1IYLA

Crystal structure of candida albicans n-myristoyltransferase with non-peptidic inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
384
structure length
384
Chain Sequence
TPEDVPNDPLPLISDFEWSTLDIDDNLQLDELYKLLYDNYVEDIDATFRFKYSHEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVTFKLNKSNKVIDSVEINFLCIHKKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPTPLTTCRYQHRPINWSKLHDVGFSHLPPNQTKSSMVASYTLPNNPKLKGLRPMTGKDVSTVLSLLYKYQERFDIVQLFTEEEFKHWMLGHDENSDSNVVKSYVVEDENGIITDYFSYYLLPFTVLDNAQHDELGIAYLFYYASDSFEKPNYKKRLNELITDALITSKKFGVDVFNCLTCQDNTYFLKDCKFGSGDGFLNYYLFNYRTFPMDGGIDKKTKEVVEDQTSGIGVVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myristoyl-CoA:Protein N-Myristoyltransferase
publication title Crystal Structures of Candida albicans N-Myristoyltransferase with Two Distinct Inhibitors
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 103
structure length 384
sequence length 384
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iylA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iylA02
4R3KA 2FCKA 3ZJ0A 4B5PB 3QB8A 4KOXA 3TOAA 4JXQA 3VWEA 3JVNA 4MY3A 2B3VA 4B5PA 4UBRA 3V8IA 1Z4RA 3JUWA 1IB1E 1XF8A 2ATRA 4FD5A 5EBVA 2D4OA 3W6XA 4IUSA 1KUVA 1M4GA 2I00A 2K5TA 4QUSA 3DDDA 2KCWA 2GE3A 3N7ZA 4YRHA 4KOYA 2B3UA 5KTCA 4NEXA 4J3GA 1XMTA 3BJ8A 3TO6A 1S3ZA 1CJWA 3FYNA 1M1DA 3E0KA 3VWDA 4RI1A 3DR8A 2FSRA 4AG7A 2R98A 2HV2A 2PR1A 4R9MA 2RC4A 1YREA 2PRBA 1N71A 4E0AA 4CS0B 2Q44A 3S6KA 2PQ8A 4M85A 1PU9A 4F0YA 4XPLA 3TO9A 3UY5A 2Q4VA 1OZPA 2PR8A 4KLWA 2B58A 3D8PA 3TE4A 4KVXA 3DR6A 4NXYA 4AVAA 4L8AA 4YFJA 1Y9WA 2R1IA 2X7BA 1I21A 1IICA 4H89A 4NCZA 1XEBA 3F8KA 4H6UA 4R3LA 1GHEA 1S60A 2PDOA 3BLNA 1V0CA 5C82A 4F6AA 4ORFA 2JDCA 2Z10A 2ZPAA 3F0AA 4OAEA 5C88A 5DWMA 2BSWA 4MY0A 5JQ4A 1WK4A 3H4QA 4JJXA 3I9SA 5J8CA 3EXNA 1QSRA 2P0WA 5H84A 1B87A 5F49A 4Y49B 2JDDA 1YK3A 2BUEA 3FB3A 3FNCA 1J4JA 2DXQA 3GY9A 3ZZIA 4QVTA 2HUZA 1CM0A 3P2HA 4RS2A 4R57A 3IGRA 3MGDA 4NF1A 2R8VA 4KLVA 2J8RA 2R7HA 4E2AA 2I79A 5F48A 1MK4A 4JWPA 3TT2A 2B4DB 4KOVA 1M4IA 3C26A 3RYOA 4PSWA 2F5IA 2B4DA 2OH1A 4NSQA 2J8MA 3DSBA 4I49A 1MJ9A 2AJ6A 2GANA 5F46A 3FRMA 3SXNA 1XIXA 3G8WA 2A4NA 1NMTA 3I3GA 3LODA 4FD7A 4E8OA 2Y0MA 2VZYA 4AVBA 3QAHA 3TCVA 4AB7A 3TTHA 2CNSA 4KOUA 1FY7A 4UWIA 4JXRA 4OLLA 2OZGA 4JD6A 2OB0A 3R96A 1KZFA 1YGHA 3EFAA 1VKCA 3NE7A 1YVOA 2Q0YA 3TO7A 4XPKA 4MI4A 1P4NA 5GCNA 1YLEA 2EUIA 2G3TA 2PSWA 2Q7BA 5CNPA 1NE9A 3S6FA 4L89A 4M3SA 2AE6A 5E96A 4HNYB 2Q4YA 5KTDA 3GKRA 4QB9A 1BOBA 1BO4A 1R57A 3OWCA 2HQYA 2IL4A 1Q2YA 2JEVA 1ON0A 4CAXA 2D4PA 2FS5A 4KZTA 1KUYA 4XPDC 3FIXA 5HH1A 2FT0A 5ISVA 2FIAA 4II9A 4DNCA 4KVOE 4U5YA 4UWJA 4ZBGA 2ZW5A 3PP9A 2Z0ZA 3P2FA 4KORA 4QBJA 2ZW6A 2CNTA 1IYLA 2FL4A 4KOTA 2WPWA 4XNHC 2OZUA 4EVYA 4KUAA 4BMHA 1M44A 1UFHA 4CRYB 5I0CA 2EVNA 2ARHA 1WWZA 4B5OA 2REEA 3CXPA 1Y7RA 3IWGA 2FIWA 2C27A 2CNMA 4PK3A 4KOWA 2VXKA 5F47A 4FD6A 2VEZA 3TFYA 1NSLA 2OU2A 2G3AA 3S6HA 4CAVA 1XE4A 4PV6A 4OADA 1LRZA 2ZW4A 5KTAA 2QMLA 1I1DA 1S7LA 1YR0A 2ZXVA 3EY5A 3D3SA 2VBQA 3FBUA 4PSXA 1S7KA 3B8GA 5FVJA 3EO4A 4KUBA 2FXFA 1L0CA 5IB0A 5EC4A 1IYKA 2CY2A 3W91A 3EC4A 3SHPA 2OZHA 2QIRA 3R9GA 4KOSA 5IX3A 4GS4A 4H6ZA 4FD4A 2J8NA 3FXTA 4XNHB 4K30A 3R9FA 1QSOA 3BJ7A 3SXOA 5JPHA 4AVCA 4HKFA 3LD2A 1RXTA 3PGPA 1MJBA 1QSTA 4U9ZA 3KKWA 5IV0A 1YX0A 4LUAA 4Y49C 2Q04A 4UA3A 3CXSA 4MHDA 1Q2CA 2G0BA 2B4BA 4CAWA 5J8FA 2GIVA 4MJ8A 4HNWB 3WR7A 1MJAA 1K4JA 4HNXB 3R95A 1TIQA 1IIDA 2B5GB 3S6GA 4CRZB 1S5KA 2B5GA 4PK2A 1SQHA 4X5KA 2Z11A 1S7NA 1KUXA 4R87A 1QSMA 2P6FA 1P0HA 2VQYA 1RO5A 3TOBA 4U9YA 2BL1A 2QECA 3G3SA 2NMTA 3D2MA 4YGOA 5DWNA 1I12A 4QC6A 2VI7A 3GYAA 2REFA 3R9EA 3K9UA 3R1KA 1YVKA 2ZW7A 3W6SA 2JLMA 1PUAA 1Q2DA 4AG9A 2BEIA 4IF5A 5HMNA 1Y9KA 2FE7A 2VZZA 1Z9UA 3PZJA 3D2PA 1S7FA 3T90A 2WPXA 5H86A 3F5BA 1VHSA 3T9YA 3DNSA 1QSNA 2PC1A 1Z4EA 1M4DA 4MBUA 4ONUA 3CXQA 4KVME 2P6GA 4LX9A 2O28A 2H5MA 1B6BA 4XPDB 2P6EA 4JLYA 1U6MA
chains in the Genus database with same CATH superfamily
