1IYLA

Crystal structure of candida albicans n-myristoyltransferase with non-peptidic inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
384
structure length
384
Chain Sequence
b'TPEDVPNDPLPLISDFEWSTLDIDDNLQLDELYKLLYDNYVEDIDATFRFKYSHEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVTFKLNKSNKVIDSVEINFLCIHKKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPTPLTTCRYQHRPINWSKLHDVGFSHLPPNQTKSSMVASYTLPNNPKLKGLRPMTGKDVSTVLSLLYKYQERFDIVQLFTEEEFKHWMLGHDENSDSNVVKSYVVEDENGIITDYFSYYLLPFTVLDNAQHDELGIAYLFYYASDSFEKPNYKKRLNELITDALITSKKFGVDVFNCLTCQDNTYFLKDCKFGSGDGFLNYYLFNYRTFPMDGGIDKKTKEVVEDQTSGIGVVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myristoyl-CoA:Protein N-Myristoyltransferase
publication title Crystal Structures of Candida albicans N-Myristoyltransferase with Two Distinct Inhibitors
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 103
structure length 384
sequence length 384
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iylA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iylA02
4UWJA 2D4PA 1QSRA 3S6KA 4E0AA 2OH1A 4H6UA 2R8VA 4DNCA 3IGRA 2Q44A 4HKFA 3R9FA 1IYKA 4MJ8A 3DNSA 2B3VA 1Z4RA 2ZPAA 2J8NA 1M1DA 1MJAA 1MJBA 1J4JA 2O28A 2Q4VA 1M4DA 2HQYA 2GIVA 1S60A 1Q2CA 4R3KA 2H5MA 4OAEA 2REEA 1M4GA 2FIWA 1I1DA 2PQ8A 4RS2A 3R1KA 1IICA 4PSWA 4KORA 2ATRA 1I12A 1BOBA 4M85A 3FRMA 4KUAA 2QIRA 5H86A 4UBRA 3G8WA 3C26A 3CXSA 4CRZB 3DR8A 4J3GA 4AG9A 5C88A 3GKRA 2R7HA 5IV0A 3FXTA 4IUSA 2FL4A 2ZW7A 4M3SA 2I00A 4PSXA 2G0BA 4FD4A 4XNHB 4E2AA 4AG7A 5J8CA 1YGHA 3EY5A 1B6BA 1MJ9A 2FSRA 2EVNA 1L0CA 3WR7A 4L89A 4X5KA 2QECA 2RC4A 4FD6A 2OZGA 2P6FA 2GANA 3CXPA 1KUXA 4II9A 3QAHA 2BL1A 3PP9A 2P0WA 3ZZIA 4PK3A 1B87A 3BJ8A 4KLWA 4NEXA 1QSTA 4MY3A 3FBUA 1QSMA 5JQ4A 5IX3A 3TOBA 4PK2A 4Y49C 3JVNA 5DWMA 4YFJA 4XPDC 3F0AA 3IWGA 3T9YA 2VZYA 4HNWB 4F6AA 4H89A 1S7KA 2OZUA 2VBQA 3TFYA 4KOVA 4YRHA 1Z4EA 1P0HA 5F46A 3CXQA 2K5TA 2PDOA 3EFAA 3K9UA 4JJXA 2B4DB 2G3AA 2WPWA 3TCVA 3TO6A 2Z0ZA 5EBVA 4U5YA 5H84A 3KKWA 4NSQA 1YVKA 2FCKA 1QSOA 2PR8A 2VXKA 3UY5A 3S6HA 1CJWA 4GS4A 4AVAA 1N71A 2PC1A 4XPKA 2JLMA 4AVCA 4CAWA 4ZBGA 4QVTA 5JPHA 4CAVA 2ARHA 2A4NA 2JEVA 1VHSA 1Y7RA 4U9YA 1XIXA 1YLEA 3PZJA 2CNTA 3S6FA 4UWIA 1XEBA 2Q7BA 2PSWA 1PUAA 1RO5A 2BSWA 2PRBA 2B5GA 4PV6A 1KZFA 2B3UA 2Q4YA 2FXFA 2PR1A 1S7LA 4KOSA 4JXQA 1Q2DA 1NMTA 4XPLA 1XE4A 2B4BA 2WPXA 4NXYA 5F49A 1S7FA 4E8OA 1TIQA 1YVOA 4AVBA 3P2HA 1I21A 4FD7A 4R9MA 1WWZA 3TO9A 2OU2A 1YREA 2Q04A 4R57A 3W6SA 3LD2A 4KOTA 2F5IA 3W91A 3FNCA 1KUVA 2VQYA 4JD6A 1K4JA 4UA3A 2D4OA 4JWPA 1WK4A 4QB9A 3TOAA 2HV2A 5KTCA 3TT2A 2X7BA 4RI1A 4MHDA 4I49A 1IYLA 5IB0A 2AE6A 5J8FA 2ZW4A 3NE7A 1R57A 4MY0A 3TTHA 2C27A 5KTAA 3F5BA 1NSLA 2ZW5A 3EXNA 1YK3A 3D2PA 3I9SA 4JXRA 2JDDA 3DR6A 4HNXB 2P6EA 2FT0A 4B5PA 2R1IA 3EO4A 2CNMA 5KTDA 1ON0A 5F47A 1SQHA 4B5OA 3B8GA 2P6GA 4KLVA 4LUAA 1YR0A 4R3LA 2DXQA 3OWCA 4H6ZA 2VI7A 2QMLA 3R95A 1XF8A 2Y0MA 3SXOA 4OADA 4KZTA 3MGDA 3E0KA 3SXNA 5C82A 3I3GA 1PU9A 1YX0A 4XNHC 2OB0A 1V0CA 1M44A 4IF5A 4QUSA 2Q0YA 2G3TA 4CS0B 2KCWA 3D3SA 4OLLA 4L8AA 3VWEA 2FE7A 4KUBA 2CNSA 4KOUA 4FD5A 5E96A 3ZJ0A 1IIDA 3LODA 4QBJA 3N7ZA 3RYOA 1MK4A 3TE4A 1RXTA 3D8PA 2ZW6A 1Z9UA 1Y9KA 1KUYA 2NMTA 4KVXA 4KVOE 4MBUA 1OZPA 3R9EA 2FS5A 4NF1A 3SHPA 1VKCA 2BEIA 2ZXVA 3DDDA 3T90A 2BUEA 2B5GB 5GCNA 4R87A 4K30A 3F8KA 2J8MA 4Y49B 4XPDB 4HNYB 2B58A 4KOYA 3QB8A 3EC4A 3JUWA 1FY7A 2Z10A 1NE9A 1GHEA 1M4IA 5EC4A 3R96A 3R9GA 3VWDA 5DWNA 2HUZA 2J8RA 4ONUA 4AB7A 2IL4A 5HH1A 3H4QA 3FB3A 4QC6A 4EVYA 1S7NA 3GYAA 3GY9A 1Y9WA 2Z11A 1P4NA 5FVJA 5F48A 3BLNA 1S3ZA 1CM0A 3FIXA 2FIAA 5CNPA 3G3SA 4KVME 3BJ7A 2EUIA 2OZHA 4LX9A 4ORFA 1BO4A 4JLYA 1Q2YA 2I79A 2VEZA 1IB1E 1LRZA 2CY2A 4BMHA 2AJ6A 4YGOA 4MI4A 2VZZA 1S5KA 3TO7A 4F0YA 4NCZA 4CRYB 3FYNA 3W6XA 4B5PB 4CAXA 3P2FA 2JDCA 4KOWA 3PGPA 3S6GA 4U9ZA 3D2MA 4KOXA 2REFA 5HMNA 5ISVA 1UFHA 2B4DA 3V8IA 3DSBA 2GE3A 1QSNA 1XMTA 1U6MA 5I0CA 2R98A
chains in the Genus database with same CATH superfamily
