1IYLA

Crystal structure of candida albicans n-myristoyltransferase with non-peptidic inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
384
structure length
384
Chain Sequence
TPEDVPNDPLPLISDFEWSTLDIDDNLQLDELYKLLYDNYVEDIDATFRFKYSHEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVTFKLNKSNKVIDSVEINFLCIHKKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPTPLTTCRYQHRPINWSKLHDVGFSHLPPNQTKSSMVASYTLPNNPKLKGLRPMTGKDVSTVLSLLYKYQERFDIVQLFTEEEFKHWMLGHDENSDSNVVKSYVVEDENGIITDYFSYYLLPFTVLDNAQHDELGIAYLFYYASDSFEKPNYKKRLNELITDALITSKKFGVDVFNCLTCQDNTYFLKDCKFGSGDGFLNYYLFNYRTFPMDGGIDKKTKEVVEDQTSGIGVVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myristoyl-CoA:Protein N-Myristoyltransferase
publication title Crystal Structures of Candida albicans N-Myristoyltransferase with Two Distinct Inhibitors
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
total genus 103
structure length 384
sequence length 384
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2002-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iylA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1iylA02
3TTHA 4XNHB 2Q4YA 4KOWA 4UWJA 3N7ZA 2D4OA 3P2FA 3E0KA 3OWCA 3W6SA 1S7FA 4B5OA 4DNCA 1P0HA 3VWEA 4AVCA 4JLYA 2FIAA 2CNTA 2B4DA 2B5GB 2HQYA 4H6UA 3G3SA 3IGRA 1I21A 4CRZB 3SXNA 3D2PA 2QIRA 1QSRA 1M4GA 1P4NA 2F5IA 4KUBA 4F6AA 3TFYA 3LODA 3NE7A 2OH1A 3QAHA 3H4QA 5HH1A 3T90A 3SHPA 4Y49C 1NMTA 1K4JA 2B4DB 4M3SA 5HMNA 1B87A 2FXFA 2JDCA 1XMTA 3GYAA 3R95A 3FBUA 2R98A 4R3LA 3TO6A 5F47A 2OZUA 3RYOA 3QB8A 2G3TA 1QSMA 1XE4A 3EY5A 2JLMA 4FD6A 4MI4A 2FS5A 3R9FA 1M4IA 2JEVA 4K30A 4XPDC 1CJWA 3S6FA 2OB0A 1MJBA 2I79A 2ZPAA 4KOTA 4KOYA 4KLWA 4NCZA 2ATRA 5F48A 1YX0A 2ZW7A 1PUAA 3EC4A 4LX9A 2PR8A 3BJ7A 2VQYA 1S3ZA 3GY9A 4QB9A 3ZJ0A 1S60A 4UWIA 3TO9A 2J8RA 1WWZA 4LUAA 3W6XA 1Y7RA 2G3AA 4AVAA 4CRYB 2P6GA 4AVBA 1NSLA 4NSQA 1S7LA 4JXRA 3EXNA 3R9GA 3GKRA 1YLEA 4R57A 3JUWA 2ZW4A 4QBJA 4XPKA 2FE7A 2REEA 4XPLA 2PR1A 1QSOA 2ZXVA 4MBUA 4PK2A 4PSWA 3BLNA 3TOBA 4OLLA 1I1DA 3W91A 2DXQA 2H5MA 3D3SA 4KOSA 3BJ8A 3S6KA 3FYNA 1ON0A 5DWNA 4II9A 1KUVA 1S7KA 3TOAA 4R3KA 1IYLA 2AJ6A 2D4PA 5IX3A 4CAVA 3T9YA 1RXTA 2OZHA 5J8FA 3TT2A 3FNCA 4MY0A 4CAXA 1BO4A 4E2AA 4E0AA 4AB7A 2HV2A 2REFA 1Z4RA 2P6FA 2PSWA 3ZZIA 2FL4A 3FB3A 3SXOA 1FY7A 5C82A 2Q0YA 4YGOA 4PV6A 3D8PA 1R57A 1TIQA 4U5YA 4AG7A 1M4DA 4KOXA 1YR0A 4JXQA 4HNWB 5EC4A 1S5KA 4KVOE 2JDDA 1YK3A 3EO4A 3PGPA 2KCWA 2Z10A 1Q2DA 5JQ4A 2B3UA 2B4BA 2C27A 4R87A 1M44A 1CM0A 3B8GA 4NEXA 1I12A 1UFHA 4KOVA 1XEBA 5IV0A 2Z0ZA 3F8KA 3JVNA 1M1DA 1S7NA 4U9YA 3DNSA 4YRHA 5EBVA 3CXPA 3TCVA 4KVME 1Z9UA 2ZW5A 4L8AA 5JPHA 2ARHA 5DWMA 2O28A 2FSRA 5J8CA 2IL4A 2R1IA 2R8VA 1LRZA 2J8NA 4U9ZA 4JJXA 2VZZA 4JWPA 4QUSA 4M85A 3C26A 2Q44A 4RS2A 4R9MA 4KORA 4XNHC 3P2HA 2QMLA 1YGHA 3WR7A 1PU9A 2GIVA 4IUSA 2BL1A 1KUYA 2BUEA 1XF8A 3D2MA 3PP9A 1Y9KA 2A4NA 4BMHA 3S6GA 4ZBGA 4CAWA 4H6ZA 2FT0A 5F46A 1Z4EA 4KZTA 4RI1A 3FXTA 2PC1A 2R7HA 1MJ9A 1MK4A 4OAEA 4KUAA 4ORFA 4HKFA 1IICA 4B5PA 3TE4A 2PDOA 2J8MA 4UBRA 4PK3A 1IIDA 2WPWA 1KUXA 1BOBA 5FVJA 1V0CA 2VEZA 4YFJA 1WK4A 1KZFA 4QVTA 2QECA 4I49A 4NXYA 4UA3A 1L0CA 2NMTA 4KVXA 2VI7A 2I00A 4EVYA 3DR8A 2RC4A 4H89A 1GHEA 2Y0MA 4FD7A 3PZJA 2PQ8A 1U6MA 1QSTA 2Q4VA 2CNSA 4B5PB 3FIXA 4X5KA 5H86A 2BEIA 3R1KA 1YVKA 4CS0B 4HNXB 3V8IA 2VBQA 1XIXA 4IF5A 2K5TA 3DR6A 4OADA 1Q2YA 2Z11A 3I3GA 3R9EA 2GE3A 5KTCA 3R96A 3FRMA 1YREA 2B58A 2HUZA 1IB1E 4KOUA 5C88A 3IWGA 2Q04A 1SQHA 3G8WA 1Q2CA 3K9UA 1J4JA 5IB0A 5F49A 2GANA 1VHSA 1VKCA 4AG9A 3DSBA 3CXSA 2CNMA 2P6EA 4PSXA 5GCNA 2EUIA 4MHDA 2PRBA 4NF1A 4Y49B 4E8OA 4ONUA 2VZYA 1OZPA 5KTAA 2Q7BA 3TO7A 4GS4A 2CY2A 2FIWA 4FD4A 2WPXA 5ISVA 3S6HA 5I0CA 3I9SA 2AE6A 4HNYB 2OU2A 5H84A 2B3VA 2X7BA 3UY5A 3KKWA 4MY3A 4MJ8A 1YVOA 1RO5A 2P0WA 3CXQA 2G0BA 4QC6A 1B6BA 2FCKA 4KLVA 1N71A 4XPDB 3F0AA 4FD5A 3MGDA 3LD2A 2OZGA 2VXKA 4JD6A 4J3GA 2BSWA 5CNPA 1IYKA 4L89A 2B5GA 2ZW6A 1QSNA 3DDDA 2EVNA 3VWDA 3F5BA 5KTDA 1MJAA 1NE9A 3EFAA 4F0YA 1Y9WA 5E96A
chains in the Genus database with same CATH superfamily