4R3KA 1YQEA 2FCKA 3ZJ0A 4B5PB 3QB8A 4KOXA 1H8LA 2WSAA 3TOAA 4JXQA 4MCRA 4CGOA 5G20A 4MFQA 3VWEA 3JVNA 2XEGA 4MY3A 5CPAA 2B3VA 4B5PA 1Z8WA 4UBRA 3V8IA 3SI0A 1Z4RA 2ZEPA 2YNEA 1IB1E 3JUWA 4R76A 2IJZA 1LFWA 3V7ZA 2ZEHA 4M6IA 2GU2A 2XEJA 4UFVA 1ZG8A 4P4JA 3IU2A 3K9TA 3GIUA 1XF8A 2Q43A 2ATRA 3FECA 4FD5A 5EBVA 2D4OA 3V38A 4IUSA 3W6XA 4B12A 4BBHA 4RUHA 1KUVA 5LRJA 1M4GA 3LACA 4F9UA 2I00A 2IQ6A 5D29A 4ONWA 2ZOGA 1CP7A 4JYWA 2K5TA 4QUSA 2AFXA 2HB6A 2Z3KA 3DDDA 4IHMA 2KCWA 2GE3A 3N7ZA 4YRHA 4KOYA 2B3UA 3IIBA 4MFLA 4OC5A 5KTCA 4NEXA 1U6MA 4J3GA 5K8OA 1AMPA 1XMTA 3BJ8A 3IC1A 3NA6A 3T8WA 2NSMA 3H5ZA 3TO6A 3CPAA 1BAVA 1CJWA 1S3ZA 1M1DA 3E0KA 3FYNA 4RI1A 3VWDA 1ARLA 1QMUA 4AVBA 3DR8A 2FSRA 4TWEA 2I3CA 2OR4A 4AG7A 2PJ6A 2XEFA 2R98A 1R43A 2HV2A 2PR1A 4R9MA 4MHYA 4MFZA 5JH9A 2RC4A 2ZENA 4O23A 1RTQA 1YREA 4CYQA 1ELLP 2PRBA 4F0XA 4CYPA 1N71A 4E0AA 3K2KA 4H2KA 4MCSA 4M6HA 4CS0B 2Q44A 3S6KA 3HUVA 2RFHA 2PQ8A 4M85A 2OOTA 1YMEA 1PU9A 4F0YA 3S9MA 4XPLA 3TO9A 1BPMA 1Y7EA 3UY5A 4PXBA 2Q4VA 3IEHA 5CBMA 3NE8A 3IWEA 1OZPA 4DJLA 1X10A 2PR8A 4KLWA 3PBEA 4FBEA 2B58A 4MCPA 3D8PA 2C6CA 2JEWA 4CPAA 1TF8A 3D68A 4KVXA 4C7HA 4ZYQA 3TE4A 1TKJA 3DR6A 2PJ1A 3SJGA 4NXYA 2PE3A 4YU9A 4HPSA 4AVAA 5G22A 4L8AA 3PB4X 4MFKA 4Q38A 4YFJA 1Y9WA 2R1IA 2X7BA 4P4IA 2ANPA 1I21A 1IICA 1YSJA 4H89A 2ZEOA 4NCZA 4P4EA 5THWA 3SJEA 4B11A 3B35A 1XEBA 3LWUA 1QQ9A 4OP4A 3F8KA 4H6UA 1LAMA 4R3LA 4JZ0A 1GHEA 1S60A 2PDOA 3BLNA 1V0CA 4NGRA 3HLPA 5C82A 2RB7A 3D7HA 4NJRA 4UEFA 4F6AA 4ORFA 1LANA 2JDCA 4OIDA 4CGLA 5HXDA 2Z10A 2ZPAA 1CPXA 2PJ3A 3F0AA 4OAEA 1AUGA 2V8GA 2BSWA 1FNOA 3FX6A 4MY0A 3DGVA 5DWMA 3QNVA 3KASA 5JQ4A 1LOKA 1WK4A 4WJBA 3PB7X 3B3CA 3BI1A 3H8FA 3H4QA 4JJXA 4PPZA 3I9SA 2BOAA 1PCAA 2ZEFA 5J8CA 3EXNA 4GXHA 2DPTA 4A39A 3FEDA 3VH9A 3PB6X 5JM6A 1QSRA 2P0WA 4NGSA 5H84A 1B87A 3NH8A 5F49A 4Y49B 2JDDA 4Z65A 3JRUA 3CDXA 2PVWA 1YK3A 2BUEA 3FJUA 3RBUA 3WC5A 3BXMA 3FB3A 3FNCA 3TX8A 1J4JA 2DXQA 3GY9A 5HVGA 2PJ5A 4QVTA 3ZZIA 3D66A 1XOVA 2HUZA 1CM0A 1VHOA 2Z3LA 3P2HA 4R57A 4RS2A 1TF9A 3IGRA 4A33A 1YW6A 3MGDA 4NF1A 1VGYA 2R8VA 4KLVA 1F2PA 4A32A 2J8RA 2PJ0A 2R7HA 3JTKA 4A95A 3SJFA 1YW4A 4E2AA 2I79A 5F48A 3L2NA 1MK4A 4JWPA 4CYNA 3TT2A 1LAPA 2QJ8A 2B4DB 5LRGA 4KOVA 4EFDA 1M4IA 3C26A 3PB8X 3RYOA 4PSWA 2F5IA 2B4DA 5D8NA 5K8NA 1Q7LA 2OH1A 3QAYA 4NSQA 2J8MA 3DSBA 4I49A 1MJ9A 3PEIA 3KQXA 5A28A 2AJ6A 1OBRA 4MHZA 2GANA 5F46A 3FRMA 3TC8A 1R3NA 3SXNA 1XIXA 4PXCA 2C6PA 4KSAA 3G8WA 3PRTA 1XBUA 2A4NA 3B3TA 1NMTA 3I3GA 3WT4A 2YNDA 3LODA 4FD7A 2IMOA 4E8OA 2Y0MA 2VZYA 3NFZA 2QYVA 3QAHA 4OC2A 1BLLE 1IOIA 2DPSA 2EK9A 3GLJA 5J1QA 3TCVA 4AB7A 3KR4A 4LQGA 4CGPA 3TTHA 1CP6A 4C7IA 4P6YA 4A37A 5A27A 1GYTA 4X8IA 1AYEA 2CNSA 4MXUA 2DEAA 4KOUA 2CTCA 2QVPA 3SI2A 1FY7A 5K8MA 4NGMA 4UWIA 1TKFA 4JXRA 4OLLA 2OZGA 4JD6A 5LYIA 2OB0A 2YGWA 2YNCA 5LYDA 4NGQA 1KZFA 1YGHA 3EFAA 3R96A 1VKCA 3B7IA 4P44A 3NE7A 2AFUA 1YVOA 2Q0YA 2JBJA 3TO7A 4ZY1A 4XPKA 4MI4A 3RO0A 3VARA 5AGEA 1P4NA 5GCNA 1YLEA 3ISXA 2EUIA 2Z3PA 2G3TA 4R7MA 2PSWA 4C2YA 2Q7BA 4MCQA 2DF5A 3NH5A 5CNPA 2PJ4A 2XEIA 3N5FA 1NE9A 4MFJA 3S6FA 4L89A 4M3SA 1LCPA 2AE6A 2AFOA 5E96A 2Z3OA 4HNYB 2Q4YA 3PBBA 5KTDA 1Y0RA 3S9NA 3GKRA 1X12A 3FMCA 4QB9A 1BOBA 1BO4A 1Z8TA 5HVFA 1R57A 2Q4ZA 3OWCA 4YWYA 2WYRA 2HQYA 2IL4A 1Q2YA 2JEVA 3A9LA 4B14A 4EMEA 1ON0A 2VL1A 4CAXA 2D4PA 2FS5A 4OC1A 4KZTA 1KUYA 4XPDC 5G1ZA 3FIXA 5HH1A 7CPAA 2FT0A 2ODFA 2ZOFA 3B3WA 4RN7A 3BHXA 5ISVA 2FIAA 2AFMA 3IJ3A 4II9A 2V77A 4DNCA 4KVOE 2GREA 3B3VA 2AFZA 4U5YA 4UWJA 4ZBGA 2V8VA 2ZW5A 1HDUA 1EE3P 2AFWA 3PP9A 2Z0ZA 3P2FA 4BINA 2GLFA 2PJCA 4KORA 4QBJA 2PIYA 3KL9A 5AG4A 2ZW6A 2PJ2A 2JBKA 1PYTB 3SI1A 2F8HA 2O4HA 5AG7A 2Z3MA 1XFOA 2CNTA 4KS9A 2NYQA 1JQGA 1IYLA 4PQAA 3H8GA 4OC3A 4B6ZA 4PXEA 1ZLHA 2FL4A 3FEEA 4KOTA 4MMOA 4A30A 1TXRA 4FAIA 2WPWA 1F57A 4KSIA 4XNHC 2OZUA 4MHPA 3MRUA 4Q36A 4KUAA 2PJ7A 3KR5A 4UIBA 4EVYA 4BMHA 1IGBA 1M44A 3PB9X 4NFRA 4P4DA 3CPXA 1UFHA 4CRYB 5I0CA 2EVNA 2ARHA 2C1CA 4LQ6A 1WWZA 1FT7A 4P4BA 4B5OA 2O53A 2REEA 2HC9A 2EWBA 3CXPA 1ZG9A 3D4UA 4P45A 1Y7RA 1CX8A 3IWGA 3RNZA 2FIWA 5I4MA 2C27A 2CNMA 4UIAA 3FF3A 4PK3A 1IY7A 4IAVA 1TKHA 4KOWA 4UFXA 4WWVA 5G21A 2VXKA 3IU1A 3SJXA 4R8FA 5F47A 4FD6A 4UEZA 4K3NA 2VEZA 3TFYA 5C88A 1NSLA 2EBJA 2OU2A 4IK2A 1Z8LA 2G3AA 4B10A 