3L2NA 3IC1A 4CYOA 3HLPA 2YNEA 4OMEA 2G9DA 4UWJA 2D4PA 4A31A 1QSRA 3S6KA 4E0AA 3B35A 3MN8A 2OH1A 4H6UA 2R8VA 3B3TA 4DNCA 1Z8XA 6CPAA 3IGRA 2Q44A 4HKFA 4M6GA 2PJ7A 4ZYQA 3KI9A 3R9FA 1IYKA 2ZEMA 3K2KA 1TF9A 3DNSA 2B3VA 1Z4RA 2ZPAA 4H2KA 2J8NA 4MJ8A 3BXMA 3PB4X 1M1DA 1FT7A 1MJAA 1MJBA 2WUUA 3RZAA 1J4JA 1KWMA 1F2OA 3H5ZA 2HB6A 2O28A 2ZELA 2Q4VA 4IHMA 1M4DA 4KSFA 2HQYA 2GIVA 3DGVA 4MFQA 1S60A 1Q2CA 2Z3OA 3PFOA 4R3KA 1R43A 5A27A 2H5MA 4OAEA 2DPSA 1M4GA 2REEA 4BD9A 2FIWA 2GLFA 4F8ZA 1I1DA 2PQ8A 4RS2A 4O23A 2QJ8A 3R1KA 1IICA 4B6ZA 4P45A 2I3CA 4R6TA 4CPAA 1PYTB 4P4BA 3CZXA 4PSWA 1XFOA 4KORA 4OC0A 5BWAB 4RUHA 2ATRA 1I12A 2GU2A 3QNVA 1BOBA 5JH9A 1BAVA 1XMBA 4M85A 3SI0A 1LAPA 3FRMA 3D68A 4KUAA 2QIRA 4JZ0A 4UBRA 5H86A 4UCPA 2PJBA 1M4LA 3C26A 3G8WA 3CXSA 3SJXA 3SJFA 2F7VA 4CRZB 2OR4A 3DR8A 4J3GA 3WC7A 5G20A 4AG9A 2V8VA 1TF8A 5C88A 5AG5A 3GKRA 2POKA 2R7HA 3IWWA 4B11A 2CXAA 4PXEA 1Q7LA 2XEFA 3K9TA 2ZEPA 1ZLIA 4MHYA 2C6CA 4WWVA 4P44A 5IV0A 5AG4A 1QQ9A 3PB8X 4C2YA 3FXTA 3LACA 1QMUA 4IUSA 1CP6A 2XEGA 1YQEA 2FL4A 2ZW7A 4M3SA 4WJBA 5IB9A 4OIDA 2I00A 4PSXA 3LWUA 2G0BA 4FD4A 4XNHB 3HUVA 4DYOA 4E2AA 4FBEA 4AG7A 5J8CA 1YGHA 4Q7AA 3EY5A 1B6BA 1IOFA 1MJ9A 1ZG7A 5DS0A 1Z5RA 2FSRA 1HDQA 4CGMA 4UF4A 2EVNA 1L0CA 3WR7A 4L89A 4X5KA 3WC6A 2QECA 1YW6A 2RC4A 4FD6A 2OZGA 2P6FA 1VHEA 2GANA 3IJ3A 3CXPA 1KUXA 2EK9A 4UEEA 3PB7X 4P6YA 4II9A 2J9AA 5EMIA 1JWQA 3QAHA 2BL1A 2DPTA 3D66A 2PJCA 4OC3A 4MCSA 3PP9A 2XEIA 4UEZA 1AUGA 4C2ZA 4G1PA 2P0WA 2PCUA 3ZZIA 4PK3A 4LQGA 1B87A 3BJ8A 4KLWA 4C7IA 3QAYA 4NEXA 1VIXA 1QSTA 3D7DA 3KR4A 4MY3A 2BCOA 3FBUA 1LCPA 3H8GA 3IIBA 5LRGA 2PVVA 1QSMA 5JQ4A 5IX3A 1F57A 3PB9X 3TOBA 3D7GA 1TKFA 1TXRA 4PK2A 4ZGYB 4Y49C 3JVNA 5DWMA 3GLJA 4XPDC 4CYNA 4YFJA 4C7HA 4OC4A 3F0AA 3KHXA 3KQZA 4MFLA 3I1UA 4R7MA 4YWYA 3SJEA 2AFWA 3IWGA 1Z2LA 5LYLA 1Y0RA 3T9YA 2VZYA 4HNWB 4F6AA 3KHZA 4H89A 4A95A 2Z3MA 1YW4A 1S7KA 3VATA 2OZUA 3SJGA 2VBQA 2PJ4A 2ABZA 4MMOA 4CGLA 2PIZA 2V77A 2HC9A 3TFYA 4KOVA 2YGWA 4YRHA 1Z4EA 1P0HA 4UEFA 3CXQA 5F46A 2K5TA 4K3NA 2PDOA 3KL9A 4MFJA 3EFAA 4UIAA 3NE8A 2Z3PA 3K9UA 4CAEA 2CF4A 1F2PA 2EK8A 3D7HA 3IFEA 2B4DB 2G3AA 2WPWA 4JJXA 3TCVA 4PXDA 1BLLE 4OC5A 3RNZA 4MCPA 4FUUA 4GM5A 4MXUA 2Z0ZA 3TO6A 2Z3NA 3CPXA 5EBVA 4EWTA 4U5YA 5H84A 4CGOA 3FJUA 3KKWA 4MFPA 4NSQA 5JM6A 1YVKA 3CT9A 2FCKA 4PPZA 1QSOA 2O53A 2PR8A 2VXKA 3UY5A 3S6HA 3ISXA 2ZENA 3IWEA 4R76A 1CJWA 4GS4A 4AVAA 1N71A 4ZY0A 2PC1A 3FVLA 4XPKA 4OKOA 4GXHA 2JLMA 2PJ3A 4AVCA 4YU9A 4A30A 4CAWA 4ZBGA 3JRUA 1Z8TA 1ARMA 2ZEGA 4QVTA 5JPHA 4CAVA 2ARHA 2A4NA 2JEVA 1CPXA 1VHSA 1Y7RA 4U9YA 1XIXA 1ZG8A 1YLEA 3KASA 3CPAA 3PZJA 1FNOA 3TC8A 2CNTA 2AFZA 3S6FA 2BO9A 4UWIA 3RBUA 5ELYA 1ZO0A 1XEBA 2NYQA 2YNCC 5HXDA 4NGNA 2Q7BA 2PSWA 1PUAA 1RO5A 2BOAA 2BSWA 2JBJA 2PRBA 3A9LA 4A39A 2IJZA 1Z8LA 2Q7SA 4KS9A 4MFZA 3KGQA 2B5GA 4PV6A 1KZFA 2B3UA 1X12A 2Q4YA 2FXFA 2PR1A 1S7LA 2YNDA 3D67A 4NFRA 1DE4C 2PJ8A 4KOSA 2ZEOA 1Q2DA 1NMTA 4JXQA 4XPLA 2PJAA 1XE4A 2PIYA 2B4BA 2WPXA 1BPNA 2ZEHA 2ZOGA 4NXYA 4P4IA 4TWEA 5F49A 4MRIA 1S7FA 4MFKA 4NGRA 2AFOA 4E8OA 1TIQA 1YVOA 3N5FA 4AVBA 3P2HA 3FEEA 1I21A 3NH8A 4FD7A 4R9MA 1WWZA 5AG6A 3PFEA 3TO9A 2OU2A 1YREA 2Q04A 4R57A 1A2ZA 3W6SA 4ZX9A 2C1CA 3LD2A 4KOTA 2F5IA 3W91A 1IU8A 3FNCA 5F09A 5LRJA 2JEWA 1KUVA 4LQ6A 4X8IA 2VQYA 4JD6A 4ONWA 4EMEA 4FAIA 1K4JA 2O4HA 4UA3A 3BI1A 1LAMA 1ARLA 2D4OA 4JWPA 1WK4A 4KSAA 4QB9A 3VARA 4B13A 3TOAA 5J1QA 2ZEFA 2HV2A 3WABA 5KTCA 3TT2A 4ZY1A 2X7BA 5D8NA 4A32A 2AFMA 4PQAA 4A38A 4RI1A 3V7ZA 1IGBA 3H8EA 4MHDA 4I49A 2V8DA 5HVFA 1IOIA 1IYLA 2WYRA 5IB0A 4MCRA 4ZX8A 3NH5A 4TNUA 2AE6A 1XBUA 4NGSA 5J8FA 5HVGA 2ZW4A 3NE7A 4B14A 1R57A 4MY0A 4OIWA 1R3NA 3TTHA 2C27A 4A37A 5KTAA 2Q4ZA 3F5BA 1NSLA 3B7IA 2ZW5A 3EXNA 5CBMA 5LYFA 4P10A 1YK3A 3D2PA 3I9SA 3PEIA 4JXRA 2JDDA 2YNCA 4IK2A 5AGEA 3DR6A 5A28A 4HNXB 3WC5A 2P6EA 2EWBA 4ZI6A 2FT0A 4B5PA 2R1IA 3EO4A 2RB7A 5K8OA 2NSMA 2CNMA 4M6HA 5KTDA 1OBRA 5HVHA 1ON0A 4UCNA 5F47A 2AFSA 4OC2A 8CPAA 1SQHA 1YMEA 4B5OA 3B8GA 2F8HA 1Z8WA 3PB6X 3JTKA 2V8HA 2P6GA 4KLVA 7CPAA 4B10A 3ISZA 1YR0A 4LUAA 1AMPA 2DXQA 4R3LA 2ANPA 5AG7A 2PVWA 3FF3A 3T8WA 4CYPA 3PBBA 2RFHA 3OWCA 4H6ZA 4F9UA 5LYIA 4BBHA 2VI7A 2QMLA 1CP7A 3PRTA 3R95A 1XF8A 2Y0MA 3SXOA 4OADA 1BPMA 3CDXA 3GIUA 4KZTA 3MGDA 1UWYA 