1IYLA

Crystal structure of candida albicans n-myristoyltransferase with non-peptidic inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
384
structure length
384
Chain Sequence
TPEDVPNDPLPLISDFEWSTLDIDDNLQLDELYKLLYDNYVEDIDATFRFKYSHEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVTFKLNKSNKVIDSVEINFLCIHKKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPTPLTTCRYQHRPINWSKLHDVGFSHLPPNQTKSSMVASYTLPNNPKLKGLRPMTGKDVSTVLSLLYKYQERFDIVQLFTEEEFKHWMLGHDENSDSNVVKSYVVEDENGIITDYFSYYLLPFTVLDNAQHDELGIAYLFYYASDSFEKPNYKKRLNELITDALITSKKFGVDVFNCLTCQDNTYFLKDCKFGSGDGFLNYYLFNYRTFPMDGGIDKKTKEVVEDQTSGIGVVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Candida albicans N-Myristoyltransferase with Two Distinct Inhibitors
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
molecule keywords Myristoyl-CoA:Protein N-Myristoyltransferase
total genus 103
structure length 384
sequence length 384
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iylA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iylA02
4XPDB 4F0YA 3LD2A 4JJXA 5H84A 1N71A 4MY0A 4YRHA 4R87A 2HV2A 1CJWA 2K5TA 4HKFA 1QSTA 3N7ZA 5FVJA 3P2FA 3R95A 3CXSA 2F5IA 2Q0YA 1J4JA 1QSOA 1VKCA 1ON0A 2A4NA 3ZZIA 2ZW4A 4R57A 2JDCA 4KORA 3BJ7A 5IB0A 5F47A 2PR8A 4KOSA 4KOTA 2H5MA 4CS0B 3BJ8A 2JEVA 3CXQA 4PK2A 4KOVA 1M4DA 4MHDA 4AVCA 2O28A 2GE3A 1LRZA 3IGRA 3S6FA 4XPLA 3KKWA 2JDDA 1S7KA 2B3VA 2FIAA 3B8GA 1KUYA 1U6MA 2ZXVA 4XNHB 3DNSA 2B4DA 1Q2YA 4II9A 1XMTA 2Z0ZA 1Q2CA 3PGPA 1VHSA 4E0AA 1PUAA 3G3SA 2FE7A 5IV0A 1S60A 2BEIA 4PV6A 3E0KA 3W91A 4BMHA 5F49A 3SXNA 1QSNA 1M4IA 1GHEA 2I00A 2CNMA 4PSXA 2KCWA 3WR7A 5J8FA 4AG7A 2Z11A 3FXTA 3UY5A 2BUEA 1P4NA 2OZHA 2FS5A 4B5PA 3TTHA 4PK3A 3TT2A 4K30A 2R7HA 4IUSA 2QECA 2CNTA 5KTDA 3VWEA 4OLLA 2PC1A 3EXNA 3T9YA 3GYAA 2J8RA 4UWJA 2Y0MA 4JXRA 3TOAA 2B4BA 3R1KA 4QUSA 4RI1A 3G8WA 1S7FA 4OAEA 1Q2DA 1I21A 3FBUA 5HH1A 2G3AA 2IL4A 2OB0A 1M1DA 4IF5A 4R3KA 1R57A 1XIXA 2P0WA 4Y49B 5KTAA 1MK4A 2DXQA 1KZFA 1Y7RA 3LODA 3P2HA 3DR8A 4M85A 4NSQA 3SHPA 3PP9A 4JLYA 3IWGA 4QBJA 4KLVA 1I1DA 1M44A 3NE7A 2EVNA 2GIVA 3R9FA 4H6UA 2R1IA 3K9UA 1RXTA 4MI4A 3QB8A 4CAWA 3TO7A 1MJBA 3OWCA 2ZPAA 3FB3A 4KOYA 1Z4EA 1M4GA 1MJAA 1SQHA 4MBUA 3JVNA 4ONUA 4KOWA 4LX9A 4OADA 2Z10A 4L8AA 2X7BA 1YR0A 4KLWA 1S7LA 3RYOA 2HQYA 2HUZA 4E8OA 3I3GA 4KVME 1K4JA 5H86A 4CAVA 4I49A 4NF1A 4JD6A 1B6BA 2NMTA 1YVKA 2ZW5A 2PDOA 1IICA 4EVYA 4L89A 3TFYA 3MGDA 2QIRA 4QVTA 3EFAA 1WK4A 4UWIA 2ATRA 4R9MA 1S7NA 4H89A 1WWZA 2WPWA 4AG9A 1S5KA 2EUIA 4UBRA 3CXPA 2I79A 2FCKA 2VZZA 1IYKA 1OZPA 3FIXA 4NXYA 2P6FA 4HNXB 2FIWA 3D2PA 3BLNA 3F5BA 4JWPA 1YGHA 4U9YA 2B58A 3H4QA 5IX3A 2JLMA 4FD5A 1QSRA 1B87A 2VZYA 1IYLA 5GCNA 2ZW6A 4KVOE 5I0CA 2BSWA 3SXOA 1CM0A 2P6GA 2VQYA 4MY3A 5HMNA 4AVAA 2D4OA 1KUVA 1YLEA 3F0AA 2CY2A 2AE6A 2Q4VA 5ISVA 2VBQA 3S6GA 3VWDA 4KZTA 2REEA 1Z4RA 4H6ZA 4U9ZA 2R98A 2WPXA 4KOUA 4RS2A 5EBVA 4QC6A 4FD7A 1P0HA 2OU2A 2PRBA 1IIDA 2VEZA 5EC4A 1YVOA 3TE4A 4MJ8A 2FXFA 3I9SA 5J8CA 2OZUA 3W6XA 2Q04A 4U5YA 2OH1A 4HNWB 1Y9KA 2Q7BA 1YX0A 3GY9A 4R3LA 1I12A 4J3GA 4GS4A 5DWNA 3TO9A 3R96A 5JPHA 1TIQA 1Z9UA 3EC4A 1PU9A 1YK3A 2FT0A 2G3TA 2RC4A 3S6KA 3D3SA 4ZBGA 2ARHA 3FNCA 4CAXA 1KUXA 2C27A 1XF8A 4QB9A 3TO6A 1IB1E 1XEBA 3JUWA 2Q4YA 1L0CA 2VI7A 4CRZB 4YFJA 1MJ9A 1S3ZA 4PSWA 4KUBA 4X5KA 5JQ4A 2AJ6A 4Y49C 3QAHA 2G0BA 1XE4A 3EO4A 4XPDC 4XNHC 1YREA 3R9GA 3DDDA 4F6AA 5KTCA 4NEXA 3V8IA 4NCZA 1FY7A 4UA3A 3W6SA 3EY5A 2GANA 4KVXA 4LUAA 2J8MA 4HNYB 2D4PA 4XPKA 2QMLA 1BO4A 3ZJ0A 1NE9A 3D2MA 1RO5A 4AB7A 1NMTA 3F8KA 2B5GB 3S6HA 1QSMA 2PR1A 1NSLA 5F46A 1UFHA 1BOBA 3GKRA 2FL4A 4KUAA 2FSRA 2BL1A 2R8VA 4YGOA 5C88A 4E2AA 4B5PB 3PZJA 3TOBA 3D8PA 2CNSA 3DR6A 4CRYB 2B5GA 4JXQA 3C26A 4ORFA 5CNPA 3TCVA 1Y9WA 2REFA 4FD6A 4M3SA 2B4DB 4B5OA 3FYNA 2ZW7A 5C82A 3T90A 5E96A 3FRMA 4KOXA 5F48A 2PQ8A 2OZGA 4AVBA 2P6EA 4DNCA 2B3UA 2J8NA 4FD4A 1V0CA 3R9EA 2PSWA 2Q44A 5DWMA 2VXKA 3DSBA
chains in the Genus database with same CATH superfamily
