EVNA 4PSXA 3TFYA 1Y7RA 4FD7A 4CRYB 4IUSA 2JLMA 5EBVA 2A4NA 3DSBA 3D2PA 2P6FA 2BSWA 4AG9A 3TO6A 5IX3A 1LRZA 1MJ9A 1M1DA 2EUIA 4KUBA 4PK2A 2VZYA 3TO7A 3UY5A 5KTDA 4UA3A 4YFJA 5F47A 2QMLA 5DWNA 5F48A 5FVJA 2C27A 1Z4EA 1QSRA 3H4QA 4JXQA 2B4DA 2ZW5A 3MGDA 1YR0A 3FRMA 4NXYA 1PU9A 2J8NA 4B5PB 3FNCA 3FBUA 2G0BA 1S3ZA 2R98A 3SHPA 2DXQA 3FIXA 4Y49C 4HKFA 3T90A 3D8PA 3S6KA 1S7NA 4CAVA 2FE7A 3TE4A 1S7KA 2QIRA 4XPLA 5C88A 4JXRA 1KUXA 1Y9WA 3JUWA 2G3AA 1NMTA 4R3KA 4JJXA 4KOSA 2FXFA 2PDOA 2PC1A 4X5KA 4XNHB 3R9EA 3K9UA 2ZXVA 2JDCA 1YLEA 5C82A 4KVXA 2NMTA 4QBJA 4QB9A 1I12A 2PRBA 4KLVA 1J4JA 3F8KA 2AJ6A 4FD4A 3C26A 1IYLA 1YX0A 2D4OA 3QAHA 4PK3A 3CXQA 4OAEA 1RO5A 4AG7A 5ISVA 1ON0A 3DR8A 2P0WA 3BJ8A 2Q44A 4KOYA 1WK4A 3T9YA 3I9SA 4B5OA 4II9A 2VQYA 1KZFA 3G8WA 3DR6A 1IB1E 1V0CA 3F0AA 4MJ8A 4DNCA 3FYNA 4MBUA 3S6GA 1S7LA 3BJ7A 3BLNA 4RS2A 2JDDA 4HNXB 1S60A 1SQHA 2Q4VA 2ZW7A 1Q2DA 3S6HA 1CM0A 3W6XA 3FB3A 4F0YA 4IF5A 3S6FA 1YGHA 2B5GA 4MI4A 1KUVA 1U6MA 2GANA 5J8FA 4M3SA 1Z4RA 3R1KA 3R95A 3GKRA 5HMNA 4NF1A 2REEA 3D2MA 1R57A 4U9YA 2ZW6A 4QC6A 4UWIA 1L0CA 4L8AA 1B87A 4KVME 5F46A 1XF8A 1I21A 4CS0B 2B4DB 3GYAA 5J8CA 1B6BA 1VHSA 4E8OA 2O28A 4RI1A 2I79A 4XNHC 4KLWA 3JVNA 4E0AA 1VKCA 4K30A 2B3UA 2VEZA 5JQ4A 2ATRA 1Y9KA 2HUZA 2OZGA 3G3SA 2ARHA 2B4BA 4KOTA 4M85A 5DWMA 3VWEA 2OU2A 5H86A 1KUYA 2FIWA 2REFA 4ZBGA 4CAXA 1IYKA 1UFHA 5IV0A 1Q2YA 5KTAA 4GS4A 3TOBA 2BEIA 2Z11A 4F6AA 1YK3A 1YVOA 1I1DA 2R8VA 2FL4A 3PP9A 2G3TA 2ZW4A 4NSQA 1K4JA 2R7HA 4YRHA 4PV6A 4Y49B 2D4PA 1NSLA 4R9MA 1Q2CA 3RYOA 4PSWA 3LD2A 3GY9A 3SXNA 1XMTA 4KOWA 1YREA 2WPXA 2FCKA 2Q0YA 2HV2A 3TOAA 3N7ZA 4KVOE 3WR7A 4XPDC 1QSMA 1MJAA 2VBQA 2J8RA 2RC4A 4L89A 4KORA 5GCNA 4UWJA 2FT0A 4JWPA 1PUAA 4QVTA 3CXPA 1S5KA 3B8GA 2P6GA 2JEVA
chains in the Genus database with same CATH superfamily
3QNVA 2FS5A 3EY5A 5THWA 3SI1A 3PRTA 4NGTA 4R57A 2NYQA 5KTCA 2ZOFA 2VZZA 4H6UA 3E0KA 4A30A 4DUKA 1KWMA 2OR4A 4C68A 3ZZIA 4HNYB 2EO8A 1YSJA 4CGOA 4A2ZA 2X7BA 4NJQA 4YGOA 3KL9A 2B58A 3BI1A 2QYVA 3MRUA 2Q51A 4EVYA 1XEBA 3FJUA 1S7FA 3PZJA 3QB8A 4KOXA 4OADA 5F49A 1CJWA 3W6SA 1QSOA 1IIDA 1FY7A 2KCWA 1M4GA 2GREA 4JD6A 3D7GA 5H84A 3TT2A 3W91A 4Q36A 3BHXA 4UCNA 4AVAA 5HH1A 3VARA 3KKWA 1GYTA 3VH9A 4MCPA 2YNCC 3ZJ0A 2PQ8A 5CBMA 1JWQA 3LWUA 5G21A 1LCPA 4MFPA 3F5BA 2OH1A 1Q7LA 2PJ8A 1F57A 5IB9A 5JGFA 4DYOA 3HUVA 2V8VA 3KQZA 1XRYA 3K9TA 3KQXA 4IHMA 4OC4A 5DS0A 3HLPA 8CPAA 3CDXA 2Z3OA 2Z10A 3BI0A 1Z8XA 3CPAA 4OC3A 1MJBA 2K5TA 1YVKA 5E96A 2I00A 2GE3A 3IWWA 3NA6A 4NEXA 2Q7BA 4HNWB 5LRKA 2VXKA 5HVFA 2IL4A 4WWVA 4AVBA 4R3LA 3V8IA 2C1CA 3D7FA 2AFMA 4FUUA 4OIDA 4M6HA 4P44A 4F8ZA 4NGPA 1N71A 3PB7X 2BCOA 2OZUA 4C7IA 3D66A 4LUAA 4WJBA 3SXOA 1IGBA 1YQEA 2PR8A 4JLYA 2V77A 2HQYA 1Z8TA 2QECA 2R1IA 2PVWA 4PXDA 3R96A 4E2AA 1PCAA 3ISXA 3PGPA 1IICA 4H89A 4MY3A 1MK4A 2CNTA 2PJCA 2CNMA 1BLLE 3EC4A 3PB4X 4U5YA 4H6ZA 4U9ZA 4FD5A 4R8FA 3D3SA 4OLLA 4MY0A 2Q4YA 2PIZA 2YNCA 1XBUA 1XE4A 2F5IA 2OZHA 1AUGA 4P6YA 4ZX9A 4B5PA 4C2XA 1EE3P 4NJRA 4XPKA 5EC4A 3TTHA 4X8IA 3IWGA 3CPXA 1Z9UA 1P4NA 2GU2A 2WSAA 2J8MA 2O4HA 3IIBA 2YNEA 2VI7A 4KS9A 2CY2A 3EO4A 4BMHA 1LOKA 3EFAA 4PXCA 4UIAA 2AE6A 3LODA 2PCUA 3D7HA 2EK8A 5LRGA 4CRZB 3B3CA 1QMUA 3V7ZA 2Q04A 1WWZA 4C7HA 1BO4A 1TKHA 4KSIA 1P0HA 3B3TA 5JPHA 3H8EA 5A27A 2OB0A 2CNSA 4C2ZA 1OZPA 2VL1A 3CXSA 3H8GA 3NE7A 4UBRA 4UCMA 4P4FA 3DLJA 3VWDA 3KHZA 5BWAB 2J9AA 4P4DA 3R9GA 4MHPA 3DNSA 1GHEA 3R9FA 4TNUA 5AG4A 1RXTA 2BL1A 3FXTA 4CAEA 2PJ2A 2RB7A 2FSRA 3FECA 3IFEA 2IMOA 2Y0MA 2WZNA 5I0CA 3EXNA 2GIVA 2Z0ZA 1QSTA 1M4IA 1M4DA 1QSNA 2ZEOA 3B2YA 4KUAA 4CAFA 4CGPA 1BOBA 1NE9A 2Q4ZA 1XIXA 1Z8LA 2DPSA 3CT9A 3FVLA 2ZENA 4MHDA 4AB7A 3RAMA 3D68A 4KOVA 3DDDA 4QUSA 3IWEA 4ORFA 1RTQA 2B3VA 3K2KA 4NCZA 4PXEA 1X10A 2AFWA 2P6EA 3PFEA 4J3GA 2PSWA 4CAWA 1F2PA 1TIQA 3KI9A 3OWCA 4A31A 1YW6A 5IB0A 3FH4A 4ONUA 2EK9A 4R87A 