3VH9A 3NH8A 3TTHA 2YNCA 4XNHB 4NGQA 2Q4YA 4UCPA 4YWYA 3N5FA 4KOWA 4UWJA 3RZAA 4X3RA 4C2XA 3N7ZA 4C7HA 2D4OA 1LOKA 4Q38A 4A38A 3P2FA 3E0KA 3OWCA 3D67A 3IEHA 3W6SA 4RUHA 1S7FA 4BD9A 3FX6A 4B5OA 6CPAA 2ZEOA 4DNCA 1P0HA 3FEEA 3D7HA 3VWEA 4AVCA 4JLYA 1XBUA 2FIAA 2CNTA 2B4DA 2B5GB 1F2PA 2HQYA 3KR4A 4H6UA 4CGMA 3KZWA 4ZX9A 2AFZA 4MXUA 1KWMA 3G3SA 1R43A 3IGRA 1I21A 4CRZB 1M4LA 2CTCA 3D2PA 4OC3A 3SXNA 2QIRA 1QSRA 2ZEFA 5F09A 1M4GA 1P4NA 2F5IA 4PXDA 2C1CA 3BHXA 1R3NA 2WUUA 1LANA 1IY7A 1H8LA 1YQEA 3SI0A 3PB6X 4A32A 4KUBA 2PVVA 4F6AA 3TFYA 3LODA 3NE7A 2OH1A 3CZXA 4K3NA 2V8DA 3QAHA 3RAMA 4CGLA 2CTBA 4UCMA 3H4QA 5G20A 4BINA 4DJLA 5HH1A 2V8VA 3T90A 2AFWA 4OKOA 4MCQA 3SHPA 4FBEA 3SJEA 4Y49C 4OC1A 1CP7A 1NMTA 1K4JA 4ZYQA 5HXDA 2O4HA 2B4DB 2Z3OA 3D7FA 4M3SA 5A28A 3WT4A 4GM5A 5HMNA 1B87A 2FXFA 2JDCA 1XMTA 1XFOA 3GYAA 4P4BA 4DUKA 2Z3MA 3B7IA 4F9UA 3R95A 3FBUA 1XMBA 4CGOA 3SI2A 1VHOA 4CGPA 4ZY0A 4DYOA 2R98A 1YSJA 4R3LA 5AG6A 3B3SA 5F47A 3TO6A 2OZUA 3RYOA 3QB8A 2G3TA 1QSMA 1XE4A 3EY5A 3QAYA 2JLMA 5LYDA 4FD6A 4UFWA 1IOFA 2FS5A 4MI4A 3R9FA 4B11A 1M4IA 2JEVA 2ZEPA 5LYFA 3BXMA 1ZLIA 2PJ2A 4K30A 1DE4C 4XPDC 2PJ9A 3S9MA 1CJWA 2GREA 3HLPA 3S6FA 3RBUA 2OB0A 2ABZA 1MJBA 2I79A 4B10A 2ZPAA 1Z8XA 4KOTA 4KOYA 5LRGA 4KLWA 1ARMA 4NCZA 4H2KA 2ATRA 5F48A 2ZENA 1YX0A 2ZW7A 1YMEA 4MFZA 3KGQA 1PUAA 3EC4A 4MFLA 4TWEA 1QMUA 2PR8A 1TF8A 2VQYA 3BJ7A 4LX9A 4LQGA 1Z8LA 1S3ZA 3CPAA 3GY9A 4QB9A 3ZJ0A 1S60A 2PJ1A 4UWIA 1IOIA 3B3CA 3TO9A 5I4MA 2J8RA 2GLJA 1WWZA 1HDUA 2GLFA 4LUAA 3W6XA 1Y7RA 2G3AA 4AVAA 4CRYB 2AFUA 4MCPA 2PJ7A 4A39A 4P4DA 2GFQA 2P6GA 4AVBA 3KQZA 5A27A 2DEAA 1NSLA 3K2KA 3LWUA 2ZOFA 4C2ZA 2JBKA 4NSQA 1S7LA 4JXRA 2XEIA 3EXNA 1ELLP 3R9GA 3GKRA 1YLEA 4R57A 3JUWA 4A94A 4FWUA 2ZW4A 3BI1A 4PXCA 4QBJA 4XPKA 2FE7A 2QYVA 2REEA 4XPLA 2PR1A 1QSOA 2ZXVA 5G22A 4MBUA 2IQ6A 4PK2A 4PSWA 4P4JA 3BLNA 3B35A 3TOBA 2EO8A 4CYNA 4OLLA 4M6HA 3MRUA 3LMSA 3IU1A 1I1DA 2BO9A 3W91A 2DXQA 2H5MA 1JQGA 3D3SA 3PB9X 4KOSA 3BJ8A 5D29A 1F57A 3GIUA 4ZX8A 1CBXA 5LRKA 2CF4A 4KSIA 3DGVA 2AFXA 2C6PA 5AG7A 5LRJA 3S6KA 3FYNA 1ON0A 2YNCC 5DWNA 4II9A 3SI1A 1KUVA 2Q7SA 1S7KA 3TOAA 4OC4A 1GYTA 2V77A 4R3KA 1IYLA 2AJ6A 2D4PA 4TNUA 5IX3A 2PJ6A 4CAVA 2BOAA 3T9YA 1RXTA 2OZHA 4NGMA 5J8FA 3TT2A 3FNCA 4MY0A 4A37A 4CAXA 1BO4A 4X2TA 4E2AA 4E0AA 4NGPA 3D66A 3PB8X 4AB7A 2Z3PA 2HV2A 2REFA 4KSAA 1Z4RA 2POKA 2XEJA 2PIYA 3KL9A 5JM6A 2PJAA 2P6FA 2GU2A 2PSWA 2FL4A 3ZZIA 3FB3A 3SXOA 1FY7A 4MHYA 3S9LA 5C82A 2Q0YA 1AYEA 4PV6A 4YGOA 4FAIA 3D8PA 4P44A 1R57A 1TIQA 4U5YA 5HVHA 4AG7A 4CYOA 1M4DA 4UEFA 2DF5A 3JTKA 3WC7A 4IAVA 2EK9A 4A33A 4NGTA 3D7DA 4KOXA 1YR0A 2VL1A 4NGRA 1ELMP 4JXQA 4HNWB 4MFKA 1Z8WA 4LQ6A 3GLJA 5K8NA 2I3CA 5EC4A 3SJGA 3B3VA 1S5KA 4X8IA 4KVOE 4B13A 4YU9A 2PJ5A 2V8GA 2JDDA 5G21A 3IFEA 1YK3A 3EO4A 2Q43A 3T8WA 2RB7A 3PGPA 2KCWA 2Z10A 3L2NA 1Q2DA 3D68A 5JQ4A 1Y7EA 2B3UA 4KS9A 2B4BA 2C27A 3NE8A 1Y0YA 4OC2A 4R87A 3PEIA 4MFQA 1M44A 1CM0A 3FH4A 3B8GA 5IB9A 4NEXA 1I12A 1UFHA 4KOVA 1YLOA 1XEBA 3H8FA 2Z0ZA 2C6CA 3F8KA 4PXBA 3PBBA 3JVNA 5IV0A 3CDXA 1M1DA 1S7NA 4IHMA 3JRUA 4U9YA 3RNZA 1PCAA 1X12A 3DNSA 4CAEA 4YRHA 5EBVA 3KASA 3CXPA 4PQAA 2IJZA 2O53A 2OOTA 3DLJA 3TCVA 3KI9A 4KVME 1Z9UA 2ZW5A 3IC1A 4UIBA 4L8AA 3HUVA 4MFJA 3IO1A 1Y0RA 5AGEA 5JPHA 1BPNA 3NA6A 4NJRA 2ARHA 3FEDA 2EWBA 4NJQA 4NFRA 5DWMA 2O28A 4GXHA 1ARLA 4R8FA 1TKFA 2FSRA 5J8CA 3WABA 2AFMA 2IL4A 2R1IA 2R8VA 3H5ZA 1LRZA 5D8NA 2J8NA 4A2ZA 4U9ZA 4A30A 4HPSA 5EMIA 3IIBA 4JJXA 2VZZA 4JWPA 4ZI6A 2IMOA 3CPXA 4QUSA 5AG4A 4M85A 3C26A 4C68A 1X10A 2NSMA 2Q44A 1ZO0A 4R9MA 4KORA 4RS2A 3NH5A 3H8GA 4XNHC 3D7GA 2V8HA 3P2HA 1YW4A 2QMLA 1YGHA 3WR7A 1PU9A 2GIVA 4IUSA 3GB0A 1LAPA 1Z8TA 2EK8A 2BL1A 4UEEA 3ISZA 4RN7A 1Z2LA 5J1QA 1KUYA 3KR5A 5CBMA 3TX8A 2BUEA 1XF8A 4M6GA 3D2MA 5HVGA 2HB6A 3IU2A 3PP9A 3PBEA 1Y9KA 3VARA 2PJ4A 2G9DA 2A4NA 2XEFA 3PFEA 4A95A 4BMHA 5G1ZA 3S6GA 7CPAA 4ZBGA 4CAWA 1HDQA 2J9AA 5DS0A 4H6ZA 3FECA 1Z5RA 2FT0A 1ZLHA 5F46A 1Z4EA 3PFOA 4KZTA 2Q51A 4RI1A 4P45A 2WSAA 2CIJA 5HVFA 2ZOGA 3FXTA 3NH4A 4OIDA 1BLLE 2PC1A 2R7HA 1MJ9A 2EBJA 4AXVA 1MK4A 4OAEA 4B12A 5CPAA 1TKHA 4KUAA 1OBRA 1LFWA 2OR4A 2Z3NA 3H8EA 4WWVA 4ORFA 4C2YA 4HKFA 1IICA 1JWQA 4B5PA 3TE4A 4UFVA 2PDOA 2J8MA 