3IJ3A 3KGQA 2JEWA 5D8NA 4A38A 2WSAA 4XPDB 2ZELA 4F0YA 2PJ4A 3LD2A 4JJXA 1YMEA 3FEDA 4FWUA 1N71A 4MY0A 5AG5A 5H84A 2BOAA 4YRHA 2O53A 4R87A 2HV2A 1CJWA 2AFXA 2K5TA 4HKFA 1QSTA 2WZNA 3CDXA 4TWEA 4K3NA 4KS9A 3N7ZA 5FVJA 3P2FA 3R95A 2PJAA 4KSIA 8CPAA 1QQ9A 3B2YA 3CXSA 2F5IA 5DS0A 2ZEPA 1XFOA 2Q0YA 1J4JA 2Q4ZA 3WABA 1QSOA 1VKCA 1ON0A 2A4NA 1DE4C 3B3WA 3ZZIA 2DPTA 7CPAA 2YNCC 4X8IA 2ZW4A 4R57A 2JDCA 2XEGA 4KORA 1Y0RA 2PJ3A 3BJ7A 5IB0A 2HC9A 5LYLA 5F47A 4ZY2A 2PR8A 5JH9A 4KOSA 4KOTA 2H5MA 2ZEFA 3NE8A 4JZ0A 4OC5A 3N5FA 2RB7A 2AFUA 1YSJA 5HVFA 3QNVA 2V8HA 4CS0B 3IO1A 5G20A 3BJ8A 2JEVA 4UFXA 2AFSA 3CXQA 4PK2A 4KOVA 1M4DA 4JYWA 2PJ1A 4A39A 4MFPA 4MHDA 3IU2A 4AVCA 2O28A 3IFEA 3FEEA 1Y0YA 2GE3A 1LRZA 3IGRA 3S6FA 4XPLA 3KKWA 1QMUA 3V7ZA 2ZOGA 2JDDA 2JBJA 1S7KA 2B3VA 2GLFA 2ODFA 4P10A 4EWTA 2FIAA 4EMEA 1AYEA 3B8GA 5K8OA 4MHYA 1KUYA 1U6MA 2ZXVA 4A31A 4XNHB 1M4LA 3DNSA 2B4DA 4P4IA 4OC0A 1Q2YA 1TKJA 4MMOA 5G1ZA 4II9A 1XMTA 1YW4A 2GFQA 1NSAA 2Z0ZA 3BI1A 1LAPA 3FECA 1Q2CA 4UCMA 1CBXA 1VHSA 3PGPA 4E0AA 1Z5RA 4BINA 3PFOA 4IK2A 4PQAA 5HVHA 3TX8A 1PUAA 1ARMA 1X10A 3G3SA 3BI0A 2FE7A 5IV0A 1S60A 2BEIA 3JRUA 4UIBA 4PV6A 3E0KA 2PJ0A 3W91A 2PCUA 4BMHA 5F49A 3SXNA 1QSNA 4TNUA 1M4IA 2BO9A 1GHEA 4AXVA 4C2ZA 2I00A 5JGFA 2CNMA 1ZLIA 3SJFA 4IHMA 4PSXA 2KCWA 3WR7A 5J8FA 4AG7A 1CX8A 1JQGA 2JBKA 2Z11A 1TF8A 3KR4A 3FXTA 3UY5A 2YNDA 5AG7A 3D7FA 1ZO0A 1ARLA 1P4NA 2BUEA 2OZHA 4C2YA 4ZY0A 2FS5A 2CTBA 3TTHA 4B5PA 4PK3A 3S9LA 3TT2A 4UEEA 2OR4A 4NFRA 4Q38A 4K30A 2R7HA 2ZEHA 4IUSA 4P6YA 2QECA 2CNTA 5KTDA 1Y7EA 3VWEA 4OLLA 3NFZA 2PC1A 3EXNA 3VATA 3T9YA 3GYAA 2J8RA 4UWJA 5I4MA 2Y0MA 2CF4A 4JXRA 3TOAA 1FT7A 1H8LA 2B4BA 3R1KA 2EBJA 4QUSA 4UF4A 3ISZA 4PXBA 4BBHA 1Z8TA 1GYTA 1DTDA 1Z8XA 4RI1A 3MRUA 2PIZA 3G8WA 3PBEA 3PB6X 3PRTA 5G22A 3SI2A 1S7FA 4OAEA 3H8GA 2PJ6A 4M6IA 4OC2A 1Q2DA 1I21A 3FBUA 3KQXA 5HH1A 2G3AA 2IL4A 3CPAA 2OB0A 5HXDA 1M1DA 1ZLHA 4G1PA 4IF5A 4R3KA 1R57A 1XIXA 2P0WA 4UFVA 4X3RA 4CAEA 4Y49B 5KTAA 1MK4A 4R8FA 1LCPA 1KZFA 2DXQA 4P4DA 1Y7RA 1BPNA 3LODA 2ZENA 3P2HA 3DR8A 4IAVA 4X2TA 5K8NA 3TC8A 4M85A 2EO8A 3WC7A 4H2KA 3PB8X 4NSQA 4NGSA 3SHPA 3PP9A 4JLYA 4P4JA 5LYIA 3IWGA 4OMEA 4QBJA 4MFQA 4ZX9A 4KLVA 1I1DA 1TXRA 1M44A 3NE7A 1KWMA 2EVNA 3S9NA 4LQ6A 4ONWA 2GIVA 2ZEMA 1LANA 3K2KA 3QAYA 1XOVA 4NGNA 5AGEA 3R9FA 1F57A 4KSFA 4H6UA 2R1IA 4BD9A 5A28A 3K9UA 1RXTA 4MI4A 1X12A 2Z3LA 3QB8A 2PJ7A 4CAWA 3TO7A 4R7MA 3WT4A 4OP4A 1MJBA 3OWCA 4R76A 4C2XA 2ZPAA 4B14A 1F2OA 3FJUA 4NGRA 4B10A 5LRKA 3H5ZA 3FB3A 4NGTA 4OC3A 4CGNA 3GB0A 4KOYA 1Z4EA 5AG6A 4UEZA 1TF9A 1ZG8A 5A27A 2PJ5A 2QYVA 3HUVA 2Q43A 1M4GA 1MJAA 1SQHA 4MBUA 2QJ8A 4PXDA 2CIJA 2HB6A 4M6HA 3JVNA 4ONUA 5HVGA 4A32A 5JM6A 5LYFA 3RBUA 4CYNA 4KOWA 4LX9A 4OADA 3KI9A 2Z10A 4L8AA 4PPZA 2AFMA 2XEFA 3FX6A 4FBEA 2X7BA 1YR0A 2YNCA 4KLWA 4ZYQA 1S7LA 3RYOA 4NGMA 2DPSA 2HQYA 2HUZA 3IEHA 2AFZA 3I3GA 4E8OA 4OIDA 4PXCA 4CGLA 4KVME 1K4JA 5H86A 4CAVA 6CPAA 4I49A 4UEFA 4NF1A 4JD6A 3B3SA 1B6BA 1PCAA 2NMTA 1YVKA 2WUUA 2Z3MA 5THWA 2ZW5A 4P44A 3V38A 2I3CA 2PDOA 2OOTA 1IICA 1EE3P 4P45A 4NGQA 3FVLA 4EVYA 2NYQA 1R43A 2CXAA 3RNZA 4L89A 3GIUA 4NJQA 4C68A 3TFYA 4CPAA 3MGDA 2XEIA 4GM5A 2QIRA 2YGWA 4QVTA 2C1CA 3EFAA 1WK4A 3B3TA 3IIBA 2ATRA 4MFLA 4R9MA 3I1UA 1S7NA 4UWIA 4GXHA 4A2ZA 2DEAA 4F8ZA 1IU8A 1VGYA 4H89A 5F09A 1IOIA 1R3NA 1F2PA 1WWZA 3GUXA 3VH9A 2WPWA 4AG9A 4RN7A 1S5KA 2EUIA 4UBRA 3CXPA 2I79A 3PB4X 1UWYA 3ISXA 4F9UA 2V8DA 3SJXA 5EMIA 2ZEGA 2FCKA 2VZZA 1Q7LA 4MRIA 1IYKA 1OZPA 3FIXA 4OC1A 4OIWA 4NXYA 3WC6A 3NH5A 1ELMP 2P6FA 4HNXB 4YWYA 1TKFA 2FIWA 4MCQA 2GU2A 3D2PA 4CYPA 3BLNA 5G21A 1BPMA 4CGPA 3F5BA 4A94A 3L2NA 1CP7A 4JWPA 1JWQA 1YGHA 4U9YA 2NSMA 4P4FA 2B58A 3H4QA 1Z8WA 2PJ2A 4EFDA 5IX3A 2JLMA 4FD5A 2IQ6A 1QSRA 1B87A 2VZYA 4M6GA 4Z65A 3SJEA 5CPAA 3PFEA 1AMPA 1IYLA 5GCNA 4A33A 2ZEDA 2ZW6A 2PJ9A 2WYRA 4UIAA 2DF5A 2C6GA 1Z8LA 3HLPA 4KVOE 5I0CA 2BSWA 3SXOA 1CM0A 2P6GA 3CPXA 1HDQA 2VQYA 2ZEEA 4FUUA 4MY3A 4A95A 4OC4A 4O23A 3KHXA 3IC1A 5HMNA 4AVAA 2D4OA 1KUVA 1YLEA 3F0AA 2CY2A 3VARA 2AE6A 2F7VA 2Q4VA 4DYOA 1VIXA 5ISVA 2VBQA 3DLJA 3CT9A 4ZGYB 1BLLE 3B35A 3LMSA 2BCOA 3S6GA 4MHPA 3VWDA 4ZY1A 4KZTA 2REEA 1Z4RA 1LFWA 5AG4A 3FH4A 4H6ZA 4U9ZA 3B3CA 3D4UA 2R98A 2C6PA 2WPXA 3D68A 2EWBA 4KOUA 4RS2A 1TKHA 3B3VA 3T8WA 4FAIA 