2HB6A 2PJAA 3TCVA 2WPWA 1ZO0A 2B5GB 2AFZA 3PBEA 3TO9A 1M44A 3TX8A 3P2HA 3I3GA 2Q43A 4FD6A 3RBUA 5I4MA 1TXRA 3GB0A 2ZPAA 2BUEA 1TKFA 2PJ0A 3WT4A 2C6GA 3IEHA 2H5MA 4XPDB 2PR1A 4KOUA 1CBXA 1DE4C 4B10A 4KZTA 4B6ZA 1PYTB 4I49A 5CNPA 3IGRA 4LX9A 4P4IA 4A37A 2FIAA 3P2FA 4A95A 5JM6A 1M4LA 2EVNA 4PSXA 3SJXA 3TFYA 1Y7RA 4B13A 4CYOA 4FD7A 4CRYB 4UCPA 2CIJA 4IUSA 2JLMA 5EBVA 2ZEGA 4NFRA 2A4NA 2V8GA 4CYPA 2PJ4A 3DSBA 3D2PA 3SI2A 4EWTA 2P6FA 5G20A 3SJEA 2BSWA 4AG9A 3TO6A 3VATA 4AVCA 2DF5A 1LFWA 5IX3A 4MCQA 1LRZA 1MJ9A 2CTCA 1M1DA 2PJ6A 4OIWA 1HEEA 2EUIA 5K8OA 4KUBA 4PK2A 2VZYA 3TO7A 1IOIA 3UY5A 5KTDA 4DJLA 1ELMP 3GUXA 3PEIA 4UA3A 4F9VA 4YFJA 4UEZA 2AFXA 2CF4A 3V38A 2RFHA 5F47A 3MN8A 4MCSA 4A39A 2Z3PA 2QMLA 3B7IA 1TKJA 2BOAA 4NGSA 2I3CA 3FF3A 4C2YA 5DWNA 5F48A 4MHYA 2C27A 4MXUA 1Z4EA 4P10A 5FVJA 7CPAA 1QSRA 1X12A 3H4QA 3H5ZA 4JXQA 4ZY0A 2B4DA 3PB8X 2ZW5A 1NSAA 1YR0A 2GFQA 3FEDA 3MGDA 3FRMA 2GLJA 4R6TA 4NXYA 4BINA 1CPSA 1PU9A 2J8NA 3FX6A 5AG5A 4B11A 4M6GA 4B5PB 3FNCA 4KSFA 3JRUA 3FBUA 4GXHA 5LRJA 2JBJA 2G0BA 1S3ZA 1LAPA 2PJBA 2DXQA 2R98A 3FIXA 2CTBA 3SHPA 1VIXA 4Y49C 4HKFA 1LAMA 1CX8A 2ZOGA 3D8PA 4R76A 5D29A 3S6KA 3T90A 1S7NA 1QQ9A 2FE7A 3I1UA 4CAVA 5K8NA 3KZWA 4FWUA 2DPTA 3TE4A 1S7KA 4ZX8A 2QIRA 4XPLA 4UF4A 5C88A 3WC5A 1Y7EA 4GM5A 4JXRA 1YMEA 4RUHA 4OC2A 3NFZA 1KUXA 1Y9WA 3NH5A 3SI0A 3JUWA 2AFUA 1ELLP 2C6PA 2G3AA 2Z3NA 1NMTA 2PE3A 3NE8A 4ZY1A 3IC1A 4JJXA 4KOSA 2FXFA 2PDOA 2PC1A 4R3KA 4X5KA 4XNHB 4A94A 3KASA 3R9EA 3K9UA 4RN7A 3FEEA 4YWYA 4A38A 2POKA 2ZXVA 2PVVA 2Z3LA 2JDCA 1YLEA 4IK2A 4Q7AA 4R7MA 5LYIA 5C82A 4KVXA 3GLJA 2NMTA 4QBJA 4UFWA 1IY7A 4QB9A 1I12A 2PRBA 4KLVA 1Z5RA 5G1ZA 1J4JA 3BXMA 1CPXA 4NGNA 3F8KA 2AJ6A 4FD4A 1OBRA 1IYLA 3C26A 4G1PA 5K8PA 1YX0A 3SJFA 4JZ0A 2D4OA 3ISZA 3QAHA 4F9UA 1AYEA 2QVPA 1VGYA 3CXQA 4PK3A 4OAEA 1RO5A 5CPAA 4AG7A 4FAIA 5ISVA 1ON0A 3DR8A 2P0WA 3BJ8A 2Q44A 4MFKA 3WC7A 4KOYA 1TF8A 4X2TA 3RNZA 1WK4A 1AMPA 2F8HA 3L2NA 1ZLIA 2V8DA 3WC6A 4UEFA 2Q7SA 2ZEFA 3T9YA 2BO9A 3I9SA 5AG7A 3RO0A 3KR5A 4B5OA 2WYRA 4MMOA 3FMCA 2GLFA 5D8NA 4II9A 2VQYA 3NH8A 1KZFA 3G8WA 4OC1A 4UIBA 1ARLA 1R3NA 3DR6A 5A28A 3A9LA 1IB1E 4TWEA 4MFJA 4OP4A 4YU9A 1CG2A 2PJ1A 1V0CA 3KGQA 4KSAA 2DEAA 1CP7A 3F0AA 4MJ8A 4DNCA 1HDQA 3FYNA 1ARMA 4BBHA 2ZEPA 2ODFA 3D4UA 4MBUA 3S6GA 1S7LA 2QJ8A 3BJ7A 3BLNA 3PB9X 4RS2A 3B3SA 2JDDA 1IOFA 4HNXB 1S60A 1SQHA 2NSMA 4LQGA 5AGEA 2Q4VA 2ZW7A 4CPAA 1VHOA 1Q2DA 3S6HA 1CM0A 3W6XA 3FB3A 4HPSA 4F0YA 3SJGA 4IF5A 4P45A 4CYQA 3S6FA 1YGHA 2B5GA 4MI4A 2OOTA 2G9DA 1YW4A 4P4BA 1ZG9A 2PRQA 4K3NA 4OKOA 1KUVA 2GANA 1U6MA 2EBJA 1Y0YA 1BPNA 4M3SA 5J8FA 1Z4RA 3PFOA 1F2OA 3R1KA 4MRIA 4O23A 2ZEMA 5AG6A 3R95A 6CPAA 5HVHA 3GKRA 5HMNA 2ZELA 4NF1A 4UFXA 5HVGA 2REEA 2ANPA 3D2MA 3B3WA 4AXVA 1R57A 2YNDA 1DTDA 2HC9A 4U9YA 2ZW6A 4QC6A 2Z3MA 2ZEDA 4UWIA 1ZLHA 2FVGA 1L0CA 2XEIA 1BPMA 1B87A 4L8AA 2PJ7A 4KVME 3QAYA 1YLOA 4A32A 5F46A 1XF8A 3RZAA 2CXAA 1I21A 1VHEA 1ZG8A 2F7VA 3IO1A 4CS0B 1IU8A 2B4DB 3GYAA 5JH9A 5J8CA 4UFVA 1B6BA 1VHSA 4E8OA 2PJ9A 5LYDA 1XOVA 2O28A 3KHXA 4RI1A 4CGMA 4MFQA 2I79A 3PBBA 4MCRA 4XNHC 4KLWA 4OC0A 2PJ5A 3JVNA 4E0AA 4Q38A 1VKCA 4K30A 4JYWA 2B3UA 4PQAA 2VEZA 3KR4A 2ATRA 5JQ4A 4ZYQA 1Y9KA 2HUZA 2OZGA 4CGNA 3G3SA 2ARHA 2B4BA 4KOTA 4M85A 2AFOA 2C6CA 4OMEA 1LANA 2EWBA 5DWMA 4UEEA 3VWEA 5LYLA 2XEGA 2JEWA 2OU2A 4P4JA 4W9YA 5H86A 5K8MA 1ZG7A 1KUYA 2FIWA 2REFA 2WUUA 3LMSA 1Z2LA 2PJ3A 3H8FA 4ZBGA 1IYKA 1UFHA 4CAXA 4F0XA 4EMEA 4M6IA 5IV0A 3NH4A 4ZI6A 1Q2YA 1JQGA 5KTAA 3PB6X 3IJ3A 4GS4A 3TOBA 2BEIA 2Z3KA 1FNOA 2Z11A 4F6AA 4ONWA 1CP6A 2XEFA 1YK3A 4NGQA 1HDUA 1YVOA 1I1DA 3JTKA 4PPZA 2R8VA 4PXBA 2FL4A 4MHNA 5LYFA 2JBKA 3DGVA 4B14A 1TF9A 2G3TA 3PP9A 2ZW4A 4NSQA 2ABZA 1K4JA 2O53A 2R7HA 4H2KA 3B35A 4BD9A 2IJZA 2XEJA 4EFDA 4YRHA 4PV6A 4Y49B 3WABA 5HXDA 2V8HA 5EMIA 4CGLA 2D4PA 4MHZA 3D7DA 1NSLA 5F09A 4OC5A 4R9MA 1Q2CA 4P4EA 1R43A 1XJOA 1XMBA 3RYOA 4NGRA 3IU2A 4PSWA 3LD2A 1H8LA 4ZY2A 3B3VA 3GY9A 2IQ6A 4MFZA 3SXNA 1XMTA 1A2ZA 1YREA 2WPXA 2FCKA 4KOWA 2Q0YA 2HV2A 2PIYA 3TOAA 3S9NA 3N7ZA 4KVOE 2AFSA 3D67A 4B12A 3WR7A 4XPDC 3TC8A 1QSMA 1XFOA 1MJAA 3N5FA 1BAVA 2VBQA 4CYNA 4ZGYB 2J8RA 2RC4A 2ZEEA 3LACA 4NGMA 5J1QA 1UWYA 3T8WA 4MFLA 4L89A 4KORA 3CZXA 4LQ6A 5ELYA 4A33A 5GCNA 4UWJA 4FBEA 4Z65A 1FT7A 2FT0A 4JWPA 1PUAA 4QVTA 1Y0RA 3GIUA 3S9MA 3CXPA 1S5KA 3B8GA 5G22A 2ZEHA 3S9LA 3IU1A 2P6GA 2JEVA 4X3RA 1Z8WA 4IAVA 2YGWA