3E0KA 3SXNA 3NA6A 2DEAA 5C82A 1CBXA 1PU9A 1TKHA 1YX0A 3B3SA 2OB0A 2PJ2A 1V0CA 3I3GA 4XNHC 1M44A 1VHOA 5G22A 4IF5A 4QUSA 2Q0YA 1EE3P 2CTCA 2G3TA 2KCWA 4BINA 4CS0B 1CG2A 1LOKA 2Z3LA 3D3SA 4OLLA 4L8AA 3VWEA 2FE7A 3FEDA 4KUBA 3VH9A 4C68A 2CNSA 3B3WA 4KOUA 3FECA 3RAMA 4FD5A 4MHPA 5E96A 2ZOFA 3ZJ0A 3NH4A 1IIDA 3LODA 4NGTA 3B2YA 5CPAA 1YSJA 4B12A 4QBJA 1AYEA 3N7ZA 3RYOA 5K8PA 4OC1A 2PJ6A 5G21A 1MK4A 4F9VA 3TE4A 2EO8A 1RXTA 3D8PA 3S9MA 4A94A 3FH4A 2ZW6A 4M6IA 2PRQA 1LFWA 2V8GA 4OP4A 1Z9UA 3S9LA 1Y9KA 1NSAA 5K8MA 1KUYA 2NMTA 4KVXA 4KVOE 1CPSA 3LMSA 4Q36A 4MBUA 2PE3A 4NJQA 1OZPA 2QYVA 3H8FA 3KQXA 3KZWA 4ZY2A 1HDUA 3R9EA 1HEEA 4F0XA 1Y7EA 2FS5A 2JBKA 4NF1A 4X3RA 3SHPA 1VKCA 2BEIA 4Q38A 2ZXVA 3DDDA 4MHNA 2BUEA 3T90A 2CTBA 2DF5A 4DUKA 4EFDA 2B5GB 5GCNA 4P4EA 4R87A 4K30A 3F8KA 2J8MA 4Y49B 4XPDB 4NGQA 1PCAA 4A2ZA 1ELMP 4HNYB 4CGPA 2GLJA 2B58A 4UCMA 4KOYA 4AXVA 3QB8A 1Y0YA 3EC4A 3IEHA 1FY7A 3JUWA 4UFXA 2QVPA 4FWUA 2Z10A 1ZLHA 1GHEA 1NE9A 1M4IA 5EC4A 3R96A 1TKJA 5K8NA 1GYTA 4R8FA 3R9GA 1ELLP 3D7FA 4IAVA 2OOTA 3DLJA 3VWDA 5LRKA 2PJ0A 2HUZA 1IY7A 5DWNA 3IU2A 2J8RA 4ONUA 4MHZA 4AB7A 2XEJA 2IL4A 2PJ5A 5HH1A 5THWA 3SI1A 3H4QA 4P4JA 3FB3A 4QC6A 4NJRA 4EVYA 2ZEEA 1S7NA 3GYAA 4X2TA 4W9YA 2Q51A 5JGFA 3NFZA 4KSIA 3GY9A 3TX8A 4DJLA 1Y9WA 4CGNA 2Z11A 4Z65A 2AFUA 1P4NA 1VGYA 5FVJA 5F48A 1YLOA 4UFWA 2FVGA 1DTDA 2IQ6A 2Q43A 2PJ1A 2C6GA 3BI0A 3BLNA 1S3ZA 2AFXA 4HPSA 3V38A 1CM0A 3FIXA 2EBJA 2FIAA 1CX8A 5CNPA 4CAFA 1XJOA 4CYQA 3G3SA 2CIJA 4KVME 4PXCA 3BJ7A 2EUIA 2OZHA 4LX9A 2ODFA 4ORFA 1LANA 1BO4A 3KR5A 4JLYA 1Q2YA 2I79A 3FMCA 1XOVA 4UIBA 3GB0A 3D4UA 2VEZA 1IB1E 5D29A 4NGPA 1LRZA 2ZEDA 2CY2A 3IO1A 2Z3KA 3PBEA 4JYWA 4BMHA 2AJ6A 1ZG9A 4YGOA 4MI4A 1X10A 3B3VA 3BHXA 2C6PA 2PJ9A 1S5KA 2VZZA 3SI2A 3TO7A 4F0YA 4A33A 2IMOA 2VL1A 4RN7A 4NCZA 4CRYB 3FYNA 2GREA 1XRYA 4P4FA 3W6XA 4B5PB 1H8LA 2WZNA 4CAXA 2GFQA 3P2FA 2JDCA 4KOWA 4C2XA 3PGPA 1JQGA 4PXBA 2WSAA 3S6GA 4U9ZA 3B3CA 5I4MA 3S9NA 3D2MA 4KOXA 3FX6A 1RTQA 2REFA 3GUXA 3WT4A 5HMNA 4UFVA 4P4DA 3MRUA 1UFHA 2B4DA 5ISVA 5G1ZA 3RO0A 4MCQA 3V8IA 3DSBA 2GE3A 5LYDA 1QSNA 1XMTA 4NGMA 1U6MA 5I0CA 2R98A 3IU1A
chains in the Genus database with same CATH topology
4CYOA 2YNEA 4UWJA 2D4PA 4A31A 1QSRA 3S6KA 4E0AA 2OH1A 4H6UA 2R8VA 4DNCA 3IGRA 2Q44A 4HKFA 3R9FA 1IYKA 4MJ8A 3DNSA 2B3VA 1Z4RA 2ZPAA 2J8NA 1M1DA 1MJAA 1MJBA 2WUUA 1J4JA 3H5ZA 2O28A 2Q4VA 1M4DA 4KSFA 2HQYA 2GIVA 4MFQA 1S60A 1Q2CA 2Z3OA 4R3KA 5A27A 2H5MA 4OAEA 2DPSA 1M4GA 2REEA 2FIWA 1I1DA 2PQ8A 4RS2A 3R1KA 1IICA 4PSWA 4KORA 5BWAB 2ATRA 1I12A 1BOBA 4M85A 3FRMA 4KUAA 2QIRA 5H86A 4UBRA 4UCPA 3G8WA 3C26A 3CXSA 4CRZB 3DR8A 4J3GA 5G20A 4AG9A 5C88A 3GKRA 2R7HA 4B11A 2CXAA 5IV0A 5AG4A 4C2YA 3FXTA 5AG5A 4IUSA 2FL4A 2ZW7A 4M3SA 2I00A 4PSXA 2G0BA 4FD4A 4XNHB 4E2AA 4AG7A 5J8CA 1YGHA 3EY5A 1B6BA 1MJ9A 2FSRA 4CGMA 2EVNA 1L0CA 3WR7A 4L89A 4X5KA 2QECA 2RC4A 4FD6A 2OZGA 2P6FA 2GANA 3CXPA 1KUXA 4II9A 3QAHA 2BL1A 2DPTA 3PP9A 4C2ZA 2P0WA 3ZZIA 4PK3A 1B87A 3BJ8A 4KLWA 4C7IA 4NEXA 1QSTA 4MY3A 3FBUA 1QSMA 5JQ4A 5IX3A 3TOBA 4PK2A 4ZGYB 4Y49C 3JVNA 5DWMA 4CYNA 4XPDC 4YFJA 4C7HA 3F0AA 4MFLA 3IWGA 3T9YA 2VZYA 4HNWB 4F6AA 4H89A 4A95A 2Z3MA 1S7KA 2OZUA 2VBQA 4CGLA 3TFYA 4KOVA 2YGWA 4YRHA 1Z4EA 1P0HA 5F46A 3CXQA 2K5TA 2PDOA 4MFJA 3EFAA 2Z3PA 3K9UA 4CAEA 4JJXA 2B4DB 2G3AA 2WPWA 3TCVA 3TO6A 2Z0ZA 2Z3NA 5EBVA 4U5YA 5H84A 4CGOA 4MFPA 3KKWA 4NSQA 1YVKA 2FCKA 1QSOA 2PR8A 2VXKA 3UY5A 3S6HA 3IWEA 1CJWA 4GS4A 4AVAA 1N71A 2PC1A 4XPKA 2JLMA 4AVCA 4A30A 4CAWA 4ZBGA 4QVTA 5JPHA 4CAVA 2ARHA 2A4NA 2JEVA 1VHSA 1Y7RA 4U9YA 1XIXA 1YLEA 3PZJA 2CNTA 3S6FA 4UWIA 1ZO0A 1XEBA 2YNCC 2Q7BA 2PSWA 1PUAA 1RO5A 2BSWA 2PRBA 3A9LA 4KS9A 4MFZA 2B5GA 4PV6A 1KZFA 2B3UA 2Q4YA 2FXFA 2PR1A 1S7LA 2YNDA 4KOSA 4JXQA 1Q2DA 1NMTA 4XPLA 1XE4A 2B4BA 2WPXA 4NXYA 5F49A 1S7FA 4MFKA 4E8OA 1TIQA 1YVOA 4AVBA 3P2HA 1I21A 4FD7A 4R9MA 1WWZA 5AG6A 3TO9A 2OU2A 1YREA 2Q04A 4R57A 3W6SA 3LD2A 4KOTA 2F5IA 3W91A 3FNCA 1KUVA 2VQYA 4JD6A 1K4JA 4UA3A 2D4OA 4JWPA 1WK4A 4KSAA 4QB9A 4B13A 3TOAA 2HV2A 5KTCA 3TT2A 2X7BA 4A32A 4RI1A 4MHDA 4I49A 1IYLA 5IB0A 2AE6A 5J8FA 2ZW4A 3NE7A 4B14A 1R57A 