4C7HA 2ZEOA 3RO0A 5EBVA 4QC6A 4FD7A 1P0HA 3KQZA 4HPSA 3IWEA 3WC5A 2OU2A 2PRBA 1IIDA 2Z3OA 2VEZA 5EC4A 2J9AA 3RZAA 3BHXA 3A9LA 1YVOA 3TE4A 4MJ8A 2FXFA 3DGVA 4CAFA 3I9SA 5J8CA 3K9TA 2OZUA 3PEIA 4P4BA 3W6XA 2PVWA 2Q04A 2PE3A 1XBUA 4YU9A 5LRJA 4U5YA 4B12A 1VHOA 2V8VA 3SI1A 2EK8A 2C6CA 2OH1A 4HNWB 1ZG7A 4MCRA 3KZWA 4MFKA 1VHEA 2F8HA 3KHZA 3NA6A 2V77A 1Y9KA 1CPSA 4MCPA 2Q7BA 1YX0A 1A2ZA 3GY9A 4R3LA 4CYOA 5K8MA 1I12A 3JTKA 4J3GA 3D7DA 4GS4A 5DWNA 2IJZA 4WWVA 3TO9A 2PIYA 3R96A 1YQEA 5JPHA 1LOKA 1TIQA 4NGPA 1Z9UA 3EC4A 2IMOA 1PU9A 2CTCA 1YK3A 4LQGA 4CGOA 2FT0A 2G3TA 2RC4A 2Q7SA 3S6KA 3D3SA 4MXUA 4ZBGA 2Z3NA 5ELYA 4Q36A 2ARHA 3FNCA 5LRGA 2V8GA 4CAXA 1PYTB 3CZXA 1KUXA 2C27A 1XF8A 4QB9A 2AFWA 5D29A 1IB1E 3B7IA 3PB9X 3TO6A 1XEBA 1XMBA 1OBRA 3JUWA 2Q4YA 3D66A 1L0CA 1IGBA 3D7HA 1XRYA 2VI7A 3D7GA 4CRZB 4YFJA 2PVVA 1MJ9A 1S3ZA 4PSWA 3NH4A 4KUBA 4KSAA 5BWAB 4W9YA 4CGMA 4X5KA 5JQ4A 2AJ6A 4Q7AA 4Y49C 1ZG9A 3QAHA 2G0BA 1XE4A 3EO4A 4XPDC 4R6TA 4RUHA 4XNHC 4UFWA 1YREA 3R9GA 1LAMA 3DDDA 4F6AA 5KTCA 3H8EA 4NEXA 4UCNA 3V8IA 3PB7X 1XJOA 4NCZA 4A37A 4C7IA 1FY7A 1Z2LA 2RFHA 4UA3A 3S9MA 3KASA 4PXEA 3W6SA 3EY5A 1CPXA 2GANA 5J1QA 4KVXA 4LUAA 2J8MA 4HNYB 3IWWA 2D4PA 2G9DA 2POKA 2QMLA 4XPKA 1YLOA 5K8PA 1BO4A 3ZJ0A 2VL1A 3BXMA 2GLJA 1NE9A 2O4HA 3D2MA 3FF3A 1RO5A 4AB7A 4ZI6A 4MCSA 3GLJA 1NMTA 2YNEA 3F8KA 2B5GB 4MFJA 3SI0A 3S6HA 4MHNA 5LYDA 1QSMA 2PR1A 1NSLA 2ABZA 4CYQA 5F46A 4MFZA 4ZX8A 2GREA 3SJGA 1UFHA 3PBBA 1BOBA 2Z3PA 3GKRA 2FL4A 4KUAA 1FNOA 3FMCA 2FSRA 1HEEA 4P4EA 2BL1A 4WJBA 2AFOA 2R8VA 4YGOA 5C88A 1BAVA 1RTQA 4E2AA 4B5PB 1CP6A 3PZJA 2QVPA 3TOBA 3D8PA 3LACA 4UCPA 1HDUA 3IU1A 1CG2A 2CNSA 3LWUA 3DR6A 4B13A 2ZOFA 4CRYB 4NJRA 2PJBA 1IOFA 2B5GA 3KR5A 2ANPA 4DJLA 4JXQA 3C26A 3KL9A 4OKOA 1AUGA 4ORFA 4A30A 2PJCA 3MN8A 3NH8A 5CNPA 1IY7A 1YW6A 2PJ8A 2PRQA 3TCVA 4DUKA 1Y9WA 2REFA 2Z3KA 4FD6A 4M3SA 4B6ZA 2B4DB 4B5OA 3FYNA 2ZW7A 4F9VA 4B11A 5C82A 3T90A 5CBMA 5E96A 3RAMA 3D67A 1ELLP 3FRMA 4KOXA 5F48A 2PQ8A 2FVGA 2OZGA 3H8FA 4AVBA 2EK9A 2P6EA 4DNCA 2B3UA 2J8NA 2Q51A 4MHZA 4F0XA 4FD4A 1V0CA 3R9EA 2PSWA 2Q44A 5DWMA 5IB9A 2VXKA 3DSBA 2XEJA
chains in the Genus database with same CATH topology
2WSAA 4XPDB 4F0YA 3LD2A 4JJXA 5H84A 1N71A 4MY0A 5AG5A 4YRHA 4R87A 2HV2A 1CJWA 2K5TA 4HKFA 1QSTA 4KS9A 3N7ZA 5FVJA 3P2FA 3R95A 3CXSA 2F5IA 2Q0YA 1J4JA 1QSOA 1VKCA 1ON0A 2A4NA 3ZZIA 2DPTA 2YNCC 2ZW4A 4R57A 2JDCA 4KORA 3BJ7A 5IB0A 5F47A 2PR8A 4KOSA 4KOTA 2H5MA 4CS0B 5G20A 3BJ8A 2JEVA 4UFXA 3CXQA 4PK2A 4KOVA 1M4DA 4MFPA 4MHDA 3IU2A 4AVCA 2O28A 2GE3A 1LRZA 3IGRA 3S6FA 4XPLA 3KKWA 2JDDA 1S7KA 2B3VA 2FIAA 3B8GA 1KUYA 1U6MA 2ZXVA 4A31A 4XNHB 3DNSA 2B4DA 1Q2YA 5G1ZA 4II9A 1XMTA 2Z0ZA 4UCMA 1Q2CA 3PGPA 1VHSA 4E0AA 1PUAA 3G3SA 2FE7A 5IV0A 1S60A 2BEIA 4PV6A 3E0KA 3W91A 4BMHA 5F49A 3SXNA 1QSNA 1M4IA 1GHEA 4C2ZA 2I00A 2CNMA 4PSXA 2KCWA 3WR7A 5J8FA 4AG7A 2Z11A 3FXTA 3UY5A 2YNDA 5AG7A 1ZO0A 1P4NA 2BUEA 4C2YA 2OZHA 2FS5A 4B5PA 3TTHA 4PK3A 3TT2A 4Q38A 4K30A 2R7HA 4IUSA 2QECA 2CNTA 5KTDA 3VWEA 4OLLA 2PC1A 3EXNA 3T9YA 3GYAA 2J8RA 4UWJA 2Y0MA 4JXRA 3TOAA 2B4BA 3R1KA 4QUSA 4BBHA 4RI1A 3G8WA 5G22A 1S7FA 4OAEA 1Q2DA 1I21A 3FBUA 5HH1A 2G3AA 2IL4A 2OB0A 1M1DA 4IF5A 4R3KA 1R57A 1XIXA 2P0WA 4UFVA 4CAEA 4Y49B 5KTAA 1MK4A 2DXQA 1KZFA 1Y7RA 3LODA 3P2HA 3DR8A 4M85A 4NSQA 3SHPA 3PP9A 4JLYA 3IWGA 4QBJA 4MFQA 4KLVA 1I1DA 1M44A 3NE7A 2EVNA 2GIVA 5AGEA 3R9FA 4KSFA 4H6UA 2R1IA 5A28A 3K9UA 1RXTA 4MI4A 2Z3LA 3QB8A 4CAWA 3TO7A 1MJBA 3OWCA 4C2XA 2ZPAA 4B14A 4B10A 3H5ZA 3FB3A 4CGNA 4KOYA 1Z4EA 5AG6A 5A27A 1M4GA 1MJAA 1SQHA 4MBUA 3JVNA 4ONUA 4A32A 4CYNA 4KOWA 4LX9A 4OADA 2Z10A 4L8AA 2X7BA 1YR0A 2YNCA 4KLWA 1S7LA 3RYOA 2DPSA 2HQYA 2HUZA 4E8OA 3I3GA 4CGLA 4KVME 1K4JA 5H86A 4CAVA 4I49A 4NF1A 4JD6A 1B6BA 2NMTA 2Z3MA 1YVKA 2WUUA 2ZW5A 2PDOA 1IICA 4EVYA 2CXAA 4L89A 4C68A 3TFYA 3MGDA 2QIRA 2YGWA 4QVTA 3EFAA 1WK4A 4MFLA 4UWIA 2ATRA 4R9MA 4A2ZA 1S7NA 4H89A 1WWZA 2WPWA 4AG9A 1S5KA 2EUIA 4UBRA 3CXPA 2I79A 2FCKA 2VZZA 1IYKA 1OZPA 3FIXA 4NXYA 2P6FA 4HNXB 2FIWA 3D2PA 4CYPA 3BLNA 5G21A 4CGPA 3F5BA 4JWPA 1YGHA 4U9YA 2B58A 3H4QA 5IX3A 2JLMA 4FD5A 1QSRA 1B87A 