chains in the Genus database with same CATH topology
2FS5A 3EY5A 4R57A 5KTCA 2VZZA 4H6UA 3E0KA 4A30A 4C68A 3ZZIA 4HNYB 4CGOA 4A2ZA 2X7BA 4YGOA 2B58A 4EVYA 1XEBA 4KOXA 1S7FA 3PZJA 3QB8A 4OADA 5F49A 1CJWA 3W6SA 1QSOA 1IIDA 1FY7A 2KCWA 1M4GA 4JD6A 3TT2A 4AVCA 5H84A 3W91A 4Q36A 4UCNA 4AVAA 5HH1A 3KKWA 2YNCC 3ZJ0A 2PQ8A 5G21A 4MFPA 3F5BA 2OH1A 2Z3OA 2Z10A 1MJBA 2K5TA 1YVKA 5E96A 2I00A 2GE3A 2Q7BA 4NEXA 4HNWB 2VXKA 4AVBA 2IL4A 4R3LA 3V8IA 1N71A 2OZUA 4C7IA 4LUAA 3SXOA 2PR8A 4JLYA 2HQYA 2QECA 2R1IA 3R96A 4E2AA 3PGPA 1IICA 4H89A 4MY3A 1MK4A 2CNTA 2CNMA 3EC4A 4U5YA 4H6ZA 4U9ZA 4FD5A 3D3SA 4OLLA 4MY0A 2Q4YA 2YNCA 1XE4A 2F5IA 2OZHA 4C2XA 4B5PA 4XPKA 5EC4A 3TTHA 3IWGA 1Z9UA 1P4NA 2WSAA 2J8MA 4KS9A 2YNEA 2VI7A 2CY2A 3EO4A 4BMHA 3EFAA 2AE6A 3LODA 4CRZB 2Q04A 1WWZA 4C7HA 1BO4A 1P0HA 5JPHA 5A27A 2OB0A 2CNSA 4C2ZA 1OZPA 3CXSA 3NE7A 4UBRA 4UCMA 3VWDA 5BWAB 3R9GA 3DNSA 1GHEA 3R9FA 5AG4A 1RXTA 2BL1A 3FXTA 4CAEA 2FSRA 2Y0MA 5I0CA 3EXNA 2GIVA 2Z0ZA 1QSTA 1M4IA 1M4DA 1QSNA 4KUAA 4CAFA 4CGPA 1BOBA 1NE9A 1XIXA 2DPSA 4MHDA 4AB7A 4KOVA 3DDDA 4QUSA 3IWEA 4ORFA 2B3VA 4NCZA 2P6EA 4J3GA 2PSWA 4CAWA 1TIQA 4A31A 3OWCA 5IB0A 4ONUA 4R87A 3TCVA 2WPWA 1ZO0A 2B5GB 3TO9A 1M44A 3P2HA 3I3GA 4FD6A 2ZPAA 2BUEA 2H5MA 4XPDB 2PR1A 4KOUA 4B10A 4KZTA 4I49A 5CNPA 3IGRA 4LX9A 2FIAA 3P2FA 4A95A 2EVNA 4PSXA 3TFYA 1Y7RA 4B13A 4CYOA 4FD7A 4CRYB 4UCPA 4IUSA 2JLMA 5EBVA 2A4NA 4CYPA 3DSBA 3D2PA 2P6FA 5G20A 2BSWA 4AG9A 3TO6A 5IX3A 1LRZA 1MJ9A 1M1DA 2EUIA 4KUBA 4PK2A 2VZYA 3TO7A 3UY5A 5KTDA 4UA3A 4YFJA 5F47A 2Z3PA 2QMLA 4C2YA 5DWNA 5F48A 5FVJA 2C27A 1Z4EA 1QSRA 4JXQA 3H4QA 3H5ZA 2B4DA 2ZW5A 3MGDA 1YR0A 3FRMA 4NXYA 1PU9A 2J8NA 5AG5A 4B11A 4B5PB 3FNCA 4KSFA 3FBUA 2G0BA 1S3ZA 2R98A 3SHPA 2DXQA 3FIXA 4Y49C 4HKFA 3T90A 3D8PA 3S6KA 1S7NA 4CAVA 2FE7A 2DPTA 3TE4A 1S7KA 2QIRA 4XPLA 5C88A 4JXRA 1KUXA 1Y9WA 3JUWA 2G3AA 2Z3NA 1NMTA 4R3KA 4JJXA 4KOSA 2FXFA 2PDOA 2PC1A 4X5KA 4XNHB 3R9EA 3K9UA 2ZXVA 2Z3LA 2JDCA 1YLEA 5C82A 4KVXA 2NMTA 4QBJA 4UFWA 4QB9A 1I12A 2PRBA 4KLVA 5G1ZA 1J4JA 3F8KA 2AJ6A 4FD4A 3C26A 1IYLA 1YX0A 2D4OA 3QAHA 4PK3A 3CXQA 4OAEA 1RO5A 4AG7A 5ISVA 1ON0A 3DR8A 2P0WA 3BJ8A 2Q44A 4MFKA 4KOYA 1WK4A 3T9YA 3I9SA 5AG7A 4B5OA 4II9A 2VQYA 1KZFA 3G8WA 3DR6A 5A28A 3A9LA 1IB1E 4MFJA 1V0CA 4KSAA 3F0AA 4MJ8A 4DNCA 3FYNA 4BBHA 4MBUA 3S6GA 1S7LA 3BJ7A 3BLNA 4RS2A 2JDDA 4HNXB 1S60A 1SQHA 5AGEA 2Q4VA 2ZW7A 1Q2DA 3S6HA 1CM0A 3W6XA 3FB3A 4F0YA 4IF5A 4CYQA 3S6FA 1YGHA 2B5GA 4MI4A 1KUVA 1U6MA 2GANA 5J8FA 4M3SA 1Z4RA 3R1KA 5AG6A 3R95A 3GKRA 5HMNA 4NF1A 4UFXA 2REEA 3D2MA 1R57A 2YNDA 4U9YA 2ZW6A 4QC6A 2Z3MA 4UWIA 1L0CA 4L8AA 1B87A 4KVME 4A32A 5F46A 1XF8A 2CXAA 1I21A 4CS0B 2B4DB 3GYAA 5J8CA 4UFVA 1B6BA 1VHSA 4E8OA 2O28A 4RI1A 4CGMA 4MFQA 2I79A 4XNHC 4KLWA 3JVNA 4E0AA 4Q38A 1VKCA 4K30A 2B3UA 2VEZA 5JQ4A 2ATRA 1Y9KA 2HUZA 2OZGA 4CGNA 3G3SA 2ARHA 2B4BA 4KOTA 4M85A 5DWMA 3VWEA 2OU2A 5H86A 1KUYA 2FIWA 2REFA 2WUUA 4ZBGA 4CAXA 1IYKA 1UFHA 4F0XA 5IV0A 1Q2YA 5KTAA 4GS4A 3TOBA 2BEIA 2Z3KA 2Z11A 4F6AA 1YK3A 1YVOA 1I1DA 3JTKA 2R8VA 2FL4A 4B14A 3PP9A 2G3TA 2ZW4A 4NSQA 1K4JA 2R7HA 4YRHA 4PV6A 4Y49B 4CGLA 2D4PA 1NSLA 4R9MA 1Q2CA 3RYOA 3IU2A 4PSWA 3LD2A 3GY9A 4MFZA 3SXNA 1XMTA 4KOWA 1YREA 2WPXA 2FCKA 2Q0YA 2HV2A 3TOAA 3N7ZA 4KVOE 4B12A 3WR7A 4XPDC 1QSMA 1MJAA 4CYNA 2VBQA 4ZGYB 2J8RA 2RC4A 4MFLA 4L89A 