1IYSA

Crystal structure of class a beta-lactamase toho-1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
b'NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVTHGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TOHO-1
publication title Crystal Structure of Extended-Spectrum beta-Lactamase Toho-1: Insights into the Molecular Mechanism for Catalytic Reaction and Substrate Specificity Expansion
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1iysA00
1XPBA 1E3UA 3OZHA 4UA7A 4ZJ2A 3SS5A 3UNWA 1L0DA 1E4DA 4HEFA 1K57C 2EX9A 1CEFA 3LCEA 2E8IA 3C4OA 5FQKA 2WGVA 4JXWA 5FQ9A 3EQVA 4Z9QA 1L0FA 5D3OA 1PIOA 4E3MA 1G68A 3GMWA 4E6XA 3HLFA 1FR6A 1XX2A 5AQ7A 3AGDA 4EBPA 4S2KA 5A90A 4UA6A 4JF6A 2ZD8A 4OOLA 4LV3A 1K56D 1I2SA 5M1AA 1PZPA 1YLJA 4JXSA 5CGSA 5HAIA 5HFOA 1IKGA 2WGWA 4E3OA 3QNCA 5F1GA 3UPNA 1NZUA 4OVDA 3HL9A 4QY5A 4GB7A 5GHXA 3CG5A 1KGGA 2Y2JA 3IQAA 2Y2NA 3AGFA 4KQRA 1KE3A 1Z6FA 2FFYA 3PBRA 5GLCA 1W7FA 3IWIA 4P6BA 4MBKA 4CPKA 4OPRA 4XUXA 1FR1A 3HUMA 4K91A 1K56A 2WAEA 3GRJA 4JKTA 3ITBA 3ZNYA 4ZAMA 4BL3A 5M19A 2ZM2A 4QHCA 1L0EA 1W79A 2H0TA 1SKFA 4ZBEA 4F94A 4MBFA 2XD5A 3VOZA 5HW3A 4ZJ1A 3ZCZA 4Q8IA 1RGYA 3S1YA 3VP1A 5CTNA 4OOMA 3G30A 3GTCA 5M18A 1LI0A 5F83A 2H0YA 5IHVA 1FCNA 2FFFB 5KSCA 2WZXA 3DWZA 4KZ9A 5E2EA 1YT4A 4BD0A 2Y2OA 2Q9MA 3BFEA 3CJMA 4LCLA 5E2HA 1H8YA 4S2JA 1FQGA 2B5RA 4JF4A 3Q7VA 3G35A 5CEDA 2Y4AA 3WRTA 3MZEA 1YLZA 2P74A 3N6IA 2P9VB 4L0LA 4WZ5A 5FA7A 1K6SA 2ZC3B 1K38A 1ONGA 4OLDA 2Z2MB 2Y2PA 1ES5A 3S22A 3BFCA 1GHMA 5EVIA 3UY6A 4WMCD 5AQBA 1FCOA 1HZOA 1MXOA 2G2WA 3LY3A 4MLLA 3A3FA 1XGIA 3E2KA 1S6RA 3RXXA 1O07A 4OQHA 4Y7PA 4OH0A 3C7UA 4S2OA 4KENB 1W5DA 1ZKJA 3NC8A 3WS1A 2XEPA 4EV4A 1ESIA 4OQGA 3G2ZA 2PU2A 5CECA 5BOHA 3ITAA 2ZM0A 4PM8A 2ZLYA 2WAFA 2ZQAA 3V5MA 4PM5A 4DE0A 3ZHHA 1XP4A 2WKIA 1CI8A 1AXBA 1C3BA 1VQQA 5A93A 3PBTA 1E25A 4M3KA 4U0TA 4GOGA 3MBZA 3GV9A 4X68A 3OPRA 4UA9A 2C6WB 2HPBA 2V1ZA 2Y91A 3NDGA 4KQQA 2HDUA 1JWZA 4KZ3A 2OSUA 5FAPA 2OLUA 2H10A 3IF6A 3HREA 2RCXA 1ERMA 5CHUA 3VOYA 3VP0A 1E3UD 4LENA 4EWFA 3D4FA 5CERA 3IXDA 3ZG8B 1BLCA 1NYMA 2QZ6A 3N8RA 3LEZA 3O3VA 1BLSA 2Y2MA 3VFFA 5CEBA 1IYPA 3PBOA 5EPHA 3Q81A 1I2WA 4JXGA 4RVAA 2HDRA 4BQMA 1KGEA 4U0XA 4DXCA 1XXMA 4OPZA 3NY4A 5FSRA 4EUZA 2ZQ7A 4QB8A 5GHYA 2CC1A 3VP2A 1BLHA 2XD1A 5I94A 5DTKA 5EVLA 1KDWA 4S2IA 4OPQA 3C7VA 3DW0A 3V3RA 4KZ8A 4FH2A 1RCJA 1KGFA 1KVMA 2IWCA 2HDQA 4O7DA 5FASA 1JTGA 4ID4A 3P09A 4RYEA 4U3TA 1NZOA 5TR7A 3V39A 1U60A 3LY4A 4KG2A 4EBLA 3FYZA 5E2GA 4BLMA 3CZDA 5EOOA 1ESUA 1WE4A 4X55A 4HESA 3O87A 1XA1A 3S4XA 4OKPA 1IEMA 4K0XA 1LHYA 5KZHA 2ZC4B 1GHPA 5CGXA 5F82A 4DF6A 3C4PA 4FD8A 5JYOA 2IWDA 2ZC7A 5FAQA 2ZQ8A 5FQJA 1ES4A 1FSYA 1DJBA 1PWDA 3MZFA 5CRFA 4YINA 4C6YA 4R1GA 1L2SA 1QMEA 1XA7A 4UAAA 4WZ5C 3SH9A 2WADA 4N1XA 3W8KA 2VGKA 1K55C 2V2FF 4IBXA 3VFHA 1NXYA 3VSKA 1MWRA 2WKHA 1LL5A 4H8RA 4EQIA 1XGJA 3ZFZA 3N8LA 3BLSA 1LLBA 1MY8A 2EX6A 4LV0A 1H8ZA 3FV7A 5E43A 5DF7A 4MEZA 2P9VA 1EWZA 4N1HA 3TOIA 4OPYA 4R3BA 4A5RA 4DKIA 1JTDA 3Q1FA 3HLCA 4PPRA 2EFUA 1K54A 2IWBA 3SS3A 4S2LA 5EVID 2ZC6B 5KMWA 1KE0A 1K57A 2HDSA 1SCWA 2V20A 3RXWA 3UPPA 1YLYA 3OPPA 2EFXA 4Y0TA 2Y55A 1RGZA 3B3XA 4OQIA 1TEMA 2Z2LB 3GVBA 2WYXA 4GKUA 2Y2HA 2J7VA 5TGFA 4KZ5A 4E3JA 2J9PA 3SH8A 3TG9A 4XUZA 3V3SA 2J8YA 1YM1A 3M6HA 3IXBA 4X69A 3N7WA 5AQAA 1N9BA 1MWSA 3Q7ZA 1MBLA 3OPHA 5CTMA 1PI5A 4JBFA 1GCEA 3G32A 5FI7A 2BLSA 1PWGA 2A49A 1BTLA 3ZVWA 3UE3A 1LL9A 3MXRA 2VGJA 2R9XA 4ZJ3A 1MWTA 4N9LA 1JWPA 2BG1A 4GN2A 1TDGA 1WYBA 4JF5A 3IHAA 4DDYA 1RP5A 5EE8A 3HLGA 3PTEA 5FQQA 3OCLA 4R3JA 4N92A 3HLDA 3PBQA 4RA7A 1GA9A 1YQSA 3QNBA 4S2PA 4BENA 2EXAA 1HD8A 4KG6A 4IVIA 4B4ZA 2Y2QA 1ERQA 1NYYA 4S2NC 4JPMA 3AGEA 2JC7A 2JBFA 4N9KA 4LV2A 1BULA 2HP5A 5U47A 1KVLA 3DWKA 5E2FA 3TSGA 4BJPA 2I72A 2UWXA 1QMFA 1PYYA 2XH9A 3HUOA 3OC2A 4WEJA 3QHYA 5J8XA 3IH9A 4NETA 4BL2A 4DXBA 2XR0A 2EX8A 2EXBA 4R23A 3FWLA 5G18A 1IYOA 4PM7A 4IBRA 1DJCA 3A3EA 1SDEA 3BFGA 4BD1A 1CI9A 1YLPA 3A3IA 1HTZA 3ZNTA 3PBSA 2ZQ9A 3ZDJA 5CXWA 1JWVA 2ZQCA 1FSWA 1YLWA 4KQOA 4QD4A 5FI2A 4C75A 4KZ6A 3ISGA 1WYCA 4GDBA 4WBGA 4FSFA 4GDNA 1S0WA 4DE3A 1ZG4A 4GZBA 4OLGA 3A3JA 5A92A 3SH7A 3N8SA 3ZG5A 2Y2IA 3HLWA 3G2YA 1BSGA 4HBTA 5HAPA 2PBYA 4ZTKA 4P87A 3MKEA 1BLPA 4R4SA 4MBHA 1SDNA 3W4PA 5GL9A 5HAQA 2OV5A 5AQ9A 1K6RA 2Q9NA 3NCKA 2XGNA 4E3LA 2XQZA 3OPLA 5EOEA 4B4XA 3GSGA 3BFFA 2X71A 3HLBA 3UE1A 1ZG6A 1W8YA 1PZOA 2WZZA 1LI9A 3MFDA 4XXRA 1YMSA 1HVBA 3N4IA 2J9OA 1EI5A 3O88A 4JXVA 3ZG9B 2A3UA 1K4FA 5FI6A 1BZAA 3IT9A 2ZQDA 2X02A 1M40A 2R9WA 1DJAA 3SOIA 3PBNA 4FCFA 4D2OA 5F1FA 3G34A 3BEBA 5DF8A 4KZBA 1L0GA 4OOYA 2WKEA 4E3NA 4PM9A 4YFMA 4DE1A 4S2MA 4LV1A 5JYPA 3ZG7B 5A91A 3HUNA 4UHUA 3ZGAB 5EVIC 4LCMA 1SHVA 2PU4A 3WS5A 4X6TA 4P85A 5DTSA 3MZDA 4R4RA 1TDLA 2XF3A 3UDIA 3NDEA 5FQMA 1PWCA 1FOFA 3OCNA 3P98A 5GHZA 3WRZA 3WS2A 2HP6A 3W4QA 3IWOA 4E3KA 2G2UA 4GNUA 4KG5A 3DTMA 1Q2PA 3FKWA 3UDXA 3BECA 1GA0A 3UO9A 1GHIA 1DY6A 2JE5A 1G6AA 3I7JA 3NBLA 3IWQA 2DNSA 1MKIA 2WUQA 2WGWB 1Y54A 3BM6A 1J9MA 1NY0A 1OMEA 4K0WA 3UN7A 3C5AA 2XFSA 3WWXA 3HVFA 1YMXA 4WELA 4X56A 3IF5A 1NRFA 1PW1A 4QY6A 4GD6A 1KDSA 3M6BA 4RX2A 3EQUA 2GDNA 4KZ7A 4OQ0A 1ES2A 2DRWA 5EECA 3IF6C 2ZM8A 1MWUA 3BFDA 1EROA 1IYSA 1NJ4A 4IEDA 3SS4A 4ZDXA 3BLMA 3LO7A 4QJGA 4HBUA 3Q07A 3O86A 5HARA 1ZC2A 2Y2LA 5CGWA 2X01A 1O7EA 3IXHA 4OP8A 1K55A 3MKFA 1W8QA 5HX9A 1BT5A 5TFQA 3UPOA 1I5QA 2DCFA 4GD8A 1ONHA 4OP5A 3W4OA 3FKVA 5FAOA 4DE2A 1PI4A 3GQZA 2XLNA 4WZ4A 4R0QA 5KSHA 4JLFA 2JCHA 3Q7VB 5DF9A 3M2JA 3FZCA 5HL1A 2ZC5B 4QU3A 1TVFA 1IKIA 1CK3A 2QMIA 3VMAA 3WS0A 4MNRA 5FDHA 1Q2QA 3PAGA 3A3DA 4RX3A 4Y0OA 4EBNA 5FQIA 4WMCA 2OLVA 3G4PA 5EVIB 1VM1A 5GLBA 3BYDA 1XKZA 2Y59A 5GLDA 2ZMAA 3NIAA 4IVKA 3E2LA 1N4OA 4Y0UA 2Y2KA 3HBRA 2C5WB 1ES3A 1BUEA 1IYQA 2WK0A 3Q82A 5EUAA 3V50A 3ZG0A 4NK3A 3JYIA 3ZVTA 2XFTA 1KE4A 4KZAA 4DRTA 3PAEA 3VP4A 3RJUA 1FCMA 4X53A 3NI9A 3VSLA 4PM6A 4WYYA 1MPLA 4FH4A 4WEKA 1JVJA 2H5SA 2Y2GA 2HP9A 3WS4A 3M2KA 4C3QA 3G31A 5CHJA 4WM9A 5DTTA 4E6WA 5FATA 1K4EA 2XDMA 3BRMA 3CMZA 1IELA 4E3IA 1H5XA 3MXSA 4KZ4A 3UDFA 2WGIA 1K25A 3IHBA 3HLEA 4OONA 4B88A 1ALQA 5DVAA 4CJNA 5L2FA 1YLTA 3VP3A 2QPNA 3GR2A 2RL3A 1CEGA 2ZJ9A 4PMAA 4P0MA 3UE0A 1M6KA 5CHMA 1PW8A 3IH8A 3IXGA 3IF6B 2XK1A 5GLAA 4S2NA 2EX2A 1K54C 4DDSA
chains in the Genus database with same CATH superfamily