4MY0A 3TTHA 2C27A 5KTAA 3F5BA 1NSLA 2ZW5A 3EXNA 1YK3A 3D2PA 3I9SA 4JXRA 5AGEA 2JDDA 2YNCA 5A28A 3DR6A 4HNXB 2P6EA 2FT0A 4B5PA 2R1IA 3EO4A 2CNMA 5KTDA 1ON0A 4UCNA 5F47A 1SQHA 4B5OA 3B8GA 3JTKA 2P6GA 4KLVA 4B10A 4LUAA 1YR0A 4R3LA 2DXQA 5AG7A 4CYPA 3OWCA 4H6ZA 4BBHA 2VI7A 2QMLA 3R95A 1XF8A 2Y0MA 3SXOA 4OADA 4KZTA 3MGDA 3E0KA 3SXNA 5C82A 3I3GA 1PU9A 1YX0A 4XNHC 2OB0A 1V0CA 1M44A 5G22A 4IF5A 4QUSA 2Q0YA 2G3TA 4CS0B 2KCWA 2Z3LA 3D3SA 4OLLA 4L8AA 3VWEA 2FE7A 4KUBA 4C68A 2CNSA 4KOUA 4FD5A 5E96A 3ZJ0A 1IIDA 3LODA 4B12A 4QBJA 3N7ZA 3RYOA 5G21A 1MK4A 3TE4A 1RXTA 3D8PA 2ZW6A 1Z9UA 1Y9KA 1KUYA 2NMTA 4KVXA 4KVOE 4Q36A 4MBUA 1OZPA 3R9EA 4F0XA 2FS5A 4NF1A 3SHPA 1VKCA 2BEIA 4Q38A 2ZXVA 3DDDA 3T90A 2BUEA 2B5GB 5GCNA 4R87A 4K30A 3F8KA 2J8MA 4Y49B 4XPDB 4A2ZA 4HNYB 4CGPA 2B58A 4UCMA 4KOYA 3QB8A 3EC4A 3JUWA 1FY7A 4UFXA 2Z10A 1NE9A 1GHEA 1M4IA 5EC4A 3R96A 3R9GA 3VWDA 5DWNA 2HUZA 3IU2A 2J8RA 4ONUA 4AB7A 2IL4A 5HH1A 3H4QA 3FB3A 4QC6A 4EVYA 1S7NA 3GYAA 3GY9A 1Y9WA 4CGNA 2Z11A 1P4NA 5FVJA 5F48A 4UFWA 3BLNA 1S3ZA 1CM0A 3FIXA 2FIAA 5CNPA 4CAFA 4CYQA 3G3SA 4KVME 3BJ7A 2EUIA 2OZHA 4LX9A 4ORFA 1BO4A 4JLYA 1Q2YA 2I79A 2VEZA 1IB1E 1LRZA 2CY2A 2Z3KA 4BMHA 2AJ6A 4YGOA 4MI4A 2VZZA 1S5KA 3TO7A 4F0YA 4A33A 4NCZA 4CRYB 3FYNA 3W6XA 4B5PB 4CAXA 3P2FA 2JDCA 4KOWA 4C2XA 3PGPA 2WSAA 3S6GA 4U9ZA 3D2MA 4KOXA 2REFA 5HMNA 4UFVA 5ISVA 1UFHA 2B4DA 5G1ZA 3V8IA 3DSBA 2GE3A 1QSNA 1XMTA 1U6MA 5I0CA 2R98A 3IU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UWJ A;  2D4P A;  1QSR A;  3S6K A;  4E0A A;  2OH1 A;  4H6U A;  2R8V A;  4DNC A;  3IGR A;  2Q44 A;  4HKF A;  3R9F A;  1IYK A;  4MJ8 A;  3DNS A;  2B3V A;  1Z4R A;  2ZPA A;  2J8N A;  1M1D A;  1MJA A;  1MJB A;  1J4J A;  2O28 A;  2Q4V A;  1M4D A;  2HQY A;  2GIV A;  1S60 A;  1Q2C A;  4R3K A;  2H5M A;  4OAE A;  2REE A;  1M4G A;  2FIW A;  1I1D A;  2PQ8 A;  4RS2 A;  3R1K A;  1IIC A;  4PSW A;  4KOR A;  2ATR A;  1I12 A;  1BOB A;  4M85 A;  3FRM A;  4KUA A;  2QIR A;  5H86 A;  4UBR A;  3G8W A;  3C26 A;  3CXS A;  4CRZ B;  3DR8 A;  4J3G A;  4AG9 A;  5C88 A;  3GKR A;  2R7H A;  5IV0 A;  3FXT A;  4IUS A;  2FL4 A;  2ZW7 A;  4M3S A;  2I00 A;  4PSX A;  2G0B A;  4FD4 A;  4XNH B;  4E2A A;  4AG7 A;  5J8C A;  1YGH A;  3EY5 A;  1B6B A;  1MJ9 A;  2FSR A;  2EVN A;  1L0C A;  3WR7 A;  4L89 A;  4X5K A;  2QEC A;  2RC4 A;  4FD6 A;  2OZG A;  2P6F A;  2GAN A;  3CXP A;  1KUX A;  4II9 A;  3QAH A;  2BL1 A;  3PP9 A;  2P0W A;  3ZZI A;  4PK3 A;  1B87 A;  3BJ8 A;  4KLW A;  4NEX A;  1QST A;  4MY3 A;  3FBU A;  1QSM A;  5JQ4 A;  5IX3 A;  3TOB A;  4PK2 A;  4Y49 C;  3JVN A;  5DWM A;  4YFJ A;  4XPD C;  3F0A A;  3IWG A;  3T9Y A;  2VZY A;  4HNW B;  4F6A A;  4H89 A;  1S7K A;  2OZU A;  2VBQ A;  3TFY A;  4KOV A;  4YRH A;  1Z4E A;  1P0H A;  5F46 A;  3CXQ A;  2K5T A;  2PDO A;  3EFA A;  3K9U A;  4JJX A;  2B4D B;  2G3A A;  2WPW A;  3TCV A;  3TO6 A;  2Z0Z A;  5EBV A;  4U5Y A;  5H84 A;  3KKW A;  4NSQ A;  1YVK A;  2FCK A;  1QSO A;  2PR8 A;  2VXK A;  3UY5 A;  3S6H A;  1CJW A;  4GS4 A;  4AVA A;  1N71 A;  2PC1 A;  4XPK A;  2JLM A;  4AVC A;  4CAW A;  4ZBG A;  4QVT A;  5JPH A;  4CAV A;  2ARH A;  2A4N A;  2JEV A;  1VHS A;  1Y7R A;  4U9Y A;  1XIX A;  1YLE A;  3PZJ A;  2CNT A;  3S6F A;  4UWI A;  1XEB A;  2Q7B A;  2PSW A;  1PUA A;  1RO5 A;  2BSW A;  2PRB A;  2B5G A;  4PV6 A;  1KZF A;  2B3U A;  2Q4Y A;  2FXF A;  2PR1 A;  1S7L A;  4KOS A;  4JXQ A;  1Q2D A;  1NMT A;  4XPL A;  1XE4 A;  2B4B A;  2WPX A;  4NXY A;  5F49 A;  1S7F A;  4E8O A;  1TIQ A;  1YVO A;  4AVB A;  3P2H A;  1I21 A;  4FD7 A;  4R9M A;  1WWZ A;  3TO9 A;  2OU2 A;  1YRE A;  2Q04 A;  4R57 A;  3W6S A;  3LD2 A;  4KOT A;  2F5I A;  3W91 A;  3FNC A;  1KUV A;  2VQY A;  4JD6 A;  1K4J A;  4UA3 A;  2D4O A;  4JWP A;  1WK4 A;  4QB9 A;  3TOA A;  2HV2 A;  5KTC A;  3TT2 A;  2X7B A;  4RI1 A;  4MHD A;  4I49 A;  1IYL A;  5IB0 A;  2AE6 A;  5J8F A;  2ZW4 A;  3NE7 A;  1R57 A;  4MY0 A;  3TTH A;  2C27 A;  5KTA A;  3F5B A;  1NSL A;  2ZW5 A;  3EXN A;  1YK3 A;  3D2P A;  3I9S A;  4JXR A;  2JDD A;  3DR6 A;  4HNX B;  2P6E A;  2FT0 A;  4B5P A;  2R1I A;  3EO4 A;  2CNM A;  5KTD A;  