4KORA 4A33A 5GCNA 4UWJA 2FT0A 4JWPA 1PUAA 4QVTA 3CXPA 1S5KA 3B8GA 5G22A 3IU1A 2P6GA 2JEVA 2YGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS5 A;  3EY5 A;  4R57 A;  5KTC A;  2VZZ A;  4H6U A;  3E0K A;  3ZZI A;  4HNY B;  2X7B A;  4YGO A;  2B58 A;  4EVY A;  1XEB A;  4KOX A;  1S7F A;  3PZJ A;  3QB8 A;  4OAD A;  5F49 A;  1CJW A;  3W6S A;  1QSO A;  1IID A;  1FY7 A;  2KCW A;  1M4G A;  4JD6 A;  3TT2 A;  4AVC A;  5H84 A;  3W91 A;  4AVA A;  5HH1 A;  3KKW A;  3ZJ0 A;  2PQ8 A;  3F5B A;  2OH1 A;  2Z10 A;  1MJB A;  2K5T A;  1YVK A;  5E96 A;  2I00 A;  2GE3 A;  2Q7B A;  4NEX A;  4HNW B;  2VXK A;  4AVB A;  2IL4 A;  4R3L A;  3V8I A;  1N71 A;  2OZU A;  4LUA A;  3SXO A;  2PR8 A;  4JLY A;  2HQY A;  2QEC A;  2R1I A;  3R96 A;  4E2A A;  3PGP A;  1IIC A;  4H89 A;  4MY3 A;  1MK4 A;  2CNT A;  2CNM A;  3EC4 A;  4U5Y A;  4H6Z A;  4U9Z A;  4FD5 A;  3D3S A;  4OLL A;  4MY0 A;  2Q4Y A;  1XE4 A;  2F5I A;  2OZH A;  4B5P A;  4XPK A;  5EC4 A;  3TTH A;  3IWG A;  1Z9U A;  1P4N A;  2J8M A;  2VI7 A;  2CY2 A;  3EO4 A;  4BMH A;  3EFA A;  2AE6 A;  3LOD A;  4CRZ B;  2Q04 A;  1WWZ A;  1BO4 A;  1P0H A;  5JPH A;  2OB0 A;  2CNS A;  1OZP A;  3CXS A;  3NE7 A;  4UBR A;  3VWD A;  3R9G A;  3DNS A;  1GHE A;  3R9F A;  1RXT A;  2BL1 A;  3FXT A;  2FSR A;  2Y0M A;  5I0C A;  3EXN A;  2GIV A;  2Z0Z A;  1QST A;  1M4I A;  1M4D A;  1QSN A;  4KUA A;  1BOB A;  1NE9 A;  1XIX A;  4MHD A;  4AB7 A;  4KOV A;  3DDD A;  4QUS A;  4ORF A;  2B3V A;  4NCZ A;  2P6E A;  4J3G A;  2PSW A;  4CAW A;  1TIQ A;  3OWC A;  5IB0 A;  4ONU A;  4R87 A;  3TCV A;  2WPW A;  2B5G B;  3TO9 A;  1M44 A;  3P2H A;  3I3G A;  4FD6 A;  2ZPA A;  2BUE A;  2H5M A;  4XPD B;  2PR1 A;  4KOU A;  4KZT A;  4I49 A;  5CNP A;  3IGR A;  4LX9 A;  2FIA A;  3P2F A;  2EVN A;  4PSX A;  3TFY A;  1Y7R A;  4FD7 A;  4CRY B;  4IUS A;  2JLM A;  5EBV A;  2A4N A;  3DSB A;  3D2P A;  2P6F A;  2BSW A;  4AG9 A;  3TO6 A;  5IX3 A;  1LRZ A;  1MJ9 A;  1M1D A;  2EUI A;  4KUB A;  4PK2 A;  2VZY A;  3TO7 A;  3UY5 A;  5KTD A;  4UA3 A;  4YFJ A;  5F47 A;  2QML A;  5DWN A;  5F48 A;  5FVJ A;  2C27 A;  1Z4E A;  1QSR A;  3H4Q A;  4JXQ A;  2B4D A;  2ZW5 A;  3MGD A;  1YR0 A;  3FRM A;  4NXY A;  1PU9 A;  2J8N A;  4B5P B;  3FNC A;  3FBU A;  2G0B A;  1S3Z A;  2R98 A;  3SHP A;  2DXQ A;  3FIX A;  4Y49 C;  4HKF A;  3T90 A;  3D8P A;  3S6K A;  1S7N A;  4CAV A;  2FE7 A;  3TE4 A;  1S7K A;  2QIR A;  4XPL A;  5C88 A;  4JXR A;  1KUX A;  1Y9W A;  3JUW A;  2G3A A;  1NMT A;  4R3K A;  4JJX A;  4KOS A;  2FXF A;  2PDO A;  2PC1 A;  4X5K A;  4XNH B;  3R9E A;  3K9U A;  2ZXV A;  2JDC A;  1YLE A;  5C82 A;  4KVX A;  2NMT A;  4QBJ A;  4QB9 A;  1I12 A;  2PRB A;  4KLV A;  1J4J A;  3F8K A;  2AJ6 A;  4FD4 A;  3C26 A;  1IYL A;  1YX0 A;  2D4O A;  3QAH A;  4PK3 A;  3CXQ A;  4OAE A;  1RO5 A;  4AG7 A;  5ISV A;  1ON0 A;  3DR8 A;  2P0W A;  3BJ8 A;  2Q44 A;  4KOY A;  1WK4 A;  3T9Y A;  3I9S A;  4B5O A;  4II9 A;  2VQY A;  1KZF A;  3G8W A;  3DR6 A;  1IB1 E;  1V0C A;  3F0A A;  4MJ8 A;  4DNC A;  3FYN A;  4MBU A;  3S6G A;  1S7L A;  3BJ7 A;  3BLN A;  4RS2 A;  2JDD A;  4HNX B;  1S60 A;  1SQH A;  2Q4V A;  2ZW7 A;  1Q2D A;  3S6H A;  1CM0 A;  3W6X A;  3FB3 A;  4F0Y A;  4IF5 A;  3S6F A;  1YGH A;  2B5G A;  4MI4 A;  1KUV A;  1U6M A;  2GAN A;  5J8F A;  4M3S A;  1Z4R A;  3R1K A;  3R95 A;  3GKR A;  5HMN A;  4NF1 A;  2REE A;  3D2M A;  1R57 A;  4U9Y A;  2ZW6 A;  4QC6 A;  4UWI A;  1L0C A;  4L8A A;  1B87 A;  4KVM E;  5F46 A;  1XF8 A;  1I21 A;  4CS0 B;  2B4D B;  3GYA A;  5J8C A;  1B6B A;  1VHS A;  4E8O A;  2O28 A;  4RI1 A;  2I79 A;  4XNH C;  4KLW A;  3JVN A;  4E0A A;  1VKC A;  4K30 A;  2B3U A;  2VEZ A;  5JQ4 A;  2ATR A;  1Y9K A;  2HUZ A;  2OZG A;  3G3S A;  2ARH A;  2B4B A;  4KOT A;  4M85 A;  5DWM A;  3VWE A;  2OU2 A;  5H86 A;  1KUY A;  2FIW A;  2REF A;  4ZBG A;  4CAX A;  1IYK A;  1UFH A;  5IV0 A;  1Q2Y A;  5KTA A;  4GS4 A;  3TOB A;  2BEI A;  2Z11 A;  4F6A A;  1YK3 A;  1YVO A;  1I1D A;  2R8V A;  2FL4 A;  3PP9 A;  2G3T A;  2ZW4 A;  4NSQ A;  1K4J A;  2R7H A;  4YRH A;  4PV6 A;  4Y49 B;  2D4P A;  1NSL A;  4R9M A;  1Q2C A;  3RYO A;  4PSW A;  3LD2 A;  3GY9 A;  3SXN A;  1XMT A;  4KOW A;  1YRE A;  2WPX A;  2FCK A;  2Q0Y A;  2HV2 A;  3TOA A;  3N7Z A;  4KVO E;  3WR7 A;  4XPD C;  1QSM A;  1MJA A;  2VBQ A;  2J8R A;  2RC4 A;  4L89 A;  4KOR A;  5GCN A;  4UWJ A;  2FT0 A;  4JWP A;  1PUA A;  4QVT A;  3CXP A;  1S5K A;  3B8G A;  2P6G A;  2JEV A; 