1XPBA 2L0WA 3OZHA 4UA7A 3UNWA 1E4DA 1K57C 2EX9A 2LB9A 3A0SA 5FQKA 3EQVA 4NXFA 1L0FA 5D3OA 2HGVA 4E6XA 3HLFA 4BBVA 1D06A 5A90A 2XROA 4E3OA 5CGSA 2O9BA 3UPNA 4QY5A 4LLOB 4P6ZS 2Y2JA 2Y2NA 3AGFA 4KQRA 1Z6FA 3PBRA 2DMWA 4OPRA 3HUMA 3P01A 3ITBA 3E4QA 5M19A 2M1CA 3LICA 4ZBEA 4F94A 5HW3A 4HOIA 3BW6A 3T4SA 5F83A 2H0YA 5IHVA 1YT4A 2Y2OA 4WUJA 4R70A 4LCLA 5E2HA 1H8YA 3MMHA 2B5RA 1G5UA 2WKQA 4JF4A 5CEDA 2Y4AA 1TD5A 5FA7A 2Z6DA 2Z2MB 4B93A 2VKSA 4DMZA 4Z1WA 1GHMA 5EM0A 5EVIA 3UY6A 4O8GA 1O07A 4CLCA 1W5DA 4EV4A 2PU2A 2ZM0A 3FPWA 4PM8A 1KOUA 1CI8A 1C3BA 3EGDC 3KSHA 3NJAA 5F6AA 2C6WB 1Y28A 2V1ZA 3CHWP 4L9FA 4GS9A 1DP9A 4ME4A 1S67L 1NRJA 1X0OA 2V9AA 4EW7A 4HQAA 3UB9A 3VOLA 2L4RA 4EWFA 5CERA 1BLCA 2QZ6A 3BQ8A 4X25A 5CEBA 1IYPA 3PBOA 5IU1A 1I2WA 1XXMA 3NY4A 5FSRA 4EUZA 2ZQ7A 3VP2A 4NXEA 4FH2A 2IA2A 1JTGA 3P09A 4RYEA 1DP8A 3EWKA 2G7UA 1T1AA 4YWZA 4BLMA 3CZDA 4X1MA 3O5YA 1NLYA 4HJ3A 1LHYA 4DN0A 5HD3A 3T4QA 4FD8A 2ZC7A 3LIEA 2ZQ8A 1ES4A 3MZFA 1K0KA 1L2SA 4PAUA 3LIBA 1TF1A 2WADA 4MN6A 1K55C 4IBXA 3VFHA 3CITA 4MMNA 4LV0A 4ZRRA 5DF7A 4MEZA 1EWZA 4A5RA 1JTDA 1T1BA 1K54A 2IWBA 3LR5A 4S2LA 1KE0A 4EESA 1NLZA 1YLYA 1VETB 4II7A 5DJUA 4LPZA 2Z2LB 2A2LA 4GKUA 2Y2HA 4E3JA 4GHIB 2JKGA 3C2WA 2ACGA 5AQAA 1N9BA 1MBLA 2ZOHA 1PI5A 5FI7A 4AFIA 3G32A 1PWGA 3EGXC 3MXRA 2W3DA 2R9XA 2MJ6A 4ZJ3A 1MWTA 4JF5A 1T18A 4DDYA 2GJ3A 5FQQA 3H9WA 3PBQA 3QNBA 4BENA 2EXAA 2VGLS 2D02A 1ERQA 2JBFA 4N9KA 4BJPA 4UQIS 2YKHA 4LFUA 2XR0A 2EX8A 2EXBA 4R23A 2V8FA 1HTZA 2VX8A 3NOPC 2W27A 2BASA 4KQOA 4QD4A 5FI2A 1WYCA 3LI9A 5HWVA 4OLGA 3A3JA 4JGOA 3HLWA 3MKEA 4R4SA 3B47A 5GL9A 2OV5A 3B33A 2PD8A 2WKRA 3BFFA 1UGUA 4LRZE 2WZZA 4JXVA 2EA9A 4HH3A 4HP4A 5FI6A 3IT9A 2X02A 3QP2A 4EEPA 3PBNA 2GZAA 2WKEA 4E3NA 2ZMVA 5A91A 1NWZA 1ACFA 4X6TA 1TDLA 1VETA 1PWCA 4JGQA 3IWOA 4GHIA 3MQ0A 4D60A 1GHIA 2JE5A 1CJFA 1MKIA 2WUQA 1OMEA 4G3WA 3C5AA 1CF0A 2XFSA 3WWXA 4WELA 4X56A 1OTIA 3U2AA 3IF5A 4DJ2A 3BJNA 1KDSA 4HHDA 4I3JA 4RX2A 3EQUA 2ZM8A 1EROA 4Y13A 4IEDA 4HBUA 2YKFA 3Q07A 1YSQA 5TFQA 2B02A 2XLNA 1N9OA 1VHMA 4R0QA 2OAQ1 5KSHA 2ZC5B 3PXPA 3VMAA 3WS0A 5TBMB 4RX3A 4IJGA 4WMCA 2A24B 3BYDA 3RH8B 3E2LA 4Y0UA 1ES3A 2PYRA 2WK0A 2INWA 3ZG0A 4P6ZM 3QP1A 2JKRI 4DRTA 3G6OA 3PAEA 3VE3A 3F1OB 5F69A 1ZTUA 4PM6A 2PR6A 4FH4A 2Y2GA 2HP9A 3WS4A 3GDIA 4WM9A 5IS1A 3V67A 3CMZA 3BRMA 4E3IA 2WGIA 1K25A 3IHBA 4ETXA 3VP3A 2QPNA 3GR2A 3KX0X 1CEGA 4O01A 4PMAA 5CHMA 1M6KA 2O0YA 3IF6B 4DDSA 3DTIA 1S1ZA 3SS5A 3P7NA 3LCEA 2WGVA 4JXWA 5FQ9A 3QP8A 4E3MA 1PIOA 1FR6A 3KSFA 1XX2A 4EBPA 3AGDA 3HCYA 4S2KA 2LB5A 4UA6A 1J3WA 1I2SA 1LT0A 1PZPA 5HAIA 5L09A 4Y3IA 2PT7A 4OVDA 3CG5A 1KGGA 1OPXA 3IQAA 1KE3A 3IX8A 3IWIA 4PKYG 1F2KA 2B18A 4MBKA 4XUXA 1K56A 2WAEA 2W3FA 1W79A 4I3IA 4Q8IA 1RGYA 5CTNA 4DJ3A 2J3TD 4YNRA 1LI0A 5F68A 2PRFA 1UWPX 5E2EA 3T4TA 3BFEA 2NUTC 4KUKA 3G35A 3LGOA 3IX3A 4WZ5A 1ONGA 3B42A 5TBMA 1ES5A 2A24A 2EWWA 2V0UA 1FCOA 2HJ9C 1MZUA 3E2KA 1S6RA 4OQHA 5L8MA 5C5KA 3SZTA 3NC8A 2XEPA 1IOUA 1ESIA 3F1OA 3LIFA 2PD7A 2ZQAA 4X1LA 3ZHHA 1XP4A 1AXBA 4I39A 4M3KA 4U0TA 1HLUP 1A0KA 4X68A 3OPRA 2Y91A 2HDUA 1JWZA 5K5BA 5F5YA 2H10A 3IF6A 2FZ0A 1UWNX 1ERMA 1E3UD 5HZHA 3D4FA 1OJ5A 3N8RA 1XFNA 4JXGA 4OPZA 4M4XA 2XD1A 2W3GA 5DTKA 5EVLA 3DW0A 2OOLA 1H0MA 4O7DA 2HDQA 3T1SA 4ID4A 4U3TA 4Q0JA 4EBLA 4PHTA 3FYZA 3FC7A 3T12B 5EOOA 1ESUA 3SW1A 3E4OA 2AVXA 2ZC4B 3DTKA 1JNUA 2K2NA 3C4PA 5CRFA 3UB7A 2O99A 1OTDA 4UAAA 2J3TC 3C30A 4N1XA 2VGLM 3CUEA 5HDCA 3VSKA 3L7HA 2WKHA 4H8RA 4Q0HA 3N8LA 3BLSA 4UQIM 3TOIA 4DKIA 3HLCA 2EFUA 5CX7A 2V0WA 2ZC6B 2L1MA 1K57A 5DFYA 2EFXA 2BTFP 5DFXA 4OQIA 2WYXA 4O0PA 4KZ5A 2J9PA 3SH8A 2J3WA 3M6HA 4X69A 3N7WA 4EQ1A 5CTMA 1S4RA 1GCEA 2QJ5A 2A49A 1BTLA 3ZVWA 3UE3A 1LL9A 1XJ4A 1GSVA 4LGWA 1JWPA 4Y17A 1TDGA 1WYBA 3UB6A 3IHAA 3NHQA 1RP5A 3PTEA 3OCLA 3MF0A 4RA7A 4S2PA 1GA9A 1OT9A 1NYYA 2XA7S 2HJEA 1KVLA 1XFQA 1PYYA 2XH9A 3HUOA 2B95A 4DXBA 5EFWA 2KX6A 5G18A 4NEED 1SZVA 1DJCA 3A3EA 1SDEA 1YLPA 3HJIA 2KOIA 2ZQ9A 5CXWA 2M7UA 4C75A 4KZ6A 2K7SA 3ISGA 4WBGA 4GDBA 4GDNA 1ZG4A 3SH7A 3N8SA 3ZG5A 3LYXA 5HAPA 4HBTA 1F9IA 1IFQA 3W4PA 1DP6A 5G4YA 5AQ9A 1K6RA 2V8CA 1PNEA 3H7WA 2VJWA 5EOEA 1FILA 4B4XA 3GSGA 2X71A 3CAXA 4GW9A 1BZAA 5HD5A 4F3LB 1M40A 2R9WA 4FCFA 4D2OA 3BEBA 2W1TA 3LR0A 4PM9A 4YFMA 4S2MA 4UHUA 4LCMA 1SHVA 2PU4A 4P85A 4R4RA 4BMWA 2XF3A 3T1RA 5FQMA 3OCNA 1XJ3A 5EV0A 1PRQA 2HP6A 4WL9A 3DTMA 3FKWA 3BECA 1BYWA 3HVFA 2Y79A 3S7OA 4QY6A 4R6LA 3M6BA 1Y4OA 5KIZA 4KZ7A 1PFLA 5EECA 3F1PA 4ZDXA 3LO7A 4NG2A 5HWWA 3T1XA 4OP8A 3IXHA 4NKPA 1K55A 1W8QA 1S66L 1BT5A 1I5QA 2R78A 4GD8A 5FAOA 3GQZA 3K2NA 4R38A 4JLFA 3Q7VB 5DF9A 5HL1A 3FZCA 4QU3A 3U4LP 2QMIA 4MNRA 5FDHA 4B9OA 2PYPA 2GX5A 3NIAA 1YSPA 4IVKA 1N4OA 3V50A 4NK3A 3JYIA 3RJUA 4X53A 3ZQ5A 3MQOA 1MKMA 4WYYA 3ULFA 3VV4A 4F3LA 5DTTA 1K4EA 2XDMA 1H5XA 3UDFA 3LR4A 1YLTA 3KYZA 2ZJ9A 4IUKA 2WKPA 3UE0A 3IH8A 3C8CA 2PHYA 3FG8A 2E8IA 1F98A 3R4KA 4Z9QA 3GMWA 4JF6A 4OOLA 4LV3A 1K56D 1YLJA 5HFOA 4JXSA 1IKGA 2QJ7A 1NZUA 3HL9A 2PAVP 2P7JA 2PDRA 5GLCA 2FFYA 4P6BA 3T4KA 4CPKA 1FR1A 4K91A 3GRJA 4BL3A 4QHCA 1L0EA 1STZA 1SKFA 4MBFA 3T4JA 3VOZA 4ZJ1A 3ZCZA 3KSIA 3UE6A 1FCNA 2FFFB 4BD0A 1XJ6A 3CJMA 1AWIA 1FQGA 3Q7VA 3MZEA 1YLZA 2P9VB 2ZC3B 4HY8A 1K38A 4OLDA 4XT2B 3MR0A 2ZL1B 1HZOA 3LY3A 3KO6A 4MLLA 1XGIA 2ZBBA 3RXXA 4Y7PA 2JN7A 4OH0A 3C7UA 4S2OA 3A0VA 1LSVA 3OOVA 4OQGA 3G2ZA 5BOHA 2ZLYA 2WAFA 3V5MA 4DE0A 2WKIA 1L3LA 1D1JA 5A93A 2P08A 3E98A 3MQQA 3NULA 4GOGA 5HWTA 2Q0OA 3GV9A 2HPBA 3CWFA 4FOFA 3ICYA 5FAPA 1CQAA 2OLUA 3HREA 3VOYA 3VP0A 4LENA 3ZG8B 1NYMA 3LEZA 3O3VA 1BLSA 3Q81A 4U0XA 4DXCA 5GHYA 3K3CA 4IHQA 5I94A 1KDWA 4S2IA 4OPQA 1RCJA 1KGFA 1KVMA 3DAVA 3KYEA 5TR7A 1NZOA 2VV6A 1U60A 3LY4A 4KG2A 3E4PA 4X55A 5TJJA 3S4XA 4QPRA 4OKPA 1IEMA 4K0XA 3BQAA 5KZHA 1GHPA 5CGXA 3IS2B 5JYOA 1PWDA 4YINA 3H82A 4WZ5C 3W8KA 2VGKA 3NOUC 2V2FF 1NXYA 3UB5P 1MWRA 1LL5A 3QP5A 4BBTA 4EQIA 2EX6A 5E43A 2P9VA 3UMDA 5LBRA 4XT2A 4PPRA 3R7WB 1S4SA 1VEUA 5EVID 3S7NA 2ZL1A 5KMWA 3D9YA 2V20A 3RXWA 3UPPA 4CLCD 2Y55A 2J80A 3B3XA 1TEMA 3GVBA 3EOIA 3TG9A 4XUZA 1P0ZA 3IXBA 3LEQA 2M7VA 2BLSA 3T4OA 3TE8A 4N9LA 2BG1A 3UMEA 2UV0E 3D3OA 1N9NA 3HLGA 3QP4A 4N92A 3HLDA 3CLOA 1TS0A 1HD8A 4IVIA 4S2NC 4JPMA 3AGEA 2JC7A 5U47A 1P97A 2W0NA 3DWKA 5E2FA 2I72A 4WEJA 1QMFA 5J8XA 3QHYA 3IBRA 4NETA 4BL2A 1D7EA 3FWLA 2EWVA 2Y8HA 4IBRA 3BFGA 4HH2A 4L9GA 3ZDJA 4FSFA 4DE3A 5A92A 2Y2IA 1BSGA 2PBYA 3BWLA 1BLPA 1MC0A 5HAQA 4IUHA 2XSSA 4R3AA 2Q9NA 3IS2A 3TRCA 3OPLA 3HLBA 1LSXA 1LI9A 3MFDA 4JGRA 4WF0A 1YMSA 4MN5A 2J9OA 1LSWA 3O88A 3RTYA 3QP6A 3EEAA 1TS6A 3LR3A 2ZQDA 3H7WB 1LL8A 4Y5FA 3CI6A 5F1FA 2OWJA 4OOYA 5A8BA 3R7WA 4DE1A 1GSWA 4QWOA 2KDKA 1T1CA 5JYPA 4I38A 4BWIA 3PYPA 5EVIC 3TW8A 5DTSA 2OAP1 4CLCC 2W1TB 3P98A 5GHZA 3WRZA 3W4QA 1OT6A 3C38A 4E3KA 2P04A 3UDXA 5AVFA 3UO9A 1DY6A 2Z6CA 3NBLA 3IWQA 2DNSA 2WGWB 1Y54A 3BM6A 5FEGA 1NY0A 4K0WA 1YMXA 2HV1A 1NRFA 3D72A 4NXGA 2NUPC 4GD6A 3CPTB 3IBJA 1P9RA 2GDNA 4OQ0A 1T19A 2DRWA 4HNBA 3BFDA 1NJ4A 3SS4A 4QJGA 3LIAA 2QKPA 5HARA 1ZC2A 3LI8A 3NOTC 2X01A 3MKFA 4RQ9A 4OP5A 3FKVA 4WZ4A 3F1PB 4ETZA 1CK3A 4EXOA 1G28A 3PAGA 3A3DA 4Y0OA 1TS7A 4YOFA 5FQIA 4EBNA 2OLVA 2ZMAA 2JKTI 2Y2KA 3HBRA 2HZ5A 1IYQA 5EUAA 3ZVTA 2XFTA 4KZAA 4MCWA 5FDSA 3VSLA 4LRXC 1MPLA 4WEKA 3OBFA 1JVJA 2H5SA 3ZYTA 4I3AA 3G31A 5CHJA 2VLGA 4E6WA 2QYBA 3MXSA 4OONA 5DVAA 5L2FA 5HPFA 4HJ4A 1PW8A 3IXGA 2GNXA 2XK1A 5GLAA 1K54C 1L0GA 1E3UA 