3S6HA 2PJAA 1VIXA 4CAVA 3B2YA 1XE4A 1ARMA 4PV6A 2FVGA 1CBXA 4OADA 5K8PA 3IWWA 3B3SA 4CAFA 4ZGYB 1LRZA 3KZWA 2ZW4A 3WABA 2WUUA 2BCOA 5KTAA 3KI9A 4X3RA 2QMLA 3RZAA 1I1DA 1S7LA 1XRYA 1YR0A 1HEEA 4F8ZA 2ZXVA 3EY5A 2BO9A 3D3SA 3WC7A 2VBQA 4FWUA 3FBUA 4MFPA 4EWTA 4ZY0A 4DUKA 1IU8A 3FH4A 4PSXA 1Y0YA 1S7KA 1VHEA 4G1PA 3B8GA 5FVJA 3WC6A 3EO4A 4B13A 3H8EA 4KUBA 2FXFA 1Z8XA 4C2ZA 1L0CA 1IOFA 4X2TA 2PJ9A 4CGMA 5IB0A 5EC4A 1IYKA 2CY2A 2ZEDA 4FUUA 3W91A 3EC4A 3SHPA 3NH4A 2OZHA 2QIRA 3R9GA 4KOSA 5IX3A 2G9DA 4C68A 4GS4A 2J9AA 4ZX8A 4H6ZA 4KSFA 2ZEMA 4FD4A 4ZI6A 2J8NA 3KGQA 4CYOA 2CTBA 3FXTA 4XNHB 3BI0A 4K30A 3R9FA 4CGNA 1Z5RA 1XMBA 1QSOA 3D7DA 3PFOA 5HVHA 3BJ7A 3SXOA 5JPHA 1M4LA 4AVCA 1YLOA 4HKFA 3LD2A 1RXTA 2WZNA 5ELYA 3PGPA 5DS0A 1MJBA 4M6GA 4R6TA 2ZEEA 1QSTA 2GLJA 2V8DA 2ABZA 1F2OA 2CF4A 4U9ZA 2PRQA 3KKWA 3MN8A 1YX0A 5IV0A 4LUAA 4Y49C 2Q04A 5BWAB 4UA3A 1UWYA 1BPNA 3CXSA 4MHDA 4TNUA 4DYOA 3LMSA 3IFEA 1Q2CA 2G0BA 2B4BA 2F7VA 4CAWA 5J8FA 2GIVA 4NGPA 4MJ8A 3KHZA 3GB0A 4HNWB 2ZELA 2Q7SA 3WR7A 4A38A 4ZY2A 1MJAA 1K4JA 2EO8A 4HNXB 2CIJA 3R95A 4NGTA 4OMEA 4A94A 3D67A 1TIQA 1IIDA 2B5GB 4OKOA 3S6GA 4CRZB 4P4FA 5JGFA 1S5KA 2B5GA 2PCUA 4PK2A 1SQHA 1HDQA 4X5KA 2Z11A 1DTDA 1S7NA 3FVLA 3VATA 3CZXA 1KUXA 1XJOA 4R87A 1A2ZA 1QSMA 4W9YA 5LRKA 2P6FA 3GUXA 2POKA 1P0HA 5LYFA 2PVVA 1RO5A 2VQYA 3TOBA 4U9YA 2BL1A 3D7FA 2QECA 3G3SA 1ELMP 2V8HA 1ZLIA 2NMTA 3D2MA 3IO1A 3KHXA 4YGOA 5DWNA 1I12A 2Q51A 4C2XA 4QC6A 4ZX9A 2VI7A 1ZG7A 3GYAA 3RAMA 2EK8A 2REFA 3R9EA 3K9UA 3R1KA 1YVKA 5LYLA 4F9VA 4P10A 2ZW7A 3DLJA 3W6SA 3I1UA 3PFEA 4UCNA 2PJ8A 1DE4C 2JLMA 1PUAA 1Q2DA 4AG9A 4CAEA 1NSAA 2BEIA 1ZO0A 4IF5A 3D7GA 5HMNA 6CPAA 4UEEA 4MRIA 4UCMA 2ZEGA 1Y9KA 4Q7AA 2FE7A 2Z3NA 2VZZA 1Z9UA 3PZJA 1CG2A 3KQZA 5IB9A 4A31A 3ISZA 3D2PA 2YNCC 3S9LA 1S7FA 4AXVA 4NGNA 2PIZA 3T90A 4MHNA 2WPXA 5AG6A 5EMIA 5H86A 4NJQA 3F5BA 1KWMA 1VHSA 3T9YA 4PXDA 4UCPA 2PJBA 4OIWA 4OC0A 3DNSA 8CPAA 1QSNA 2PC1A 1Z4EA 1M4DA 4UF4A 5AG5A 4MBUA 4BD9A 5F09A 4ONUA 3CXQA 4GM5A 2CXAA 1JWQA 4KVME 2P6GA 4LX9A 2O28A 4UFWA 2H5MA 2C6GA 1B6BA 4OC4A 1Z2LA 4XPDB 4A2ZA 1CPSA 2P6EA 2GFQA 4JLYA 3CT9A 2AFSA
chains in the Genus database with same CATH topology
4R3KA 2FCKA 3ZJ0A 4B5PB 3QB8A 4KOXA 2WSAA 3TOAA 4CGOA 4JXQA 5G20A 4MFQA 3VWEA 3JVNA 4MY3A 2B3VA 4B5PA 4UBRA 3V8IA 1Z4RA 2YNEA 1IB1E 3JUWA 4UFVA 3IU2A 1XF8A 2ATRA 4FD5A 5EBVA 2D4OA 3W6XA 4IUSA 4B12A 4BBHA 1KUVA 1M4GA 2I00A 2K5TA 4QUSA 3DDDA 2Z3KA 2KCWA 2GE3A 3N7ZA 4YRHA 4KOYA 2B3UA 4MFLA 5KTCA 4NEXA 4J3GA 1XMTA 3BJ8A 3H5ZA 3TO6A 1S3ZA 1CJWA 3FYNA 1M1DA 3E0KA 3VWDA 4RI1A 3DR8A 2FSRA 4AG7A 2R98A 2HV2A 2PR1A 4R9MA 4MFZA 2RC4A 1YREA 4CYQA 2PRBA 4F0XA 4CYPA 1N71A 4E0AA 4CS0B 2Q44A 3S6KA 2PQ8A 4M85A 1PU9A 4F0YA 4XPLA 3TO9A 3UY5A 2Q4VA 3IWEA 1OZPA 2PR8A 4KLWA 2B58A 3D8PA 3TE4A 4KVXA 4C7HA 3DR6A 4NXYA 4AVAA 5G22A 4L8AA 4MFKA 4Q38A 4YFJA 1Y9WA 2R1IA 2X7BA 1I21A 1IICA 4H89A 4NCZA 4B11A 1XEBA 3F8KA 4H6UA 4R3LA 1GHEA 1S60A 2PDOA 3BLNA 1V0CA 5C82A 4F6AA 4ORFA 2JDCA 4CGLA 2Z10A 2ZPAA 3F0AA 4OAEA 5C88A 5DWMA 2BSWA 4MY0A 5JQ4A 1WK4A 3H4QA 4JJXA 3I9SA 5J8CA 3EXNA 2DPTA 1QSRA 2P0WA 5H84A 1B87A 5F49A 4Y49B 2JDDA 1YK3A 2BUEA 3FB3A 3FNCA 1J4JA 2DXQA 3GY9A 3ZZIA 4QVTA 2Z3LA 2HUZA 1CM0A 3P2HA 4RS2A 4R57A 3IGRA 4A33A 3MGDA 4NF1A 2R8VA 4KLVA 4A32A 2J8RA 3JTKA 2R7HA 4A95A 4E2AA 2I79A 5F48A 4CYNA 1MK4A 4JWPA 3TT2A 2B4DB 4KOVA 1M4IA 3C26A 3RYOA 4PSWA 2F5IA 2B4DA 2OH1A 4NSQA 2J8MA 3DSBA 4I49A 1MJ9A 5A28A 2AJ6A 2GANA 5F46A 3FRMA 3SXNA 1XIXA 4KSAA 3G8WA 2A4NA 1NMTA 3I3GA 2YNDA 3LODA 4FD7A 4E8OA 2Y0MA 2VZYA 4AVBA 3QAHA 2DPSA 3TCVA 4AB7A 4CGPA 3TTHA 5A27A 4C7IA 2CNSA 4KOUA 1FY7A 4UWIA 4JXRA 4OLLA 2OZGA 4JD6A 2OB0A 2YGWA 2YNCA 3R96A 1KZFA 1YGHA 3EFAA 1VKCA 3NE7A 1YVOA 2Q0YA 3TO7A 4XPKA 4MI4A 5AGEA 1P4NA 5GCNA 1YLEA 2EUIA 2Z3PA 2G3TA 2PSWA 4C2YA 2Q7BA 5CNPA 1NE9A 4MFJA 3S6FA 4L89A 4M3SA 2AE6A 5E96A 2Z3OA 4HNYB 2Q4YA 5KTDA 3GKRA 4QB9A 1BOBA 1BO4A 1R57A 3OWCA 2HQYA 2IL4A 1Q2YA 2JEVA 3A9LA 4B14A 1ON0A 4CAXA 2D4PA 2FS5A 4KZTA 1KUYA 4XPDC 5G1ZA 3FIXA 5HH1A 2FT0A 5ISVA 2FIAA 4II9A 4DNCA 4KVOE 4U5YA 4UWJA 4ZBGA 2ZW5A 3PP9A 2Z0ZA 3P2FA 