#chains in the Genus database with same CATH topology
 3QNV A;  2FS5 A;  3EY5 A;  5THW A;  3SI1 A;  3PRT A;  4NGT A;  4R57 A;  2NYQ A;  5KTC A;  2ZOF A;  2VZZ A;  4H6U A;  3E0K A;  4A30 A;  4DUK A;  1KWM A;  2OR4 A;  4C68 A;  3ZZI A;  4HNY B;  2EO8 A;  1YSJ A;  4CGO A;  4A2Z A;  2X7B A;  4NJQ A;  4YGO A;  3KL9 A;  2B58 A;  3BI1 A;  2QYV A;  3MRU A;  2Q51 A;  4EVY A;  1XEB A;  3FJU A;  1S7F A;  3PZJ A;  3QB8 A;  4KOX A;  4OAD A;  5F49 A;  1CJW A;  3W6S A;  1QSO A;  1IID A;  1FY7 A;  2KCW A;  1M4G A;  2GRE A;  4JD6 A;  3D7G A;  5H84 A;  3TT2 A;  3W91 A;  4Q36 A;  3BHX A;  4UCN A;  4AVA A;  5HH1 A;  3VAR A;  3KKW A;  1GYT A;  3VH9 A;  4MCP A;  2YNC C;  3ZJ0 A;  2PQ8 A;  5CBM A;  1JWQ A;  3LWU A;  5G21 A;  1LCP A;  4MFP A;  3F5B A;  2OH1 A;  1Q7L A;  2PJ8 A;  1F57 A;  5IB9 A;  5JGF A;  4DYO A;  3HUV A;  2V8V A;  3KQZ A;  1XRY A;  3K9T A;  3KQX A;  4IHM A;  4OC4 A;  5DS0 A;  3HLP A;  8CPA A;  3CDX A;  2Z3O A;  2Z10 A;  3BI0 A;  1Z8X A;  3CPA A;  4OC3 A;  1MJB A;  2K5T A;  1YVK A;  5E96 A;  2I00 A;  2GE3 A;  3IWW A;  3NA6 A;  4NEX A;  2Q7B A;  4HNW B;  5LRK A;  2VXK A;  5HVF A;  2IL4 A;  4WWV A;  4AVB A;  4R3L A;  3V8I A;  2C1C A;  3D7F A;  2AFM A;  4FUU A;  4OID A;  4M6H A;  4P44 A;  4F8Z A;  4NGP A;  1N71 A;  3PB7 X;  2BCO A;  2OZU A;  4C7I A;  3D66 A;  4LUA A;  4WJB A;  3SXO A;  1IGB A;  1YQE A;  2PR8 A;  4JLY A;  2V77 A;  2HQY A;  1Z8T A;  2QEC A;  2R1I A;  2PVW A;  4PXD A;  3R96 A;  4E2A A;  1PCA A;  3ISX A;  3PGP A;  1IIC A;  4H89 A;  4MY3 A;  1MK4 A;  2CNT A;  2PJC A;  2CNM A;  1BLL E;  3EC4 A;  3PB4 X;  4U5Y A;  4H6Z A;  4U9Z A;  4FD5 A;  4R8F A;  3D3S A;  4OLL A;  4MY0 A;  2Q4Y A;  2PIZ A;  2YNC A;  1XBU A;  1XE4 A;  2F5I A;  2OZH A;  1AUG A;  4P6Y A;  4ZX9 A;  4B5P A;  4C2X A;  1EE3 P;  4NJR A;  4XPK A;  5EC4 A;  3TTH A;  4X8I A;  3IWG A;  3CPX A;  1Z9U A;  1P4N A;  2GU2 A;  2WSA A;  2J8M A;  2O4H A;  3IIB A;  2YNE A;  2VI7 A;  4KS9 A;  2CY2 A;  3EO4 A;  4BMH A;  1LOK A;  3EFA A;  4PXC A;  4UIA A;  2AE6 A;  3LOD A;  2PCU A;  3D7H A;  2EK8 A;  5LRG A;  4CRZ B;  3B3C A;  1QMU A;  3V7Z A;  2Q04 A;  1WWZ A;  4C7H A;  1BO4 A;  1TKH A;  4KSI A;  1P0H A;  3B3T A;  5JPH A;  3H8E A;  5A27 A;  2OB0 A;  2CNS A;  4C2Z A;  1OZP A;  2VL1 A;  3CXS A;  3H8G A;  3NE7 A;  4UBR A;  4UCM A;  4P4F A;  3DLJ A;  3VWD A;  3KHZ A;  5BWA B;  2J9A A;  4P4D A;  3R9G A;  4MHP A;  3DNS A;  1GHE A;  3R9F A;  4TNU A;  5AG4 A;  1RXT A;  2BL1 A;  3FXT A;  4CAE A;  2PJ2 A;  2RB7 A;  2FSR A;  3FEC A;  3IFE A;  2IMO A;  2Y0M A;  2WZN A;  5I0C A;  3EXN A;  2GIV A;  2Z0Z A;  1QST A;  1M4I A;  1M4D A;  1QSN A;  2ZEO A;  3B2Y A;  4KUA A;  4CAF A;  4CGP A;  1BOB A;  1NE9 A;  2Q4Z A;  1XIX A;  1Z8L A;  2DPS A;  3CT9 A;  3FVL A;  2ZEN A;  4MHD A;  4AB7 A;  3RAM A;  3D68 A;  4KOV A;  3DDD A;  4QUS A;  3IWE A;  4ORF A;  1RTQ A;  2B3V A;  3K2K A;  4NCZ A;  4PXE A;  1X10 A;  2AFW A;  2P6E A;  3PFE A;  4J3G A;  2PSW A;  4CAW A;  1F2P A;  1TIQ A;  3KI9 A;  3OWC A;  4A31 A;  1YW6 A;  5IB0 A;  3FH4 A;  4ONU A;  2EK9 A;  4R87 A;  2HB6 A;  2PJA A;  3TCV A;  2WPW A;  1ZO0 A;  2B5G B;  2AFZ A;  3PBE A;  3TO9 A;  1M44 A;  3TX8 A;  3P2H A;  3I3G A;  2Q43 A;  4FD6 A;  3RBU A;  5I4M A;  1TXR A;  3GB0 A;  2ZPA