1CG2A 4UBRA 3MN8A 4PK3A 1IIDA 1ZG8A 2WPWA 1YW6A 1KUXA 1BOBA 4BBHA 1QQ9A 5FVJA 5AG5A 1V0CA 2VEZA 5K8MA 4OIWA 4YFJA 1WK4A 1KZFA 2JEWA 1CPXA 1VGYA 3I1UA 2QECA 4I49A 2ANPA 4NXYA 1F2OA 4QVTA 4UA3A 3V38A 5JH9A 1L0CA 2NMTA 1LAMA 1IGBA 2ZELA 4KVXA 4MHPA 4UIAA 2F8HA 2VI7A 1IU8A 2I00A 4UEZA 3DR8A 4P4FA 4EVYA 2Z3KA 2AFOA 5LYIA 1VHEA 2RC4A 5K8OA 2HC9A 2ZEEA 3RO0A 4ZY1A 2PRQA 4H89A 2PJ8A 3A9LA 1GHEA 2Y0MA 4FD7A 4Z65A 3KHXA 4Q7AA 3PZJA 4ZY2A 4Q36A 4MMOA 2PQ8A 1U6MA 2ZEDA 2BCOA 1DTDA 1QSTA 2Q4VA 3WC5A 2DPTA 3SJXA 4G1PA 2CNSA 3FMCA 3FIXA 4X5KA 4B5PB 4B14A 2XEGA 4UCNA 2Q4ZA 5H86A 3LACA 3PB7X 2PIZA 2PE3A 2BEIA 5ELYA 3R1KA 1A2ZA 3FF3A 4NGSA 4KSFA 4O23A 1YVKA 4F0XA 4CS0B 2Z3LA 4HNXB 3V8IA 1TXRA 2VBQA 3IJ3A 3PB4X 1XIXA 1FNOA 4MFPA 2ZEMA 2JBJA 3B3WA 1AMPA 4IF5A 2K5TA 3DR6A 4OADA 1Q2YA 2Z11A 3B2YA 3I3GA 4OMEA 3WC6A 5JGFA 4MCSA 2PJ3A 3R9EA 2GE3A 2YNEA 4CPAA 3R96A 3NFZA 3FRMA 5KTCA 1YREA 3CT9A 2B58A 2HUZA 1IB1E 2PCUA 3KQXA 4KOUA 4CYPA 5C88A 5K8PA 3IWGA 2Q04A 4M6IA 1CPSA 1SQHA 1TF9A 1UWYA 3G8WA 4MRIA 1XRYA 2ODFA 4EWTA 3VATA 1Q2CA 1FT7A 3K9UA 2PVWA 4FUUA 1J4JA 2NYQA 4R6TA 5IB0A 5F49A 5THWA 2GANA 3BI0A 4CAFA 8CPAA 2WZNA 1RTQA 3PRTA 4ZGYB 1VHSA 3TC8A 1VKCA 1VIXA 2PJBA 3FJUA 4ONWA 4R7MA 3DSBA 4MHNA 4NGNA 4AG9A 3CXSA 2CNMA 4P6YA 4C7IA 4P4EA 2P6EA 4PSXA 5GCNA 2EUIA 3D4UA 4P4IA 5LYLA 4MHDA 2PRBA 4NF1A 1PYTB 4Y49B 4E8OA 2C6GA 3KHZA 4W9YA 4ONUA 1ZG9A 2VZYA 1BAVA 1OZPA 3GUXA 4EMEA 5KTAA 2YGWA 2Q7BA 3TO7A 3V7ZA 2CXAA 1TKJA 4JYWA 1HEEA 4P10A 4GS4A 2AFSA 4F8ZA 2CY2A 3ISXA 2FIWA 4FD4A 2WPXA 4MHZA 4MCRA 3S6HA 3I9SA 5I0CA 5ISVA 2AE6A 3IWEA 4JZ0A 4HNYB 3SJFA 3B3TA 2OU2A 2QVPA 2ZEHA 5H84A 2B3VA 3FVLA 2X7BA 3UY5A 3KKWA 4MY3A 2PJCA 4MJ8A 1CP6A 1YVOA 1RO5A 2P0WA 2DPSA 4IK2A 3CXQA 4CGNA 2G0BA 4QC6A 4EFDA 1B6BA 4UFXA 4A31A 2FCKA 2F7VA 1N71A 4KLVA 4XPDB 1Q7LA 2QJ8A 3F0AA 3K9TA 4FD5A 2PJ0A 3MGDA 3LD2A 3QNVA 2OZGA 4UF4A 2VXKA 4JD6A 2FVGA 4J3GA 1NSAA 4OC0A 4R76A 2BSWA 4OP4A 5CNPA 1IYKA 4OC5A 4WJBA 5BWAB 1BPMA 4L89A 2B5GA 2ZW6A 4CYQA 1CX8A 2WYRA 4F9VA 1QSNA 1XOVA 3DDDA 2EVNA 3VWDA 4PXEA 3S9NA 1LCPA 3F5BA 1EE3P 2RFHA 5KTDA 1AUGA 1MJAA 4B6ZA 1NE9A 4PPZA 2YNDA 1XJOA 2ZEGA 3EFAA 4F0YA 1Y9WA 5E96A 3IWWA 1ZG7A
chains in the Genus database with same CATH topology
3TTHA 2YNCA 4XNHB 2Q4YA 4UCPA 4C2XA 4KOWA 4C7HA 4UWJA 3N7ZA 2D4OA 4Q38A 3P2FA 3E0KA 3OWCA 3W6SA 1S7FA 4B5OA 4DNCA 1P0HA 3VWEA 4AVCA 4JLYA 2FIAA 2CNTA 2B4DA 2B5GB 2HQYA 4H6UA 4CGMA 3G3SA 3IGRA 1I21A 4CRZB 3SXNA 3D2PA 2QIRA 1QSRA 1M4GA 1P4NA 2F5IA 2WUUA 4A32A 4KUBA 4F6AA 3TFYA 3LODA 3NE7A 2OH1A 3QAHA 4CGLA 4UCMA 3H4QA 5G20A 5HH1A 3T90A 3SHPA 4Y49C 1NMTA 1K4JA 2B4DB 2Z3OA 5A28A 4M3SA 5HMNA 1B87A 2FXFA 3GYAA 2JDCA 1XMTA 2Z3MA 3R95A 3FBUA 4CGOA 4CGPA 2R98A 4R3LA 5AG6A 3TO6A 5F47A 2OZUA 3RYOA 3QB8A 2G3TA 1QSMA 1XE4A 3EY5A 2JLMA 4FD6A 4UFWA 4MI4A 2FS5A 4B11A 3R9FA 1M4IA 2JEVA 4K30A 4XPDC 1CJWA 3S6FA 2OB0A 1MJBA 2I79A 4B10A 2ZPAA 4KOTA 4KOYA 4KLWA 4NCZA 2ATRA 5F48A 1YX0A 2ZW7A 4MFZA 1PUAA 3EC4A 4MFLA 4LX9A 2PR8A 3BJ7A 2VQYA 1S3ZA 3GY9A 4QB9A 3ZJ0A 1S60A 4UWIA 3TO9A 2J8RA 1WWZA 4LUAA 3W6XA 1Y7RA 2G3AA 4AVAA 4CRYB 2P6GA 4AVBA 5A27A 1NSLA 4C2ZA 4NSQA 1S7LA 4JXRA 3EXNA 3R9GA 3GKRA 1YLEA 4R57A 3JUWA 2ZW4A 4QBJA 4XPKA 2FE7A 2REEA 4XPLA 2PR1A 1QSOA 2ZXVA 5G22A 4MBUA 4PK2A 4PSWA 3BLNA 3TOBA 4CYNA 4OLLA 3IU1A 1I1DA 3W91A 2DXQA 2H5MA 3D3SA 4KOSA 3BJ8A 5AG7A 3S6KA 3FYNA 1ON0A 2YNCC 5DWNA 4II9A 1KUVA 1S7KA 3TOAA 4R3KA 1IYLA 2AJ6A 2D4PA 5IX3A 4CAVA 3T9YA 1RXTA 2OZHA 5J8FA 3TT2A 3FNCA 4MY0A 4CAXA 1BO4A 4E2AA 4E0AA 4AB7A 2Z3PA 2HV2A 2REFA 4KSAA 1Z4RA 2P6FA 2PSWA 3ZZIA 2FL4A 3FB3A 3SXOA 1FY7A 5C82A 2Q0YA 4YGOA 4PV6A 3D8PA 1R57A 1TIQA 4U5YA 4AG7A 4CYOA 1M4DA 3JTKA 4A33A 4KOXA 1YR0A 4JXQA 4HNWB 4MFKA 5EC4A 1S5KA 4KVOE 4B13A 2JDDA 5G21A 1YK3A 3EO4A 3PGPA 2KCWA 2Z10A 1Q2DA 5JQ4A 2B3UA 4KS9A 2B4BA 2C27A 4R87A 4MFQA 1M44A 1CM0A 3B8GA 4NEXA 1I12A 1UFHA 4KOVA 1XEBA 5IV0A 2Z0ZA 3F8KA 3JVNA 1M1DA 1S7NA 4U9YA 3DNSA 4CAEA 4YRHA 5EBVA 3CXPA 3TCVA 4KVME 1Z9UA 2ZW5A 4L8AA 4MFJA 5AGEA 5JPHA 2ARHA 5DWMA 2O28A 2FSRA 5J8CA 2IL4A 2R1IA 2R8VA 3H5ZA 4A2ZA 1LRZA 2J8NA 4U9ZA 4A30A 4JJXA 2VZZA 4JWPA 