2VZYA 1IYLA 5GCNA 2ZW6A 4KVOE 5I0CA 2BSWA 3SXOA 1CM0A 2P6GA 2VQYA 4MY3A 4A95A 5HMNA 4AVAA 2D4OA 1KUVA 1YLEA 3F0AA 2CY2A 2AE6A 2Q4VA 5ISVA 2VBQA 4ZGYB 3S6GA 3VWDA 4KZTA 2REEA 1Z4RA 5AG4A 4H6ZA 4U9ZA 2R98A 2WPXA 4KOUA 4RS2A 4C7HA 5EBVA 4QC6A 4FD7A 1P0HA 3IWEA 2OU2A 2PRBA 1IIDA 2Z3OA 2VEZA 5EC4A 3A9LA 1YVOA 3TE4A 4MJ8A 2FXFA 4CAFA 3I9SA 5J8CA 2OZUA 3W6XA 2Q04A 4U5YA 4B12A 2OH1A 4HNWB 4MFKA 1Y9KA 2Q7BA 1YX0A 3GY9A 4R3LA 4CYOA 1I12A 3JTKA 4J3GA 4GS4A 5DWNA 3TO9A 3R96A 5JPHA 1TIQA 1Z9UA 3EC4A 1PU9A 1YK3A 4CGOA 2FT0A 2G3TA 2RC4A 3S6KA 3D3SA 4ZBGA 2Z3NA 4Q36A 2ARHA 3FNCA 4CAXA 1KUXA 2C27A 1XF8A 4QB9A 3TO6A 4A33A 1IB1E 1XEBA 3JUWA 2Q4YA 1L0CA 2VI7A 4CRZB 4YFJA 1MJ9A 1S3ZA 4PSWA 4KUBA 4KSAA 5BWAB 4CGMA 4X5KA 5JQ4A 2AJ6A 4Y49C 3QAHA 2G0BA 1XE4A 3EO4A 4XPDC 4XNHC 4UFWA 1YREA 3R9GA 3DDDA 4F6AA 5KTCA 4NEXA 4UCNA 3V8IA 4NCZA 4C7IA 1FY7A 4UA3A 3W6SA 3EY5A 2GANA 4KVXA 4LUAA 2J8MA 4HNYB 2D4PA 4XPKA 2QMLA 1BO4A 3ZJ0A 1NE9A 3D2MA 1RO5A 4AB7A 1NMTA 2YNEA 3F8KA 2B5GB 4MFJA 3S6HA 1QSMA 2PR1A 1NSLA 4CYQA 5F46A 4MFZA 1UFHA 1BOBA 2Z3PA 3GKRA 2FL4A 4KUAA 2FSRA 2BL1A 2R8VA 4YGOA 5C88A 4E2AA 4B5PB 3PZJA 3TOBA 3D8PA 4UCPA 3IU1A 2CNSA 3DR6A 4B13A 4CRYB 2B5GA 4JXQA 3C26A 4ORFA 4A30A 5CNPA 3TCVA 1Y9WA 2REFA 2Z3KA 4FD6A 4M3SA 2B4DB 4B5OA 3FYNA 2ZW7A 5C82A 4B11A 3T90A 5E96A 3FRMA 4KOXA 5F48A 2PQ8A 2OZGA 4AVBA 2P6EA 4DNCA 2B3UA 2J8NA 4F0XA 4FD4A 1V0CA 3R9EA 2PSWA 2Q44A 5DWMA 2VXKA 3DSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPD B;  4F0Y A;  3LD2 A;  4JJX A;  5H84 A;  1N71 A;  4MY0 A;  4YRH A;  4R87 A;  2HV2 A;  1CJW A;  2K5T A;  4HKF A;  1QST A;  3N7Z A;  5FVJ A;  3P2F A;  3R95 A;  3CXS A;  2F5I A;  2Q0Y A;  1J4J A;  1QSO A;  1VKC A;  1ON0 A;  2A4N A;  3ZZI A;  2ZW4 A;  4R57 A;  2JDC A;  4KOR A;  3BJ7 A;  5IB0 A;  5F47 A;  2PR8 A;  4KOS A;  4KOT A;  2H5M A;  4CS0 B;  3BJ8 A;  2JEV A;  3CXQ A;  4PK2 A;  4KOV A;  1M4D A;  4MHD A;  4AVC A;  2O28 A;  2GE3 A;  1LRZ A;  3IGR A;  3S6F A;  4XPL A;  3KKW A;  2JDD A;  1S7K A;  2B3V A;  2FIA A;  3B8G A;  1KUY A;  1U6M A;  2ZXV A;  4XNH B;  3DNS A;  2B4D A;  1Q2Y A;  4II9 A;  1XMT A;  2Z0Z A;  1Q2C A;  3PGP A;  1VHS A;  4E0A A;  1PUA A;  3G3S A;  2FE7 A;  5IV0 A;  1S60 A;  2BEI A;  4PV6 A;  3E0K A;  3W91 A;  4BMH A;  5F49 A;  3SXN A;  1QSN A;  1M4I A;  1GHE A;  2I00 A;  2CNM A;  4PSX A;  2KCW A;  3WR7 A;  5J8F A;  4AG7 A;  2Z11 A;  3FXT A;  3UY5 A;  2BUE A;  1P4N A;  2OZH A;  2FS5 A;  4B5P A;  3TTH A;  4PK3 A;  3TT2 A;  4K30 A;  2R7H A;  4IUS A;  2QEC A;  2CNT A;  5KTD A;  3VWE A;  4OLL A;  2PC1 A;  3EXN A;  3T9Y A;  3GYA A;  2J8R A;  4UWJ A;  2Y0M A;  4JXR A;  3TOA A;  2B4B A;  3R1K A;  4QUS A;  4RI1 A;  3G8W A;  1S7F A;  4OAE A;  1Q2D A;  1I21 A;  3FBU A;  5HH1 A;  2G3A A;  2IL4 A;  2OB0 A;  1M1D A;  4IF5 A;  4R3K A;  1R57 A;  1XIX A;  2P0W A;  4Y49 B;  5KTA A;  1MK4 A;  2DXQ A;  1KZF A;  1Y7R A;  3LOD A;  3P2H A;  3DR8 A;  4M85 A;  4NSQ A;  3SHP A;  3PP9 A;  4JLY A;  3IWG A;  4QBJ A;  4KLV A;  1I1D A;  1M44 A;  3NE7 A;  2EVN A;  2GIV A;  3R9F A;  4H6U A;  2R1I A;  3K9U A;  1RXT A;  4MI4 A;  3QB8 A;  4CAW A;  3TO7 A;  1MJB A;  3OWC A;  2ZPA A;  3FB3 A;  4KOY A;  1Z4E A;  1M4G A;  1MJA A;  1SQH A;  4MBU A;  3JVN A;  4ONU A;  4KOW A;  4LX9 A;  4OAD A;  2Z10 A;  4L8A A;  2X7B A;  1YR0 A;  4KLW A;  1S7L A;  3RYO A;  2HQY A;  2HUZ A;  4E8O A;  3I3G A;  4KVM E;  1K4J A;  5H86 A;  4CAV A;  4I49 A;  4NF1 A;  4JD6 A;  1B6B A;  2NMT A;  1YVK A;  2ZW5 A;  2PDO A;  1IIC A;  4EVY A;  4L89 A;  3TFY A;  3MGD A;  2QIR A;  4QVT A;  3EFA A;  1WK4 A;  4UWI A;  2ATR A;  4R9M A;  1S7N A;  4H89 A;  1WWZ A;  2WPW A;  4AG9 A;  1S5K A;  2EUI A;  4UBR A;  3CXP A;  2I79 A;  2FCK A;  2VZZ A;  1IYK A;  1OZP A;  3FIX A;  4NXY A;  2P6F A;  4HNX B;  2FIW A;  3D2P A;  3BLN A;  3F5B A;  4JWP A;  1YGH A;  4U9Y A;  2B58 A;  3H4Q A;  5IX3 A;  2JLM A;  4FD5 A;  1QSR A;  1B87 A;  2VZY A;  1IYL A;  5GCN A;  2ZW6 A;  4KVO E;  5I0C A;  2BSW A;  3SXO A;  1CM0 A;  2P6G A;  2VQY A;  4MY3 A;  5HMN A;  4AVA A;  2D4O A;  1KUV A;  1YLE A;  3F0A A;  2CY2 A;  2AE6 A;  2Q4V A;  