4KORA 4QBJA 5AG4A 2ZW6A 5AG7A 2Z3MA 4KS9A 2CNTA 1IYLA 2FL4A 4KOTA 4A30A 2WPWA 4XNHC 2OZUA 4EVYA 4Q36A 4KUAA 4BMHA 1M44A 1UFHA 4CRYB 5I0CA 2EVNA 2ARHA 1WWZA 4B5OA 2REEA 3CXPA 1Y7RA 3IWGA 2FIWA 2C27A 2CNMA 4PK3A 4KOWA 4UFXA 5G21A 2VXKA 3IU1A 5F47A 4FD6A 2VEZA 3TFYA 1NSLA 2OU2A 2G3AA 4B10A 3S6HA 4CAVA 1XE4A 4PV6A 4OADA 4CAFA 4ZGYB 1LRZA 2ZW4A 2WUUA 5KTAA 2QMLA 1I1DA 1S7LA 1YR0A 2ZXVA 3EY5A 3D3SA 2VBQA 3FBUA 4MFPA 4PSXA 1S7KA 3B8GA 5FVJA 3EO4A 4B13A 4KUBA 2FXFA 4C2ZA 1L0CA 4CGMA 5IB0A 5EC4A 1IYKA 2CY2A 3W91A 3EC4A 3SHPA 2OZHA 2QIRA 3R9GA 4KOSA 5IX3A 4C68A 4GS4A 4H6ZA 4KSFA 4FD4A 2J8NA 4CYOA 3FXTA 4XNHB 4K30A 3R9FA 4CGNA 1QSOA 3BJ7A 3SXOA 5JPHA 4AVCA 4HKFA 3LD2A 1RXTA 3PGPA 1MJBA 1QSTA 4U9ZA 3KKWA 5IV0A 1YX0A 4LUAA 4Y49C 2Q04A 5BWAB 4UA3A 3CXSA 4MHDA 1Q2CA 2G0BA 2B4BA 4CAWA 5J8FA 2GIVA 4MJ8A 4HNWB 3WR7A 1MJAA 1K4JA 4HNXB 3R95A 1TIQA 1IIDA 2B5GB 3S6GA 4CRZB 1S5KA 2B5GA 4PK2A 1SQHA 4X5KA 2Z11A 1S7NA 1KUXA 4R87A 1QSMA 2P6FA 1P0HA 2VQYA 1RO5A 3TOBA 4U9YA 2BL1A 2QECA 3G3SA 2NMTA 3D2MA 4YGOA 5DWNA 1I12A 4C2XA 4QC6A 2VI7A 3GYAA 2REFA 3R9EA 3K9UA 3R1KA 1YVKA 2ZW7A 3W6SA 4UCNA 2JLMA 1PUAA 1Q2DA 4AG9A 4CAEA 2BEIA 1ZO0A 4IF5A 5HMNA 4UCMA 1Y9KA 2FE7A 2Z3NA 2VZZA 1Z9UA 3PZJA 4A31A 3D2PA 2YNCC 1S7FA 3T90A 2WPXA 5AG6A 5H86A 3F5BA 1VHSA 3T9YA 4UCPA 3DNSA 1QSNA 2PC1A 1Z4EA 1M4DA 5AG5A 4MBUA 4ONUA 3CXQA 2CXAA 4KVME 2P6GA 4LX9A 2O28A 4UFWA 2H5MA 1B6BA 4XPDB 4A2ZA 2P6EA 4JLYA 1U6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R3K A;  2FCK A;  3ZJ0 A;  4B5P B;  3QB8 A;  4KOX A;  3TOA A;  4JXQ A;  3VWE A;  3JVN A;  4MY3 A;  2B3V A;  4B5P A;  4UBR A;  3V8I A;  1Z4R A;  3JUW A;  1IB1 E;  1XF8 A;  2ATR A;  4FD5 A;  5EBV A;  2D4O A;  3W6X A;  4IUS A;  1KUV A;  1M4G A;  2I00 A;  2K5T A;  4QUS A;  3DDD A;  2KCW A;  2GE3 A;  3N7Z A;  4YRH A;  4KOY A;  2B3U A;  5KTC A;  4NEX A;  4J3G A;  1XMT A;  3BJ8 A;  3TO6 A;  1S3Z A;  1CJW A;  3FYN A;  1M1D A;  3E0K A;  3VWD A;  4RI1 A;  3DR8 A;  2FSR A;  4AG7 A;  2R98 A;  2HV2 A;  2PR1 A;  4R9M A;  2RC4 A;  1YRE A;  2PRB A;  1N71 A;  4E0A A;  4CS0 B;  2Q44 A;  3S6K A;  2PQ8 A;  4M85 A;  1PU9 A;  4F0Y A;  4XPL A;  3TO9 A;  3UY5 A;  2Q4V A;  1OZP A;  2PR8 A;  4KLW A;  2B58 A;  3D8P A;  3TE4 A;  4KVX A;  3DR6 A;  4NXY A;  4AVA A;  4L8A A;  4YFJ A;  1Y9W A;  2R1I A;  2X7B A;  1I21 A;  1IIC A;  4H89 A;  4NCZ A;  1XEB A;  3F8K A;  4H6U A;  4R3L A;  1GHE A;  1S60 A;  2PDO A;  3BLN A;  1V0C A;  5C82 A;  4F6A A;  4ORF A;  2JDC A;  2Z10 A;  2ZPA A;  3F0A A;  4OAE A;  5C88 A;  5DWM A;  2BSW A;  4MY0 A;  5JQ4 A;  1WK4 A;  3H4Q A;  4JJX A;  3I9S A;  5J8C A;  3EXN A;  1QSR A;  2P0W A;  5H84 A;  1B87 A;  5F49 A;  4Y49 B;  2JDD A;  1YK3 A;  2BUE A;  3FB3 A;  3FNC A;  1J4J A;  2DXQ A;  3GY9 A;  3ZZI A;  4QVT A;  2HUZ A;  1CM0 A;  3P2H A;  4RS2 A;  4R57 A;  3IGR A;  3MGD A;  4NF1 A;  2R8V A;  4KLV A;  2J8R A;  2R7H A;  4E2A A;  2I79 A;  5F48 A;  1MK4 A;  4JWP A;  3TT2 A;  2B4D B;  4KOV A;  1M4I A;  3C26 A;  3RYO A;  4PSW A;  2F5I A;  2B4D A;  2OH1 A;  4NSQ A;  2J8M A;  3DSB A;  4I49 A;  1MJ9 A;  2AJ6 A;  2GAN A;  5F46 A;  3FRM A;  3SXN A;  1XIX A;  3G8W A;  2A4N A;  1NMT A;  3I3G A;  3LOD A;  4FD7 A;  4E8O A;  2Y0M A;  2VZY A;  4AVB A;  3QAH A;  3TCV A;  4AB7 A;  3TTH A;  2CNS A;  4KOU A;  1FY7 A;  4UWI A;  4JXR A;  4OLL A;  2OZG A;  4JD6 A;  2OB0 A;  3R96 A;  1KZF A;  1YGH A;  3EFA A;  1VKC A;  3NE7 A;  1YVO A;  2Q0Y A;  3TO7 A;  4XPK A;  4MI4 A;  1P4N A;  5GCN A;  1YLE A;  2EUI A;  2G3T A;  2PSW A;  2Q7B A;  5CNP A;  1NE9 A;  3S6F A;  4L89 A;  4M3S A;  2AE6 A;  5E96 A;  4HNY B;  2Q4Y A;  5KTD A;  3GKR A;  4QB9 A;  1BOB A;  1BO4 A;  1R57 A;  3OWC A;  2HQY A;  2IL4 A;  1Q2Y A;  2JEV A;  1ON0 A;  4CAX A;  2D4P A;  2FS5 A;  4KZT A;  1KUY A;  4XPD C;  3FIX A;  5HH1 A;  2FT0 A;  5ISV A;  2FIA A;  4II9 A;  4DNC A;  4KVO E;  4U5Y A;  4UWJ A;  4ZBG A;  2ZW5 A;  3PP9 A;  2Z0Z A;  3P2F A;  4KOR A;  4QBJ A;  2ZW6 A;  2CNT A;  1IYL A;  2FL4 A;  4KOT A;  2WPW A;  4XNH C;  2OZU A;  4EVY A;  4KUA A;  4BMH A;  1M44 A;  1UFH A;  4CRY B;  5I0C A;  2EVN A;  2ARH A;  