4QUSA 5AG4A 4M85A 3C26A 4C68A 2Q44A 1ZO0A 4R9MA 4KORA 4RS2A 4XNHC 3P2HA 2QMLA 1YGHA 3WR7A 1PU9A 2GIVA 4IUSA 2BL1A 1KUYA 2BUEA 1XF8A 3D2MA 3IU2A 3PP9A 1Y9KA 2A4NA 4A95A 4BMHA 5G1ZA 3S6GA 4ZBGA 4CAWA 4H6ZA 2FT0A 5F46A 1Z4EA 4KZTA 4RI1A 2WSAA 3FXTA 2PC1A 2R7HA 1MJ9A 1MK4A 4OAEA 4B12A 4KUAA 2Z3NA 4ORFA 4C2YA 4HKFA 1IICA 4B5PA 3TE4A 4UFVA 2PDOA 2J8MA 4UBRA 4PK3A 1IIDA 2WPWA 1KUXA 1BOBA 4BBHA 5FVJA 5AG5A 1V0CA 2VEZA 4YFJA 1WK4A 1KZFA 4QVTA 2QECA 4I49A 4NXYA 4UA3A 1L0CA 2NMTA 4KVXA 2VI7A 2I00A 4EVYA 3DR8A 2Z3KA 2RC4A 4H89A 3A9LA 1GHEA 2Y0MA 4FD7A 3PZJA 4Q36A 2PQ8A 1U6MA 1QSTA 2Q4VA 2DPTA 2CNSA 4B5PB 3FIXA 4X5KA 4B14A 4UCNA 5H86A 2BEIA 3R1KA 4KSFA 1YVKA 4F0XA 4CS0B 2Z3LA 4HNXB 3V8IA 2VBQA 1XIXA 4MFPA 4IF5A 2K5TA 3DR6A 4OADA 1Q2YA 2Z11A 3I3GA 3R9EA 2GE3A 2YNEA 5KTCA 3R96A 3FRMA 1YREA 2B58A 2HUZA 1IB1E 4CYPA 4KOUA 5C88A 3IWGA 2Q04A 1SQHA 3G8WA 1Q2CA 3K9UA 1J4JA 5IB0A 5F49A 4CAFA 2GANA 4ZGYB 1VHSA 1VKCA 4AG9A 3DSBA 3CXSA 2CNMA 4C7IA 2P6EA 4PSXA 5GCNA 2EUIA 4MHDA 2PRBA 4NF1A 4Y49B 4E8OA 4ONUA 2VZYA 1OZPA 5KTAA 2YGWA 2Q7BA 3TO7A 2CXAA 4GS4A 2CY2A 2FIWA 4FD4A 2WPXA 5ISVA 3S6HA 5I0CA 3I9SA 2AE6A 3IWEA 4HNYB 2OU2A 5H84A 2B3VA 2X7BA 3UY5A 3KKWA 4MY3A 4MJ8A 1YVOA 1RO5A 2P0WA 2DPSA 3CXQA 4CGNA 2G0BA 4QC6A 1B6BA 4UFXA 4A31A 2FCKA 4KLVA 1N71A 4XPDB 3F0AA 4FD5A 3MGDA 3LD2A 2OZGA 2VXKA 4JD6A 4J3GA 2BSWA 5CNPA 1IYKA 5BWAB 4L89A 2B5GA 2ZW6A 4CYQA 1QSNA 3DDDA 2EVNA 3VWDA 3F5BA 5KTDA 1MJAA 1NE9A 2YNDA 3EFAA 4F0YA 1Y9WA 5E96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTH A;  4XNH B;  2Q4Y A;  4KOW A;  4UWJ A;  3N7Z A;  2D4O A;  3P2F A;  3E0K A;  3OWC A;  3W6S A;  1S7F A;  4B5O A;  4DNC A;  1P0H A;  3VWE A;  4AVC A;  4JLY A;  2FIA A;  2CNT A;  2B4D A;  2B5G B;  2HQY A;  4H6U A;  3G3S A;  3IGR A;  1I21 A;  4CRZ B;  3SXN A;  3D2P A;  2QIR A;  1QSR A;  1M4G A;  1P4N A;  2F5I A;  4KUB A;  4F6A A;  3TFY A;  3LOD A;  3NE7 A;  2OH1 A;  3QAH A;  3H4Q A;  5HH1 A;  3T90 A;  3SHP A;  4Y49 C;  1NMT A;  1K4J A;  2B4D B;  4M3S A;  5HMN A;  1B87 A;  2FXF A;  2JDC A;  1XMT A;  3GYA A;  3R95 A;  3FBU A;  2R98 A;  4R3L A;  3TO6 A;  5F47 A;  2OZU A;  3RYO A;  3QB8 A;  2G3T A;  1QSM A;  1XE4 A;  3EY5 A;  2JLM A;  4FD6 A;  4MI4 A;  2FS5 A;  3R9F A;  1M4I A;  2JEV A;  4K30 A;  4XPD C;  1CJW A;  3S6F A;  2OB0 A;  1MJB A;  2I79 A;  2ZPA A;  4KOT A;  4KOY A;  4KLW A;  4NCZ A;  2ATR A;  5F48 A;  1YX0 A;  2ZW7 A;  1PUA A;  3EC4 A;  4LX9 A;  2PR8 A;  3BJ7 A;  2VQY A;  1S3Z A;  3GY9 A;  4QB9 A;  3ZJ0 A;  1S60 A;  4UWI A;  3TO9 A;  2J8R A;  1WWZ A;  4LUA A;  3W6X A;  1Y7R A;  2G3A A;  4AVA A;  4CRY B;  2P6G A;  4AVB A;  1NSL A;  4NSQ A;  1S7L A;  4JXR A;  3EXN A;  3R9G A;  3GKR A;  1YLE A;  4R57 A;  3JUW A;  2ZW4 A;  4QBJ A;  4XPK A;  2FE7 A;  2REE A;  4XPL A;  2PR1 A;  1QSO A;  2ZXV A;  4MBU A;  4PK2 A;  4PSW A;  3BLN A;  3TOB A;  4OLL A;  1I1D A;  3W91 A;  2DXQ A;  2H5M A;  3D3S A;  4KOS A;  3BJ8 A;  3S6K A;  3FYN A;  1ON0 A;  5DWN A;  4II9 A;  1KUV A;  1S7K A;  3TOA A;  4R3K A;  1IYL A;  2AJ6 A;  2D4P A;  5IX3 A;  4CAV A;  3T9Y A;  1RXT A;  2OZH A;  5J8F A;  3TT2 A;  3FNC A;  4MY0 A;  4CAX A;  1BO4 A;  4E2A A;  4E0A A;  4AB7 A;  2HV2 A;  2REF A;  1Z4R A;  2P6F A;  2PSW A;  3ZZI A;  2FL4 A;  3FB3 A;  3SXO A;  1FY7 A;  5C82 A;  2Q0Y A;  4YGO A;  4PV6 A;  3D8P A;  1R57 A;  1TIQ A;  4U5Y A;  4AG7 A;  1M4D A;  4KOX A;  1YR0 A;  4JXQ A;  4HNW B;  5EC4 A;  1S5K A;  4KVO E;  2JDD A;  1YK3 A;  3EO4 A;  3PGP A;  2KCW A;  2Z10 A;  1Q2D A;  5JQ4 A;  2B3U A;  2B4B A;  2C27 A;  4R87 A;  1M44 A;  1CM0 A;  3B8G A;  4NEX A;  1I12 A;  1UFH A;  4KOV A;  1XEB A;  5IV0 A;  2Z0Z A;  3F8K A;  3JVN A;  1M1D A;  1S7N A;  4U9Y A;  3DNS A;  4YRH A;  5EBV A;  3CXP A;  3TCV A;  4KVM E;  1Z9U A;  2ZW5 A;  4L8A A;  5JPH A;  2ARH A;  5DWM A;  2O28 A;  2FSR A;  5J8C A;  2IL4 A;  2R1I A;  2R8V A;  1LRZ A;  2J8N A;  4U9Z A;  4JJX A;  2VZZ A;  4JWP A;  4QUS A;  4M85 A;  3C26 A;  2Q44 A;  4RS2 A;  4R9M A;  4KOR A;  4XNH C;  3P2H A;  2QML A;  1YGH A;  3WR7 A;  1PU9 A;  2GIV A;  4IUS A;  2BL1 A;  1KUY A;  2BUE A;  1XF8 A;  3D2M A;  3PP9 