4ZJ2A 1L0DA 4HEFA 1CEFA 3C4OA 3BY8A 4G3VA 4CLCE 1G68A 2JKRM 5AQ7A 2ZD8A 4EU0A 1N9LA 5M1AA 2WGWA 3QNCA 5F1GA 4KUOA 4GB7A 5GHXA 3UB8A 4CQHA 5L10A 1FIKA 1W7FA 3CPTA 4WN5A 4KQDA 3T50A 4JKTA 3ZNYA 4ZAMA 2ZM2A 3T4LA 2H0TA 2XD5A 4WLAA 3S1YA 3VP1A 4OOMA 5DJTA 2PR5A 3G30A 3GTCA 2FH5A 2QWSA 5KSCA 2WZXA 3DWZA 4KZ9A 2Q9MA 4S2JA 3JVUA 1DRMA 5J4EA 1W63M 5J3WA 3WRTA 2P74A 2W3HA 3N6IA 4L0LA 5M18A 1K6SA 2Y2PA 1TS8A 3S22A 3BFCA 4WMCD 5AQBA 4JGPA 2K31A 1MXOA 2G2WA 3A3FA 1EW0A 4KENB 4HIAA 1ZKJA 3WS1A 2E8JA 3A0RA 5HDSA 5CECA 5I5LA 3MS6A 3ITAA 2W3EA 4PM5A 2QHKA 1VQQA 3PBTA 1E25A 2D01A 5AVEA 3VE4A 3MBZA 4UA9A 3NDGA 4KQQA 1YKDA 4KZ3A 2VV8A 2OSUA 5L07A 2RCXA 5CHUA 4Q0IA 1W63Q 4FUWA 3IXDA 2Y2MA 3VFFA 2ZMFA 5EPHA 4BQMA 4RVAA 2HDRA 1KGEA 2V1BA 3RFBA 4Y15A 4QB8A 2CC1A 1BLHA 1H3QA 2OWHA 3C7VA 5FL3A 4KZ8A 3V3RA 4HJ6A 2IWCA 5FASA 3V39A 3F1NB 5E2GA 5EVEA 1WE4A 4HESA 3O87A 1XA1A 4HI4A 5F82A 4EEUA 1VB6A 4DF6A 3MXQA 2IWDA 5FAQA 5FQJA 5AJGA 1FSYA 1DJBA 2KLIA 4C6YA 4R1GA 1QMEA 1XA7A 3SH9A 5FEFA 3FPVA 2VA0A 1XGJA 3ZFZA 1LLBA 1MY8A 3DBAA 2H28A 1H8ZA 3FV7A 4LRYC 3EEHA 4ARZB 4N1HA 4OPYA 4R3BA 5EM1A 3H82B 3Q1FA 3L9KA 5HPIA 3SS3A 2HDSA 1SCWA 3IX4A 3OPPA 4Y0TA 1RGZA 2VZWA 5TGFA 2J7VA 4GLQA 2ZOIA 3V3SA 1VEUB 2J8YA 1YM1A 4EETB 1MWSA 3Q7ZA 3OPHA 1OTBA 4JBFA 4K08A 2VGJA 4GN2A 3NECA 5EE8A 4R3JA 4MDZA 5HDDA 4NXBA 1YQSA 2V1AA 4GCZA 3OLOA 4KG6A 4B4ZA 2Y2QA 4LV2A 1BULA 2HP5A 3TSGA 2UWXA 1ZHHB 3OC2A 3IH9A 1IYOA 4PM7A 4BD1A 1CI9A 3A3IA 3ZNTA 1Z09A 3PBSA 1JWVA 2ZQCA 1FSWA 3W2ZA 1YLWA 3F1NA 4H6JB 1S0WA 4GZBA 4EUVA 2JKFA 3G2YA 4ZTKA 4P87A 4MBHA 1SDNA 2JHEA 3NCKA 4E3LA 2XGNA 2XQZA 3KSGA 3UE1A 1ZG6A 2HF6A 1W8YA 1PZOA 4XXRA 1HVBA 3N4IA 1EI5A 3ZG9B 1V9YA 2A3UA 3PHYA 3JVVA 1K4FA 1ODVA 2XRNA 1DJAA 1SKOB 3SOIA 3MJQA 2W1RA 1P9WA 3G34A 5DF8A 1GSXA 4ARZA 4KZBA 2PBDP 2JKTM 3MSHA 3DTEA 3S7QA 4G3KA 3HJKA 4LV1A 1OJGA 3GECA 3ZG7B 2XA7M 3HUNA 3K3DA 3ZGAB 2VV7A 3WS5A 1YPRA 3MZDA 5DKLA 2O9CA 3LUQA 4BBUA 4GJ4A 4I5SA 3NDEA 3UDIA 1FOFA 4L9EA 3WS2A 2G2UA 4GNUA 4KG5A 1Q2PA 1S1YA 4PKYA 4FTXA 1GA0A 1G6AA 3I7JA 1J9MA 3UN7A 5DKKA 4UEYA 1WA9A 1V9ZA 1F5MA 1PW1A 3PR6A 3KYQA 2I9VA 1G6OA 1ES2A 2VEAA 3T1QB 3IF6C 1MWUA 1YAXA 1IYSA 3BLMA 4HP9A 3MFXA 3O86A 2Y2LA 4ESPA 5CGWA 2VK3A 1O7EA 3LIDA 3S7PA 5HX9A 3UPOA 2DCFA 1ONHA 3W4OA 2CMNA 1H8MA 4DE2A 1PI4A 3JPUA 5G4ZA 2JCHA 3M2JA 1TVFA 5IT5A 4H6JA 1IKIA 3LFVA 1XJ2A 1Q2QA 3TJZC 4MN7A 3G4PA 5EVIB 1VM1A 5GLBA 1XKZA 2Y59A 5GLDA 4Y2FA 5MC7A 3Q82A 2C5WB 1BUEA 5J7EA 4CLCB 5HSQA 1KE4A 3VP4A 1FCMA 3NI9A 1OTAA 5HL6A 4EERA 4C3QA 3M2KA 3BY9A 2O9AA 3CUEC 3E0YA 1SKOA 5FATA 1IELA 4KZ4A 3HLEA 4B88A 1ALQA 4CJNA 4GS9B 2RL3A 4P0MA 1OTEA 4E04A 4S2NA 2EX2A
chains in the Genus database with same CATH topology
1XPBA 1E3UA 3OZHA 4UA7A 4ZJ2A 3SS5A 3UNWA 1L0DA 1E4DA 4HEFA 1K57C 2EX9A 1CEFA 3LCEA 2E8IA 3C4OA 5FQKA 2WGVA 4JXWA 5FQ9A 3EQVA 4Z9QA 1L0FA 5D3OA 1PIOA 4E3MA 1G68A 3GMWA 4E6XA 3HLFA 1FR6A 1XX2A 5AQ7A 3AGDA 4EBPA 4S2KA 5A90A 4UA6A 4JF6A 2ZD8A 4OOLA 4LV3A 1K56D 1I2SA 5M1AA 1PZPA 1YLJA 4JXSA 5CGSA 5HAIA 5HFOA 1IKGA 2WGWA 4E3OA 3QNCA 5F1GA 3UPNA 1NZUA 4OVDA 3HL9A 4QY5A 4GB7A 5GHXA 3CG5A 1KGGA 2Y2JA 3IQAA 2Y2NA 3AGFA 4KQRA 1KE3A 1Z6FA 2FFYA 3PBRA 5GLCA 1W7FA 3IWIA 4P6BA 4MBKA 4CPKA 4OPRA 4XUXA 1FR1A 3HUMA 4K91A 1K56A 2WAEA 3GRJA 4JKTA 3ITBA 3ZNYA 4ZAMA 4BL3A 5M19A 2ZM2A 4QHCA 1L0EA 1W79A 2H0TA 1SKFA 4ZBEA 4F94A 4MBFA 2XD5A 3VOZA 5HW3A 4ZJ1A 3ZCZA 4Q8IA 1RGYA 3S1YA 3VP1A 5CTNA 4OOMA 3G30A 3GTCA 5M18A 1LI0A 5F83A 2H0YA 5IHVA 1FCNA 2FFFB 5KSCA 2WZXA 3DWZA 4KZ9A 5E2EA 1YT4A 4BD0A 2Y2OA 2Q9MA 3BFEA 3CJMA 4LCLA 5E2HA 1H8YA 4S2JA 1FQGA 2B5RA 4JF4A 3Q7VA 3G35A 5CEDA 2Y4AA 3WRTA 3MZEA 1YLZA 2P74A 3N6IA 2P9VB 4L0LA 4WZ5A 5FA7A 1K6SA 2ZC3B 1K38A 1ONGA 4OLDA 2Z2MB 2Y2PA 1ES5A 3S22A 3BFCA 1GHMA 5EVIA 3UY6A 4WMCD 5AQBA 1FCOA 1HZOA 1MXOA 2G2WA 3LY3A 4MLLA 3A3FA 1XGIA 3E2KA 1S6RA 3RXXA 1O07A 4OQHA 4Y7PA 4OH0A 3C7UA 4S2OA 4KENB 1W5DA 1ZKJA 3NC8A 3WS1A 2XEPA 4EV4A 1ESIA 4OQGA 3G2ZA 2PU2A 5CECA 5BOHA 3ITAA 2ZM0A 4PM8A 2ZLYA 2WAFA 2ZQAA 3V5MA 4PM5A 4DE0A 3ZHHA 1XP4A 2WKIA 1CI8A 1AXBA 1C3BA 1VQQA 5A93A 3PBTA 1E25A 4M3KA 4U0TA 4GOGA 3MBZA 3GV9A 4X68A 3OPRA 4UA9A 2C6WB 2HPBA 2V1ZA 2Y91A 3NDGA 4KQQA 2HDUA 1JWZA 4KZ3A 2OSUA 5FAPA 2OLUA 2H10A 3IF6A 3HREA 2RCXA 1ERMA 5CHUA 3VOYA 3VP0A 1E3UD 4LENA 4EWFA 3D4FA 5CERA 3IXDA 3ZG8B 1BLCA 1NYMA 2QZ6A 3N8RA 3LEZA 3O3VA 1BLSA 2Y2MA 3VFFA 5CEBA 1IYPA 3PBOA 5EPHA 3Q81A 1I2WA 4JXGA 4RVAA 2HDRA 4BQMA 1KGEA 4U0XA 4DXCA 1XXMA 4OPZA 3NY4A 5FSRA 4EUZA 2ZQ7A 4QB8A 5GHYA 2CC1A 3VP2A 1BLHA 2XD1A 5I94A 5DTKA 5EVLA 1KDWA 4S2IA 4OPQA 3C7VA 3DW0A 3V3RA 4KZ8A 4FH2A 1RCJA 1KGFA 1KVMA 2IWCA 2HDQA 4O7DA 5FASA 1JTGA 4ID4A 3P09A 4RYEA 4U3TA 1NZOA 5TR7A 3V39A 1U60A 3LY4A 4KG2A 4EBLA 3FYZA 5E2GA 4BLMA 3CZDA 5EOOA 1ESUA 1WE4A 4X55A 4HESA 3O87A 1XA1A 3S4XA 4OKPA 1IEMA 4K0XA 1LHYA 5KZHA 2ZC4B 1GHPA 5CGXA 5F82A 4DF6A 3C4PA 4FD8A 5JYOA 2IWDA 2ZC7A 5FAQA 2ZQ8A 5FQJA 1ES4A 1FSYA 1DJBA 1PWDA 3MZFA 5CRFA 4YINA 4C6YA 4R1GA 1L2SA 1QMEA 1XA7A 4UAAA 4WZ5C 3SH9A 2WADA 4N1XA 3W8KA 2VGKA 1K55C 2V2FF 4IBXA 3VFHA 1NXYA 3VSKA 1MWRA 2WKHA 1LL5A 4H8RA 4EQIA 1XGJA 3ZFZA 3N8LA 3BLSA 1LLBA 1MY8A 2EX6A 4LV0A 1H8ZA 3FV7A 5E43A 5DF7A 4MEZA 2P9VA 1EWZA 4N1HA 3TOIA 4OPYA 4R3BA 4A5RA 4DKIA 1JTDA 3Q1FA 3HLCA 4PPRA 2EFUA 1K54A 2IWBA 3SS3A 4S2LA 5EVID 2ZC6B 5KMWA 1KE0A 1K57A 2HDSA 1SCWA 2V20A 3RXWA 3UPPA 1YLYA 3OPPA 2EFXA 4Y0TA 2Y55A 1RGZA 3B3XA 4OQIA 1TEMA 2Z2LB 3GVBA 2WYXA 4GKUA 2Y2HA 2J7VA 5TGFA 4KZ5A 4E3JA 2J9PA 3SH8A 3TG9A 4XUZA 3V3SA 2J8YA 1YM1A 3M6HA 3IXBA 4X69A 3N7WA 5AQAA 1N9BA 1MWSA 3Q7ZA 1MBLA 3OPHA 5CTMA 1PI5A 4JBFA 1GCEA 3G32A 5FI7A 2BLSA 1PWGA 2A49A 1BTLA 3ZVWA 3UE3A 1LL9A 3MXRA 2VGJA 2R9XA 4ZJ3A 1MWTA 4N9LA 1JWPA 2BG1A 4GN2A 1TDGA 1WYBA 4JF5A 3IHAA 4DDYA 1RP5A 5EE8A 3HLGA 3PTEA 5FQQA 3OCLA 4R3JA 4N92A 3HLDA 3PBQA 4RA7A 1GA9A 1YQSA 3QNBA 4S2PA 4BENA 2EXAA 1HD8A 4KG6A 4IVIA 4B4ZA 2Y2QA 1ERQA 1NYYA 4S2NC 4JPMA 3AGEA 2JC7A 2JBFA 4N9KA 4LV2A 1BULA 2HP5A 5U47A 1KVLA 3DWKA 5E2FA 3TSGA 4BJPA 2I72A 2UWXA 1QMFA 1PYYA 2XH9A 3HUOA 3OC2A 4WEJA 3QHYA 5J8XA 3IH9A 4NETA 4BL2A 4DXBA 2XR0A 2EX8A 2EXBA 4R23A 3FWLA 5G18A 1IYOA 4PM7A 4IBRA 1DJCA 3A3EA 1SDEA 3BFGA 4BD1A 1CI9A 1YLPA 3A3IA 1HTZA 3ZNTA 3PBSA 2ZQ9A 3ZDJA 5CXWA 1JWVA 2ZQCA 1FSWA 1YLWA 4KQOA 4QD4A 5FI2A 4C75A 4KZ6A 3ISGA 1WYCA 4GDBA 4WBGA 4FSFA 4GDNA 1S0WA 4DE3A 1ZG4A 4GZBA 4OLGA 3A3JA 5A92A 3SH7A 3N8SA 3ZG5A 2Y2IA 3HLWA 3G2YA 1BSGA 4HBTA 5HAPA 2PBYA 4ZTKA 4P87A 3MKEA 1BLPA 4R4SA 4MBHA 1SDNA 3W4PA 5GL9A 5HAQA 2OV5A 5AQ9A 1K6RA 2Q9NA 3NCKA 2XGNA 4E3LA 2XQZA 3OPLA 5EOEA 4B4XA 3GSGA 3BFFA 2X71A 3HLBA 3UE1A 1ZG6A 1W8YA 1PZOA 2WZZA 1LI9A 3MFDA 4XXRA 1YMSA 1HVBA 3N4IA 2J9OA 1EI5A 3O88A 4JXVA 3ZG9B 2A3UA 1K4FA 5FI6A 1BZAA 3IT9A 2ZQDA 2X02A 1M40A 2R9WA 1DJAA 3SOIA 3PBNA 4FCFA 4D2OA 5F1FA 3G34A 3BEBA 5DF8A 4KZBA 1L0GA 4OOYA 