1ON0 A;  5F47 A;  1SQH A;  4B5O A;  3B8G A;  2P6G A;  4KLV A;  4LUA A;  1YR0 A;  4R3L A;  2DXQ A;  3OWC A;  4H6Z A;  2VI7 A;  2QML A;  3R95 A;  1XF8 A;  2Y0M A;  3SXO A;  4OAD A;  4KZT A;  3MGD A;  3E0K A;  3SXN A;  5C82 A;  3I3G A;  1PU9 A;  1YX0 A;  4XNH C;  2OB0 A;  1V0C A;  1M44 A;  4IF5 A;  4QUS A;  2Q0Y A;  2G3T A;  4CS0 B;  2KCW A;  3D3S A;  4OLL A;  4L8A A;  3VWE A;  2FE7 A;  4KUB A;  2CNS A;  4KOU A;  4FD5 A;  5E96 A;  3ZJ0 A;  1IID A;  3LOD A;  4QBJ A;  3N7Z A;  3RYO A;  1MK4 A;  3TE4 A;  1RXT A;  3D8P A;  2ZW6 A;  1Z9U A;  1Y9K A;  1KUY A;  2NMT A;  4KVX A;  4KVO E;  4MBU A;  1OZP A;  3R9E A;  2FS5 A;  4NF1 A;  3SHP A;  1VKC A;  2BEI A;  2ZXV A;  3DDD A;  3T90 A;  2BUE A;  2B5G B;  5GCN A;  4R87 A;  4K30 A;  3F8K A;  2J8M A;  4Y49 B;  4XPD B;  4HNY B;  2B58 A;  4KOY A;  3QB8 A;  3EC4 A;  3JUW A;  1FY7 A;  2Z10 A;  1NE9 A;  1GHE A;  1M4I A;  5EC4 A;  3R96 A;  3R9G A;  3VWD A;  5DWN A;  2HUZ A;  2J8R A;  4ONU A;  4AB7 A;  2IL4 A;  5HH1 A;  3H4Q A;  3FB3 A;  4QC6 A;  4EVY A;  1S7N A;  3GYA A;  3GY9 A;  1Y9W A;  2Z11 A;  1P4N A;  5FVJ A;  5F48 A;  3BLN A;  1S3Z A;  1CM0 A;  3FIX A;  2FIA A;  5CNP A;  3G3S A;  4KVM E;  3BJ7 A;  2EUI A;  2OZH A;  4LX9 A;  4ORF A;  1BO4 A;  4JLY A;  1Q2Y A;  2I79 A;  2VEZ A;  1IB1 E;  1LRZ A;  2CY2 A;  4BMH A;  2AJ6 A;  4YGO A;  4MI4 A;  2VZZ A;  1S5K A;  3TO7 A;  4F0Y A;  4NCZ A;  4CRY B;  3FYN A;  3W6X A;  4B5P B;  4CAX A;  3P2F A;  2JDC A;  4KOW A;  3PGP A;  3S6G A;  4U9Z A;  3D2M A;  4KOX A;  2REF A;  5HMN A;  5ISV A;  1UFH A;  2B4D A;  3V8I A;  3DSB A;  2GE3 A;  1QSN A;  1XMT A;  1U6M A;  5I0C A;  2R98 A; 
#chains in the Genus database with same CATH topology
 3L2N A;  3IC1 A;  4CYO A;  3HLP A;  2YNE A;  4OME A;  2G9D A;  4UWJ A;  2D4P A;  4A31 A;  1QSR A;  3S6K A;  4E0A A;  3B35 A;  3MN8 A;  2OH1 A;  4H6U A;  2R8V A;  3B3T A;  4DNC A;  1Z8X A;  6CPA A;  3IGR A;  2Q44 A;  4HKF A;  4M6G A;  2PJ7 A;  4ZYQ A;  3KI9 A;  3R9F A;  1IYK A;  2ZEM A;  3K2K A;  1TF9 A;  3DNS A;  2B3V A;  1Z4R A;  2ZPA A;  4H2K A;  2J8N A;  4MJ8 A;  3BXM A;  3PB4 X;  1M1D A;  1FT7 A;  1MJA A;  1MJB A;  2WUU A;  3RZA A;  1J4J A;  1KWM A;  1F2O A;  3H5Z A;  2HB6 A;  2O28 A;  2ZEL A;  2Q4V A;  4IHM A;  1M4D A;  4KSF A;  2HQY A;  2GIV A;  3DGV A;  4MFQ A;  1S60 A;  1Q2C A;  2Z3O A;  3PFO A;  4R3K A;  1R43 A;  5A27 A;  2H5M A;  4OAE A;  2DPS A;  1M4G A;  2REE A;  4BD9 A;  2FIW A;  2GLF A;  4F8Z A;  1I1D A;  2PQ8 A;  4RS2 A;  4O23 A;  2QJ8 A;  3R1K A;  1IIC A;  4B6Z A;  4P45 A;  2I3C A;  4R6T A;  4CPA A;  1PYT B;  4P4B A;  3CZX A;  4PSW A;  1XFO A;  4KOR A;  4OC0 A;  5BWA B;  4RUH A;  2ATR A;  1I12 A;  2GU2 A;  3QNV A;  1BOB A;  5JH9 A;  1BAV A;  1XMB A;  4M85 A;  3SI0 A;  1LAP A;  3FRM A;  3D68 A;  4KUA A;  2QIR A;  4JZ0 A;  4UBR A;  5H86 A;  4UCP A;  2PJB A;  1M4L A;  3C26 A;  3G8W A;  3CXS A;  3SJX A;  3SJF A;  2F7V A;  4CRZ B;  2OR4 A;  3DR8 A;  4J3G A;  3WC7 A;  5G20 A;  4AG9 A;  2V8V A;  1TF8 A;  5C88 A;  5AG5 A;  3GKR A;  2POK A;  2R7H A;  3IWW A;  4B11 A;  2CXA A;  4PXE A;  1Q7L A;  2XEF A;  3K9T A;  2ZEP A;  1ZLI A;  4MHY A;  2C6C A;  4WWV A;  4P44 A;  5IV0 A;  5AG4 A;  1QQ9 A;  3PB8 X;  4C2Y A;  3FXT A;  3LAC A;  1QMU A;  4IUS A;  1CP6 A;  2XEG A;  1YQE A;  2FL4 A;  2ZW7 A;  4M3S A;  4WJB A;  5IB9 A;  4OID A;  2I00 A;  4PSX A;  3LWU A;  2G0B A;  4FD4 A;  4XNH B;  3HUV A;  4DYO A;  4E2A A;  4FBE A;  4AG7 A;  5J8C A;  1YGH A;  4Q7A A;  3EY5 A;  1B6B A;  1IOF A;  1MJ9 A;  1ZG7 A;  5DS0 A;  1Z5R A;  2FSR A;  1HDQ A;  4CGM A;  4UF4 A;  2EVN A;  1L0C A;  3WR7 A;  4L89 A;  4X5K A;  3WC6 A;  2QEC A;  1YW6 A;  2RC4 A;  4FD6 A;  2OZG A;  2P6F A;  1VHE A;  2GAN A;  3IJ3 A;  3CXP A;  1KUX A;  2EK9 A;  4UEE A;  3PB7 X;  4P6Y A;  4II9 A;  2J9A A;  5EMI A;  1JWQ A;  3QAH A;  2BL1 A;  2DPT A;  3D66 A;  2PJC A;  4OC3 A;  4MCS A;  3PP9 A;  2XEI A;  4UEZ A;  1AUG A;  4C2Z A;  4G1P A;  2P0W A;  2PCU A;  3ZZI A;  4PK3 A;  4LQG A;  1B87 A;  3BJ8 A;  4KLW A;  4C7I A;  3QAY A;  4NEX A;  1VIX A;  1QST A;  3D7D A;  3KR4 A;  4MY3 A;  2BCO A;  3FBU A;  