A;  1Y9K A;  2A4N A;  4BMH A;  3S6G A;  4ZBG A;  4CAW A;  4H6Z A;  2FT0 A;  5F46 A;  1Z4E A;  4KZT A;  4RI1 A;  3FXT A;  2PC1 A;  2R7H A;  1MJ9 A;  1MK4 A;  4OAE A;  4KUA A;  4ORF A;  4HKF A;  1IIC A;  4B5P A;  3TE4 A;  2PDO A;  2J8M A;  4UBR A;  4PK3 A;  1IID A;  2WPW A;  1KUX A;  1BOB A;  5FVJ A;  1V0C A;  2VEZ A;  4YFJ A;  1WK4 A;  1KZF A;  4QVT A;  2QEC A;  4I49 A;  4NXY A;  4UA3 A;  1L0C A;  2NMT A;  4KVX A;  2VI7 A;  2I00 A;  4EVY A;  3DR8 A;  2RC4 A;  4H89 A;  1GHE A;  2Y0M A;  4FD7 A;  3PZJ A;  2PQ8 A;  1U6M A;  1QST A;  2Q4V A;  2CNS A;  4B5P B;  3FIX A;  4X5K A;  5H86 A;  2BEI A;  3R1K A;  1YVK A;  4CS0 B;  4HNX B;  3V8I A;  2VBQ A;  1XIX A;  4IF5 A;  2K5T A;  3DR6 A;  4OAD A;  1Q2Y A;  2Z11 A;  3I3G A;  3R9E A;  2GE3 A;  5KTC A;  3R96 A;  3FRM A;  1YRE A;  2B58 A;  2HUZ A;  1IB1 E;  4KOU A;  5C88 A;  3IWG A;  2Q04 A;  1SQH A;  3G8W A;  1Q2C A;  3K9U A;  1J4J A;  5IB0 A;  5F49 A;  2GAN A;  1VHS A;  1VKC A;  4AG9 A;  3DSB A;  3CXS A;  2CNM A;  2P6E A;  4PSX A;  5GCN A;  2EUI A;  4MHD A;  2PRB A;  4NF1 A;  4Y49 B;  4E8O A;  4ONU A;  2VZY A;  1OZP A;  5KTA A;  2Q7B A;  3TO7 A;  4GS4 A;  2CY2 A;  2FIW A;  4FD4 A;  2WPX A;  5ISV A;  3S6H A;  5I0C A;  3I9S A;  2AE6 A;  4HNY B;  2OU2 A;  5H84 A;  2B3V A;  2X7B A;  3UY5 A;  3KKW A;  4MY3 A;  4MJ8 A;  1YVO A;  1RO5 A;  2P0W A;  3CXQ A;  2G0B A;  4QC6 A;  1B6B A;  2FCK A;  4KLV A;  1N71 A;  4XPD B;  3F0A A;  4FD5 A;  3MGD A;  3LD2 A;  2OZG A;  2VXK A;  4JD6 A;  4J3G A;  2BSW A;  5CNP A;  1IYK A;  4L89 A;  2B5G A;  2ZW6 A;  1QSN A;  3DDD A;  2EVN A;  3VWD A;  3F5B A;  5KTD A;  1MJA A;  1NE9 A;  3EFA A;  4F0Y A;  1Y9W A;  5E96 A; 
#chains in the Genus database with same CATH topology
 3VH9 A;  3NH8 A;  3TTH A;  2YNC A;  4XNH B;  4NGQ A;  2Q4Y A;  4UCP A;  4YWY A;  3N5F A;  4KOW A;  4UWJ A;  3RZA A;  4X3R A;  4C2X A;  3N7Z A;  4C7H A;  2D4O A;  1LOK A;  4Q38 A;  4A38 A;  3P2F A;  3E0K A;  3OWC A;  3D67 A;  3IEH A;  3W6S A;  4RUH A;  1S7F A;  4BD9 A;  3FX6 A;  4B5O A;  6CPA A;  2ZEO A;  4DNC A;  1P0H A;  3FEE A;  3D7H A;  3VWE A;  4AVC A;  4JLY A;  1XBU A;  2FIA A;  2CNT A;  2B4D A;  2B5G B;  1F2P A;  2HQY A;  3KR4 A;  4H6U A;  4CGM A;  3KZW A;  4ZX9 A;  2AFZ A;  4MXU A;  1KWM A;  3G3S A;  1R43 A;  3IGR A;  1I21 A;  4CRZ B;  1M4L A;  2CTC A;  3D2P A;  4OC3 A;  3SXN A;  2QIR A;  1QSR A;  2ZEF A;  5F09 A;  1M4G A;  1P4N A;  2F5I A;  4PXD A;  2C1C A;  3BHX A;  1R3N A;  2WUU A;  1LAN A;  1IY7 A;  1H8L A;  1YQE A;  3SI0 A;  3PB6 X;  4A32 A;  4KUB A;  2PVV A;  4F6A A;  3TFY A;  3LOD A;  3NE7 A;  2OH1 A;  3CZX A;  4K3N A;  2V8D A;  3QAH A;  3RAM A;  4CGL A;  2CTB A;  4UCM A;  3H4Q A;  5G20 A;  4BIN A;  4DJL A;  5HH1 A;  2V8V A;  3T90 A;  2AFW A;  4OKO A;  4MCQ A;  3SHP A;  4FBE A;  3SJE A;  4Y49 C;  4OC1 A;  1CP7 A;  1NMT A;  1K4J A;  4ZYQ A;  5HXD A;  2O4H A;  2B4D B;  2Z3O A;  3D7F A;  4M3S A;  5A28 A;  3WT4 A;  4GM5 A;  5HMN A;  1B87 A;  2FXF A;  2JDC A;  1XMT A;  1XFO A;  3GYA A;  4P4B A;  4DUK A;  2Z3M A;  3B7I A;  4F9U A;  3R95 A;  3FBU A;  1XMB A;  4CGO A;  3SI2 A;  1VHO A;  4CGP A;  4ZY0 A;  4DYO A;  2R98 A;  1YSJ A;  4R3L A;  5AG6 A;  3B3S A;  5F47 A;  3TO6 A;  2OZU A;  3RYO A;  3QB8 A;  2G3T A;  1QSM A;  1XE4 A;  3EY5 A;  3QAY A;  2JLM A;  5LYD A;  4FD6 A;  4UFW A;  1IOF A;  2FS5 A;  4MI4 A;  3R9F A;  4B11 A;  1M4I A;  2JEV A;  2ZEP A;  5LYF A;  3BXM A;  1ZLI A;  2PJ2 A;  4K30 A;  1DE4 C;  4XPD C;  2PJ9 A;  3S9M A;  1CJW A;  2GRE A;  3HLP A;  3S6F A;  3RBU A;  2OB0 A;  2ABZ A;  1MJB A;  2I79 A;  4B10 A;  2ZPA A;  1Z8X A;  4KOT A;  4KOY A;  5LRG A;  4KLW A;  1ARM A;  4NCZ A;  4H2K A;  2ATR A;  5F48 A;  2ZEN A;  1YX0 A;  2ZW7 A;  1YME A;  4MFZ A;  3KGQ A;  1PUA A;  3EC4 A;  4MFL A;  4TWE A;  1QMU A;  2PR8 A;  1TF8 A;  2VQY A;  3BJ7 A;  4LX9 A;  4LQG A;  1Z8L A;  1S3Z A;  3CPA A;  3GY9 A;  4QB9 A;  3ZJ0 A;  1S60 A;  2PJ1 A;  4UWI A;  1IOI A;  3B3C A;  3TO9 A;  5I4M A;  2J8R A;  2GLJ A;  1WWZ A;  1HDU A;  2GLF A;  4LUA A;  3W6X A;  1Y7R A;  2G3A A;  4AVA A;  4CRY B;  2AFU A;  4MCP A;  2PJ7 A;  4A39 A;  