A;  2BUE A;  1TKF A;  2PJ0 A;  3WT4 A;  2C6G A;  3IEH A;  2H5M A;  4XPD B;  2PR1 A;  4KOU A;  1CBX A;  1DE4 C;  4B10 A;  4KZT A;  4B6Z A;  1PYT B;  4I49 A;  5CNP A;  3IGR A;  4LX9 A;  4P4I A;  4A37 A;  2FIA A;  3P2F A;  4A95 A;  5JM6 A;  1M4L A;  2EVN A;  4PSX A;  3SJX A;  3TFY A;  1Y7R A;  4B13 A;  4CYO A;  4FD7 A;  4CRY B;  4UCP A;  2CIJ A;  4IUS A;  2JLM A;  5EBV A;  2ZEG A;  4NFR A;  2A4N A;  2V8G A;  4CYP A;  2PJ4 A;  3DSB A;  3D2P A;  3SI2 A;  4EWT A;  2P6F A;  5G20 A;  3SJE A;  2BSW A;  4AG9 A;  3TO6 A;  3VAT A;  4AVC A;  2DF5 A;  1LFW A;  5IX3 A;  4MCQ A;  1LRZ A;  1MJ9 A;  2CTC A;  1M1D A;  2PJ6 A;  4OIW A;  1HEE A;  2EUI A;  5K8O A;  4KUB A;  4PK2 A;  2VZY A;  3TO7 A;  1IOI A;  3UY5 A;  5KTD A;  4DJL A;  1ELM P;  3GUX A;  3PEI A;  4UA3 A;  4F9V A;  4YFJ A;  4UEZ A;  2AFX A;  2CF4 A;  3V38 A;  2RFH A;  5F47 A;  3MN8 A;  4MCS A;  4A39 A;  2Z3P A;  2QML A;  3B7I A;  1TKJ A;  2BOA A;  4NGS A;  2I3C A;  3FF3 A;  4C2Y A;  5DWN A;  5F48 A;  4MHY A;  2C27 A;  4MXU A;  1Z4E A;  4P10 A;  5FVJ A;  7CPA A;  1QSR A;  1X12 A;  3H4Q A;  3H5Z A;  4JXQ A;  4ZY0 A;  2B4D A;  3PB8 X;  2ZW5 A;  1NSA A;  1YR0 A;  2GFQ A;  3FED A;  3MGD A;  3FRM A;  2GLJ A;  4R6T A;  4NXY A;  4BIN A;  1CPS A;  1PU9 A;  2J8N A;  3FX6 A;  5AG5 A;  4B11 A;  4M6G A;  4B5P B;  3FNC A;  4KSF A;  3JRU A;  3FBU A;  4GXH A;  5LRJ A;  2JBJ A;  2G0B A;  1S3Z A;  1LAP A;  2PJB A;  2DXQ A;  2R98 A;  3FIX A;  2CTB A;  3SHP A;  1VIX A;  4Y49 C;  4HKF A;  1LAM A;  1CX8 A;  2ZOG A;  3D8P A;  4R76 A;  5D29 A;  3S6K A;  3T90 A;  1S7N A;  1QQ9 A;  2FE7 A;  3I1U A;  4CAV A;  5K8N A;  3KZW A;  4FWU A;  2DPT A;  3TE4 A;  1S7K A;  4ZX8 A;  2QIR A;  4XPL A;  4UF4 A;  5C88 A;  3WC5 A;  1Y7E A;  4GM5 A;  4JXR A;  1YME A;  4RUH A;  4OC2 A;  3NFZ A;  1KUX A;  1Y9W A;  3NH5 A;  3SI0 A;  3JUW A;  2AFU A;  1ELL P;  2C6P A;  2G3A A;  2Z3N A;  1NMT A;  2PE3 A;  3NE8 A;  4ZY1 A;  3IC1 A;  4JJX A;  4KOS A;  2FXF A;  2PDO A;  2PC1 A;  4R3K A;  4X5K A;  4XNH B;  4A94 A;  3KAS A;  3R9E A;  3K9U A;  4RN7 A;  3FEE A;  4YWY A;  4A38 A;  2POK A;  2ZXV A;  2PVV A;  2Z3L A;  2JDC A;  1YLE A;  4IK2 A;  4Q7A A;  4R7M A;  5LYI A;  5C82 A;  4KVX A;  3GLJ A;  2NMT A;  4QBJ A;  4UFW A;  1IY7 A;  4QB9 A;  1I12 A;  2PRB A;  4KLV A;  1Z5R A;  5G1Z A;  1J4J A;  3BXM A;  1CPX A;  4NGN A;  3F8K A;  2AJ6 A;  4FD4 A;  1OBR A;  1IYL A;  3C26 A;  4G1P A;  5K8P A;  1YX0 A;  3SJF A;  4JZ0 A;  2D4O A;  3ISZ A;  3QAH A;  4F9U A;  1AYE A;  2QVP A;  1VGY A;  3CXQ A;  4PK3 A;  4OAE A;  1RO5 A;  5CPA A;  4AG7 A;  4FAI A;  5ISV A;  1ON0 A;  3DR8 A;  2P0W A;  3BJ8 A;  2Q44 A;  4MFK A;  3WC7 A;  4KOY A;  1TF8 A;  4X2T A;  3RNZ A;  1WK4 A;  1AMP A;  2F8H A;  3L2N A;  1ZLI A;  2V8D A;  3WC6 A;  4UEF A;  2Q7S A;  2ZEF A;  3T9Y A;  2BO9 A;  3I9S A;  5AG7 A;  3RO0 A;  3KR5 A;  4B5O A;  2WYR A;  4MMO A;  3FMC A;  2GLF A;  5D8N A;  4II9 A;  2VQY A;  3NH8 A;  1KZF A;  3G8W A;  4OC1 A;  4UIB A;  1ARL A;  1R3N A;  3DR6 A;  5A28 A;  3A9L A;  1IB1 E;  4TWE A;  4MFJ A;  4OP4 A;  4YU9 A;  1CG2 A;  2PJ1 A;  1V0C A;  3KGQ A;  4KSA A;  2DEA A;  1CP7 A;  3F0A A;  4MJ8 A;  4DNC A;  1HDQ A;  3FYN A;  1ARM A;  4BBH A;  2ZEP A;  2ODF A;  3D4U A;  4MBU A;  3S6G A;  1S7L A;  2QJ8 A;  3BJ7 A;  3BLN A;  3PB9 X;  4RS2 A;  3B3S A;  2JDD A;  1IOF A;  4HNX B;  1S60 A;  1SQH A;  2NSM A;  4LQG A;  5AGE A;  2Q4V A;  2ZW7 A;  4CPA A;  1VHO A;  1Q2D A;  3S6H A;  1CM0 A;  3W6X A;  3FB3 A;  4HPS A;  4F0Y A;  3SJG A;  4IF5 A;  4P45 A;  4CYQ A;  3S6F A;  1YGH A;  2B5G A;  4MI4 A;  2OOT A;  2G9D A;  1YW4 A;  4P4B A;  1ZG9 A;  2PRQ A;  4K3N A;  4OKO A;  1KUV A;  2GAN A;  1U6M A;  2EBJ A;  1Y0Y A;  1BPN A;  4M3S A;  5J8F A;  1Z4R A;  3PFO A;  1F2O A;  3R1K A;  4MRI A;  4O23 A;  2ZEM A;  5AG6 A;  3R95 A;  6CPA A;  5HVH A;  3GKR A;  