2WKEA 4E3NA 4PM9A 4YFMA 4DE1A 4S2MA 4LV1A 5JYPA 3ZG7B 5A91A 3HUNA 4UHUA 3ZGAB 5EVIC 4LCMA 1SHVA 2PU4A 3WS5A 4X6TA 4P85A 5DTSA 3MZDA 4R4RA 1TDLA 2XF3A 3UDIA 3NDEA 5FQMA 1PWCA 1FOFA 3OCNA 3P98A 5GHZA 3WRZA 3WS2A 2HP6A 3W4QA 3IWOA 4E3KA 2G2UA 4GNUA 4KG5A 3DTMA 1Q2PA 3FKWA 3UDXA 3BECA 1GA0A 3UO9A 1GHIA 1DY6A 2JE5A 1G6AA 3I7JA 3NBLA 3IWQA 2DNSA 1MKIA 2WUQA 2WGWB 1Y54A 3BM6A 1J9MA 1NY0A 1OMEA 4K0WA 3UN7A 3C5AA 2XFSA 3WWXA 3HVFA 1YMXA 4WELA 4X56A 3IF5A 1NRFA 1PW1A 4QY6A 4GD6A 1KDSA 3M6BA 4RX2A 3EQUA 2GDNA 4KZ7A 4OQ0A 1ES2A 2DRWA 5EECA 3IF6C 2ZM8A 1MWUA 3BFDA 1EROA 1IYSA 1NJ4A 4IEDA 3SS4A 4ZDXA 3BLMA 3LO7A 4QJGA 4HBUA 3Q07A 3O86A 5HARA 1ZC2A 2Y2LA 5CGWA 2X01A 1O7EA 3IXHA 4OP8A 1K55A 3MKFA 1W8QA 5HX9A 1BT5A 5TFQA 3UPOA 1I5QA 2DCFA 4GD8A 1ONHA 4OP5A 3W4OA 3FKVA 5FAOA 4DE2A 1PI4A 3GQZA 2XLNA 4WZ4A 4R0QA 5KSHA 4JLFA 2JCHA 3Q7VB 5DF9A 3M2JA 3FZCA 5HL1A 2ZC5B 4QU3A 1TVFA 1IKIA 1CK3A 2QMIA 3VMAA 3WS0A 4MNRA 5FDHA 1Q2QA 3PAGA 3A3DA 4RX3A 4Y0OA 4EBNA 5FQIA 4WMCA 2OLVA 3G4PA 5EVIB 1VM1A 5GLBA 3BYDA 1XKZA 2Y59A 5GLDA 2ZMAA 3NIAA 4IVKA 3E2LA 1N4OA 4Y0UA 2Y2KA 3HBRA 2C5WB 1ES3A 1BUEA 1IYQA 2WK0A 3Q82A 5EUAA 3V50A 3ZG0A 4NK3A 3JYIA 3ZVTA 2XFTA 1KE4A 4KZAA 4DRTA 3PAEA 3VP4A 3RJUA 1FCMA 4X53A 3NI9A 3VSLA 4PM6A 4WYYA 1MPLA 4FH4A 4WEKA 1JVJA 2H5SA 2Y2GA 2HP9A 3WS4A 3M2KA 4C3QA 3G31A 5CHJA 4WM9A 5DTTA 4E6WA 5FATA 1K4EA 2XDMA 3BRMA 3CMZA 1IELA 4E3IA 1H5XA 3MXSA 4KZ4A 3UDFA 2WGIA 1K25A 3IHBA 3HLEA 4OONA 4B88A 1ALQA 5DVAA 4CJNA 5L2FA 1YLTA 3VP3A 2QPNA 3GR2A 2RL3A 1CEGA 2ZJ9A 4PMAA 4P0MA 3UE0A 1M6KA 5CHMA 1PW8A 3IH8A 3IXGA 3IF6B 2XK1A 5GLAA 4S2NA 2EX2A 1K54C 4DDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPB A;  1E3U A;  3OZH A;  4UA7 A;  4ZJ2 A;  3SS5 A;  3UNW A;  1L0D A;  1E4D A;  4HEF A;  1K57 C;  2EX9 A;  1CEF A;  3LCE A;  2E8I A;  3C4O A;  5FQK A;  2WGV A;  4JXW A;  5FQ9 A;  3EQV A;  4Z9Q A;  1L0F A;  5D3O A;  1PIO A;  4E3M A;  1G68 A;  3GMW A;  4E6X A;  3HLF A;  1FR6 A;  1XX2 A;  5AQ7 A;  3AGD A;  4EBP A;  4S2K A;  5A90 A;  4UA6 A;  4JF6 A;  2ZD8 A;  4OOL A;  4LV3 A;  1K56 D;  1I2S A;  5M1A A;  1PZP A;  1YLJ A;  4JXS A;  5CGS A;  5HAI A;  5HFO A;  1IKG A;  2WGW A;  4E3O A;  3QNC A;  5F1G A;  3UPN A;  1NZU A;  4OVD A;  3HL9 A;  4QY5 A;  4GB7 A;  5GHX A;  3CG5 A;  1KGG A;  2Y2J A;  3IQA A;  2Y2N A;  3AGF A;  4KQR A;  1KE3 A;  1Z6F A;  2FFY A;  3PBR A;  5GLC A;  1W7F A;  3IWI A;  4P6B A;  4MBK A;  4CPK A;  4OPR A;  4XUX A;  1FR1 A;  3HUM A;  4K91 A;  1K56 A;  2WAE A;  3GRJ A;  4JKT A;  3ITB A;  3ZNY A;  4ZAM A;  4BL3 A;  5M19 A;  2ZM2 A;  4QHC A;  1L0E A;  1W79 A;  2H0T A;  1SKF A;  4ZBE A;  4F94 A;  4MBF A;  2XD5 A;  3VOZ A;  5HW3 A;  4ZJ1 A;  3ZCZ A;  4Q8I A;  1RGY A;  3S1Y A;  3VP1 A;  5CTN A;  4OOM A;  3G30 A;  3GTC A;  5M18 A;  1LI0 A;  5F83 A;  2H0Y A;  5IHV A;  1FCN A;  2FFF B;  5KSC A;  2WZX A;  3DWZ A;  4KZ9 A;  5E2E A;  1YT4 A;  4BD0 A;  2Y2O A;  2Q9M A;  3BFE A;  3CJM A;  4LCL A;  5E2H A;  1H8Y A;  4S2J A;  1FQG A;  2B5R A;  4JF4 A;  3Q7V A;  3G35 A;  5CED A;  2Y4A A;  3WRT A;  3MZE A;  1YLZ A;  2P74 A;  3N6I A;  2P9V B;  4L0L A;  4WZ5 A;  5FA7 A;  1K6S A;  2ZC3 B;  1K38 A;  1ONG A;  4OLD A;  2Z2M B;  2Y2P A;  1ES5 A;  3S22 A;  3BFC A;  1GHM A;  5EVI A;  3UY6 A;  4WMC D;  5AQB A;  1FCO A;  1HZO A;  1MXO A;  2G2W A;  3LY3 A;  4MLL A;  3A3F A;  1XGI A;  3E2K A;  1S6R A;  3RXX A;  1O07 A;  4OQH A;  4Y7P A;  4OH0 A;  3C7U A;  4S2O A;  4KEN B;  1W5D A;  1ZKJ A;  3NC8 A;  3WS1 A;  2XEP A;  4EV4 A;  1ESI A;  4OQG A;  3G2Z A;  2PU2 A;  5CEC A;  5BOH A;  3ITA A;  2ZM0 A;  4PM8 A;  2ZLY A;  2WAF A;  2ZQA A;  3V5M A;  4PM5 A;  4DE0 A;  3ZHH A;  1XP4 A;  2WKI A;  1CI8 A;  1AXB A;  1C3B A;  1VQQ A;  5A93 A;  3PBT A;  1E25 A;  4M3K A;  4U0T A;  4GOG A;  3MBZ A;  3GV9 A;  4X68 A;  3OPR A;  4UA9 A;  2C6W B;  2HPB A;  2V1Z A;  2Y91 A;  3NDG A;  4KQQ A;  2HDU A;  1JWZ A;  4KZ3 A;  2OSU A;  5FAP A;  2OLU A;  2H10 A;  3IF6 A;  3HRE A;  2RCX A;  1ERM A;  5CHU A;  3VOY A;  3VP0 A;  1E3U D;  4LEN A;  4EWF A;  3D4F A;  5CER A;  3IXD A;  3ZG8 B;  1BLC A;  1NYM A;  2QZ6 A;  3N8R A;  3LEZ A;  3O3V A;  1BLS A;  2Y2M A;  3VFF A;  5CEB A;  1IYP A;  3PBO A;  5EPH A;  3Q81 A;  1I2W A;  4JXG A;  4RVA A;  2HDR A;  4BQM A;  1KGE A;  4U0X A;  4DXC A;  1XXM A;  4OPZ A;  3NY4 A;  5FSR A;  4EUZ A;  2ZQ7 A;  4QB8 A;  5GHY A;  2CC1 A;  3VP2 A;  1BLH A;  2XD1 A;  5I94 A;  5DTK A;  5EVL A;  1KDW A;  4S2I A;  4OPQ A;  3C7V A;  3DW0 A;  3V3R A;  4KZ8 A;  4FH2 A;  1RCJ A;  1KGF A;  1KVM A;  2IWC A;  2HDQ A;  4O7D A;  5FAS A;  1JTG A;  4ID4 A;  3P09 A;  4RYE A;  4U3T A;  1NZO A;  5TR7 A;  3V39 A;  1U60 A;  3LY4 A;  4KG2 A;  4EBL A;  3FYZ A;  5E2G A;  4BLM A;  3CZD A;  5EOO A;  1ESU A;  1WE4 A;  4X55 A;  4HES A;  3O87 A;  1XA1 A;  3S4X A;  4OKP A;  1IEM A;  4K0X A;  1LHY A;  5KZH A;  2ZC4 B;  1GHP A;  5CGX A;  5F82 A;  4DF6 A;  3C4P A;  4FD8 A;  5JYO A;  2IWD A;  2ZC7 A;  5FAQ A;  2ZQ8 A;  5FQJ A;  1ES4 A;  1FSY A;  1DJB A;  1PWD A;  3MZF A;  5CRF A;  4YIN A;  4C6Y A;  4R1G A;  1L2S A;  1QME A;  1XA7 A;  4UAA A;  4WZ5 C;  3SH9 A;  2WAD A;  4N1X A;  3W8K A;  2VGK A;  1K55 C;  2V2F F;  4IBX A;  3VFH A;  1NXY A;  3VSK A;  1MWR A;  2WKH A;  1LL5 A;  4H8R A;  4EQI A;  1XGJ A;  3ZFZ A;  3N8L A;  3BLS A;  1LLB A;  1MY8 A;  2EX6 A;  4LV0 A;  1H8Z A;  3FV7 A;  5E43 A;  5DF7 A;  4MEZ A;  2P9V A;  1EWZ A;  4N1H A;  3TOI A;  4OPY A;  4R3B A;  4A5R A;  4DKI A;  1JTD A;  3Q1F A;  3HLC A;  4PPR A;  2EFU A;  1K54 A;  2IWB A;  3SS3 A;  4S2L A;  5EVI D;  2ZC6 B;  5KMW A;  1KE0 A;  1K57 A;  2HDS A;  1SCW A;  2V20 A;  3RXW A;  3UPP A;  1YLY A;  3OPP A;  2EFX A;  4Y0T A;  2Y55 A;  1RGZ A;  3B3X A;  4OQI A;  1TEM A;  2Z2L B;  3GVB A;  2WYX A;  4GKU A;  2Y2H A;  2J7V A;  5TGF A;  4KZ5 A;  4E3J A;  2J9P A;  3SH8 A;  3TG9 A;  4XUZ A;  3V3S A;  2J8Y A;  1YM1 A;  3M6H A;  3IXB A;  4X69 A;  3N7W A;  5AQA A;  1N9B A;  1MWS A;  3Q7Z A;  1MBL A;  3OPH A;  5CTM A;  1PI5 A;  4JBF A;  1GCE A;  3G32 A;  5FI7 A;  2BLS A;  1PWG A;  2A49 A;  1BTL A;  3ZVW A;  3UE3 A;  1LL9 A;  3MXR A;  2VGJ A;  2R9X A;  4ZJ3 A;  1MWT A;  4N9L A;  1JWP A;  2BG1 A;  4GN2 A;  1TDG A;  1WYB A;  4JF5 A;  3IHA A;  4DDY A;  1RP5 A;  5EE8 A;  3HLG A;  3PTE A;  5FQQ A;  3OCL A;  4R3J A;  4N92 A;  3HLD A;  3PBQ A;  4RA7 A;  1GA9 A;  1YQS A;  3QNB A;  4S2P A;  4BEN A;  2EXA A;  1HD8 A;  4KG6 A;  4IVI A;  4B4Z A;  2Y2Q A;  1ERQ A;  1NYY A;  4S2N C;  4JPM A;  3AGE A;  2JC7 A;  2JBF A;  4N9K A;  4LV2 A;  1BUL A;  2HP5 A;  5U47 A;  1KVL A;  3DWK A;  5E2F A;  3TSG A;  4BJP A;  2I72 A;  2UWX A;  1QMF A;  1PYY A;  2XH9 A;  3HUO A;  3OC2 A;  4WEJ A;  3QHY A;  5J8X A;  3IH9 A;  4NET A;  4BL2 A;  4DXB A;  2XR0 A;  2EX8 A;  2EXB A;  4R23 A;  3FWL A;  5G18 A;  1IYO A;  4PM7 A;  4IBR A;  