4P4D A;  2GFQ A;  2P6G A;  4AVB A;  3KQZ A;  5A27 A;  2DEA A;  1NSL A;  3K2K A;  3LWU A;  2ZOF A;  4C2Z A;  2JBK A;  4NSQ A;  1S7L A;  4JXR A;  2XEI A;  3EXN A;  1ELL P;  3R9G A;  3GKR A;  1YLE A;  4R57 A;  3JUW A;  4A94 A;  4FWU A;  2ZW4 A;  3BI1 A;  4PXC A;  4QBJ A;  4XPK A;  2FE7 A;  2QYV A;  2REE A;  4XPL A;  2PR1 A;  1QSO A;  2ZXV A;  5G22 A;  4MBU A;  2IQ6 A;  4PK2 A;  4PSW A;  4P4J A;  3BLN A;  3B35 A;  3TOB A;  2EO8 A;  4CYN A;  4OLL A;  4M6H A;  3MRU A;  3LMS A;  3IU1 A;  1I1D A;  2BO9 A;  3W91 A;  2DXQ A;  2H5M A;  1JQG A;  3D3S A;  3PB9 X;  4KOS A;  3BJ8 A;  5D29 A;  1F57 A;  3GIU A;  4ZX8 A;  1CBX A;  5LRK A;  2CF4 A;  4KSI A;  3DGV A;  2AFX A;  2C6P A;  5AG7 A;  5LRJ A;  3S6K A;  3FYN A;  1ON0 A;  2YNC C;  5DWN A;  4II9 A;  3SI1 A;  1KUV A;  2Q7S A;  1S7K A;  3TOA A;  4OC4 A;  1GYT A;  2V77 A;  4R3K A;  1IYL A;  2AJ6 A;  2D4P A;  4TNU A;  5IX3 A;  2PJ6 A;  4CAV A;  2BOA A;  3T9Y A;  1RXT A;  2OZH A;  4NGM A;  5J8F A;  3TT2 A;  3FNC A;  4MY0 A;  4A37 A;  4CAX A;  1BO4 A;  4X2T A;  4E2A A;  4E0A A;  4NGP A;  3D66 A;  3PB8 X;  4AB7 A;  2Z3P A;  2HV2 A;  2REF A;  4KSA A;  1Z4R A;  2POK A;  2XEJ A;  2PIY A;  3KL9 A;  5JM6 A;  2PJA A;  2P6F A;  2GU2 A;  2PSW A;  2FL4 A;  3ZZI A;  3FB3 A;  3SXO A;  1FY7 A;  4MHY A;  3S9L A;  5C82 A;  2Q0Y A;  1AYE A;  4PV6 A;  4YGO A;  4FAI A;  3D8P A;  4P44 A;  1R57 A;  1TIQ A;  4U5Y A;  5HVH A;  4AG7 A;  4CYO A;  1M4D A;  4UEF A;  2DF5 A;  3JTK A;  3WC7 A;  4IAV A;  2EK9 A;  4A33 A;  4NGT A;  3D7D A;  4KOX A;  1YR0 A;  2VL1 A;  4NGR A;  1ELM P;  4JXQ A;  4HNW B;  4MFK A;  1Z8W A;  4LQ6 A;  3GLJ A;  5K8N A;  2I3C A;  5EC4 A;  3SJG A;  3B3V A;  1S5K A;  4X8I A;  4KVO E;  4B13 A;  4YU9 A;  2PJ5 A;  2V8G A;  2JDD A;  5G21 A;  3IFE A;  1YK3 A;  3EO4 A;  2Q43 A;  3T8W A;  2RB7 A;  3PGP A;  2KCW A;  2Z10 A;  3L2N A;  1Q2D A;  3D68 A;  5JQ4 A;  1Y7E A;  2B3U A;  4KS9 A;  2B4B A;  2C27 A;  3NE8 A;  1Y0Y A;  4OC2 A;  4R87 A;  3PEI A;  4MFQ A;  1M44 A;  1CM0 A;  3FH4 A;  3B8G A;  5IB9 A;  4NEX A;  1I12 A;  1UFH A;  4KOV A;  1YLO A;  1XEB A;  3H8F A;  2Z0Z A;  2C6C A;  3F8K A;  4PXB A;  3PBB A;  3JVN A;  5IV0 A;  3CDX A;  1M1D A;  1S7N A;  4IHM A;  3JRU A;  4U9Y A;  3RNZ A;  1PCA A;  1X12 A;  3DNS A;  4CAE A;  4YRH A;  5EBV A;  3KAS A;  3CXP A;  4PQA A;  2IJZ A;  2O53 A;  2OOT A;  3DLJ A;  3TCV A;  3KI9 A;  4KVM E;  1Z9U A;  2ZW5 A;  3IC1 A;  4UIB A;  4L8A A;  3HUV A;  4MFJ A;  3IO1 A;  1Y0R A;  5AGE A;  5JPH A;  1BPN A;  3NA6 A;  4NJR A;  2ARH A;  3FED A;  2EWB A;  4NJQ A;  4NFR A;  5DWM A;  2O28 A;  4GXH A;  1ARL A;  4R8F A;  1TKF A;  2FSR A;  5J8C A;  3WAB A;  2AFM A;  2IL4 A;  2R1I A;  2R8V A;  3H5Z A;  1LRZ A;  5D8N A;  2J8N A;  4A2Z A;  4U9Z A;  4A30 A;  4HPS A;  5EMI A;  3IIB A;  4JJX A;  2VZZ A;  4JWP A;  4ZI6 A;  2IMO A;  3CPX A;  4QUS A;  5AG4 A;  4M85 A;  3C26 A;  4C68 A;  1X10 A;  2NSM A;  2Q44 A;  1ZO0 A;  4R9M A;  4KOR A;  4RS2 A;  3NH5 A;  3H8G A;  4XNH C;  3D7G A;  2V8H A;  3P2H A;  1YW4 A;  2QML A;  1YGH A;  3WR7 A;  1PU9 A;  2GIV A;  4IUS A;  3GB0 A;  1LAP A;  1Z8T A;  2EK8 A;  2BL1 A;  4UEE A;  3ISZ A;  4RN7 A;  1Z2L A;  5J1Q A;  1KUY A;  3KR5 A;  5CBM A;  3TX8 A;  2BUE A;  1XF8 A;  4M6G A;  3D2M A;  5HVG A;  2HB6 A;  3IU2 A;  3PP9 A;  3PBE A;  1Y9K A;  3VAR A;  2PJ4 A;  2G9D A;  2A4N A;  2XEF A;  3PFE A;  4A95 A;  4BMH A;  5G1Z A;  3S6G A;  7CPA A;  4ZBG A;  4CAW A;  1HDQ A;  2J9A A;  5DS0 A;  4H6Z A;  3FEC A;  1Z5R A;  2FT0 A;  1ZLH A;  5F46 A;  1Z4E A;  3PFO A;  4KZT A;  2Q51 A;  4RI1 A;  4P45 A;  2WSA A;  2CIJ A;  5HVF A;  2ZOG A;  3FXT A;  3NH4 A;  4OID A;  1BLL E;  2PC1 A;  2R7H A;  1MJ9 A;  2EBJ A;  4AXV A;  1MK4 A;  4OAE A;  4B12 A;  5CPA A;  1TKH A;  4KUA A;  1OBR A;  1LFW A;  2OR4 A;  2Z3N A;  3H8E A;  4WWV A;  4ORF A;  4C2Y A;  4HKF A;  1IIC A;  1JWQ A;  4B5P A;  3TE4 A;  4UFV A;  2PDO A;  2J8M A;  1CG2 A;  4UBR A;  3MN8 A;  4PK3 A;  1IID A;  1ZG8 A;  2WPW A;  1YW6 A;  1KUX A;  1BOB A;  4BBH A;  1QQ9 A;  5FVJ A;  5AG5 A;  1V0C A;  2VEZ A;  5K8M A;  4OIW A;  4YFJ A;  1WK4 A;  1KZF A;  2JEW A;  