5HMN A;  2ZEL A;  4NF1 A;  4UFX A;  5HVG A;  2REE A;  2ANP A;  3D2M A;  3B3W A;  4AXV A;  1R57 A;  2YND A;  1DTD A;  2HC9 A;  4U9Y A;  2ZW6 A;  4QC6 A;  2Z3M A;  2ZED A;  4UWI A;  1ZLH A;  2FVG A;  1L0C A;  2XEI A;  1BPM A;  1B87 A;  4L8A A;  2PJ7 A;  4KVM E;  3QAY A;  1YLO A;  4A32 A;  5F46 A;  1XF8 A;  3RZA A;  2CXA A;  1I21 A;  1VHE A;  1ZG8 A;  2F7V A;  3IO1 A;  4CS0 B;  1IU8 A;  2B4D B;  3GYA A;  5JH9 A;  5J8C A;  4UFV A;  1B6B A;  1VHS A;  4E8O A;  2PJ9 A;  5LYD A;  1XOV A;  2O28 A;  3KHX A;  4RI1 A;  4CGM A;  4MFQ A;  2I79 A;  3PBB A;  4MCR A;  4XNH C;  4KLW A;  4OC0 A;  2PJ5 A;  3JVN A;  4E0A A;  4Q38 A;  1VKC A;  4K30 A;  4JYW A;  2B3U A;  4PQA A;  2VEZ A;  3KR4 A;  2ATR A;  5JQ4 A;  4ZYQ A;  1Y9K A;  2HUZ A;  2OZG A;  4CGN A;  3G3S A;  2ARH A;  2B4B A;  4KOT A;  4M85 A;  2AFO A;  2C6C A;  4OME A;  1LAN A;  2EWB A;  5DWM A;  4UEE A;  3VWE A;  5LYL A;  2XEG A;  2JEW A;  2OU2 A;  4P4J A;  4W9Y A;  5H86 A;  5K8M A;  1ZG7 A;  1KUY A;  2FIW A;  2REF A;  2WUU A;  3LMS A;  1Z2L A;  2PJ3 A;  3H8F A;  4ZBG A;  1IYK A;  1UFH A;  4CAX A;  4F0X A;  4EME A;  4M6I A;  5IV0 A;  3NH4 A;  4ZI6 A;  1Q2Y A;  1JQG A;  5KTA A;  3PB6 X;  3IJ3 A;  4GS4 A;  3TOB A;  2BEI A;  2Z3K A;  1FNO A;  2Z11 A;  4F6A A;  4ONW A;  1CP6 A;  2XEF A;  1YK3 A;  4NGQ A;  1HDU A;  1YVO A;  1I1D A;  3JTK A;  4PPZ A;  2R8V A;  4PXB A;  2FL4 A;  4MHN A;  5LYF A;  2JBK A;  3DGV A;  4B14 A;  1TF9 A;  2G3T A;  3PP9 A;  2ZW4 A;  4NSQ A;  2ABZ A;  1K4J A;  2O53 A;  2R7H A;  4H2K A;  3B35 A;  4BD9 A;  2IJZ A;  2XEJ A;  4EFD A;  4YRH A;  4PV6 A;  4Y49 B;  3WAB A;  5HXD A;  2V8H A;  5EMI A;  4CGL A;  2D4P A;  4MHZ A;  3D7D A;  1NSL A;  5F09 A;  4OC5 A;  4R9M A;  1Q2C A;  4P4E A;  1R43 A;  1XJO A;  1XMB A;  3RYO A;  4NGR A;  3IU2 A;  4PSW A;  3LD2 A;  1H8L A;  4ZY2 A;  3B3V A;  3GY9 A;  2IQ6 A;  4MFZ A;  3SXN A;  1XMT A;  1A2Z A;  1YRE A;  2WPX A;  2FCK A;  4KOW A;  2Q0Y A;  2HV2 A;  2PIY A;  3TOA A;  3S9N A;  3N7Z A;  4KVO E;  2AFS A;  3D67 A;  4B12 A;  3WR7 A;  4XPD C;  3TC8 A;  1QSM A;  1XFO A;  1MJA A;  3N5F A;  1BAV A;  2VBQ A;  4CYN A;  4ZGY B;  2J8R A;  2RC4 A;  2ZEE A;  3LAC A;  4NGM A;  5J1Q A;  1UWY A;  3T8W A;  4MFL A;  4L89 A;  4KOR A;  3CZX A;  4LQ6 A;  5ELY A;  4A33 A;  5GCN A;  4UWJ A;  4FBE A;  4Z65 A;  1FT7 A;  2FT0 A;  4JWP A;  1PUA A;  4QVT A;  1Y0R A;  3GIU A;  3S9M A;  3CXP A;  1S5K A;  3B8G A;  5G22 A;  2ZEH A;  3S9L A;  3IU1 A;  2P6G A;  2JEV A;  4X3R A;  1Z8W A;  4IAV A;  2YGW A; 
#chains in the Genus database with same CATH homology
 2FS5 A;  3EY5 A;  4R57 A;  5KTC A;  2VZZ A;  4H6U A;  3E0K A;  4A30 A;  4C68 A;  3ZZI A;  4HNY B;  4CGO A;  4A2Z A;  2X7B A;  4YGO A;  2B58 A;  4EVY A;  1XEB A;  4KOX A;  1S7F A;  3PZJ A;  3QB8 A;  4OAD A;  5F49 A;  1CJW A;  3W6S A;  1QSO A;  1IID A;  1FY7 A;  2KCW A;  1M4G A;  4JD6 A;  3TT2 A;  4AVC A;  5H84 A;  3W91 A;  4Q36 A;  4UCN A;  4AVA A;  5HH1 A;  3KKW A;  2YNC C;  3ZJ0 A;  2PQ8 A;  5G21 A;  4MFP A;  3F5B A;  2OH1 A;  2Z3O A;  2Z10 A;  1MJB A;  2K5T A;  1YVK A;  5E96 A;  2I00 A;  2GE3 A;  2Q7B A;  4NEX A;  4HNW B;  2VXK A;  4AVB A;  2IL4 A;  4R3L A;  3V8I A;  1N71 A;  2OZU A;  4C7I A;  4LUA A;  3SXO A;  2PR8 A;  4JLY A;  2HQY A;  2QEC A;  2R1I A;  3R96 A;  4E2A A;  3PGP A;  1IIC A;  4H89 A;  4MY3 A;  1MK4 A;  2CNT A;  2CNM A;  3EC4 A;  4U5Y A;  4H6Z A;  4U9Z A;  4FD5 A;  3D3S A;  4OLL A;  4MY0 A;  2Q4Y A;  2YNC A;  1XE4 A;  2F5I A;  2OZH A;  4C2X A;  4B5P A;  4XPK A;  5EC4 A;  3TTH A;  3IWG A;  1Z9U A;  1P4N A;  2WSA A;  2J8M A;  4KS9 A;  2YNE A;  2VI7 A;  2CY2 A;  3EO4 A;  4BMH A;  3EFA A;  2AE6 A;  3LOD A;  4CRZ B;  2Q04 A;  1WWZ A;  4C7H A;  1BO4 A;  1P0H A;  5JPH A;  5A27 A;  2OB0 A;  2CNS A;  4C2Z A;  1OZP A;  3CXS A;  3NE7 A;  4UBR A;  4UCM A;  3VWD A;  5BWA B;  