1DJC A;  3A3E A;  1SDE A;  3BFG A;  4BD1 A;  1CI9 A;  1YLP A;  3A3I A;  1HTZ A;  3ZNT A;  3PBS A;  2ZQ9 A;  3ZDJ A;  5CXW A;  1JWV A;  2ZQC A;  1FSW A;  1YLW A;  4KQO A;  4QD4 A;  5FI2 A;  4C75 A;  4KZ6 A;  3ISG A;  1WYC A;  4GDB A;  4WBG A;  4FSF A;  4GDN A;  1S0W A;  4DE3 A;  1ZG4 A;  4GZB A;  4OLG A;  3A3J A;  5A92 A;  3SH7 A;  3N8S A;  3ZG5 A;  2Y2I A;  3HLW A;  3G2Y A;  1BSG A;  4HBT A;  5HAP A;  2PBY A;  4ZTK A;  4P87 A;  3MKE A;  1BLP A;  4R4S A;  4MBH A;  1SDN A;  3W4P A;  5GL9 A;  5HAQ A;  2OV5 A;  5AQ9 A;  1K6R A;  2Q9N A;  3NCK A;  2XGN A;  4E3L A;  2XQZ A;  3OPL A;  5EOE A;  4B4X A;  3GSG A;  3BFF A;  2X71 A;  3HLB A;  3UE1 A;  1ZG6 A;  1W8Y A;  1PZO A;  2WZZ A;  1LI9 A;  3MFD A;  4XXR A;  1YMS A;  1HVB A;  3N4I A;  2J9O A;  1EI5 A;  3O88 A;  4JXV A;  3ZG9 B;  2A3U A;  1K4F A;  5FI6 A;  1BZA A;  3IT9 A;  2ZQD A;  2X02 A;  1M40 A;  2R9W A;  1DJA A;  3SOI A;  3PBN A;  4FCF A;  4D2O A;  5F1F A;  3G34 A;  3BEB A;  5DF8 A;  4KZB A;  1L0G A;  4OOY A;  2WKE A;  4E3N A;  4PM9 A;  4YFM A;  4DE1 A;  4S2M A;  4LV1 A;  5JYP A;  3ZG7 B;  5A91 A;  3HUN A;  4UHU A;  3ZGA B;  5EVI C;  4LCM A;  1SHV A;  2PU4 A;  3WS5 A;  4X6T A;  4P85 A;  5DTS A;  3MZD A;  4R4R A;  1TDL A;  2XF3 A;  3UDI A;  3NDE A;  5FQM A;  1PWC A;  1FOF A;  3OCN A;  3P98 A;  5GHZ A;  3WRZ A;  3WS2 A;  2HP6 A;  3W4Q A;  3IWO A;  4E3K A;  2G2U A;  4GNU A;  4KG5 A;  3DTM A;  1Q2P A;  3FKW A;  3UDX A;  3BEC A;  1GA0 A;  3UO9 A;  1GHI A;  1DY6 A;  2JE5 A;  1G6A A;  3I7J A;  3NBL A;  3IWQ A;  2DNS A;  1MKI A;  2WUQ A;  2WGW B;  1Y54 A;  3BM6 A;  1J9M A;  1NY0 A;  1OME A;  4K0W A;  3UN7 A;  3C5A A;  2XFS A;  3WWX A;  3HVF A;  1YMX A;  4WEL A;  4X56 A;  3IF5 A;  1NRF A;  1PW1 A;  4QY6 A;  4GD6 A;  1KDS A;  3M6B A;  4RX2 A;  3EQU A;  2GDN A;  4KZ7 A;  4OQ0 A;  1ES2 A;  2DRW A;  5EEC A;  3IF6 C;  2ZM8 A;  1MWU A;  3BFD A;  1ERO A;  1IYS A;  1NJ4 A;  4IED A;  3SS4 A;  4ZDX A;  3BLM A;  3LO7 A;  4QJG A;  4HBU A;  3Q07 A;  3O86 A;  5HAR A;  1ZC2 A;  2Y2L A;  5CGW A;  2X01 A;  1O7E A;  3IXH A;  4OP8 A;  1K55 A;  3MKF A;  1W8Q A;  5HX9 A;  1BT5 A;  5TFQ A;  3UPO A;  1I5Q A;  2DCF A;  4GD8 A;  1ONH A;  4OP5 A;  3W4O A;  3FKV A;  5FAO A;  4DE2 A;  1PI4 A;  3GQZ A;  2XLN A;  4WZ4 A;  4R0Q A;  5KSH A;  4JLF A;  2JCH A;  3Q7V B;  5DF9 A;  3M2J A;  3FZC A;  5HL1 A;  2ZC5 B;  4QU3 A;  1TVF A;  1IKI A;  1CK3 A;  2QMI A;  3VMA A;  3WS0 A;  4MNR A;  5FDH A;  1Q2Q A;  3PAG A;  3A3D A;  4RX3 A;  4Y0O A;  4EBN A;  5FQI A;  4WMC A;  2OLV A;  3G4P A;  5EVI B;  1VM1 A;  5GLB A;  3BYD A;  1XKZ A;  2Y59 A;  5GLD A;  2ZMA A;  3NIA A;  4IVK A;  3E2L A;  1N4O A;  4Y0U A;  2Y2K A;  3HBR A;  2C5W B;  1ES3 A;  1BUE A;  1IYQ A;  2WK0 A;  3Q82 A;  5EUA A;  3V50 A;  3ZG0 A;  4NK3 A;  3JYI A;  3ZVT A;  2XFT A;  1KE4 A;  4KZA A;  4DRT A;  3PAE A;  3VP4 A;  3RJU A;  1FCM A;  4X53 A;  3NI9 A;  3VSL A;  4PM6 A;  4WYY A;  1MPL A;  4FH4 A;  4WEK A;  1JVJ A;  2H5S A;  2Y2G A;  2HP9 A;  3WS4 A;  3M2K A;  4C3Q A;  3G31 A;  5CHJ A;  4WM9 A;  5DTT A;  4E6W A;  5FAT A;  1K4E A;  2XDM A;  3BRM A;  3CMZ A;  1IEL A;  4E3I A;  1H5X A;  3MXS A;  4KZ4 A;  3UDF A;  2WGI A;  1K25 A;  3IHB A;  3HLE A;  4OON A;  4B88 A;  1ALQ A;  5DVA A;  4CJN A;  5L2F A;  1YLT A;  3VP3 A;  2QPN A;  3GR2 A;  2RL3 A;  1CEG A;  2ZJ9 A;  4PMA A;  4P0M A;  3UE0 A;  1M6K A;  5CHM A;  1PW8 A;  3IH8 A;  3IXG A;  3IF6 B;  2XK1 A;  5GLA A;  4S2N A;  2EX2 A;  1K54 C;  4DDS A; 
#chains in the Genus database with same CATH topology
 1XPB A;  2L0W A;  3OZH A;  4UA7 A;  3UNW A;  1E4D A;  1K57 C;  2EX9 A;  2LB9 A;  3A0S A;  5FQK A;  3EQV A;  4NXF A;  1L0F A;  5D3O A;  2HGV A;  4E6X A;  3HLF A;  4BBV A;  1D06 A;  5A90 A;  2XRO A;  4E3O A;  5CGS A;  2O9B A;  3UPN A;  4QY5 A;  4LLO B;  4P6Z S;  2Y2J A;  2Y2N A;  3AGF A;  4KQR A;  1Z6F A;  3PBR A;  2DMW A;  4OPR A;  3HUM A;  3P01 A;  3ITB A;  3E4Q A;  5M19 A;  2M1C A;  3LIC A;  4ZBE A;  4F94 A;  5HW3 A;  4HOI A;  3BW6 A;  3T4S A;  5F83 A;  2H0Y A;  5IHV A;  1YT4 A;  2Y2O A;  4WUJ A;  4R70 A;  4LCL A;  5E2H A;  1H8Y A;  3MMH A;  2B5R A;  1G5U A;  2WKQ A;  4JF4 A;  5CED A;  2Y4A A;  1TD5 A;  5FA7 A;  2Z6D A;  2Z2M B;  4B93 A;  2VKS A;  4DMZ A;  4Z1W A;  1GHM A;  5EM0 A;  5EVI A;  3UY6 A;  4O8G A;  1O07 A;  4CLC A;  1W5D A;  4EV4 A;  2PU2 A;  2ZM0 A;  3FPW A;  4PM8 A;  1KOU A;  1CI8 A;  1C3B A;  3EGD C;  3KSH A;  3NJA A;  5F6A A;  2C6W B;  1Y28 A;  2V1Z A;  3CHW P;  4L9F A;  4GS9 A;  1DP9 A;  4ME4 A;  1S67 L;  1NRJ A;  1X0O A;  2V9A A;  4EW7 A;  4HQA A;  3UB9 A;  3VOL A;  2L4R A;  4EWF A;  5CER A;  1BLC A;  2QZ6 A;  3BQ8 A;  4X25 A;  5CEB A;  1IYP A;  3PBO A;  5IU1 A;  1I2W A;  1XXM A;  3NY4 A;  5FSR A;  4EUZ A;  2ZQ7 A;  3VP2 A;  4NXE A;  4FH2 A;  2IA2 A;  1JTG A;  3P09 A;  4RYE A;  1DP8 A;  3EWK A;  2G7U A;  1T1A A;  4YWZ A;  4BLM A;  3CZD A;  4X1M A;  3O5Y A;  1NLY A;  4HJ3 A;  1LHY A;  4DN0 A;  5HD3 A;  3T4Q A;  4FD8 A;  2ZC7 A;  3LIE A;  2ZQ8 A;  1ES4 A;  3MZF A;  1K0K A;  1L2S A;  4PAU A;  3LIB A;  1TF1 A;  2WAD A;  4MN6 A;  1K55 C;  4IBX A;  3VFH A;  3CIT A;  4MMN A;  4LV0 A;  4ZRR A;  5DF7 A;  4MEZ A;  1EWZ A;  4A5R A;  1JTD A;  1T1B A;  1K54 A;  2IWB A;  3LR5 A;  4S2L A;  1KE0 A;  4EES A;  1NLZ A;  1YLY A;  1VET B;  4II7 A;  5DJU A;  4LPZ A;  2Z2L B;  2A2L A;  4GKU A;  2Y2H A;  4E3J A;  4GHI B;  2JKG A;  3C2W A;  2ACG A;  5AQA A;  1N9B A;  1MBL A;  2ZOH A;  1PI5 A;  5FI7 A;  4AFI A;  3G32 A;  1PWG A;  3EGX C;  3MXR A;  2W3D A;  2R9X A;  2MJ6 A;  4ZJ3 A;  1MWT A;  4JF5 A;  1T18 A;  4DDY A;  2GJ3 A;  5FQQ A;  3H9W A;  3PBQ A;  3QNB A;  4BEN A;  2EXA A;  2VGL S;  2D02 A;  1ERQ A;  2JBF A;  4N9K A;  4BJP A;  4UQI S;  2YKH A;  4LFU A;  2XR0 A;  2EX8 A;  2EXB A;  4R23 A;  2V8F A;  1HTZ A;  2VX8 A;  3NOP C;  2W27 A;  2BAS A;  4KQO A;  4QD4 A;  5FI2 A;  1WYC A;  3LI9 A;  5HWV A;  4OLG A;  3A3J A;  4JGO A;  3HLW A;  3MKE A;  4R4S A;  3B47 A;  5GL9 A;  2OV5 A;  3B33 A;  2PD8 A;  2WKR A;  3BFF A;  1UGU A;  4LRZ E;  2WZZ A;  4JXV A;  2EA9 A;  4HH3 A;  4HP4 A;  5FI6 A;  3IT9 A;  2X02 A;  3QP2 A;  4EEP A;  3PBN A;  2GZA A;  2WKE A;  4E3N A;  2ZMV A;  5A91 A;  1NWZ A;  1ACF A;  4X6T A;  1TDL A;  1VET A;  1PWC A;  4JGQ A;  3IWO A;  4GHI A;  3MQ0 A;  4D60 A;  1GHI A;  2JE5 A;  1CJF A;  1MKI A;  2WUQ A;  1OME A;  4G3W A;  3C5A A;  1CF0 A;  2XFS A;  3WWX A;  4WEL A;  4X56 A;  1OTI A;  3U2A A;  3IF5 A;  4DJ2 A;  3BJN A;  1KDS A;  4HHD A;  4I3J A;  4RX2 A;  3EQU A;  2ZM8 A;  1ERO A;  4Y13 A;  4IED A;  4HBU A;  2YKF A;  3Q07 A;  1YSQ A;  5TFQ A;  2B02 A;  2XLN A;  1N9O A;  1VHM A;  4R0Q A;  2OAQ 1;  5KSH A;  2ZC5 B;  3PXP A;  3VMA A;  3WS0 A;  5TBM B;  4RX3 A;  4IJG A;  4WMC A;  2A24 B;  3BYD A;  3RH8 B;  3E2L A;  4Y0U A;  1ES3 A;  2PYR A;  2WK0 A;  2INW A;  