5ISV A;  2VBQ A;  3S6G A;  3VWD A;  4KZT A;  2REE A;  1Z4R A;  4H6Z A;  4U9Z A;  2R98 A;  2WPX A;  4KOU A;  4RS2 A;  5EBV A;  4QC6 A;  4FD7 A;  1P0H A;  2OU2 A;  2PRB A;  1IID A;  2VEZ A;  5EC4 A;  1YVO A;  3TE4 A;  4MJ8 A;  2FXF A;  3I9S A;  5J8C A;  2OZU A;  3W6X A;  2Q04 A;  4U5Y A;  2OH1 A;  4HNW B;  1Y9K A;  2Q7B A;  1YX0 A;  3GY9 A;  4R3L A;  1I12 A;  4J3G A;  4GS4 A;  5DWN A;  3TO9 A;  3R96 A;  5JPH A;  1TIQ A;  1Z9U A;  3EC4 A;  1PU9 A;  1YK3 A;  2FT0 A;  2G3T A;  2RC4 A;  3S6K A;  3D3S A;  4ZBG A;  2ARH A;  3FNC A;  4CAX A;  1KUX A;  2C27 A;  1XF8 A;  4QB9 A;  3TO6 A;  1IB1 E;  1XEB A;  3JUW A;  2Q4Y A;  1L0C A;  2VI7 A;  4CRZ B;  4YFJ A;  1MJ9 A;  1S3Z A;  4PSW A;  4KUB A;  4X5K A;  5JQ4 A;  2AJ6 A;  4Y49 C;  3QAH A;  2G0B A;  1XE4 A;  3EO4 A;  4XPD C;  4XNH C;  1YRE A;  3R9G A;  3DDD A;  4F6A A;  5KTC A;  4NEX A;  3V8I A;  4NCZ A;  1FY7 A;  4UA3 A;  3W6S A;  3EY5 A;  2GAN A;  4KVX A;  4LUA A;  2J8M A;  4HNY B;  2D4P A;  4XPK A;  2QML A;  1BO4 A;  3ZJ0 A;  1NE9 A;  3D2M A;  1RO5 A;  4AB7 A;  1NMT A;  3F8K A;  2B5G B;  3S6H A;  1QSM A;  2PR1 A;  1NSL A;  5F46 A;  1UFH A;  1BOB A;  3GKR A;  2FL4 A;  4KUA A;  2FSR A;  2BL1 A;  2R8V A;  4YGO A;  5C88 A;  4E2A A;  4B5P B;  3PZJ A;  3TOB A;  3D8P A;  2CNS A;  3DR6 A;  4CRY B;  2B5G A;  4JXQ A;  3C26 A;  4ORF A;  5CNP A;  3TCV A;  1Y9W A;  2REF A;  4FD6 A;  4M3S A;  2B4D B;  4B5O A;  3FYN A;  2ZW7 A;  5C82 A;  3T90 A;  5E96 A;  3FRM A;  4KOX A;  5F48 A;  2PQ8 A;  2OZG A;  4AVB A;  2P6E A;  4DNC A;  2B3U A;  2J8N A;  4FD4 A;  1V0C A;  3R9E A;  2PSW A;  2Q44 A;  5DWM A;  2VXK A;  3DSB A; 
#chains in the Genus database with same CATH topology
 3IJ3 A;  3KGQ A;  2JEW A;  5D8N A;  4A38 A;  2WSA A;  4XPD B;  2ZEL A;  4F0Y A;  2PJ4 A;  3LD2 A;  4JJX A;  1YME A;  3FED A;  4FWU A;  1N71 A;  4MY0 A;  5AG5 A;  5H84 A;  2BOA A;  4YRH A;  2O53 A;  4R87 A;  2HV2 A;  1CJW A;  2AFX A;  2K5T A;  4HKF A;  1QST A;  2WZN A;  3CDX A;  4TWE A;  4K3N A;  4KS9 A;  3N7Z A;  5FVJ A;  3P2F A;  3R95 A;  2PJA A;  4KSI A;  8CPA A;  1QQ9 A;  3B2Y A;  3CXS A;  2F5I A;  5DS0 A;  2ZEP A;  1XFO A;  2Q0Y A;  1J4J A;  2Q4Z A;  3WAB A;  1QSO A;  1VKC A;  1ON0 A;  2A4N A;  1DE4 C;  3B3W A;  3ZZI A;  2DPT A;  7CPA A;  2YNC C;  4X8I A;  2ZW4 A;  4R57 A;  2JDC A;  2XEG A;  4KOR A;  1Y0R A;  2PJ3 A;  3BJ7 A;  5IB0 A;  2HC9 A;  5LYL A;  5F47 A;  4ZY2 A;  2PR8 A;  5JH9 A;  4KOS A;  4KOT A;  2H5M A;  2ZEF A;  3NE8 A;  4JZ0 A;  4OC5 A;  3N5F A;  2RB7 A;  2AFU A;  1YSJ A;  5HVF A;  3QNV A;  2V8H A;  4CS0 B;  3IO1 A;  5G20 A;  3BJ8 A;  2JEV A;  4UFX A;  2AFS A;  3CXQ A;  4PK2 A;  4KOV A;  1M4D A;  4JYW A;  2PJ1 A;  4A39 A;  4MFP A;  4MHD A;  3IU2 A;  4AVC A;  2O28 A;  3IFE A;  3FEE A;  1Y0Y A;  2GE3 A;  1LRZ A;  3IGR A;  3S6F A;  4XPL A;  3KKW A;  1QMU A;  3V7Z A;  2ZOG A;  2JDD A;  2JBJ A;  1S7K A;  2B3V A;  2GLF A;  2ODF A;  4P10 A;  4EWT A;  2FIA A;  4EME A;  1AYE A;  3B8G A;  5K8O A;  4MHY A;  1KUY A;  1U6M A;  2ZXV A;  4A31 A;  4XNH B;  1M4L A;  3DNS A;  2B4D A;  4P4I A;  4OC0 A;  1Q2Y A;  1TKJ A;  4MMO A;  5G1Z A;  4II9 A;  1XMT A;  1YW4 A;  2GFQ A;  1NSA A;  2Z0Z A;  3BI1 A;  1LAP A;  3FEC A;  1Q2C A;  4UCM A;  1CBX A;  1VHS A;  3PGP A;  4E0A A;  1Z5R A;  4BIN A;  3PFO A;  4IK2 A;  4PQA A;  5HVH A;  3TX8 A;  1PUA A;  1ARM A;  1X10 A;  3G3S A;  3BI0 A;  2FE7 A;  5IV0 A;  1S60 A;  2BEI A;  3JRU A;  4UIB A;  4PV6 A;  3E0K A;  2PJ0 A;  3W91 A;  2PCU A;  4BMH A;  5F49 A;  3SXN A;  1QSN A;  4TNU A;  1M4I A;  2BO9 A;  1GHE A;  4AXV A;  4C2Z A;  2I00 A;  5JGF A;  2CNM A;  1ZLI A;  3SJF A;  4IHM A;  4PSX A;  2KCW A;  3WR7 A;  5J8F A;  4AG7 A;  1CX8 A;  1JQG A;  2JBK A;  2Z11 A;  1TF8 A;  3KR4 A;  3FXT A;  3UY5 A;  2YND A;  5AG7 A;  3D7F A;  1ZO0 A;  1ARL A;  1P4N A;  2BUE A;  2OZH A;  4C2Y A;  4ZY0 A;  2FS5 A;  2CTB A;  3TTH A;  4B5P A;  4PK3 A;  3S9L A;  3TT2 A;  4UEE A;  2OR4 A;  4NFR A;  4Q38 A;  4K30 A;  2R7H A;  2ZEH A;  4IUS A;  4P6Y A;  2QEC A;  2CNT A;  5KTD A;  1Y7E A;  3VWE A;  4OLL A;  3NFZ A;  2PC1 A;  3EXN A;  3VAT A;  3T9Y