1WWZ A;  4B5O A;  2REE A;  3CXP A;  1Y7R A;  3IWG A;  2FIW A;  2C27 A;  2CNM A;  4PK3 A;  4KOW A;  2VXK A;  5F47 A;  4FD6 A;  2VEZ A;  3TFY A;  1NSL A;  2OU2 A;  2G3A A;  3S6H A;  4CAV A;  1XE4 A;  4PV6 A;  4OAD A;  1LRZ A;  2ZW4 A;  5KTA A;  2QML A;  1I1D A;  1S7L A;  1YR0 A;  2ZXV A;  3EY5 A;  3D3S A;  2VBQ A;  3FBU A;  4PSX A;  1S7K A;  3B8G A;  5FVJ A;  3EO4 A;  4KUB A;  2FXF A;  1L0C A;  5IB0 A;  5EC4 A;  1IYK A;  2CY2 A;  3W91 A;  3EC4 A;  3SHP A;  2OZH A;  2QIR A;  3R9G A;  4KOS A;  5IX3 A;  4GS4 A;  4H6Z A;  4FD4 A;  2J8N A;  3FXT A;  4XNH B;  4K30 A;  3R9F A;  1QSO A;  3BJ7 A;  3SXO A;  5JPH A;  4AVC A;  4HKF A;  3LD2 A;  1RXT A;  3PGP A;  1MJB A;  1QST A;  4U9Z A;  3KKW A;  5IV0 A;  1YX0 A;  4LUA A;  4Y49 C;  2Q04 A;  4UA3 A;  3CXS A;  4MHD A;  1Q2C A;  2G0B A;  2B4B A;  4CAW A;  5J8F A;  2GIV A;  4MJ8 A;  4HNW B;  3WR7 A;  1MJA A;  1K4J A;  4HNX B;  3R95 A;  1TIQ A;  1IID A;  2B5G B;  3S6G A;  4CRZ B;  1S5K A;  2B5G A;  4PK2 A;  1SQH A;  4X5K A;  2Z11 A;  1S7N A;  1KUX A;  4R87 A;  1QSM A;  2P6F A;  1P0H A;  2VQY A;  1RO5 A;  3TOB A;  4U9Y A;  2BL1 A;  2QEC A;  3G3S A;  2NMT A;  3D2M A;  4YGO A;  5DWN A;  1I12 A;  4QC6 A;  2VI7 A;  3GYA A;  2REF A;  3R9E A;  3K9U A;  3R1K A;  1YVK A;  2ZW7 A;  3W6S A;  2JLM A;  1PUA A;  1Q2D A;  4AG9 A;  2BEI A;  4IF5 A;  5HMN A;  1Y9K A;  2FE7 A;  2VZZ A;  1Z9U A;  3PZJ A;  3D2P A;  1S7F A;  3T90 A;  2WPX A;  5H86 A;  3F5B A;  1VHS A;  3T9Y A;  3DNS A;  1QSN A;  2PC1 A;  1Z4E A;  1M4D A;  4MBU A;  4ONU A;  3CXQ A;  4KVM E;  2P6G A;  4LX9 A;  2O28 A;  2H5M A;  1B6B A;  4XPD B;  2P6E A;  4JLY A;  1U6M A; 
#chains in the Genus database with same CATH topology
 4R3K A;  1YQE A;  2FCK A;  3ZJ0 A;  4B5P B;  3QB8 A;  4KOX A;  1H8L A;  2WSA A;  3TOA A;  4JXQ A;  4MCR A;  4CGO A;  5G20 A;  4MFQ A;  3VWE A;  3JVN A;  2XEG A;  4MY3 A;  5CPA A;  2B3V A;  4B5P A;  1Z8W A;  4UBR A;  3V8I A;  3SI0 A;  1Z4R A;  2ZEP A;  2YNE A;  1IB1 E;  3JUW A;  4R76 A;  2IJZ A;  1LFW A;  3V7Z A;  2ZEH A;  4M6I A;  2GU2 A;  2XEJ A;  4UFV A;  1ZG8 A;  4P4J A;  3IU2 A;  3K9T A;  3GIU A;  1XF8 A;  2Q43 A;  2ATR A;  3FEC A;  4FD5 A;  5EBV A;  2D4O A;  3V38 A;  4IUS A;  3W6X A;  4B12 A;  4BBH A;  4RUH A;  1KUV A;  5LRJ A;  1M4G A;  3LAC A;  4F9U A;  2I00 A;  2IQ6 A;  5D29 A;  4ONW A;  2ZOG A;  1CP7 A;  4JYW A;  2K5T A;  4QUS A;  2AFX A;  2HB6 A;  2Z3K A;  3DDD A;  4IHM A;  2KCW A;  2GE3 A;  3N7Z A;  4YRH A;  4KOY A;  2B3U A;  3IIB A;  4MFL A;  4OC5 A;  5KTC A;  4NEX A;  1U6M A;  4J3G A;  5K8O A;  1AMP A;  1XMT A;  3BJ8 A;  3IC1 A;  3NA6 A;  3T8W A;  2NSM A;  3H5Z A;  3TO6 A;  3CPA A;  1BAV A;  1CJW A;  1S3Z A;  1M1D A;  3E0K A;  3FYN A;  4RI1 A;  3VWD A;  1ARL A;  1QMU A;  4AVB A;  3DR8 A;  2FSR A;  4TWE A;  2I3C A;  2OR4 A;  4AG7 A;  2PJ6 A;  2XEF A;  2R98 A;  1R43 A;  2HV2 A;  2PR1 A;  4R9M A;  4MHY A;  4MFZ A;  5JH9 A;  2RC4 A;  2ZEN A;  4O23 A;  1RTQ A;  1YRE A;  4CYQ A;  1ELL P;  2PRB A;  4F0X A;  4CYP A;  1N71 A;  4E0A A;  3K2K A;  4H2K A;  4MCS A;  4M6H A;  4CS0 B;  2Q44 A;  3S6K A;  3HUV A;  2RFH A;  2PQ8 A;  4M85 A;  2OOT A;  1YME A;  1PU9 A;  4F0Y A;  3S9M A;  4XPL A;  3TO9 A;  1BPM A;  1Y7E A;  3UY5 A;  4PXB A;  2Q4V A;  3IEH A;  5CBM A;  3NE8 A;  3IWE A;  1OZP A;  4DJL A;  1X10 A;  2PR8 A;  4KLW A;  3PBE A;  4FBE A;  2B58 A;  4MCP A;  3D8P A;  2C6C A;  2JEW A;  4CPA A;  1TF8 A;  3D68 A;  4KVX A;  4C7H A;  4ZYQ A;  3TE4 A;  1TKJ A;  3DR6 A;  2PJ1 A;  3SJG A;  4NXY A;  2PE3 A;  4YU9 A;  4HPS A;  4AVA A;  5G22 A;  4L8A A;  3PB4 X;  4MFK A;  4Q38 A;  4YFJ A;  1Y9W A;  2R1I A;  2X7B A;  4P4I A;  2ANP A;  1I21 A;  1IIC A;  1YSJ A;  4H89 A;  2ZEO A;  4NCZ A;  4P4E A;  5THW A;  3SJE A;  4B11 A;  3B35 A;  1XEB A;  3LWU A;  1QQ9 A;  4OP4 A;  3F8K A;  4H6U A;  1LAM A;  4R3L A;  4JZ0 A;  1GHE A;  1S60 A;  2PDO A;  3BLN A;  1V0C A;  4NGR A;  3HLP A;  5C82 A;  2RB7 A;  3D7H A;  4NJR A;  4UEF A;  4F6A A;  4ORF A;  1LAN A;  2JDC A;  4OID A;  4CGL A;  5HXD A;  2Z10 A;  2ZPA A;  1CPX A;  2PJ3 A;  3F0A A;  4OAE A;  1AUG A;  2V8G A;  2BSW A;  