3ZG0 A;  4P6Z M;  3QP1 A;  2JKR I;  4DRT A;  3G6O A;  3PAE A;  3VE3 A;  3F1O B;  5F69 A;  1ZTU A;  4PM6 A;  2PR6 A;  4FH4 A;  2Y2G A;  2HP9 A;  3WS4 A;  3GDI A;  4WM9 A;  5IS1 A;  3V67 A;  3CMZ A;  3BRM A;  4E3I A;  2WGI A;  1K25 A;  3IHB A;  4ETX A;  3VP3 A;  2QPN A;  3GR2 A;  3KX0 X;  1CEG A;  4O01 A;  4PMA A;  5CHM A;  1M6K A;  2O0Y A;  3IF6 B;  4DDS A;  3DTI A;  1S1Z A;  3SS5 A;  3P7N A;  3LCE A;  2WGV A;  4JXW A;  5FQ9 A;  3QP8 A;  4E3M A;  1PIO A;  1FR6 A;  3KSF A;  1XX2 A;  4EBP A;  3AGD A;  3HCY A;  4S2K A;  2LB5 A;  4UA6 A;  1J3W A;  1I2S A;  1LT0 A;  1PZP A;  5HAI A;  5L09 A;  4Y3I A;  2PT7 A;  4OVD A;  3CG5 A;  1KGG A;  1OPX A;  3IQA A;  1KE3 A;  3IX8 A;  3IWI A;  4PKY G;  1F2K A;  2B18 A;  4MBK A;  4XUX A;  1K56 A;  2WAE A;  2W3F A;  1W79 A;  4I3I A;  4Q8I A;  1RGY A;  5CTN A;  4DJ3 A;  2J3T D;  4YNR A;  1LI0 A;  5F68 A;  2PRF A;  1UWP X;  5E2E A;  3T4T A;  3BFE A;  2NUT C;  4KUK A;  3G35 A;  3LGO A;  3IX3 A;  4WZ5 A;  1ONG A;  3B42 A;  5TBM A;  1ES5 A;  2A24 A;  2EWW A;  2V0U A;  1FCO A;  2HJ9 C;  1MZU A;  3E2K A;  1S6R A;  4OQH A;  5L8M A;  5C5K A;  3SZT A;  3NC8 A;  2XEP A;  1IOU A;  1ESI A;  3F1O A;  3LIF A;  2PD7 A;  2ZQA A;  4X1L A;  3ZHH A;  1XP4 A;  1AXB A;  4I39 A;  4M3K A;  4U0T A;  1HLU P;  1A0K A;  4X68 A;  3OPR A;  2Y91 A;  2HDU A;  1JWZ A;  5K5B A;  5F5Y A;  2H10 A;  3IF6 A;  2FZ0 A;  1UWN X;  1ERM A;  1E3U D;  5HZH A;  3D4F A;  1OJ5 A;  3N8R A;  1XFN A;  4JXG A;  4OPZ A;  4M4X A;  2XD1 A;  2W3G A;  5DTK A;  5EVL A;  3DW0 A;  2OOL A;  1H0M A;  4O7D A;  2HDQ A;  3T1S A;  4ID4 A;  4U3T A;  4Q0J A;  4EBL A;  4PHT A;  3FYZ A;  3FC7 A;  3T12 B;  5EOO A;  1ESU A;  3SW1 A;  3E4O A;  2AVX A;  2ZC4 B;  3DTK A;  1JNU A;  2K2N A;  3C4P A;  5CRF A;  3UB7 A;  2O99 A;  1OTD A;  4UAA A;  2J3T C;  3C30 A;  4N1X A;  2VGL M;  3CUE A;  5HDC A;  3VSK A;  3L7H A;  2WKH A;  4H8R A;  4Q0H A;  3N8L A;  3BLS A;  4UQI M;  3TOI A;  4DKI A;  3HLC A;  2EFU A;  5CX7 A;  2V0W A;  2ZC6 B;  2L1M A;  1K57 A;  5DFY A;  2EFX A;  2BTF P;  5DFX A;  4OQI A;  2WYX A;  4O0P A;  4KZ5 A;  2J9P A;  3SH8 A;  2J3W A;  3M6H A;  4X69 A;  3N7W A;  4EQ1 A;  5CTM A;  1S4R A;  1GCE A;  2QJ5 A;  2A49 A;  1BTL A;  3ZVW A;  3UE3 A;  1LL9 A;  1XJ4 A;  1GSV A;  4LGW A;  1JWP A;  4Y17 A;  1TDG A;  1WYB A;  3UB6 A;  3IHA A;  3NHQ A;  1RP5 A;  3PTE A;  3OCL A;  3MF0 A;  4RA7 A;  4S2P A;  1GA9 A;  1OT9 A;  1NYY A;  2XA7 S;  2HJE A;  1KVL A;  1XFQ A;  1PYY A;  2XH9 A;  3HUO A;  2B95 A;  4DXB A;  5EFW A;  2KX6 A;  5G18 A;  4NEE D;  1SZV A;  1DJC A;  3A3E A;  1SDE A;  1YLP A;  3HJI A;  2KOI A;  2ZQ9 A;  5CXW A;  2M7U A;  4C75 A;  4KZ6 A;  2K7S A;  3ISG A;  4WBG A;  4GDB A;  4GDN A;  1ZG4 A;  3SH7 A;  3N8S A;  3ZG5 A;  3LYX A;  5HAP A;  4HBT A;  1F9I A;  1IFQ A;  3W4P A;  1DP6 A;  5G4Y A;  5AQ9 A;  1K6R A;  2V8C A;  1PNE A;  3H7W A;  2VJW A;  5EOE A;  1FIL A;  4B4X A;  3GSG A;  2X71 A;  3CAX A;  4GW9 A;  1BZA A;  5HD5 A;  4F3L B;  1M40 A;  2R9W A;  4FCF A;  4D2O A;  3BEB A;  2W1T A;  3LR0 A;  4PM9 A;  4YFM A;  4S2M A;  4UHU A;  4LCM A;  1SHV A;  2PU4 A;  4P85 A;  4R4R A;  4BMW A;  2XF3 A;  3T1R A;  5FQM A;  3OCN A;  1XJ3 A;  5EV0 A;  1PRQ A;  2HP6 A;  4WL9 A;  3DTM A;  3FKW A;  3BEC A;  1BYW A;  3HVF A;  2Y79 A;  3S7O A;  4QY6 A;  4R6L A;  3M6B A;  1Y4O A;  5KIZ A;  4KZ7 A;  1PFL A;  5EEC A;  3F1P A;  4ZDX A;  3LO7 A;  4NG2 A;  5HWW A;  3T1X A;  4OP8 A;  3IXH A;  4NKP A;  1K55 A;  1W8Q A;  1S66 L;  1BT5 A;  1I5Q A;  2R78 A;  4GD8 A;  5FAO A;  3GQZ A;  3K2N A;  4R38 A;  4JLF A;  3Q7V B;  5DF9 A;  5HL1 A;  3FZC A;  4QU3 A;  3U4L P;  2QMI A;  4MNR A;  5FDH A;  4B9O A;  2PYP A;  2GX5 A;  3NIA A;  1YSP A;  4IVK A;  1N4O A;  3V50 A;  4NK3 A;  3JYI A;  3RJU A;  4X53 A;  3ZQ5 A;  3MQO A;  1MKM A;  4WYY A;  3ULF A;  3VV4 A;  4F3L A;  5DTT A;  1K4E A;  2XDM A;  1H5X A;  3UDF A;  3LR4 A;  1YLT A;  3KYZ A;  2ZJ9 A;  4IUK A;  2WKP A;  3UE0 A;  3IH8 A;  3C8C A;  2PHY A;  3FG8 A;  2E8I A;  1F98 A;  3R4K A;  4Z9Q A;  3GMW A;  4JF6 A;  4OOL A;  4LV3 A;  1K56 D;  1YLJ A;  5HFO A;  4JXS A;  1IKG A;  2QJ7 A;  1NZU A;  3HL9 A;  2PAV P;  2P7J A;  2PDR A;  5GLC A;  2FFY A;  4P6B A;  3T4K A;  4CPK A;  1FR1 A;  4K91 A;  3GRJ A;  4BL3 A;  4QHC A;  1L0E A;  1STZ A;  1SKF A;  4MBF A;  3T4J A;  3VOZ A;  4ZJ1 A;  3ZCZ A;  3KSI A;  3UE6 A;  1FCN A;  2FFF B;  4BD0 A;  1XJ6 A;  3CJM A;  1AWI A;  1FQG A;  3Q7V A;  3MZE A;  1YLZ A;  2P9V B;  2ZC3 B;  4HY8 A;  1K38 A;  4OLD A;  4XT2 B;  3MR0 A;  2ZL1 B;  1HZO A;  3LY3 A;  3KO6 A;  4MLL A;  1XGI A;  2ZBB A;  3RXX A;  4Y7P A;  2JN7 A;  4OH0 A;  3C7U A;  4S2O A;  3A0V A;  1LSV A;  3OOV A;  4OQG A;  3G2Z A;  5BOH A;  2ZLY A;  2WAF A;  3V5M A;  4DE0 A;  2WKI A;  1L3L A;  1D1J A;  5A93 A;  2P08 A;  3E98 A;  3MQQ A;  3NUL A;  4GOG A;  5HWT A;  2Q0O A;  3GV9 A;  2HPB A;  3CWF A;  4FOF A;  3ICY A;  5FAP A;  1CQA A;  2OLU A;  3HRE A;  3VOY A;  3VP0 A;  4LEN A;  3ZG8 B;  1NYM A;  3LEZ A;  3O3V A;  1BLS A;  3Q81 A;  4U0X A;  4DXC A;  5GHY A;  3K3C A;  4IHQ A;  5I94 A;  1KDW A;  4S2I A;  4OPQ A;  1RCJ A;  1KGF A;  1KVM A;  3DAV A;  3KYE A;  5TR7 A;  1NZO A;  2VV6 A;  1U60 A;  3LY4 A;  4KG2 A;  3E4P A;  4X55 A;  5TJJ A;  3S4X A;  4QPR A;  4OKP A;  1IEM A;  4K0X A;  3BQA A;  5KZH A;  1GHP A;  5CGX A;  3IS2 B;  5JYO A;  1PWD A;  4YIN A;  3H82 A;  4WZ5 C;  3W8K A;  2VGK A;  3NOU C;  2V2F F;  1NXY A;  3UB5 P;  1MWR A;  1LL5 A;  3QP5 A;  4BBT A;  4EQI A;  2EX6 A;  5E43 A;  2P9V A;  3UMD A;  5LBR A;  4XT2 A;  4PPR A;  3R7W B;  1S4S A;  1VEU A;  5EVI D;  3S7N A;  2ZL1 A;  5KMW A;  3D9Y A;  2V20 A;  3RXW A;  3UPP A;  4CLC D;  2Y55 A;  2J80 A;  3B3X A;  1TEM A;  3GVB A;  3EOI A;  3TG9 A;  4XUZ A;  1P0Z A;  3IXB A;  3LEQ A;  2M7V A;  2BLS A;  3T4O A;  3TE8 A;  4N9L A;  2BG1 A;  3UME A;  2UV0 E;  3D3O A;  1N9N A;  3HLG A;  3QP4 A;  4N92 A;  3HLD A;  3CLO A;  1TS0 A;  1HD8 A;  4IVI A;  4S2N C;  4JPM A;  3AGE A;  2JC7 A;  5U47 A;  1P97 A;  2W0N A;  3DWK A;  5E2F A;  2I72 A;  4WEJ A;  1QMF A;  5J8X A;  3QHY A;  3IBR A;  4NET A;  4BL2 A;  1D7E A;  3FWL A;  2EWV A;  2Y8H A;  4IBR A;  3BFG A;  4HH2 A;  4L9G A;  3ZDJ A;  4FSF A;  4DE3 A;  5A92 A;  2Y2I A;  1BSG A;  2PBY A;  3BWL A;  1BLP A;  1MC0 A;  5HAQ A;  4IUH A;  2XSS A;  4R3A A;  2Q9N A;  3IS2 A;  3TRC A;  3OPL A;  3HLB A;  1LSX A;  1LI9 A;  3MFD A;  4JGR A;  4WF0 A;  1YMS A;  4MN5 A;  2J9O A;  1LSW A;  3O88 A;  3RTY A;  3QP6 A;  3EEA A;  1TS6 A;  3LR3 A;  2ZQD A;  3H7W B;  1LL8 A;  4Y5F A;  3CI6 A;  5F1F A;  2OWJ A;  4OOY A;  5A8B A;  3R7W A;  4DE1 A;  1GSW A;  4QWO A;  2KDK A;  1T1C A;  5JYP A;  4I38 A;  4BWI A;  3PYP A;  5EVI C;  3TW8 A;  5DTS A;  2OAP 1;  4CLC C;  2W1T B;  3P98 A;  5GHZ A;  3WRZ A;  3W4Q A;  1OT6 A;  3C38 A;  4E3K A;  2P04 A;  3UDX A;  