A;  3GYA A;  2J8R A;  4UWJ A;  5I4M A;  2Y0M A;  2CF4 A;  4JXR A;  3TOA A;  1FT7 A;  1H8L A;  2B4B A;  3R1K A;  2EBJ A;  4QUS A;  4UF4 A;  3ISZ A;  4PXB A;  4BBH A;  1Z8T A;  1GYT A;  1DTD A;  1Z8X A;  4RI1 A;  3MRU A;  2PIZ A;  3G8W A;  3PBE A;  3PB6 X;  3PRT A;  5G22 A;  3SI2 A;  1S7F A;  4OAE A;  3H8G A;  2PJ6 A;  4M6I A;  4OC2 A;  1Q2D A;  1I21 A;  3FBU A;  3KQX A;  5HH1 A;  2G3A A;  2IL4 A;  3CPA A;  2OB0 A;  5HXD A;  1M1D A;  1ZLH A;  4G1P A;  4IF5 A;  4R3K A;  1R57 A;  1XIX A;  2P0W A;  4UFV A;  4X3R A;  4CAE A;  4Y49 B;  5KTA A;  1MK4 A;  4R8F A;  1LCP A;  1KZF A;  2DXQ A;  4P4D A;  1Y7R A;  1BPN A;  3LOD A;  2ZEN A;  3P2H A;  3DR8 A;  4IAV A;  4X2T A;  5K8N A;  3TC8 A;  4M85 A;  2EO8 A;  3WC7 A;  4H2K A;  3PB8 X;  4NSQ A;  4NGS A;  3SHP A;  3PP9 A;  4JLY A;  4P4J A;  5LYI A;  3IWG A;  4OME A;  4QBJ A;  4MFQ A;  4ZX9 A;  4KLV A;  1I1D A;  1TXR A;  1M44 A;  3NE7 A;  1KWM A;  2EVN A;  3S9N A;  4LQ6 A;  4ONW A;  2GIV A;  2ZEM A;  1LAN A;  3K2K A;  3QAY A;  1XOV A;  4NGN A;  5AGE A;  3R9F A;  1F57 A;  4KSF A;  4H6U A;  2R1I A;  4BD9 A;  5A28 A;  3K9U A;  1RXT A;  4MI4 A;  1X12 A;  2Z3L A;  3QB8 A;  2PJ7 A;  4CAW A;  3TO7 A;  4R7M A;  3WT4 A;  4OP4 A;  1MJB A;  3OWC A;  4R76 A;  4C2X A;  2ZPA A;  4B14 A;  1F2O A;  3FJU A;  4NGR A;  4B10 A;  5LRK A;  3H5Z A;  3FB3 A;  4NGT A;  4OC3 A;  4CGN A;  3GB0 A;  4KOY A;  1Z4E A;  5AG6 A;  4UEZ A;  1TF9 A;  1ZG8 A;  5A27 A;  2PJ5 A;  2QYV A;  3HUV A;  2Q43 A;  1M4G A;  1MJA A;  1SQH A;  4MBU A;  2QJ8 A;  4PXD A;  2CIJ A;  2HB6 A;  4M6H A;  3JVN A;  4ONU A;  5HVG A;  4A32 A;  5JM6 A;  5LYF A;  3RBU A;  4CYN A;  4KOW A;  4LX9 A;  4OAD A;  3KI9 A;  2Z10 A;  4L8A A;  4PPZ A;  2AFM A;  2XEF A;  3FX6 A;  4FBE A;  2X7B A;  1YR0 A;  2YNC A;  4KLW A;  4ZYQ A;  1S7L A;  3RYO A;  4NGM A;  2DPS A;  2HQY A;  2HUZ A;  3IEH A;  2AFZ A;  3I3G A;  4E8O A;  4OID A;  4PXC A;  4CGL A;  4KVM E;  1K4J A;  5H86 A;  4CAV A;  6CPA A;  4I49 A;  4UEF A;  4NF1 A;  4JD6 A;  3B3S A;  1B6B A;  1PCA A;  2NMT A;  1YVK A;  2WUU A;  2Z3M A;  5THW A;  2ZW5 A;  4P44 A;  3V38 A;  2I3C A;  2PDO A;  2OOT A;  1IIC A;  1EE3 P;  4P45 A;  4NGQ A;  3FVL A;  4EVY A;  2NYQ A;  1R43 A;  2CXA A;  3RNZ A;  4L89 A;  3GIU A;  4NJQ A;  4C68 A;  3TFY A;  4CPA A;  3MGD A;  2XEI A;  4GM5 A;  2QIR A;  2YGW A;  4QVT A;  2C1C A;  3EFA A;  1WK4 A;  3B3T A;  3IIB A;  2ATR A;  4MFL A;  4R9M A;  3I1U A;  1S7N A;  4UWI A;  4GXH A;  4A2Z A;  2DEA A;  4F8Z A;  1IU8 A;  1VGY A;  4H89 A;  5F09 A;  1IOI A;  1R3N A;  1F2P A;  1WWZ A;  3GUX A;  3VH9 A;  2WPW A;  4AG9 A;  4RN7 A;  1S5K A;  2EUI A;  4UBR A;  3CXP A;  2I79 A;  3PB4 X;  1UWY A;  3ISX A;  4F9U A;  2V8D A;  3SJX A;  5EMI A;  2ZEG A;  2FCK A;  2VZZ A;  1Q7L A;  4MRI A;  1IYK A;  1OZP A;  3FIX A;  4OC1 A;  4OIW A;  4NXY A;  3WC6 A;  3NH5 A;  1ELM P;  2P6F A;  4HNX B;  4YWY A;  1TKF A;  2FIW A;  4MCQ A;  2GU2 A;  3D2P A;  4CYP A;  3BLN A;  5G21 A;  1BPM A;  4CGP A;  3F5B A;  4A94 A;  3L2N A;  1CP7 A;  4JWP A;  1JWQ A;  1YGH A;  4U9Y A;  2NSM A;  4P4F A;  2B58 A;  3H4Q A;  1Z8W A;  2PJ2 A;  4EFD A;  5IX3 A;  2JLM A;  4FD5 A;  2IQ6 A;  1QSR A;  1B87 A;  2VZY A;  4M6G A;  4Z65 A;  3SJE A;  5CPA A;  3PFE A;  1AMP A;  1IYL A;  5GCN A;  4A33 A;  2ZED A;  2ZW6 A;  2PJ9 A;  2WYR A;  4UIA A;  2DF5 A;  2C6G A;  1Z8L A;  3HLP A;  4KVO E;  5I0C A;  2BSW A;  3SXO A;  1CM0 A;  2P6G A;  3CPX A;  1HDQ A;  2VQY A;  2ZEE A;  4FUU A;  4MY3 A;  4A95 A;  4OC4 A;  4O23 A;  3KHX A;  3IC1 A;  5HMN A;  4AVA A;  2D4O A;  1KUV A;  1YLE A;  3F0A A;  2CY2 A;  3VAR A;  2AE6 A;  2F7V A;  2Q4V A;  4DYO A;  1VIX A;  5ISV A;  2VBQ A;  3DLJ A;  3CT9 A;  4ZGY B;  1BLL E;  3B35 A;  3LMS A;  2BCO A;  3S6G A;  4MHP A;  3VWD A;  4ZY1 A;  4KZT A;  2REE A;  1Z4R A;  1LFW A;  5AG4 A;  3FH4 A;  4H6Z A;  4U9Z A;  3B3C A;  3D4U A;  2R98 A;  2C6P A;  2WPX A;  3D68 A;  2EWB A;  4KOU A;  4RS2 A;  1TKH A;  3B3V A;  3T8W A;  4FAI A;  4C7H A;  2ZEO A;  3RO0 A;  5EBV A;  4QC6 A;  4FD7 A;  1P0H A;  3KQZ A;  4HPS A;  3IWE A;  3WC5 A;  2OU2 A;  2PRB A;  1IID A;  