1CPX A;  1VGY A;  3I1U A;  2QEC A;  4I49 A;  2ANP A;  4NXY A;  1F2O A;  4QVT A;  4UA3 A;  3V38 A;  5JH9 A;  1L0C A;  2NMT A;  1LAM A;  1IGB A;  2ZEL A;  4KVX A;  4MHP A;  4UIA A;  2F8H A;  2VI7 A;  1IU8 A;  2I00 A;  4UEZ A;  3DR8 A;  4P4F A;  4EVY A;  2Z3K A;  2AFO A;  5LYI A;  1VHE A;  2RC4 A;  5K8O A;  2HC9 A;  2ZEE A;  3RO0 A;  4ZY1 A;  2PRQ A;  4H89 A;  2PJ8 A;  3A9L A;  1GHE A;  2Y0M A;  4FD7 A;  4Z65 A;  3KHX A;  4Q7A A;  3PZJ A;  4ZY2 A;  4Q36 A;  4MMO A;  2PQ8 A;  1U6M A;  2ZED A;  2BCO A;  1DTD A;  1QST A;  2Q4V A;  3WC5 A;  2DPT A;  3SJX A;  4G1P A;  2CNS A;  3FMC A;  3FIX A;  4X5K A;  4B5P B;  4B14 A;  2XEG A;  4UCN A;  2Q4Z A;  5H86 A;  3LAC A;  3PB7 X;  2PIZ A;  2PE3 A;  2BEI A;  5ELY A;  3R1K A;  1A2Z A;  3FF3 A;  4NGS A;  4KSF A;  4O23 A;  1YVK A;  4F0X A;  4CS0 B;  2Z3L A;  4HNX B;  3V8I A;  1TXR A;  2VBQ A;  3IJ3 A;  3PB4 X;  1XIX A;  1FNO A;  4MFP A;  2ZEM A;  2JBJ A;  3B3W A;  1AMP A;  4IF5 A;  2K5T A;  3DR6 A;  4OAD A;  1Q2Y A;  2Z11 A;  3B2Y A;  3I3G A;  4OME A;  3WC6 A;  5JGF A;  4MCS A;  2PJ3 A;  3R9E A;  2GE3 A;  2YNE A;  4CPA A;  3R96 A;  3NFZ A;  3FRM A;  5KTC A;  1YRE A;  3CT9 A;  2B58 A;  2HUZ A;  1IB1 E;  2PCU A;  3KQX A;  4KOU A;  4CYP A;  5C88 A;  5K8P A;  3IWG A;  2Q04 A;  4M6I A;  1CPS A;  1SQH A;  1TF9 A;  1UWY A;  3G8W A;  4MRI A;  1XRY A;  2ODF A;  4EWT A;  3VAT A;  1Q2C A;  1FT7 A;  3K9U A;  2PVW A;  4FUU A;  1J4J A;  2NYQ A;  4R6T A;  5IB0 A;  5F49 A;  5THW A;  2GAN A;  3BI0 A;  4CAF A;  8CPA A;  2WZN A;  1RTQ A;  3PRT A;  4ZGY B;  1VHS A;  3TC8 A;  1VKC A;  1VIX A;  2PJB A;  3FJU A;  4ONW A;  4R7M A;  3DSB A;  4MHN A;  4NGN A;  4AG9 A;  3CXS A;  2CNM A;  4P6Y A;  4C7I A;  4P4E A;  2P6E A;  4PSX A;  5GCN A;  2EUI A;  3D4U A;  4P4I A;  5LYL A;  4MHD A;  2PRB A;  4NF1 A;  1PYT B;  4Y49 B;  4E8O A;  2C6G A;  3KHZ A;  4W9Y A;  4ONU A;  1ZG9 A;  2VZY A;  1BAV A;  1OZP A;  3GUX A;  4EME A;  5KTA A;  2YGW A;  2Q7B A;  3TO7 A;  3V7Z A;  2CXA A;  1TKJ A;  4JYW A;  1HEE A;  4P10 A;  4GS4 A;  2AFS A;  4F8Z A;  2CY2 A;  3ISX A;  2FIW A;  4FD4 A;  2WPX A;  4MHZ A;  4MCR A;  3S6H A;  3I9S A;  5I0C A;  5ISV A;  2AE6 A;  3IWE A;  4JZ0 A;  4HNY B;  3SJF A;  3B3T A;  2OU2 A;  2QVP A;  2ZEH A;  5H84 A;  2B3V A;  3FVL A;  2X7B A;  3UY5 A;  3KKW A;  4MY3 A;  2PJC A;  4MJ8 A;  1CP6 A;  1YVO A;  1RO5 A;  2P0W A;  2DPS A;  4IK2 A;  3CXQ A;  4CGN A;  2G0B A;  4QC6 A;  4EFD A;  1B6B A;  4UFX A;  4A31 A;  2FCK A;  2F7V A;  1N71 A;  4KLV A;  4XPD B;  1Q7L A;  2QJ8 A;  3F0A A;  3K9T A;  4FD5 A;  2PJ0 A;  3MGD A;  3LD2 A;  3QNV A;  2OZG A;  4UF4 A;  2VXK A;  4JD6 A;  2FVG A;  4J3G A;  1NSA A;  4OC0 A;  4R76 A;  2BSW A;  4OP4 A;  5CNP A;  1IYK A;  4OC5 A;  4WJB A;  5BWA B;  1BPM A;  4L89 A;  2B5G A;  2ZW6 A;  4CYQ A;  1CX8 A;  2WYR A;  4F9V A;  1QSN A;  1XOV A;  3DDD A;  2EVN A;  3VWD A;  4PXE A;  3S9N A;  1LCP A;  3F5B A;  1EE3 P;  2RFH A;  5KTD A;  1AUG A;  1MJA A;  4B6Z A;  1NE9 A;  4PPZ A;  2YND A;  1XJO A;  2ZEG A;  3EFA A;  4F0Y A;  1Y9W A;  5E96 A;  3IWW A;  1ZG7 A; 
#chains in the Genus database with same CATH homology
 3TTH A;  2YNC A;  4XNH B;  2Q4Y A;  4UCP A;  4C2X A;  4KOW A;  4C7H A;  4UWJ A;  3N7Z A;  2D4O A;  4Q38 A;  3P2F A;  3E0K A;  3OWC A;  3W6S A;  1S7F A;  4B5O A;  4DNC A;  1P0H A;  3VWE A;  4AVC A;  4JLY A;  2FIA A;  2CNT A;  2B4D A;  2B5G B;  2HQY A;  4H6U A;  4CGM A;  3G3S A;  3IGR A;  1I21 A;  4CRZ B;  3SXN A;  3D2P A;  2QIR A;  1QSR A;  1M4G A;  1P4N A;  2F5I A;  2WUU A;  4A32 A;  4KUB A;  4F6A A;  3TFY A;  3LOD A;  3NE7 A;  2OH1 A;  3QAH A;  4CGL A;  4UCM A;  3H4Q A;  5G20 A;  5HH1 A;  3T90 A;  3SHP A;  4Y49 C;  1NMT A;  1K4J A;  2B4D B;  2Z3O A;  5A28 A;  4M3S A;  5HMN A;  1B87 A;  2FXF A;  3GYA A;  2JDC A;  1XMT A;  2Z3M A;  3R95 A;  3FBU A;  4CGO A;  4CGP A;  2R98 A;  4R3L A;  5AG6 A;  3TO6 A;  5F47 A;  2OZU A;  3RYO A;  3QB8 A;  2G3T A;  1QSM A;  1XE4 A;  3EY5 A;  2JLM A;  4FD6 A;  4UFW A;  4MI4 A;  2FS5 A;  4B11 A;  3R9F A;  1M4I A;  2JEV A;  4K30 A;  4XPD C;  1CJW A;  3S6F A;  2OB0 A;  1MJB A;  2I79 A;  4B10 