1LCP A;  3H8G A;  3IIB A;  5LRG A;  2PVV A;  1QSM A;  5JQ4 A;  5IX3 A;  1F57 A;  3PB9 X;  3TOB A;  3D7G A;  1TKF A;  1TXR A;  4PK2 A;  4ZGY B;  4Y49 C;  3JVN A;  5DWM A;  3GLJ A;  4XPD C;  4CYN A;  4YFJ A;  4C7H A;  4OC4 A;  3F0A A;  3KHX A;  3KQZ A;  4MFL A;  3I1U A;  4R7M A;  4YWY A;  3SJE A;  2AFW A;  3IWG A;  1Z2L A;  5LYL A;  1Y0R A;  3T9Y A;  2VZY A;  4HNW B;  4F6A A;  3KHZ A;  4H89 A;  4A95 A;  2Z3M A;  1YW4 A;  1S7K A;  3VAT A;  2OZU A;  3SJG A;  2VBQ A;  2PJ4 A;  2ABZ A;  4MMO A;  4CGL A;  2PIZ A;  2V77 A;  2HC9 A;  3TFY A;  4KOV A;  2YGW A;  4YRH A;  1Z4E A;  1P0H A;  4UEF A;  3CXQ A;  5F46 A;  2K5T A;  4K3N A;  2PDO A;  3KL9 A;  4MFJ A;  3EFA A;  4UIA A;  3NE8 A;  2Z3P A;  3K9U A;  4CAE A;  2CF4 A;  1F2P A;  2EK8 A;  3D7H A;  3IFE A;  2B4D B;  2G3A A;  2WPW A;  4JJX A;  3TCV A;  4PXD A;  1BLL E;  4OC5 A;  3RNZ A;  4MCP A;  4FUU A;  4GM5 A;  4MXU A;  2Z0Z A;  3TO6 A;  2Z3N A;  3CPX A;  5EBV A;  4EWT A;  4U5Y A;  5H84 A;  4CGO A;  3FJU A;  3KKW A;  4MFP A;  4NSQ A;  5JM6 A;  1YVK A;  3CT9 A;  2FCK A;  4PPZ A;  1QSO A;  2O53 A;  2PR8 A;  2VXK A;  3UY5 A;  3S6H A;  3ISX A;  2ZEN A;  3IWE A;  4R76 A;  1CJW A;  4GS4 A;  4AVA A;  1N71 A;  4ZY0 A;  2PC1 A;  3FVL A;  4XPK A;  4OKO A;  4GXH A;  2JLM A;  2PJ3 A;  4AVC A;  4YU9 A;  4A30 A;  4CAW A;  4ZBG A;  3JRU A;  1Z8T A;  1ARM A;  2ZEG A;  4QVT A;  5JPH A;  4CAV A;  2ARH A;  2A4N A;  2JEV A;  1CPX A;  1VHS A;  1Y7R A;  4U9Y A;  1XIX A;  1ZG8 A;  1YLE A;  3KAS A;  3CPA A;  3PZJ A;  1FNO A;  3TC8 A;  2CNT A;  2AFZ A;  3S6F A;  2BO9 A;  4UWI A;  3RBU A;  5ELY A;  1ZO0 A;  1XEB A;  2NYQ A;  2YNC C;  5HXD A;  4NGN A;  2Q7B A;  2PSW A;  1PUA A;  1RO5 A;  2BOA A;  2BSW A;  2JBJ A;  2PRB A;  3A9L A;  4A39 A;  2IJZ A;  1Z8L A;  2Q7S A;  4KS9 A;  4MFZ A;  3KGQ A;  2B5G A;  4PV6 A;  1KZF A;  2B3U A;  1X12 A;  2Q4Y A;  2FXF A;  2PR1 A;  1S7L A;  2YND A;  3D67 A;  4NFR A;  1DE4 C;  2PJ8 A;  4KOS A;  2ZEO A;  1Q2D A;  1NMT A;  4JXQ A;  4XPL A;  2PJA A;  1XE4 A;  2PIY A;  2B4B A;  2WPX A;  1BPN A;  2ZEH A;  2ZOG A;  4NXY A;  4P4I A;  4TWE A;  5F49 A;  4MRI A;  1S7F A;  4MFK A;  4NGR A;  2AFO A;  4E8O A;  1TIQ A;  1YVO A;  3N5F A;  4AVB A;  3P2H A;  3FEE A;  1I21 A;  3NH8 A;  4FD7 A;  4R9M A;  1WWZ A;  5AG6 A;  3PFE A;  3TO9 A;  2OU2 A;  1YRE A;  2Q04 A;  4R57 A;  1A2Z A;  3W6S A;  4ZX9 A;  2C1C A;  3LD2 A;  4KOT A;  2F5I A;  3W91 A;  1IU8 A;  3FNC A;  5F09 A;  5LRJ A;  2JEW A;  1KUV A;  4LQ6 A;  4X8I A;  2VQY A;  4JD6 A;  4ONW A;  4EME A;  4FAI A;  1K4J A;  2O4H A;  4UA3 A;  3BI1 A;  1LAM A;  1ARL A;  2D4O A;  4JWP A;  1WK4 A;  4KSA A;  4QB9 A;  3VAR A;  4B13 A;  3TOA A;  5J1Q A;  2ZEF A;  2HV2 A;  3WAB A;  5KTC A;  3TT2 A;  4ZY1 A;  2X7B A;  5D8N A;  4A32 A;  2AFM A;  4PQA A;  4A38 A;  4RI1 A;  3V7Z A;  1IGB A;  3H8E A;  4MHD A;  4I49 A;  2V8D A;  5HVF A;  1IOI A;  1IYL A;  2WYR A;  5IB0 A;  4MCR A;  4ZX8 A;  3NH5 A;  4TNU A;  2AE6 A;  1XBU A;  4NGS A;  5J8F A;  5HVG A;  2ZW4 A;  3NE7 A;  4B14 A;  1R57 A;  4MY0 A;  4OIW A;  1R3N A;  3TTH A;  2C27 A;  4A37 A;  5KTA A;  2Q4Z A;  3F5B A;  1NSL A;  3B7I A;  2ZW5 A;  3EXN A;  5CBM A;  5LYF A;  4P10 A;  1YK3 A;  3D2P A;  3I9S A;  3PEI A;  4JXR A;  2JDD A;  2YNC A;  4IK2 A;  5AGE A;  3DR6 A;  5A28 A;  4HNX B;  3WC5 A;  2P6E A;  2EWB A;  4ZI6 A;  2FT0 A;  4B5P A;  2R1I A;  3EO4 A;  2RB7 A;  5K8O A;  2NSM A;  2CNM A;  4M6H A;  5KTD A;  1OBR A;  5HVH A;  1ON0 A;  4UCN A;  5F47 A;  2AFS A;  4OC2 A;  8CPA A;  1SQH A;  1YME A;  4B5O A;  3B8G A;  2F8H A;  1Z8W A;  3PB6 X;  3JTK A;  2V8H A;  2P6G A;  4KLV A;  7CPA A;  4B10 A;  3ISZ A;  1YR0 A;  4LUA A;  1AMP A;  2DXQ A;  4R3L A;  2ANP A;  5AG7 A;  2PVW A;  3FF3 A;  3T8W A;  4CYP A;  3PBB A;  2RFH A;  3OWC A;  4H6Z A;  4F9U A;  5LYI A;  4BBH A;  2VI7 A;  2QML A;  1CP7 A;  3PRT A;  3R95 A;  1XF8 A;  2Y0M A;  3SXO A;  4OAD A;  1BPM A;  3CDX A;  3GIU A;  4KZT A;  3MGD A;  1UWY A;  3E0K A;  3SXN A;  3NA6 A;  2DEA A;  5C82 A;  1CBX A;  1PU9 A;  1TKH A;  1YX0 A;  3B3S A;  2OB0 A;  2PJ2 A;  1V0C A;  3I3G A;  4XNH C;  1M44 A;  