2Z3O A;  2VEZ A;  5EC4 A;  2J9A A;  3RZA A;  3BHX A;  3A9L A;  1YVO A;  3TE4 A;  4MJ8 A;  2FXF A;  3DGV A;  4CAF A;  3I9S A;  5J8C A;  3K9T A;  2OZU A;  3PEI A;  4P4B A;  3W6X A;  2PVW A;  2Q04 A;  2PE3 A;  1XBU A;  4YU9 A;  5LRJ A;  4U5Y A;  4B12 A;  1VHO A;  2V8V A;  3SI1 A;  2EK8 A;  2C6C A;  2OH1 A;  4HNW B;  1ZG7 A;  4MCR A;  3KZW A;  4MFK A;  1VHE A;  2F8H A;  3KHZ A;  3NA6 A;  2V77 A;  1Y9K A;  1CPS A;  4MCP A;  2Q7B A;  1YX0 A;  1A2Z A;  3GY9 A;  4R3L A;  4CYO A;  5K8M A;  1I12 A;  3JTK A;  4J3G A;  3D7D A;  4GS4 A;  5DWN A;  2IJZ A;  4WWV A;  3TO9 A;  2PIY A;  3R96 A;  1YQE A;  5JPH A;  1LOK A;  1TIQ A;  4NGP A;  1Z9U A;  3EC4 A;  2IMO A;  1PU9 A;  2CTC A;  1YK3 A;  4LQG A;  4CGO A;  2FT0 A;  2G3T A;  2RC4 A;  2Q7S A;  3S6K A;  3D3S A;  4MXU A;  4ZBG A;  2Z3N A;  5ELY A;  4Q36 A;  2ARH A;  3FNC A;  5LRG A;  2V8G A;  4CAX A;  1PYT B;  3CZX A;  1KUX A;  2C27 A;  1XF8 A;  4QB9 A;  2AFW A;  5D29 A;  1IB1 E;  3B7I A;  3PB9 X;  3TO6 A;  1XEB A;  1XMB A;  1OBR A;  3JUW A;  2Q4Y A;  3D66 A;  1L0C A;  1IGB A;  3D7H A;  1XRY A;  2VI7 A;  3D7G A;  4CRZ B;  4YFJ A;  2PVV A;  1MJ9 A;  1S3Z A;  4PSW A;  3NH4 A;  4KUB A;  4KSA A;  5BWA B;  4W9Y A;  4CGM A;  4X5K A;  5JQ4 A;  2AJ6 A;  4Q7A A;  4Y49 C;  1ZG9 A;  3QAH A;  2G0B A;  1XE4 A;  3EO4 A;  4XPD C;  4R6T A;  4RUH A;  4XNH C;  4UFW A;  1YRE A;  3R9G A;  1LAM A;  3DDD A;  4F6A A;  5KTC A;  3H8E A;  4NEX A;  4UCN A;  3V8I A;  3PB7 X;  1XJO A;  4NCZ A;  4A37 A;  4C7I A;  1FY7 A;  1Z2L A;  2RFH A;  4UA3 A;  3S9M A;  3KAS A;  4PXE A;  3W6S A;  3EY5 A;  1CPX A;  2GAN A;  5J1Q A;  4KVX A;  4LUA A;  2J8M A;  4HNY B;  3IWW A;  2D4P A;  2G9D A;  2POK A;  2QML A;  4XPK A;  1YLO A;  5K8P A;  1BO4 A;  3ZJ0 A;  2VL1 A;  3BXM A;  2GLJ A;  1NE9 A;  2O4H A;  3D2M A;  3FF3 A;  1RO5 A;  4AB7 A;  4ZI6 A;  4MCS A;  3GLJ A;  1NMT A;  2YNE A;  3F8K A;  2B5G B;  4MFJ A;  3SI0 A;  3S6H A;  4MHN A;  5LYD A;  1QSM A;  2PR1 A;  1NSL A;  2ABZ A;  4CYQ A;  5F46 A;  4MFZ A;  4ZX8 A;  2GRE A;  3SJG A;  1UFH A;  3PBB A;  1BOB A;  2Z3P A;  3GKR A;  2FL4 A;  4KUA A;  1FNO A;  3FMC A;  2FSR A;  1HEE A;  4P4E A;  2BL1 A;  4WJB A;  2AFO A;  2R8V A;  4YGO A;  5C88 A;  1BAV A;  1RTQ A;  4E2A A;  4B5P B;  1CP6 A;  3PZJ A;  2QVP A;  3TOB A;  3D8P A;  3LAC A;  4UCP A;  1HDU A;  3IU1 A;  1CG2 A;  2CNS A;  3LWU A;  3DR6 A;  4B13 A;  2ZOF A;  4CRY B;  4NJR A;  2PJB A;  1IOF A;  2B5G A;  3KR5 A;  2ANP A;  4DJL A;  4JXQ A;  3C26 A;  3KL9 A;  4OKO A;  1AUG A;  4ORF A;  4A30 A;  2PJC A;  3MN8 A;  3NH8 A;  5CNP A;  1IY7 A;  1YW6 A;  2PJ8 A;  2PRQ A;  3TCV A;  4DUK A;  1Y9W A;  2REF A;  2Z3K A;  4FD6 A;  4M3S A;  4B6Z A;  2B4D B;  4B5O A;  3FYN A;  2ZW7 A;  4F9V A;  4B11 A;  5C82 A;  3T90 A;  5CBM A;  5E96 A;  3RAM A;  3D67 A;  1ELL P;  3FRM A;  4KOX A;  5F48 A;  2PQ8 A;  2FVG A;  2OZG A;  3H8F A;  4AVB A;  2EK9 A;  2P6E A;  4DNC A;  2B3U A;  2J8N A;  2Q51 A;  4MHZ A;  4F0X A;  4FD4 A;  1V0C A;  3R9E A;  2PSW A;  2Q44 A;  5DWM A;  5IB9 A;  2VXK A;  3DSB A;  2XEJ A; 
#chains in the Genus database with same CATH homology
 2WSA A;  4XPD B;  4F0Y A;  3LD2 A;  4JJX A;  5H84 A;  1N71 A;  4MY0 A;  5AG5 A;  4YRH A;  4R87 A;  2HV2 A;  1CJW A;  2K5T A;  4HKF A;  1QST A;  4KS9 A;  3N7Z A;  5FVJ A;  3P2F A;  3R95 A;  3CXS A;  2F5I A;  2Q0Y A;  1J4J A;  1QSO A;  1VKC A;  1ON0 A;  2A4N A;  3ZZI A;  2DPT A;  2YNC C;  2ZW4 A;  4R57 A;  2JDC A;  4KOR A;  3BJ7 A;  5IB0 A;  5F47 A;  2PR8 A;  4KOS A;  4KOT A;  2H5M A;  4CS0 B;  5G20 A;  3BJ8 A;  2JEV A;  4UFX A;  3CXQ A;  4PK2 A;  4KOV A;  1M4D A;  4MFP A;  4MHD A;  3IU2 A;  4AVC A;  2O28 A;  2GE3 A;  1LRZ A;  3IGR A;  3S6F A;  4XPL A;  3KKW A;  2JDD A;  1S7K A;  2B3V A;  2FIA A;  3B8G A;  1KUY A;  1U6M A;  2ZXV A;  4A31 A;  4XNH B;  3DNS A;  2B4D A;  1Q2Y A;  5G1Z A;  4II9 A;  1XMT A;  2Z0Z A;  4UCM A;  1Q2C A;  3PGP A;  1VHS A;  4E0A A;  1PUA A;  3G3S A;  2FE7 A;  5IV0 A;  1S60 A;  2BEI A;  4PV6 A;  3E0K A;  3W91 A;  4BMH A;  5F49 A;  3SXN A;  1QSN A;  1M4I A;  1GHE A;  4C2Z A;  2I00 A;  2CNM A;  4PSX A;  2KCW A;  