5AVF A;  3UO9 A;  1DY6 A;  2Z6C A;  3NBL A;  3IWQ A;  2DNS A;  2WGW B;  1Y54 A;  3BM6 A;  5FEG A;  1NY0 A;  4K0W A;  1YMX A;  2HV1 A;  1NRF A;  3D72 A;  4NXG A;  2NUP C;  4GD6 A;  3CPT B;  3IBJ A;  1P9R A;  2GDN A;  4OQ0 A;  1T19 A;  2DRW A;  4HNB A;  3BFD A;  1NJ4 A;  3SS4 A;  4QJG A;  3LIA A;  2QKP A;  5HAR A;  1ZC2 A;  3LI8 A;  3NOT C;  2X01 A;  3MKF A;  4RQ9 A;  4OP5 A;  3FKV A;  4WZ4 A;  3F1P B;  4ETZ A;  1CK3 A;  4EXO A;  1G28 A;  3PAG A;  3A3D A;  4Y0O A;  1TS7 A;  4YOF A;  5FQI A;  4EBN A;  2OLV A;  2ZMA A;  2JKT I;  2Y2K A;  3HBR A;  2HZ5 A;  1IYQ A;  5EUA A;  3ZVT A;  2XFT A;  4KZA A;  4MCW A;  5FDS A;  3VSL A;  4LRX C;  1MPL A;  4WEK A;  3OBF A;  1JVJ A;  2H5S A;  3ZYT A;  4I3A A;  3G31 A;  5CHJ A;  2VLG A;  4E6W A;  2QYB A;  3MXS A;  4OON A;  5DVA A;  5L2F A;  5HPF A;  4HJ4 A;  1PW8 A;  3IXG A;  2GNX A;  2XK1 A;  5GLA A;  1K54 C;  1L0G A;  1E3U A;  4ZJ2 A;  1L0D A;  4HEF A;  1CEF A;  3C4O A;  3BY8 A;  4G3V A;  4CLC E;  1G68 A;  2JKR M;  5AQ7 A;  2ZD8 A;  4EU0 A;  1N9L A;  5M1A A;  2WGW A;  3QNC A;  5F1G A;  4KUO A;  4GB7 A;  5GHX A;  3UB8 A;  4CQH A;  5L10 A;  1FIK A;  1W7F A;  3CPT A;  4WN5 A;  4KQD A;  3T50 A;  4JKT A;  3ZNY A;  4ZAM A;  2ZM2 A;  3T4L A;  2H0T A;  2XD5 A;  4WLA A;  3S1Y A;  3VP1 A;  4OOM A;  5DJT A;  2PR5 A;  3G30 A;  3GTC A;  2FH5 A;  2QWS A;  5KSC A;  2WZX A;  3DWZ A;  4KZ9 A;  2Q9M A;  4S2J A;  3JVU A;  1DRM A;  5J4E A;  1W63 M;  5J3W A;  3WRT A;  2P74 A;  2W3H A;  3N6I A;  4L0L A;  5M18 A;  1K6S A;  2Y2P A;  1TS8 A;  3S22 A;  3BFC A;  4WMC D;  5AQB A;  4JGP A;  2K31 A;  1MXO A;  2G2W A;  3A3F A;  1EW0 A;  4KEN B;  4HIA A;  1ZKJ A;  3WS1 A;  2E8J A;  3A0R A;  5HDS A;  5CEC A;  5I5L A;  3MS6 A;  3ITA A;  2W3E A;  4PM5 A;  2QHK A;  1VQQ A;  3PBT A;  1E25 A;  2D01 A;  5AVE A;  3VE4 A;  3MBZ A;  4UA9 A;  3NDG A;  4KQQ A;  1YKD A;  4KZ3 A;  2VV8 A;  2OSU A;  5L07 A;  2RCX A;  5CHU A;  4Q0I A;  1W63 Q;  4FUW A;  3IXD A;  2Y2M A;  3VFF A;  2ZMF A;  5EPH A;  4BQM A;  4RVA A;  2HDR A;  1KGE A;  2V1B A;  3RFB A;  4Y15 A;  4QB8 A;  2CC1 A;  1BLH A;  1H3Q A;  2OWH A;  3C7V A;  5FL3 A;  4KZ8 A;  3V3R A;  4HJ6 A;  2IWC A;  5FAS A;  3V39 A;  3F1N B;  5E2G A;  5EVE A;  1WE4 A;  4HES A;  3O87 A;  1XA1 A;  4HI4 A;  5F82 A;  4EEU A;  1VB6 A;  4DF6 A;  3MXQ A;  2IWD A;  5FAQ A;  5FQJ A;  5AJG A;  1FSY A;  1DJB A;  2KLI A;  4C6Y A;  4R1G A;  1QME A;  1XA7 A;  3SH9 A;  5FEF A;  3FPV A;  2VA0 A;  1XGJ A;  3ZFZ A;  1LLB A;  1MY8 A;  3DBA A;  2H28 A;  1H8Z A;  3FV7 A;  4LRY C;  3EEH A;  4ARZ B;  4N1H A;  4OPY A;  4R3B A;  5EM1 A;  3H82 B;  3Q1F A;  3L9K A;  5HPI A;  3SS3 A;  2HDS A;  1SCW A;  3IX4 A;  3OPP A;  4Y0T A;  1RGZ A;  2VZW A;  5TGF A;  2J7V A;  4GLQ A;  2ZOI A;  3V3S A;  1VEU B;  2J8Y A;  1YM1 A;  4EET B;  1MWS A;  3Q7Z A;  3OPH A;  1OTB A;  4JBF A;  4K08 A;  2VGJ A;  4GN2 A;  3NEC A;  5EE8 A;  4R3J A;  4MDZ A;  5HDD A;  4NXB A;  1YQS A;  2V1A A;  4GCZ A;  3OLO A;  4KG6 A;  4B4Z A;  2Y2Q A;  4LV2 A;  1BUL A;  2HP5 A;  3TSG A;  2UWX A;  1ZHH B;  3OC2 A;  3IH9 A;  1IYO A;  4PM7 A;  4BD1 A;  1CI9 A;  3A3I A;  3ZNT A;  1Z09 A;  3PBS A;  1JWV A;  2ZQC A;  1FSW A;  3W2Z A;  1YLW A;  3F1N A;  4H6J B;  1S0W A;  4GZB A;  4EUV A;  2JKF A;  3G2Y A;  4ZTK A;  4P87 A;  4MBH A;  1SDN A;  2JHE A;  3NCK A;  4E3L A;  2XGN A;  2XQZ A;  3KSG A;  3UE1 A;  1ZG6 A;  2HF6 A;  1W8Y A;  1PZO A;  4XXR A;  1HVB A;  3N4I A;  1EI5 A;  3ZG9 B;  1V9Y A;  2A3U A;  3PHY A;  3JVV A;  1K4F A;  1ODV A;  2XRN A;  1DJA A;  1SKO B;  3SOI A;  3MJQ A;  2W1R A;  1P9W A;  3G34 A;  5DF8 A;  1GSX A;  4ARZ A;  4KZB A;  2PBD P;  2JKT M;  3MSH A;  3DTE A;  3S7Q A;  4G3K A;  3HJK A;  4LV1 A;  1OJG A;  3GEC A;  3ZG7 B;  2XA7 M;  3HUN A;  3K3D A;  3ZGA B;  2VV7 A;  3WS5 A;  1YPR A;  3MZD A;  5DKL A;  2O9C A;  3LUQ A;  4BBU A;  4GJ4 A;  4I5S A;  3NDE A;  3UDI A;  1FOF A;  4L9E A;  3WS2 A;  2G2U A;  4GNU A;  4KG5 A;  1Q2P A;  1S1Y A;  4PKY A;  4FTX A;  1GA0 A;  1G6A A;  3I7J A;  1J9M A;  3UN7 A;  5DKK A;  4UEY A;  1WA9 A;  1V9Z A;  1F5M A;  1PW1 A;  3PR6 A;  3KYQ A;  2I9V A;  1G6O A;  1ES2 A;  2VEA A;  3T1Q B;  3IF6 C;  1MWU A;  1YAX A;  1IYS A;  3BLM A;  4HP9 A;  3MFX A;  3O86 A;  2Y2L A;  4ESP A;  5CGW A;  2VK3 A;  1O7E A;  3LID A;  3S7P A;  5HX9 A;  3UPO A;  2DCF A;  1ONH A;  3W4O A;  2CMN A;  1H8M A;  4DE2 A;  1PI4 A;  3JPU A;  5G4Z A;  2JCH A;  3M2J A;  1TVF A;  5IT5 A;  4H6J A;  1IKI A;  3LFV A;  1XJ2 A;  1Q2Q A;  3TJZ C;  4MN7 A;  3G4P A;  5EVI B;  1VM1 A;  5GLB A;  1XKZ A;  2Y59 A;  5GLD A;  4Y2F A;  5MC7 A;  3Q82 A;  2C5W B;  1BUE A;  5J7E A;  4CLC B;  5HSQ A;  1KE4 A;  3VP4 A;  1FCM A;  3NI9 A;  1OTA A;  5HL6 A;  4EER A;  4C3Q A;  3M2K A;  3BY9 A;  2O9A A;  3CUE C;  3E0Y A;  1SKO A;  5FAT A;  1IEL A;  4KZ4 A;  3HLE A;  4B88 A;  1ALQ A;  4CJN A;  4GS9 B;  2RL3 A;  4P0M A;  1OTE A;  4E04 A;  4S2N A;  2EX2 A; 
#chains in the Genus database with same CATH homology
 1XPB A;  1E3U A;  3OZH A;  4UA7 A;  4ZJ2 A;  3SS5 A;  3UNW A;  1L0D A;  1E4D A;  4HEF A;  1K57 C;  2EX9 A;  1CEF A;  3LCE A;  2E8I A;  3C4O A;  5FQK A;  2WGV A;  4JXW A;  5FQ9 A;  3EQV A;  4Z9Q A;  1L0F A;  5D3O A;  1PIO A;  4E3M A;  1G68 A;  3GMW A;  4E6X A;  3HLF A;  1FR6 A;  1XX2 A;  5AQ7 A;  3AGD A;  4EBP A;  4S2K A;  5A90 A;  4UA6 A;  4JF6 A;  2ZD8 A;  4OOL A;  4LV3 A;  1K56 D;  1I2S A;  5M1A A;  1PZP A;  1YLJ A;  4JXS A;  5CGS A;  5HAI A;  5HFO A;  1IKG A;  2WGW A;  4E3O A;  3QNC A;  5F1G A;  3UPN A;  1NZU A;  4OVD A;  3HL9 A;  4QY5 A;  4GB7 A;  5GHX A;  3CG5 A;  1KGG A;  2Y2J A;  3IQA A;  2Y2N A;  3AGF A;  4KQR A;  1KE3 A;  1Z6F A;  2FFY A;  3PBR A;  5GLC A;  1W7F A;  3IWI A;  4P6B A;  4MBK A;  4CPK A;  4OPR A;  4XUX A;  1FR1 A;  3HUM A;  4K91 A;  1K56 A;  2WAE A;  3GRJ A;  4JKT A;  3ITB A;  3ZNY A;  4ZAM A;  4BL3 A;  5M19 A;  2ZM2 A;  4QHC A;  1L0E A;  1W79 A;  2H0T A;  1SKF A;  4ZBE A;  4F94 A;  4MBF A;  2XD5 A;  3VOZ A;  5HW3 A;  4ZJ1 A;  3ZCZ A;  4Q8I A;  1RGY A;  3S1Y A;  3VP1 A;  5CTN A;  4OOM A;  3G30 A;  3GTC A;  5M18 A;  1LI0 A;  5F83 A;  2H0Y A;  5IHV A;  1FCN A;  2FFF B;  5KSC A;  2WZX A;  3DWZ A;  4KZ9 A;  5E2E A;  1YT4 A;  4BD0 A;  2Y2O A;  2Q9M A;  3BFE A;  3CJM A;  4LCL A;  5E2H A;  1H8Y A;  4S2J A;  1FQG A;  2B5R A;  4JF4 A;  3Q7V A;  3G35 A;  5CED A;  2Y4A A;  3WRT A;  3MZE A;  1YLZ A;  2P74 A;  3N6I A;  2P9V B;  4L0L A;  4WZ5 A;  5FA7 A;  1K6S A;  2ZC3 B;  1K38 A;  1ONG A;  4OLD A;  2Z2M B;  2Y2P A;  1ES5 A;  3S22 A;  3BFC A;  1GHM A;  5EVI A;  3UY6 A;  4WMC D;  5AQB A;  1FCO A;  1HZO A;  1MXO A;  2G2W A;  3LY3 A;  4MLL A;  3A3F A;  1XGI A;  3E2K A;  1S6R A;  3RXX A;  1O07 A;  4OQH A;  4Y7P A;  4OH0 A;  3C7U A;  4S2O A;  4KEN B;  1W5D A;  1ZKJ A;  3NC8 A;  3WS1 A;  2XEP A;  4EV4 A;  1ESI A;  4OQG