A;  2ZPA A;  4KOT A;  4KOY A;  4KLW A;  4NCZ A;  2ATR A;  5F48 A;  1YX0 A;  2ZW7 A;  4MFZ A;  1PUA A;  3EC4 A;  4MFL A;  4LX9 A;  2PR8 A;  3BJ7 A;  2VQY A;  1S3Z A;  3GY9 A;  4QB9 A;  3ZJ0 A;  1S60 A;  4UWI A;  3TO9 A;  2J8R A;  1WWZ A;  4LUA A;  3W6X A;  1Y7R A;  2G3A A;  4AVA A;  4CRY B;  2P6G A;  4AVB A;  5A27 A;  1NSL A;  4C2Z A;  4NSQ A;  1S7L A;  4JXR A;  3EXN A;  3R9G A;  3GKR A;  1YLE A;  4R57 A;  3JUW A;  2ZW4 A;  4QBJ A;  4XPK A;  2FE7 A;  2REE A;  4XPL A;  2PR1 A;  1QSO A;  2ZXV A;  5G22 A;  4MBU A;  4PK2 A;  4PSW A;  3BLN A;  3TOB A;  4CYN A;  4OLL A;  3IU1 A;  1I1D A;  3W91 A;  2DXQ A;  2H5M A;  3D3S A;  4KOS A;  3BJ8 A;  5AG7 A;  3S6K A;  3FYN A;  1ON0 A;  2YNC C;  5DWN A;  4II9 A;  1KUV A;  1S7K A;  3TOA A;  4R3K A;  1IYL A;  2AJ6 A;  2D4P A;  5IX3 A;  4CAV A;  3T9Y A;  1RXT A;  2OZH A;  5J8F A;  3TT2 A;  3FNC A;  4MY0 A;  4CAX A;  1BO4 A;  4E2A A;  4E0A A;  4AB7 A;  2Z3P A;  2HV2 A;  2REF A;  4KSA A;  1Z4R A;  2P6F A;  2PSW A;  3ZZI A;  2FL4 A;  3FB3 A;  3SXO A;  1FY7 A;  5C82 A;  2Q0Y A;  4YGO A;  4PV6 A;  3D8P A;  1R57 A;  1TIQ A;  4U5Y A;  4AG7 A;  4CYO A;  1M4D A;  3JTK A;  4A33 A;  4KOX A;  1YR0 A;  4JXQ A;  4HNW B;  4MFK A;  5EC4 A;  1S5K A;  4KVO E;  4B13 A;  2JDD A;  5G21 A;  1YK3 A;  3EO4 A;  3PGP A;  2KCW A;  2Z10 A;  1Q2D A;  5JQ4 A;  2B3U A;  4KS9 A;  2B4B A;  2C27 A;  4R87 A;  4MFQ A;  1M44 A;  1CM0 A;  3B8G A;  4NEX A;  1I12 A;  1UFH A;  4KOV A;  1XEB A;  5IV0 A;  2Z0Z A;  3F8K A;  3JVN A;  1M1D A;  1S7N A;  4U9Y A;  3DNS A;  4CAE A;  4YRH A;  5EBV A;  3CXP A;  3TCV A;  4KVM E;  1Z9U A;  2ZW5 A;  4L8A A;  4MFJ A;  5AGE A;  5JPH A;  2ARH A;  5DWM A;  2O28 A;  2FSR A;  5J8C A;  2IL4 A;  2R1I A;  2R8V A;  3H5Z A;  4A2Z A;  1LRZ A;  2J8N A;  4U9Z A;  4A30 A;  4JJX A;  2VZZ A;  4JWP A;  4QUS A;  5AG4 A;  4M85 A;  3C26 A;  4C68 A;  2Q44 A;  1ZO0 A;  4R9M A;  4KOR A;  4RS2 A;  4XNH C;  3P2H A;  2QML A;  1YGH A;  3WR7 A;  1PU9 A;  2GIV A;  4IUS A;  2BL1 A;  1KUY A;  2BUE A;  1XF8 A;  3D2M A;  3IU2 A;  3PP9 A;  1Y9K A;  2A4N A;  4A95 A;  4BMH A;  5G1Z A;  3S6G A;  4ZBG A;  4CAW A;  4H6Z A;  2FT0 A;  5F46 A;  1Z4E A;  4KZT A;  4RI1 A;  2WSA A;  3FXT A;  2PC1 A;  2R7H A;  1MJ9 A;  1MK4 A;  4OAE A;  4B12 A;  4KUA A;  2Z3N A;  4ORF A;  4C2Y A;  4HKF A;  1IIC A;  4B5P A;  3TE4 A;  4UFV A;  2PDO A;  2J8M A;  4UBR A;  4PK3 A;  1IID A;  2WPW A;  1KUX A;  1BOB A;  4BBH A;  5FVJ A;  5AG5 A;  1V0C A;  2VEZ A;  4YFJ A;  1WK4 A;  1KZF A;  4QVT A;  2QEC A;  4I49 A;  4NXY A;  4UA3 A;  1L0C A;  2NMT A;  4KVX A;  2VI7 A;  2I00 A;  4EVY A;  3DR8 A;  2Z3K A;  2RC4 A;  4H89 A;  3A9L A;  1GHE A;  2Y0M A;  4FD7 A;  3PZJ A;  4Q36 A;  2PQ8 A;  1U6M A;  1QST A;  2Q4V A;  2DPT A;  2CNS A;  4B5P B;  3FIX A;  4X5K A;  4B14 A;  4UCN A;  5H86 A;  2BEI A;  3R1K A;  4KSF A;  1YVK A;  4F0X A;  4CS0 B;  2Z3L A;  4HNX B;  3V8I A;  2VBQ A;  1XIX A;  4MFP A;  4IF5 A;  2K5T A;  3DR6 A;  4OAD A;  1Q2Y A;  2Z11 A;  3I3G A;  3R9E A;  2GE3 A;  2YNE A;  5KTC A;  3R96 A;  3FRM A;  1YRE A;  2B58 A;  2HUZ A;  1IB1 E;  4CYP A;  4KOU A;  5C88 A;  3IWG A;  2Q04 A;  1SQH A;  3G8W A;  1Q2C A;  3K9U A;  1J4J A;  5IB0 A;  5F49 A;  4CAF A;  2GAN A;  4ZGY B;  1VHS A;  1VKC A;  4AG9 A;  3DSB A;  3CXS A;  2CNM A;  4C7I A;  2P6E A;  4PSX A;  5GCN A;  2EUI A;  4MHD A;  2PRB A;  4NF1 A;  4Y49 B;  4E8O A;  4ONU A;  2VZY A;  1OZP A;  5KTA A;  2YGW A;  2Q7B A;  3TO7 A;  2CXA A;  4GS4 A;  2CY2 A;  2FIW A;  4FD4 A;  2WPX A;  5ISV A;  3S6H A;  5I0C A;  3I9S A;  2AE6 A;  3IWE A;  4HNY B;  2OU2 A;  5H84 A;  2B3V A;  2X7B A;  3UY5 A;  3KKW A;  4MY3 A;  4MJ8 A;  1YVO A;  1RO5 A;  2P0W A;  2DPS A;  3CXQ A;  4CGN A;  2G0B A;  4QC6 A;  1B6B A;  4UFX A;  4A31 A;  2FCK A;  4KLV A;  1N71 A;  4XPD B;  3F0A A;  4FD5 A;  3MGD A;  3LD2 A;  2OZG A;  2VXK A;  4JD6 A;  4J3G A;  2BSW A;  5CNP A;  1IYK A;  5BWA B;  4L89 A;  2B5G A;  2ZW6 A;  4CYQ A;  1QSN A;  3DDD A;  2EVN A;  3VWD A;  3F5B A;  5KTD A;  1MJA A;  1NE9 A;  2YND A;  3EFA A;  4F0Y A;  1Y9W A;  5E96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...