3WR7 A;  5J8F A;  4AG7 A;  2Z11 A;  3FXT A;  3UY5 A;  2YND A;  5AG7 A;  1ZO0 A;  1P4N A;  2BUE A;  4C2Y A;  2OZH A;  2FS5 A;  4B5P A;  3TTH A;  4PK3 A;  3TT2 A;  4Q38 A;  4K30 A;  2R7H A;  4IUS A;  2QEC A;  2CNT A;  5KTD A;  3VWE A;  4OLL A;  2PC1 A;  3EXN A;  3T9Y A;  3GYA A;  2J8R A;  4UWJ A;  2Y0M A;  4JXR A;  3TOA A;  2B4B A;  3R1K A;  4QUS A;  4BBH A;  4RI1 A;  3G8W A;  5G22 A;  1S7F A;  4OAE A;  1Q2D A;  1I21 A;  3FBU A;  5HH1 A;  2G3A A;  2IL4 A;  2OB0 A;  1M1D A;  4IF5 A;  4R3K A;  1R57 A;  1XIX A;  2P0W A;  4UFV A;  4CAE A;  4Y49 B;  5KTA A;  1MK4 A;  2DXQ A;  1KZF A;  1Y7R A;  3LOD A;  3P2H A;  3DR8 A;  4M85 A;  4NSQ A;  3SHP A;  3PP9 A;  4JLY A;  3IWG A;  4QBJ A;  4MFQ A;  4KLV A;  1I1D A;  1M44 A;  3NE7 A;  2EVN A;  2GIV A;  5AGE A;  3R9F A;  4KSF A;  4H6U A;  2R1I A;  5A28 A;  3K9U A;  1RXT A;  4MI4 A;  2Z3L A;  3QB8 A;  4CAW A;  3TO7 A;  1MJB A;  3OWC A;  4C2X A;  2ZPA A;  4B14 A;  4B10 A;  3H5Z A;  3FB3 A;  4CGN A;  4KOY A;  1Z4E A;  5AG6 A;  5A27 A;  1M4G A;  1MJA A;  1SQH A;  4MBU A;  3JVN A;  4ONU A;  4A32 A;  4CYN A;  4KOW A;  4LX9 A;  4OAD A;  2Z10 A;  4L8A A;  2X7B A;  1YR0 A;  2YNC A;  4KLW A;  1S7L A;  3RYO A;  2DPS A;  2HQY A;  2HUZ A;  4E8O A;  3I3G A;  4CGL A;  4KVM E;  1K4J A;  5H86 A;  4CAV A;  4I49 A;  4NF1 A;  4JD6 A;  1B6B A;  2NMT A;  2Z3M A;  1YVK A;  2WUU A;  2ZW5 A;  2PDO A;  1IIC A;  4EVY A;  2CXA A;  4L89 A;  4C68 A;  3TFY A;  3MGD A;  2QIR A;  2YGW A;  4QVT A;  3EFA A;  1WK4 A;  4MFL A;  4UWI A;  2ATR A;  4R9M A;  4A2Z A;  1S7N A;  4H89 A;  1WWZ A;  2WPW A;  4AG9 A;  1S5K A;  2EUI A;  4UBR A;  3CXP A;  2I79 A;  2FCK A;  2VZZ A;  1IYK A;  1OZP A;  3FIX A;  4NXY A;  2P6F A;  4HNX B;  2FIW A;  3D2P A;  4CYP A;  3BLN A;  5G21 A;  4CGP A;  3F5B A;  4JWP A;  1YGH A;  4U9Y A;  2B58 A;  3H4Q A;  5IX3 A;  2JLM A;  4FD5 A;  1QSR A;  1B87 A;  2VZY A;  1IYL A;  5GCN A;  2ZW6 A;  4KVO E;  5I0C A;  2BSW A;  3SXO A;  1CM0 A;  2P6G A;  2VQY A;  4MY3 A;  4A95 A;  5HMN A;  4AVA A;  2D4O A;  1KUV A;  1YLE A;  3F0A A;  2CY2 A;  2AE6 A;  2Q4V A;  5ISV A;  2VBQ A;  4ZGY B;  3S6G A;  3VWD A;  4KZT A;  2REE A;  1Z4R A;  5AG4 A;  4H6Z A;  4U9Z A;  2R98 A;  2WPX A;  4KOU A;  4RS2 A;  4C7H A;  5EBV A;  4QC6 A;  4FD7 A;  1P0H A;  3IWE A;  2OU2 A;  2PRB A;  1IID A;  2Z3O A;  2VEZ A;  5EC4 A;  3A9L A;  1YVO A;  3TE4 A;  4MJ8 A;  2FXF A;  4CAF A;  3I9S A;  5J8C A;  2OZU A;  3W6X A;  2Q04 A;  4U5Y A;  4B12 A;  2OH1 A;  4HNW B;  4MFK A;  1Y9K A;  2Q7B A;  1YX0 A;  3GY9 A;  4R3L A;  4CYO A;  1I12 A;  3JTK A;  4J3G A;  4GS4 A;  5DWN A;  3TO9 A;  3R96 A;  5JPH A;  1TIQ A;  1Z9U A;  3EC4 A;  1PU9 A;  1YK3 A;  4CGO A;  2FT0 A;  2G3T A;  2RC4 A;  3S6K A;  3D3S A;  4ZBG A;  2Z3N A;  4Q36 A;  2ARH A;  3FNC A;  4CAX A;  1KUX A;  2C27 A;  1XF8 A;  4QB9 A;  3TO6 A;  4A33 A;  1IB1 E;  1XEB A;  3JUW A;  2Q4Y A;  1L0C A;  2VI7 A;  4CRZ B;  4YFJ A;  1MJ9 A;  1S3Z A;  4PSW A;  4KUB A;  4KSA A;  5BWA B;  4CGM A;  4X5K A;  5JQ4 A;  2AJ6 A;  4Y49 C;  3QAH A;  2G0B A;  1XE4 A;  3EO4 A;  4XPD C;  4XNH C;  4UFW A;  1YRE A;  3R9G A;  3DDD A;  4F6A A;  5KTC A;  4NEX A;  4UCN A;  3V8I A;  4NCZ A;  4C7I A;  1FY7 A;  4UA3 A;  3W6S A;  3EY5 A;  2GAN A;  4KVX A;  4LUA A;  2J8M A;  4HNY B;  2D4P A;  4XPK A;  2QML A;  1BO4 A;  3ZJ0 A;  1NE9 A;  3D2M A;  1RO5 A;  4AB7 A;  1NMT A;  2YNE A;  3F8K A;  2B5G B;  4MFJ A;  3S6H A;  1QSM A;  2PR1 A;  1NSL A;  4CYQ A;  5F46 A;  4MFZ A;  1UFH A;  1BOB A;  2Z3P A;  3GKR A;  2FL4 A;  4KUA A;  2FSR A;  2BL1 A;  2R8V A;  4YGO A;  5C88 A;  4E2A A;  4B5P B;  3PZJ A;  3TOB A;  3D8P A;  4UCP A;  3IU1 A;  2CNS A;  3DR6 A;  4B13 A;  4CRY B;  2B5G A;  4JXQ A;  3C26 A;  4ORF A;  4A30 A;  5CNP A;  3TCV A;  1Y9W A;  2REF A;  2Z3K A;  4FD6 A;  4M3S A;  2B4D B;  4B5O A;  3FYN A;  2ZW7 A;  5C82 A;  4B11 A;  3T90 A;  5E96 A;  3FRM A;  4KOX A;  5F48 A;  2PQ8 A;  2OZG A;  4AVB A;  2P6E A;  4DNC A;  2B3U A;  2J8N A;  4F0X A;  4FD4 A;  1V0C A;  3R9E A;  2PSW A;  2Q44 A;  5DWM A;  2VXK A;  3DSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...