A;  3G2Z A;  2PU2 A;  5CEC A;  5BOH A;  3ITA A;  2ZM0 A;  4PM8 A;  2ZLY A;  2WAF A;  2ZQA A;  3V5M A;  4PM5 A;  4DE0 A;  3ZHH A;  1XP4 A;  2WKI A;  1CI8 A;  1AXB A;  1C3B A;  1VQQ A;  5A93 A;  3PBT A;  1E25 A;  4M3K A;  4U0T A;  4GOG A;  3MBZ A;  3GV9 A;  4X68 A;  3OPR A;  4UA9 A;  2C6W B;  2HPB A;  2V1Z A;  2Y91 A;  3NDG A;  4KQQ A;  2HDU A;  1JWZ A;  4KZ3 A;  2OSU A;  5FAP A;  2OLU A;  2H10 A;  3IF6 A;  3HRE A;  2RCX A;  1ERM A;  5CHU A;  3VOY A;  3VP0 A;  1E3U D;  4LEN A;  4EWF A;  3D4F A;  5CER A;  3IXD A;  3ZG8 B;  1BLC A;  1NYM A;  2QZ6 A;  3N8R A;  3LEZ A;  3O3V A;  1BLS A;  2Y2M A;  3VFF A;  5CEB A;  1IYP A;  3PBO A;  5EPH A;  3Q81 A;  1I2W A;  4JXG A;  4RVA A;  2HDR A;  4BQM A;  1KGE A;  4U0X A;  4DXC A;  1XXM A;  4OPZ A;  3NY4 A;  5FSR A;  4EUZ A;  2ZQ7 A;  4QB8 A;  5GHY A;  2CC1 A;  3VP2 A;  1BLH A;  2XD1 A;  5I94 A;  5DTK A;  5EVL A;  1KDW A;  4S2I A;  4OPQ A;  3C7V A;  3DW0 A;  3V3R A;  4KZ8 A;  4FH2 A;  1RCJ A;  1KGF A;  1KVM A;  2IWC A;  2HDQ A;  4O7D A;  5FAS A;  1JTG A;  4ID4 A;  3P09 A;  4RYE A;  4U3T A;  1NZO A;  5TR7 A;  3V39 A;  1U60 A;  3LY4 A;  4KG2 A;  4EBL A;  3FYZ A;  5E2G A;  4BLM A;  3CZD A;  5EOO A;  1ESU A;  1WE4 A;  4X55 A;  4HES A;  3O87 A;  1XA1 A;  3S4X A;  4OKP A;  1IEM A;  4K0X A;  1LHY A;  5KZH A;  2ZC4 B;  1GHP A;  5CGX A;  5F82 A;  4DF6 A;  3C4P A;  4FD8 A;  5JYO A;  2IWD A;  2ZC7 A;  5FAQ A;  2ZQ8 A;  5FQJ A;  1ES4 A;  1FSY A;  1DJB A;  1PWD A;  3MZF A;  5CRF A;  4YIN A;  4C6Y A;  4R1G A;  1L2S A;  1QME A;  1XA7 A;  4UAA A;  4WZ5 C;  3SH9 A;  2WAD A;  4N1X A;  3W8K A;  2VGK A;  1K55 C;  2V2F F;  4IBX A;  3VFH A;  1NXY A;  3VSK A;  1MWR A;  2WKH A;  1LL5 A;  4H8R A;  4EQI A;  1XGJ A;  3ZFZ A;  3N8L A;  3BLS A;  1LLB A;  1MY8 A;  2EX6 A;  4LV0 A;  1H8Z A;  3FV7 A;  5E43 A;  5DF7 A;  4MEZ A;  2P9V A;  1EWZ A;  4N1H A;  3TOI A;  4OPY A;  4R3B A;  4A5R A;  4DKI A;  1JTD A;  3Q1F A;  3HLC A;  4PPR A;  2EFU A;  1K54 A;  2IWB A;  3SS3 A;  4S2L A;  5EVI D;  2ZC6 B;  5KMW A;  1KE0 A;  1K57 A;  2HDS A;  1SCW A;  2V20 A;  3RXW A;  3UPP A;  1YLY A;  3OPP A;  2EFX A;  4Y0T A;  2Y55 A;  1RGZ A;  3B3X A;  4OQI A;  1TEM A;  2Z2L B;  3GVB A;  2WYX A;  4GKU A;  2Y2H A;  2J7V A;  5TGF A;  4KZ5 A;  4E3J A;  2J9P A;  3SH8 A;  3TG9 A;  4XUZ A;  3V3S A;  2J8Y A;  1YM1 A;  3M6H A;  3IXB A;  4X69 A;  3N7W A;  5AQA A;  1N9B A;  1MWS A;  3Q7Z A;  1MBL A;  3OPH A;  5CTM A;  1PI5 A;  4JBF A;  1GCE A;  3G32 A;  5FI7 A;  2BLS A;  1PWG A;  2A49 A;  1BTL A;  3ZVW A;  3UE3 A;  1LL9 A;  3MXR A;  2VGJ A;  2R9X A;  4ZJ3 A;  1MWT A;  4N9L A;  1JWP A;  2BG1 A;  4GN2 A;  1TDG A;  1WYB A;  4JF5 A;  3IHA A;  4DDY A;  1RP5 A;  5EE8 A;  3HLG A;  3PTE A;  5FQQ A;  3OCL A;  4R3J A;  4N92 A;  3HLD A;  3PBQ A;  4RA7 A;  1GA9 A;  1YQS A;  3QNB A;  4S2P A;  4BEN A;  2EXA A;  1HD8 A;  4KG6 A;  4IVI A;  4B4Z A;  2Y2Q A;  1ERQ A;  1NYY A;  4S2N C;  4JPM A;  3AGE A;  2JC7 A;  2JBF A;  4N9K A;  4LV2 A;  1BUL A;  2HP5 A;  5U47 A;  1KVL A;  3DWK A;  5E2F A;  3TSG A;  4BJP A;  2I72 A;  2UWX A;  1QMF A;  1PYY A;  2XH9 A;  3HUO A;  3OC2 A;  4WEJ A;  3QHY A;  5J8X A;  3IH9 A;  4NET A;  4BL2 A;  4DXB A;  2XR0 A;  2EX8 A;  2EXB A;  4R23 A;  3FWL A;  5G18 A;  1IYO A;  4PM7 A;  4IBR A;  1DJC A;  3A3E A;  1SDE A;  3BFG A;  4BD1 A;  1CI9 A;  1YLP A;  3A3I A;  1HTZ A;  3ZNT A;  3PBS A;  2ZQ9 A;  3ZDJ A;  5CXW A;  1JWV A;  2ZQC A;  1FSW A;  1YLW A;  4KQO A;  4QD4 A;  5FI2 A;  4C75 A;  4KZ6 A;  3ISG A;  1WYC A;  4GDB A;  4WBG A;  4FSF A;  4GDN A;  1S0W A;  4DE3 A;  1ZG4 A;  4GZB A;  4OLG A;  3A3J A;  5A92 A;  3SH7 A;  3N8S A;  3ZG5 A;  2Y2I A;  3HLW A;  3G2Y A;  1BSG A;  4HBT A;  5HAP A;  2PBY A;  4ZTK A;  4P87 A;  3MKE A;  1BLP A;  4R4S A;  4MBH A;  1SDN A;  3W4P A;  5GL9 A;  5HAQ A;  2OV5 A;  5AQ9 A;  1K6R A;  2Q9N A;  3NCK A;  2XGN A;  4E3L A;  2XQZ A;  3OPL A;  5EOE A;  4B4X A;  3GSG A;  3BFF A;  2X71 A;  3HLB A;  3UE1 A;  1ZG6 A;  1W8Y A;  1PZO A;  2WZZ A;  1LI9 A;  3MFD A;  4XXR A;  1YMS A;  1HVB A;  3N4I A;  2J9O A;  1EI5 A;  3O88 A;  4JXV A;  3ZG9 B;  2A3U A;  1K4F A;  5FI6 A;  1BZA A;  3IT9 A;  2ZQD A;  2X02 A;  1M40 A;  2R9W A;  1DJA A;  3SOI A;  3PBN A;  4FCF A;  4D2O A;  5F1F A;  3G34 A;  3BEB A;  5DF8 A;  4KZB A;  1L0G A;  4OOY A;  2WKE A;  4E3N A;  4PM9 A;  4YFM A;  4DE1 A;  4S2M A;  4LV1 A;  5JYP A;  3ZG7 B;  5A91 A;  3HUN A;  4UHU A;  3ZGA B;  5EVI C;  4LCM A;  1SHV A;  2PU4 A;  3WS5 A;  4X6T A;  4P85 A;  5DTS A;  3MZD A;  4R4R A;  1TDL A;  2XF3 A;  3UDI A;  3NDE A;  5FQM A;  1PWC A;  1FOF A;  3OCN A;  3P98 A;  5GHZ A;  3WRZ A;  3WS2 A;  2HP6 A;  3W4Q A;  3IWO A;  4E3K A;  2G2U A;  4GNU A;  4KG5 A;  3DTM A;  1Q2P A;  3FKW A;  3UDX A;  3BEC A;  1GA0 A;  3UO9 A;  1GHI A;  1DY6 A;  2JE5 A;  1G6A A;  3I7J A;  3NBL A;  3IWQ A;  2DNS A;  1MKI A;  2WUQ A;  2WGW B;  1Y54 A;  3BM6 A;  1J9M A;  1NY0 A;  1OME A;  4K0W A;  3UN7 A;  3C5A A;  2XFS A;  3WWX A;  3HVF A;  1YMX A;  4WEL A;  4X56 A;  3IF5 A;  1NRF A;  1PW1 A;  4QY6 A;  4GD6 A;  1KDS A;  3M6B A;  4RX2 A;  3EQU A;  2GDN A;  4KZ7 A;  4OQ0 A;  1ES2 A;  2DRW A;  5EEC A;  3IF6 C;  2ZM8 A;  1MWU A;  3BFD A;  1ERO A;  1IYS A;  1NJ4 A;  4IED A;  3SS4 A;  4ZDX A;  3BLM A;  3LO7 A;  4QJG A;  4HBU A;  3Q07 A;  3O86 A;  5HAR A;  1ZC2 A;  2Y2L A;  5CGW A;  2X01 A;  1O7E A;  3IXH A;  4OP8 A;  1K55 A;  3MKF A;  1W8Q A;  5HX9 A;  1BT5 A;  5TFQ A;  3UPO A;  1I5Q A;  2DCF A;  4GD8 A;  1ONH A;  4OP5 A;  3W4O A;  3FKV A;  5FAO A;  4DE2 A;  1PI4 A;  3GQZ A;  2XLN A;  4WZ4 A;  4R0Q A;  5KSH A;  4JLF A;  2JCH A;  3Q7V B;  5DF9 A;  3M2J A;  3FZC A;  5HL1 A;  2ZC5 B;  4QU3 A;  1TVF A;  1IKI A;  1CK3 A;  2QMI A;  3VMA A;  3WS0 A;  4MNR A;  5FDH A;  1Q2Q A;  3PAG A;  3A3D A;  4RX3 A;  4Y0O A;  4EBN A;  5FQI A;  4WMC A;  2OLV A;  3G4P A;  5EVI B;  1VM1 A;  5GLB A;  3BYD A;  1XKZ A;  2Y59 A;  5GLD A;  2ZMA A;  3NIA A;  4IVK A;  3E2L A;  1N4O A;  4Y0U A;  2Y2K A;  3HBR A;  2C5W B;  1ES3 A;  1BUE A;  1IYQ A;  2WK0 A;  3Q82 A;  5EUA A;  3V50 A;  3ZG0 A;  4NK3 A;  3JYI A;  3ZVT A;  2XFT A;  1KE4 A;  4KZA A;  4DRT A;  3PAE A;  3VP4 A;  3RJU A;  1FCM A;  4X53 A;  3NI9 A;  3VSL A;  4PM6 A;  4WYY A;  1MPL A;  4FH4 A;  4WEK A;  1JVJ A;  2H5S A;  2Y2G A;  2HP9 A;  3WS4 A;  3M2K A;  4C3Q A;  3G31 A;  5CHJ A;  4WM9 A;  5DTT A;  4E6W A;  5FAT A;  1K4E A;  2XDM A;  3BRM A;  3CMZ A;  1IEL A;  4E3I A;  1H5X A;  3MXS A;  4KZ4 A;  3UDF A;  2WGI A;  1K25 A;  3IHB A;  3HLE A;  4OON A;  4B88 A;  1ALQ A;  5DVA A;  4CJN A;  5L2F A;  1YLT A;  3VP3 A;  2QPN A;  3GR2 A;  2RL3 A;  1CEG A;  2ZJ9 A;  4PMA A;  4P0M A;  3UE0 A;  1M6K A;  5CHM A;  1PW8 A;  3IH8 A;  3IXG A;  3IF6 B;  2XK1 A;  5GLA A;  4S2N A;  2EX2 A;  1K54 C;  4DDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...