1FNO A;  3FX6 A;  4MY0 A;  3DGV A;  5DWM A;  3QNV A;  3KAS A;  5JQ4 A;  1LOK A;  1WK4 A;  4WJB A;  3PB7 X;  3B3C A;  3BI1 A;  3H8F A;  3H4Q A;  4JJX A;  4PPZ A;  3I9S A;  2BOA A;  1PCA A;  2ZEF A;  5J8C A;  3EXN A;  4GXH A;  2DPT A;  4A39 A;  3FED A;  3VH9 A;  3PB6 X;  5JM6 A;  1QSR A;  2P0W A;  4NGS A;  5H84 A;  1B87 A;  3NH8 A;  5F49 A;  4Y49 B;  2JDD A;  4Z65 A;  3JRU A;  3CDX A;  2PVW A;  1YK3 A;  2BUE A;  3FJU A;  3RBU A;  3WC5 A;  3BXM A;  3FB3 A;  3FNC A;  3TX8 A;  1J4J A;  2DXQ A;  3GY9 A;  5HVG A;  2PJ5 A;  4QVT A;  3ZZI A;  3D66 A;  1XOV A;  2HUZ A;  1CM0 A;  1VHO A;  2Z3L A;  3P2H A;  4R57 A;  4RS2 A;  1TF9 A;  3IGR A;  4A33 A;  1YW6 A;  3MGD A;  4NF1 A;  1VGY A;  2R8V A;  4KLV A;  1F2P A;  4A32 A;  2J8R A;  2PJ0 A;  2R7H A;  3JTK A;  4A95 A;  3SJF A;  1YW4 A;  4E2A A;  2I79 A;  5F48 A;  3L2N A;  1MK4 A;  4JWP A;  4CYN A;  3TT2 A;  1LAP A;  2QJ8 A;  2B4D B;  5LRG A;  4KOV A;  4EFD A;  1M4I A;  3C26 A;  3PB8 X;  3RYO A;  4PSW A;  2F5I A;  2B4D A;  5D8N A;  5K8N A;  1Q7L A;  2OH1 A;  3QAY A;  4NSQ A;  2J8M A;  3DSB A;  4I49 A;  1MJ9 A;  3PEI A;  3KQX A;  5A28 A;  2AJ6 A;  1OBR A;  4MHZ A;  2GAN A;  5F46 A;  3FRM A;  3TC8 A;  1R3N A;  3SXN A;  1XIX A;  4PXC A;  2C6P A;  4KSA A;  3G8W A;  3PRT A;  1XBU A;  2A4N A;  3B3T A;  1NMT A;  3I3G A;  3WT4 A;  2YND A;  3LOD A;  4FD7 A;  2IMO A;  4E8O A;  2Y0M A;  2VZY A;  3NFZ A;  2QYV A;  3QAH A;  4OC2 A;  1BLL E;  1IOI A;  2DPS A;  2EK9 A;  3GLJ A;  5J1Q A;  3TCV A;  4AB7 A;  3KR4 A;  4LQG A;  4CGP A;  3TTH A;  1CP6 A;  4C7I A;  4P6Y A;  4A37 A;  5A27 A;  1GYT A;  4X8I A;  1AYE A;  2CNS A;  4MXU A;  2DEA A;  4KOU A;  2CTC A;  2QVP A;  3SI2 A;  1FY7 A;  5K8M A;  4NGM A;  4UWI A;  1TKF A;  4JXR A;  4OLL A;  2OZG A;  4JD6 A;  5LYI A;  2OB0 A;  2YGW A;  2YNC A;  5LYD A;  4NGQ A;  1KZF A;  1YGH A;  3EFA A;  3R96 A;  1VKC A;  3B7I A;  4P44 A;  3NE7 A;  2AFU A;  1YVO A;  2Q0Y A;  2JBJ A;  3TO7 A;  4ZY1 A;  4XPK A;  4MI4 A;  3RO0 A;  3VAR A;  5AGE A;  1P4N A;  5GCN A;  1YLE A;  3ISX A;  2EUI A;  2Z3P A;  2G3T A;  4R7M A;  2PSW A;  4C2Y A;  2Q7B A;  4MCQ A;  2DF5 A;  3NH5 A;  5CNP A;  2PJ4 A;  2XEI A;  3N5F A;  1NE9 A;  4MFJ A;  3S6F A;  4L89 A;  4M3S A;  1LCP A;  2AE6 A;  2AFO A;  5E96 A;  2Z3O A;  4HNY B;  2Q4Y A;  3PBB A;  5KTD A;  1Y0R A;  3S9N A;  3GKR A;  1X12 A;  3FMC A;  4QB9 A;  1BOB A;  1BO4 A;  1Z8T A;  5HVF A;  1R57 A;  2Q4Z A;  3OWC A;  4YWY A;  2WYR A;  2HQY A;  2IL4 A;  1Q2Y A;  2JEV A;  3A9L A;  4B14 A;  4EME A;  1ON0 A;  2VL1 A;  4CAX A;  2D4P A;  2FS5 A;  4OC1 A;  4KZT A;  1KUY A;  4XPD C;  5G1Z A;  3FIX A;  5HH1 A;  7CPA A;  2FT0 A;  2ODF A;  2ZOF A;  3B3W A;  4RN7 A;  3BHX A;  5ISV A;  2FIA A;  2AFM A;  3IJ3 A;  4II9 A;  2V77 A;  4DNC A;  4KVO E;  2GRE A;  3B3V A;  2AFZ A;  4U5Y A;  4UWJ A;  4ZBG A;  2V8V A;  2ZW5 A;  1HDU A;  1EE3 P;  2AFW A;  3PP9 A;  2Z0Z A;  3P2F A;  4BIN A;  2GLF A;  2PJC A;  4KOR A;  4QBJ A;  2PIY A;  3KL9 A;  5AG4 A;  2ZW6 A;  2PJ2 A;  2JBK A;  1PYT B;  3SI1 A;  2F8H A;  2O4H A;  5AG7 A;  2Z3M A;  1XFO A;  2CNT A;  4KS9 A;  2NYQ A;  1JQG A;  1IYL A;  4PQA A;  3H8G A;  4OC3 A;  4B6Z A;  4PXE A;  1ZLH A;  2FL4 A;  3FEE A;  4KOT A;  4MMO A;  4A30 A;  1TXR A;  4FAI A;  2WPW A;  1F57 A;  4KSI A;  4XNH C;  2OZU A;  4MHP A;  3MRU A;  4Q36 A;  4KUA A;  2PJ7 A;  3KR5 A;  4UIB A;  4EVY A;  4BMH A;  1IGB A;  1M44 A;  3PB9 X;  4NFR A;  4P4D A;  3CPX A;  1UFH A;  4CRY B;  5I0C A;  2EVN A;  2ARH A;  2C1C A;  4LQ6 A;  1WWZ A;  1FT7 A;  4P4B A;  4B5O A;  2O53 A;  2REE A;  2HC9 A;  2EWB A;  3CXP A;  1ZG9 A;  3D4U A;  4P45 A;  1Y7R A;  1CX8 A;  3IWG A;  3RNZ A;  2FIW A;  5I4M A;  2C27 A;  2CNM A;  4UIA A;  3FF3 A;  4PK3 A;  1IY7 A;  4IAV A;  1TKH A;  4KOW A;  4UFX A;  4WWV A;  5G21 A;  2VXK A;  3IU1 A;  3SJX A;  4R8F A;  5F47 A;  4FD6 A;  4UEZ A;  4K3N A;  2VEZ A;  3TFY A;  5C88 A;  1NSL A;  2EBJ A;  2OU2 A;  4IK2 A;  1Z8L A;  2G3A A;  4B10 A;  3S6H A;  2PJA A;  1VIX A;  4CAV A;  3B2Y A;  1XE4 A;  1ARM A;  4PV6 A;  2FVG A;  1CBX A;  4OAD A;  5K8P A;  3IWW A;  3B3S A;  4CAF A;  