3R9G A;  3DNS A;  1GHE A;  3R9F A;  5AG4 A;  1RXT A;  2BL1 A;  3FXT A;  4CAE A;  2FSR A;  2Y0M A;  5I0C A;  3EXN A;  2GIV A;  2Z0Z A;  1QST A;  1M4I A;  1M4D A;  1QSN A;  4KUA A;  4CAF A;  4CGP A;  1BOB A;  1NE9 A;  1XIX A;  2DPS A;  4MHD A;  4AB7 A;  4KOV A;  3DDD A;  4QUS A;  3IWE A;  4ORF A;  2B3V A;  4NCZ A;  2P6E A;  4J3G A;  2PSW A;  4CAW A;  1TIQ A;  4A31 A;  3OWC A;  5IB0 A;  4ONU A;  4R87 A;  3TCV A;  2WPW A;  1ZO0 A;  2B5G B;  3TO9 A;  1M44 A;  3P2H A;  3I3G A;  4FD6 A;  2ZPA A;  2BUE A;  2H5M A;  4XPD B;  2PR1 A;  4KOU A;  4B10 A;  4KZT A;  4I49 A;  5CNP A;  3IGR A;  4LX9 A;  2FIA A;  3P2F A;  4A95 A;  2EVN A;  4PSX A;  3TFY A;  1Y7R A;  4B13 A;  4CYO A;  4FD7 A;  4CRY B;  4UCP A;  4IUS A;  2JLM A;  5EBV A;  2A4N A;  4CYP A;  3DSB A;  3D2P A;  2P6F A;  5G20 A;  2BSW A;  4AG9 A;  3TO6 A;  5IX3 A;  1LRZ A;  1MJ9 A;  1M1D A;  2EUI A;  4KUB A;  4PK2 A;  2VZY A;  3TO7 A;  3UY5 A;  5KTD A;  4UA3 A;  4YFJ A;  5F47 A;  2Z3P A;  2QML A;  4C2Y A;  5DWN A;  5F48 A;  5FVJ A;  2C27 A;  1Z4E A;  1QSR A;  4JXQ A;  3H4Q A;  3H5Z A;  2B4D A;  2ZW5 A;  3MGD A;  1YR0 A;  3FRM A;  4NXY A;  1PU9 A;  2J8N A;  5AG5 A;  4B11 A;  4B5P B;  3FNC A;  4KSF A;  3FBU A;  2G0B A;  1S3Z A;  2R98 A;  3SHP A;  2DXQ A;  3FIX A;  4Y49 C;  4HKF A;  3T90 A;  3D8P A;  3S6K A;  1S7N A;  4CAV A;  2FE7 A;  2DPT A;  3TE4 A;  1S7K A;  2QIR A;  4XPL A;  5C88 A;  4JXR A;  1KUX A;  1Y9W A;  3JUW A;  2G3A A;  2Z3N A;  1NMT A;  4R3K A;  4JJX A;  4KOS A;  2FXF A;  2PDO A;  2PC1 A;  4X5K A;  4XNH B;  3R9E A;  3K9U A;  2ZXV A;  2Z3L A;  2JDC A;  1YLE A;  5C82 A;  4KVX A;  2NMT A;  4QBJ A;  4UFW A;  4QB9 A;  1I12 A;  2PRB A;  4KLV A;  5G1Z A;  1J4J A;  3F8K A;  2AJ6 A;  4FD4 A;  3C26 A;  1IYL A;  1YX0 A;  2D4O A;  3QAH A;  4PK3 A;  3CXQ A;  4OAE A;  1RO5 A;  4AG7 A;  5ISV A;  1ON0 A;  3DR8 A;  2P0W A;  3BJ8 A;  2Q44 A;  4MFK A;  4KOY A;  1WK4 A;  3T9Y A;  3I9S A;  5AG7 A;  4B5O A;  4II9 A;  2VQY A;  1KZF A;  3G8W A;  3DR6 A;  5A28 A;  3A9L A;  1IB1 E;  4MFJ A;  1V0C A;  4KSA A;  3F0A A;  4MJ8 A;  4DNC A;  3FYN A;  4BBH A;  4MBU A;  3S6G A;  1S7L A;  3BJ7 A;  3BLN A;  4RS2 A;  2JDD A;  4HNX B;  1S60 A;  1SQH A;  5AGE A;  2Q4V A;  2ZW7 A;  1Q2D A;  3S6H A;  1CM0 A;  3W6X A;  3FB3 A;  4F0Y A;  4IF5 A;  4CYQ A;  3S6F A;  1YGH A;  2B5G A;  4MI4 A;  1KUV A;  1U6M A;  2GAN A;  5J8F A;  4M3S A;  1Z4R A;  3R1K A;  5AG6 A;  3R95 A;  3GKR A;  5HMN A;  4NF1 A;  4UFX A;  2REE A;  3D2M A;  1R57 A;  2YND A;  4U9Y A;  2ZW6 A;  4QC6 A;  2Z3M A;  4UWI A;  1L0C A;  4L8A A;  1B87 A;  4KVM E;  4A32 A;  5F46 A;  1XF8 A;  2CXA A;  1I21 A;  4CS0 B;  2B4D B;  3GYA A;  5J8C A;  4UFV A;  1B6B A;  1VHS A;  4E8O A;  2O28 A;  4RI1 A;  4CGM A;  4MFQ A;  2I79 A;  4XNH C;  4KLW A;  3JVN A;  4E0A A;  4Q38 A;  1VKC A;  4K30 A;  2B3U A;  2VEZ A;  5JQ4 A;  2ATR A;  1Y9K A;  2HUZ A;  2OZG A;  4CGN A;  3G3S A;  2ARH A;  2B4B A;  4KOT A;  4M85 A;  5DWM A;  3VWE A;  2OU2 A;  5H86 A;  1KUY A;  2FIW A;  2REF A;  2WUU A;  4ZBG A;  4CAX A;  1IYK A;  1UFH A;  4F0X A;  5IV0 A;  1Q2Y A;  5KTA A;  4GS4 A;  3TOB A;  2BEI A;  2Z3K A;  2Z11 A;  4F6A A;  1YK3 A;  1YVO A;  1I1D A;  3JTK A;  2R8V A;  2FL4 A;  4B14 A;  3PP9 A;  2G3T A;  2ZW4 A;  4NSQ A;  1K4J A;  2R7H A;  4YRH A;  4PV6 A;  4Y49 B;  4CGL A;  2D4P A;  1NSL A;  4R9M A;  1Q2C A;  3RYO A;  3IU2 A;  4PSW A;  3LD2 A;  3GY9 A;  4MFZ A;  3SXN A;  1XMT A;  4KOW A;  1YRE A;  2WPX A;  2FCK A;  2Q0Y A;  2HV2 A;  3TOA A;  3N7Z A;  4KVO E;  4B12 A;  3WR7 A;  4XPD C;  1QSM A;  1MJA A;  4CYN A;  2VBQ A;  4ZGY B;  2J8R A;  2RC4 A;  4MFL A;  4L89 A;  4KOR A;  4A33 A;  5GCN A;  4UWJ A;  2FT0 A;  4JWP A;  1PUA A;  4QVT A;  3CXP A;  1S5K A;  3B8G A;  5G22 A;  3IU1 A;  2P6G A;  2JEV A;  2YGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...