1VHO A;  5G22 A;  4IF5 A;  4QUS A;  2Q0Y A;  1EE3 P;  2CTC A;  2G3T A;  2KCW A;  4BIN A;  4CS0 B;  1CG2 A;  1LOK A;  2Z3L A;  3D3S A;  4OLL A;  4L8A A;  3VWE A;  2FE7 A;  3FED A;  4KUB A;  3VH9 A;  4C68 A;  2CNS A;  3B3W A;  4KOU A;  3FEC A;  3RAM A;  4FD5 A;  4MHP A;  5E96 A;  2ZOF A;  3ZJ0 A;  3NH4 A;  1IID A;  3LOD A;  4NGT A;  3B2Y A;  5CPA A;  1YSJ A;  4B12 A;  4QBJ A;  1AYE A;  3N7Z A;  3RYO A;  5K8P A;  4OC1 A;  2PJ6 A;  5G21 A;  1MK4 A;  4F9V A;  3TE4 A;  2EO8 A;  1RXT A;  3D8P A;  3S9M A;  4A94 A;  3FH4 A;  2ZW6 A;  4M6I A;  2PRQ A;  1LFW A;  2V8G A;  4OP4 A;  1Z9U A;  3S9L A;  1Y9K A;  1NSA A;  5K8M A;  1KUY A;  2NMT A;  4KVX A;  4KVO E;  1CPS A;  3LMS A;  4Q36 A;  4MBU A;  2PE3 A;  4NJQ A;  1OZP A;  2QYV A;  3H8F A;  3KQX A;  3KZW A;  4ZY2 A;  1HDU A;  3R9E A;  1HEE A;  4F0X A;  1Y7E A;  2FS5 A;  2JBK A;  4NF1 A;  4X3R A;  3SHP A;  1VKC A;  2BEI A;  4Q38 A;  2ZXV A;  3DDD A;  4MHN A;  2BUE A;  3T90 A;  2CTB A;  2DF5 A;  4DUK A;  4EFD A;  2B5G B;  5GCN A;  4P4E A;  4R87 A;  4K30 A;  3F8K A;  2J8M A;  4Y49 B;  4XPD B;  4NGQ A;  1PCA A;  4A2Z A;  1ELM P;  4HNY B;  4CGP A;  2GLJ A;  2B58 A;  4UCM A;  4KOY A;  4AXV A;  3QB8 A;  1Y0Y A;  3EC4 A;  3IEH A;  1FY7 A;  3JUW A;  4UFX A;  2QVP A;  4FWU A;  2Z10 A;  1ZLH A;  1GHE A;  1NE9 A;  1M4I A;  5EC4 A;  3R96 A;  1TKJ A;  5K8N A;  1GYT A;  4R8F A;  3R9G A;  1ELL P;  3D7F A;  4IAV A;  2OOT A;  3DLJ A;  3VWD A;  5LRK A;  2PJ0 A;  2HUZ A;  1IY7 A;  5DWN A;  3IU2 A;  2J8R A;  4ONU A;  4MHZ A;  4AB7 A;  2XEJ A;  2IL4 A;  2PJ5 A;  5HH1 A;  5THW A;  3SI1 A;  3H4Q A;  4P4J A;  3FB3 A;  4QC6 A;  4NJR A;  4EVY A;  2ZEE A;  1S7N A;  3GYA A;  4X2T A;  4W9Y A;  2Q51 A;  5JGF A;  3NFZ A;  4KSI A;  3GY9 A;  3TX8 A;  4DJL A;  1Y9W A;  4CGN A;  2Z11 A;  4Z65 A;  2AFU A;  1P4N A;  1VGY A;  5FVJ A;  5F48 A;  1YLO A;  4UFW A;  2FVG A;  1DTD A;  2IQ6 A;  2Q43 A;  2PJ1 A;  2C6G A;  3BI0 A;  3BLN A;  1S3Z A;  2AFX A;  4HPS A;  3V38 A;  1CM0 A;  3FIX A;  2EBJ A;  2FIA A;  1CX8 A;  5CNP A;  4CAF A;  1XJO A;  4CYQ A;  3G3S A;  2CIJ A;  4KVM E;  4PXC A;  3BJ7 A;  2EUI A;  2OZH A;  4LX9 A;  2ODF A;  4ORF A;  1LAN A;  1BO4 A;  3KR5 A;  4JLY A;  1Q2Y A;  2I79 A;  3FMC A;  1XOV A;  4UIB A;  3GB0 A;  3D4U A;  2VEZ A;  1IB1 E;  5D29 A;  4NGP A;  1LRZ A;  2ZED A;  2CY2 A;  3IO1 A;  2Z3K A;  3PBE A;  4JYW A;  4BMH A;  2AJ6 A;  1ZG9 A;  4YGO A;  4MI4 A;  1X10 A;  3B3V A;  3BHX A;  2C6P A;  2PJ9 A;  1S5K A;  2VZZ A;  3SI2 A;  3TO7 A;  4F0Y A;  4A33 A;  2IMO A;  2VL1 A;  4RN7 A;  4NCZ A;  4CRY B;  3FYN A;  2GRE A;  1XRY A;  4P4F A;  3W6X A;  4B5P B;  1H8L A;  2WZN A;  4CAX A;  2GFQ A;  3P2F A;  2JDC A;  4KOW A;  4C2X A;  3PGP A;  1JQG A;  4PXB A;  2WSA A;  3S6G A;  4U9Z A;  3B3C A;  5I4M A;  3S9N A;  3D2M A;  4KOX A;  3FX6 A;  1RTQ A;  2REF A;  3GUX A;  3WT4 A;  5HMN A;  4UFV A;  4P4D A;  3MRU A;  1UFH A;  2B4D A;  5ISV A;  5G1Z A;  3RO0 A;  4MCQ A;  3V8I A;  3DSB A;  2GE3 A;  5LYD A;  1QSN A;  1XMT A;  4NGM A;  1U6M A;  5I0C A;  2R98 A;  3IU1 A; 
#chains in the Genus database with same CATH homology
 4CYO A;  2YNE A;  4UWJ A;  2D4P A;  4A31 A;  1QSR A;  3S6K A;  4E0A A;  2OH1 A;  4H6U A;  2R8V A;  4DNC A;  3IGR A;  2Q44 A;  4HKF A;  3R9F A;  1IYK A;  4MJ8 A;  3DNS A;  2B3V A;  1Z4R A;  2ZPA A;  2J8N A;  1M1D A;  1MJA A;  1MJB A;  2WUU A;  1J4J A;  3H5Z A;  2O28 A;  2Q4V A;  1M4D A;  4KSF A;  2HQY A;  2GIV A;  4MFQ A;  1S60 A;  1Q2C A;  2Z3O A;  4R3K A;  5A27 A;  2H5M A;  4OAE A;  2DPS A;  1M4G A;  2REE A;  2FIW A;  1I1D A;  2PQ8 A;  4RS2 A;  3R1K A;  1IIC A;  4PSW A;  4KOR A;  5BWA B;  2ATR A;  1I12 A;  1BOB A;  4M85 A;  3FRM A;  4KUA A;  2QIR A;  5H86 A;  4UBR A;  4UCP A;  3G8W A;  3C26 A;  3CXS A;  4CRZ B;  3DR8 A;  4J3G A;  5G20 A;  4AG9 A;  5C88 A;  3GKR A;  2R7H A;  4B11 A;  2CXA A;  5IV0 A;  5AG4 A;  4C2Y A;  3FXT A;  5AG5 A;  4IUS A;  2FL4 A;  2ZW7 A;  4M3S A;  2I00 A;  4PSX A;  2G0B A;  4FD4 A;  4XNH B;  4E2A A;  4AG7 A;  5J8C A;  1YGH A;  3EY5 A;  1B6B A;  1MJ9 A;  2FSR A;  4CGM A;  2EVN A;  1L0C A;  3WR7 A;  4L89 