4ZGY B;  1LRZ A;  3KZW A;  2ZW4 A;  3WAB A;  2WUU A;  2BCO A;  5KTA A;  3KI9 A;  4X3R A;  2QML A;  3RZA A;  1I1D A;  1S7L A;  1XRY A;  1YR0 A;  1HEE A;  4F8Z A;  2ZXV A;  3EY5 A;  2BO9 A;  3D3S A;  3WC7 A;  2VBQ A;  4FWU A;  3FBU A;  4MFP A;  4EWT A;  4ZY0 A;  4DUK A;  1IU8 A;  3FH4 A;  4PSX A;  1Y0Y A;  1S7K A;  1VHE A;  4G1P A;  3B8G A;  5FVJ A;  3WC6 A;  3EO4 A;  4B13 A;  3H8E A;  4KUB A;  2FXF A;  1Z8X A;  4C2Z A;  1L0C A;  1IOF A;  4X2T A;  2PJ9 A;  4CGM A;  5IB0 A;  5EC4 A;  1IYK A;  2CY2 A;  2ZED A;  4FUU A;  3W91 A;  3EC4 A;  3SHP A;  3NH4 A;  2OZH A;  2QIR A;  3R9G A;  4KOS A;  5IX3 A;  2G9D A;  4C68 A;  4GS4 A;  2J9A A;  4ZX8 A;  4H6Z A;  4KSF A;  2ZEM A;  4FD4 A;  4ZI6 A;  2J8N A;  3KGQ A;  4CYO A;  2CTB A;  3FXT A;  4XNH B;  3BI0 A;  4K30 A;  3R9F A;  4CGN A;  1Z5R A;  1XMB A;  1QSO A;  3D7D A;  3PFO A;  5HVH A;  3BJ7 A;  3SXO A;  5JPH A;  1M4L A;  4AVC A;  1YLO A;  4HKF A;  3LD2 A;  1RXT A;  2WZN A;  5ELY A;  3PGP A;  5DS0 A;  1MJB A;  4M6G A;  4R6T A;  2ZEE A;  1QST A;  2GLJ A;  2V8D A;  2ABZ A;  1F2O A;  2CF4 A;  4U9Z A;  2PRQ A;  3KKW A;  3MN8 A;  1YX0 A;  5IV0 A;  4LUA A;  4Y49 C;  2Q04 A;  5BWA B;  4UA3 A;  1UWY A;  1BPN A;  3CXS A;  4MHD A;  4TNU A;  4DYO A;  3LMS A;  3IFE A;  1Q2C A;  2G0B A;  2B4B A;  2F7V A;  4CAW A;  5J8F A;  2GIV A;  4NGP A;  4MJ8 A;  3KHZ A;  3GB0 A;  4HNW B;  2ZEL A;  2Q7S A;  3WR7 A;  4A38 A;  4ZY2 A;  1MJA A;  1K4J A;  2EO8 A;  4HNX B;  2CIJ A;  3R95 A;  4NGT A;  4OME A;  4A94 A;  3D67 A;  1TIQ A;  1IID A;  2B5G B;  4OKO A;  3S6G A;  4CRZ B;  4P4F A;  5JGF A;  1S5K A;  2B5G A;  2PCU A;  4PK2 A;  1SQH A;  1HDQ A;  4X5K A;  2Z11 A;  1DTD A;  1S7N A;  3FVL A;  3VAT A;  3CZX A;  1KUX A;  1XJO A;  4R87 A;  1A2Z A;  1QSM A;  4W9Y A;  5LRK A;  2P6F A;  3GUX A;  2POK A;  1P0H A;  5LYF A;  2PVV A;  1RO5 A;  2VQY A;  3TOB A;  4U9Y A;  2BL1 A;  3D7F A;  2QEC A;  3G3S A;  1ELM P;  2V8H A;  1ZLI A;  2NMT A;  3D2M A;  3IO1 A;  3KHX A;  4YGO A;  5DWN A;  1I12 A;  2Q51 A;  4C2X A;  4QC6 A;  4ZX9 A;  2VI7 A;  1ZG7 A;  3GYA A;  3RAM A;  2EK8 A;  2REF A;  3R9E A;  3K9U A;  3R1K A;  1YVK A;  5LYL A;  4F9V A;  4P10 A;  2ZW7 A;  3DLJ A;  3W6S A;  3I1U A;  3PFE A;  4UCN A;  2PJ8 A;  1DE4 C;  2JLM A;  1PUA A;  1Q2D A;  4AG9 A;  4CAE A;  1NSA A;  2BEI A;  1ZO0 A;  4IF5 A;  3D7G A;  5HMN A;  6CPA A;  4UEE A;  4MRI A;  4UCM A;  2ZEG A;  1Y9K A;  4Q7A A;  2FE7 A;  2Z3N A;  2VZZ A;  1Z9U A;  3PZJ A;  1CG2 A;  3KQZ A;  5IB9 A;  4A31 A;  3ISZ A;  3D2P A;  2YNC C;  3S9L A;  1S7F A;  4AXV A;  4NGN A;  2PIZ A;  3T90 A;  4MHN A;  2WPX A;  5AG6 A;  5EMI A;  5H86 A;  4NJQ A;  3F5B A;  1KWM A;  1VHS A;  3T9Y A;  4PXD A;  4UCP A;  2PJB A;  4OIW A;  4OC0 A;  3DNS A;  8CPA A;  1QSN A;  2PC1 A;  1Z4E A;  1M4D A;  4UF4 A;  5AG5 A;  4MBU A;  4BD9 A;  5F09 A;  4ONU A;  3CXQ A;  4GM5 A;  2CXA A;  1JWQ A;  4KVM E;  2P6G A;  4LX9 A;  2O28 A;  4UFW A;  2H5M A;  2C6G A;  1B6B A;  4OC4 A;  1Z2L A;  4XPD B;  4A2Z A;  1CPS A;  2P6E A;  2GFQ A;  4JLY A;  3CT9 A;  2AFS A; 
#chains in the Genus database with same CATH homology
 4R3K A;  2FCK A;  3ZJ0 A;  4B5P B;  3QB8 A;  4KOX A;  2WSA A;  3TOA A;  4CGO A;  4JXQ A;  5G20 A;  4MFQ A;  3VWE A;  3JVN A;  4MY3 A;  2B3V A;  4B5P A;  4UBR A;  3V8I A;  1Z4R A;  2YNE A;  1IB1 E;  3JUW A;  4UFV A;  3IU2 A;  1XF8 A;  2ATR A;  4FD5 A;  5EBV A;  2D4O A;  3W6X A;  4IUS A;  4B12 A;  4BBH A;  1KUV A;  1M4G A;  2I00 A;  2K5T A;  4QUS A;  3DDD A;  2Z3K A;  2KCW A;  2GE3 A;  3N7Z A;  4YRH A;  4KOY A;  2B3U A;  4MFL A;  5KTC A;  4NEX A;  4J3G A;  1XMT A;  3BJ8 A;  3H5Z A;  3TO6 A;  1S3Z A;  1CJW A;  3FYN A;  1M1D A;  3E0K A;  3VWD A;  4RI1 A;  3DR8 A;  2FSR A;  4AG7 A;  2R98 A;  2HV2 A;  2PR1 A;  4R9M A;  4MFZ A;  2RC4 A;  1YRE A;  4CYQ A;  2PRB A;  4F0X A;  4CYP A;  1N71 A;  4E0A A;  4CS0 B;  2Q44 A;  3S6K A;  2PQ8 A;  4M85 A;  1PU9 A;  4F0Y A;  4XPL A;  3TO9 A;  3UY5 A;  2Q4V A;  3IWE A;  1OZP A;  2PR8 A;  4KLW A;  2B58 A;  3D8P A;  3TE4 A;  4KVX A;  4C7H A;  3DR6 A;  4NXY A;  4AVA A;  5G22 A;  4L8A A;  4MFK A;  4Q38 