A;  4X5K A;  2QEC A;  2RC4 A;  4FD6 A;  2OZG A;  2P6F A;  2GAN A;  3CXP A;  1KUX A;  4II9 A;  3QAH A;  2BL1 A;  2DPT A;  3PP9 A;  4C2Z A;  2P0W A;  3ZZI A;  4PK3 A;  1B87 A;  3BJ8 A;  4KLW A;  4C7I A;  4NEX A;  1QST A;  4MY3 A;  3FBU A;  1QSM A;  5JQ4 A;  5IX3 A;  3TOB A;  4PK2 A;  4ZGY B;  4Y49 C;  3JVN A;  5DWM A;  4CYN A;  4XPD C;  4YFJ A;  4C7H A;  3F0A A;  4MFL A;  3IWG A;  3T9Y A;  2VZY A;  4HNW B;  4F6A A;  4H89 A;  4A95 A;  2Z3M A;  1S7K A;  2OZU A;  2VBQ A;  4CGL A;  3TFY A;  4KOV A;  2YGW A;  4YRH A;  1Z4E A;  1P0H A;  5F46 A;  3CXQ A;  2K5T A;  2PDO A;  4MFJ A;  3EFA A;  2Z3P A;  3K9U A;  4CAE A;  4JJX A;  2B4D B;  2G3A A;  2WPW A;  3TCV A;  3TO6 A;  2Z0Z A;  2Z3N A;  5EBV A;  4U5Y A;  5H84 A;  4CGO A;  4MFP A;  3KKW A;  4NSQ A;  1YVK A;  2FCK A;  1QSO A;  2PR8 A;  2VXK A;  3UY5 A;  3S6H A;  3IWE A;  1CJW A;  4GS4 A;  4AVA A;  1N71 A;  2PC1 A;  4XPK A;  2JLM A;  4AVC A;  4A30 A;  4CAW A;  4ZBG A;  4QVT A;  5JPH A;  4CAV A;  2ARH A;  2A4N A;  2JEV A;  1VHS A;  1Y7R A;  4U9Y A;  1XIX A;  1YLE A;  3PZJ A;  2CNT A;  3S6F A;  4UWI A;  1ZO0 A;  1XEB A;  2YNC C;  2Q7B A;  2PSW A;  1PUA A;  1RO5 A;  2BSW A;  2PRB A;  3A9L A;  4KS9 A;  4MFZ A;  2B5G A;  4PV6 A;  1KZF A;  2B3U A;  2Q4Y A;  2FXF A;  2PR1 A;  1S7L A;  2YND A;  4KOS A;  4JXQ A;  1Q2D A;  1NMT A;  4XPL A;  1XE4 A;  2B4B A;  2WPX A;  4NXY A;  5F49 A;  1S7F A;  4MFK A;  4E8O A;  1TIQ A;  1YVO A;  4AVB A;  3P2H A;  1I21 A;  4FD7 A;  4R9M A;  1WWZ A;  5AG6 A;  3TO9 A;  2OU2 A;  1YRE A;  2Q04 A;  4R57 A;  3W6S A;  3LD2 A;  4KOT A;  2F5I A;  3W91 A;  3FNC A;  1KUV A;  2VQY A;  4JD6 A;  1K4J A;  4UA3 A;  2D4O A;  4JWP A;  1WK4 A;  4KSA A;  4QB9 A;  4B13 A;  3TOA A;  2HV2 A;  5KTC A;  3TT2 A;  2X7B A;  4A32 A;  4RI1 A;  4MHD A;  4I49 A;  1IYL A;  5IB0 A;  2AE6 A;  5J8F A;  2ZW4 A;  3NE7 A;  4B14 A;  1R57 A;  4MY0 A;  3TTH A;  2C27 A;  5KTA A;  3F5B A;  1NSL A;  2ZW5 A;  3EXN A;  1YK3 A;  3D2P A;  3I9S A;  4JXR A;  5AGE A;  2JDD A;  2YNC A;  5A28 A;  3DR6 A;  4HNX B;  2P6E A;  2FT0 A;  4B5P A;  2R1I A;  3EO4 A;  2CNM A;  5KTD A;  1ON0 A;  4UCN A;  5F47 A;  1SQH A;  4B5O A;  3B8G A;  3JTK A;  2P6G A;  4KLV A;  4B10 A;  4LUA A;  1YR0 A;  4R3L A;  2DXQ A;  5AG7 A;  4CYP A;  3OWC A;  4H6Z A;  4BBH A;  2VI7 A;  2QML A;  3R95 A;  1XF8 A;  2Y0M A;  3SXO A;  4OAD A;  4KZT A;  3MGD A;  3E0K A;  3SXN A;  5C82 A;  3I3G A;  1PU9 A;  1YX0 A;  4XNH C;  2OB0 A;  1V0C A;  1M44 A;  5G22 A;  4IF5 A;  4QUS A;  2Q0Y A;  2G3T A;  4CS0 B;  2KCW A;  2Z3L A;  3D3S A;  4OLL A;  4L8A A;  3VWE A;  2FE7 A;  4KUB A;  4C68 A;  2CNS A;  4KOU A;  4FD5 A;  5E96 A;  3ZJ0 A;  1IID A;  3LOD A;  4B12 A;  4QBJ A;  3N7Z A;  3RYO A;  5G21 A;  1MK4 A;  3TE4 A;  1RXT A;  3D8P A;  2ZW6 A;  1Z9U A;  1Y9K A;  1KUY A;  2NMT A;  4KVX A;  4KVO E;  4Q36 A;  4MBU A;  1OZP A;  3R9E A;  4F0X A;  2FS5 A;  4NF1 A;  3SHP A;  1VKC A;  2BEI A;  4Q38 A;  2ZXV A;  3DDD A;  3T90 A;  2BUE A;  2B5G B;  5GCN A;  4R87 A;  4K30 A;  3F8K A;  2J8M A;  4Y49 B;  4XPD B;  4A2Z A;  4HNY B;  4CGP A;  2B58 A;  4UCM A;  4KOY A;  3QB8 A;  3EC4 A;  3JUW A;  1FY7 A;  4UFX A;  2Z10 A;  1NE9 A;  1GHE A;  1M4I A;  5EC4 A;  3R96 A;  3R9G A;  3VWD A;  5DWN A;  2HUZ A;  3IU2 A;  2J8R A;  4ONU A;  4AB7 A;  2IL4 A;  5HH1 A;  3H4Q A;  3FB3 A;  4QC6 A;  4EVY A;  1S7N A;  3GYA A;  3GY9 A;  1Y9W A;  4CGN A;  2Z11 A;  1P4N A;  5FVJ A;  5F48 A;  4UFW A;  3BLN A;  1S3Z A;  1CM0 A;  3FIX A;  2FIA A;  5CNP A;  4CAF A;  4CYQ A;  3G3S A;  4KVM E;  3BJ7 A;  2EUI A;  2OZH A;  4LX9 A;  4ORF A;  1BO4 A;  4JLY A;  1Q2Y A;  2I79 A;  2VEZ A;  1IB1 E;  1LRZ A;  2CY2 A;  2Z3K A;  4BMH A;  2AJ6 A;  4YGO A;  4MI4 A;  2VZZ A;  1S5K A;  3TO7 A;  4F0Y A;  4A33 A;  4NCZ A;  4CRY B;  3FYN A;  3W6X A;  4B5P B;  4CAX A;  3P2F A;  2JDC A;  4KOW A;  4C2X A;  3PGP A;  2WSA A;  3S6G A;  4U9Z A;  3D2M A;  4KOX A;  2REF A;  5HMN A;  4UFV A;  5ISV A;  1UFH A;  2B4D A;  5G1Z A;  3V8I A;  3DSB A;  2GE3 A;  1QSN A;  1XMT A;  1U6M A;  5I0C A;  2R98 A;  3IU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...