A;  4YFJ A;  1Y9W A;  2R1I A;  2X7B A;  1I21 A;  1IIC A;  4H89 A;  4NCZ A;  4B11 A;  1XEB A;  3F8K A;  4H6U A;  4R3L A;  1GHE A;  1S60 A;  2PDO A;  3BLN A;  1V0C A;  5C82 A;  4F6A A;  4ORF A;  2JDC A;  4CGL A;  2Z10 A;  2ZPA A;  3F0A A;  4OAE A;  5C88 A;  5DWM A;  2BSW A;  4MY0 A;  5JQ4 A;  1WK4 A;  3H4Q A;  4JJX A;  3I9S A;  5J8C A;  3EXN A;  2DPT A;  1QSR A;  2P0W A;  5H84 A;  1B87 A;  5F49 A;  4Y49 B;  2JDD A;  1YK3 A;  2BUE A;  3FB3 A;  3FNC A;  1J4J A;  2DXQ A;  3GY9 A;  3ZZI A;  4QVT A;  2Z3L A;  2HUZ A;  1CM0 A;  3P2H A;  4RS2 A;  4R57 A;  3IGR A;  4A33 A;  3MGD A;  4NF1 A;  2R8V A;  4KLV A;  4A32 A;  2J8R A;  3JTK A;  2R7H A;  4A95 A;  4E2A A;  2I79 A;  5F48 A;  4CYN A;  1MK4 A;  4JWP A;  3TT2 A;  2B4D B;  4KOV A;  1M4I A;  3C26 A;  3RYO A;  4PSW A;  2F5I A;  2B4D A;  2OH1 A;  4NSQ A;  2J8M A;  3DSB A;  4I49 A;  1MJ9 A;  5A28 A;  2AJ6 A;  2GAN A;  5F46 A;  3FRM A;  3SXN A;  1XIX A;  4KSA A;  3G8W A;  2A4N A;  1NMT A;  3I3G A;  2YND A;  3LOD A;  4FD7 A;  4E8O A;  2Y0M A;  2VZY A;  4AVB A;  3QAH A;  2DPS A;  3TCV A;  4AB7 A;  4CGP A;  3TTH A;  5A27 A;  4C7I A;  2CNS A;  4KOU A;  1FY7 A;  4UWI A;  4JXR A;  4OLL A;  2OZG A;  4JD6 A;  2OB0 A;  2YGW A;  2YNC A;  3R96 A;  1KZF A;  1YGH A;  3EFA A;  1VKC A;  3NE7 A;  1YVO A;  2Q0Y A;  3TO7 A;  4XPK A;  4MI4 A;  5AGE A;  1P4N A;  5GCN A;  1YLE A;  2EUI A;  2Z3P A;  2G3T A;  2PSW A;  4C2Y A;  2Q7B A;  5CNP A;  1NE9 A;  4MFJ A;  3S6F A;  4L89 A;  4M3S A;  2AE6 A;  5E96 A;  2Z3O A;  4HNY B;  2Q4Y A;  5KTD A;  3GKR A;  4QB9 A;  1BOB A;  1BO4 A;  1R57 A;  3OWC A;  2HQY A;  2IL4 A;  1Q2Y A;  2JEV A;  3A9L A;  4B14 A;  1ON0 A;  4CAX A;  2D4P A;  2FS5 A;  4KZT A;  1KUY A;  4XPD C;  5G1Z A;  3FIX A;  5HH1 A;  2FT0 A;  5ISV A;  2FIA A;  4II9 A;  4DNC A;  4KVO E;  4U5Y A;  4UWJ A;  4ZBG A;  2ZW5 A;  3PP9 A;  2Z0Z A;  3P2F A;  4KOR A;  4QBJ A;  5AG4 A;  2ZW6 A;  5AG7 A;  2Z3M A;  4KS9 A;  2CNT A;  1IYL A;  2FL4 A;  4KOT A;  4A30 A;  2WPW A;  4XNH C;  2OZU A;  4EVY A;  4Q36 A;  4KUA A;  4BMH A;  1M44 A;  1UFH A;  4CRY B;  5I0C A;  2EVN A;  2ARH A;  1WWZ A;  4B5O A;  2REE A;  3CXP A;  1Y7R A;  3IWG A;  2FIW A;  2C27 A;  2CNM A;  4PK3 A;  4KOW A;  4UFX A;  5G21 A;  2VXK A;  3IU1 A;  5F47 A;  4FD6 A;  2VEZ A;  3TFY A;  1NSL A;  2OU2 A;  2G3A A;  4B10 A;  3S6H A;  4CAV A;  1XE4 A;  4PV6 A;  4OAD A;  4CAF A;  4ZGY B;  1LRZ A;  2ZW4 A;  2WUU A;  5KTA A;  2QML A;  1I1D A;  1S7L A;  1YR0 A;  2ZXV A;  3EY5 A;  3D3S A;  2VBQ A;  3FBU A;  4MFP A;  4PSX A;  1S7K A;  3B8G A;  5FVJ A;  3EO4 A;  4B13 A;  4KUB A;  2FXF A;  4C2Z A;  1L0C A;  4CGM A;  5IB0 A;  5EC4 A;  1IYK A;  2CY2 A;  3W91 A;  3EC4 A;  3SHP A;  2OZH A;  2QIR A;  3R9G A;  4KOS A;  5IX3 A;  4C68 A;  4GS4 A;  4H6Z A;  4KSF A;  4FD4 A;  2J8N A;  4CYO A;  3FXT A;  4XNH B;  4K30 A;  3R9F A;  4CGN A;  1QSO A;  3BJ7 A;  3SXO A;  5JPH A;  4AVC A;  4HKF A;  3LD2 A;  1RXT A;  3PGP A;  1MJB A;  1QST A;  4U9Z A;  3KKW A;  5IV0 A;  1YX0 A;  4LUA A;  4Y49 C;  2Q04 A;  5BWA B;  4UA3 A;  3CXS A;  4MHD A;  1Q2C A;  2G0B A;  2B4B A;  4CAW A;  5J8F A;  2GIV A;  4MJ8 A;  4HNW B;  3WR7 A;  1MJA A;  1K4J A;  4HNX B;  3R95 A;  1TIQ A;  1IID A;  2B5G B;  3S6G A;  4CRZ B;  1S5K A;  2B5G A;  4PK2 A;  1SQH A;  4X5K A;  2Z11 A;  1S7N A;  1KUX A;  4R87 A;  1QSM A;  2P6F A;  1P0H A;  2VQY A;  1RO5 A;  3TOB A;  4U9Y A;  2BL1 A;  2QEC A;  3G3S A;  2NMT A;  3D2M A;  4YGO A;  5DWN A;  1I12 A;  4C2X A;  4QC6 A;  2VI7 A;  3GYA A;  2REF A;  3R9E A;  3K9U A;  3R1K A;  1YVK A;  2ZW7 A;  3W6S A;  4UCN A;  2JLM A;  1PUA A;  1Q2D A;  4AG9 A;  4CAE A;  2BEI A;  1ZO0 A;  4IF5 A;  5HMN A;  4UCM A;  1Y9K A;  2FE7 A;  2Z3N A;  2VZZ A;  1Z9U A;  3PZJ A;  4A31 A;  3D2P A;  2YNC C;  1S7F A;  3T90 A;  2WPX A;  5AG6 A;  5H86 A;  3F5B A;  1VHS A;  3T9Y A;  4UCP A;  3DNS A;  1QSN A;  2PC1 A;  1Z4E A;  1M4D A;  5AG5 A;  4MBU A;  4ONU A;  3CXQ A;  2CXA A;  4KVM E;  2P6G A;  4LX9 A;  2O28 A;  4UFW A;  2H5M A;  1B6B A;  4XPD B;  4A2Z A;  2P6E A;  4JLY A;  1U6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...