1IYSA

Crystal structure of class a beta-lactamase toho-1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TOHO-1
publication title Crystal Structure of Extended-Spectrum beta-Lactamase Toho-1: Insights into the Molecular Mechanism for Catalytic Reaction and Substrate Specificity Expansion
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1iysA00
3O88A 4C3QA 5KSHA 1WYCA 3ZHHA 4OQGA 4N9KA 3LO7A 1MBLA 1U60A 4NK3A 4QY6A 5F82A 2ZQAA 4CPKA 1O7EA 4OQ0A 2J7VA 4E6WA 4KZ9A 5CRFA 5CXWA 4Y0OA 3W8KA 1EWZA 3GVBA 1XXMA 3IH8A 4MNRA 4U3TA 1MWUA 3HREA 3G2ZA 3ITAA 2HPBA 5CHMA 5FQMA 3OPRA 3TG9A 1BUEA 4JF4A 1YLTA 1GHMA 2VGJA 2Y2KA 3JYIA 4KQRA 2WKHA 2EX6A 3QHYA 5FAOA 3QNCA 1BLHA 2R9XA 1CK3A 5E2EA 4P87A 4Y0TA 4UA7A 2XD5A 4KQQA 3UE1A 1IELA 3W4PA 1PWDA 4UAAA 1W79A 4PMAA 2QZ6A 4R0QA 5CGWA 3NI9A 4U0XA 4BL2A 2Q9NA 3Q7VB 4R1GA 1PYYA 4DRTA 1PW8A 2ZC7A 1YQSA 3M2KA 3ZNTA 2Y2HA 5CTMA 2Y91A 3HLFA 1ONGA 3OZHA 1PZOA 3UPOA 5FI6A 4JXGA 4OVDA 3ZDJA 1K57A 4GB7A 4RYEA 3W4QA 1PWGA 1N4OA 4GZBA 4LENA 1LHYA 1BZAA 2EFUA 1BULA 2VGKA 3A3EA 3DTMA 4B4XA 3HUNA 1FSYA 4BD1A 1ES4A 1H8ZA 1TDLA 3CZDA 4S2OA 4ZAMA 2HDRA 1K54C 5M19A 4S2LA 3NY4A 4WBGA 1I2WA 1LL5A 2IWCA 3ZG0A 3SOIA 3G31A 3HL9A 1TDGA 1XA1A 4ZDXA 4ZJ2A 4S2MA 5TR7A 1XGJA 1FSWA 3HVFA 4OPQA 3WS2A 3NC8A 4S2PA 5FAQA 4RX2A 1ONHA 5BOHA 1PI5A 3AGEA 4GDNA 2H0TA 1E4DA 1KGGA 4D2OA 1M6KA 4QD4A 4DE0A 1K56A 4Q8IA 3RXWA 4K0XA 4DF6A 3UDFA 3UPPA 2P9VB 1E3UA 2JC7A 1MY8A 1QMEA 2XLNA 4JBFA 4WZ5A 1XKZA 4FD8A 5FDHA 3BFDA 1YLWA 3EQVA 1IYOA 1RGYA 3NIAA 1K56D 5CTNA 4BJPA 3N8SA 2BG1A 3OPPA 2DRWA 1FOFA 3MKFA 5KMWA 5GHXA 1BTLA 1E3UD 4E3JA 5HW3A 1K55C 5EOOA 5A93A 2XR0A 1KVMA 3BEBA 3VFHA 1IKIA 1VM1A 2E8IA 4KZ4A 2HDUA 5DTSA 2ZD8A 4JXVA 5M1AA 3UO9A 4LV0A 4DXBA 1XPBA 5CGSA 5DF7A 3IT9A 1IKGA 4ZJ1A 2JE5A 3GMWA 3FYZA 4MBHA 5CECA 2H10A 3NBLA 1K38A 3N6IA 3PBRA 1NYYA 2XH9A 4OOYA 4IBXA 1XA7A 4HBTA 4OP8A 4NETA 3WS0A 4OH0A 1L0GA 1JTDA 1YLZA 5FQ9A 4HESA 5G18A 3C4PA 2HP9A 3GQZA 3OCLA 4UHUA 3A3DA 5F1FA 3HUOA 2RL3A 4KENB 2G2UA 1HVBA 3GSGA 5EECA 4FH4A 2ZC5B 2Y2OA 5IHVA 4R3JA 4GDBA 3VFFA 5TGFA 4E6XA 1GHIA 4RVAA 2Z2LB 5EOEA 1ESUA 4RA7A 5EVIA 3MZDA 5GHYA 4E3IA 3GRJA 3AGDA 2OV5A 1GA9A 3DW0A 2XDMA 5AQ7A 3A3FA 3IXHA 3CJMA 1FCOA 2ZLYA 4C75A 2Y2QA 1TVFA 1K54A 4S2IA 4R4RA 5EVID 4N1HA 2WGIA 3HLCA 4BLMA 5E43A 3ZG5A 4KZAA 5J8XA 1CI9A 1ES2A 4EUZA 1KE0A 4WM9A 1K6RA 1L0DA 1G68A 1PWCA 4Y7PA 1E25A 2ZM2A 1H8YA 2V2FF 4M3KA 3IF6A 4LCMA 4P0MA 4R4SA 4EQIA 2ZQCA 2ZMAA 5D3OA 4E3LA 1W7FA 1CEGA 3LY3A 4JF6A 4GD6A 4GNUA 4X56A 4P6BA 1ZC2A 3HLBA 5GLBA 1W8YA 1S0WA 2A49A 3IXGA 3ZGAB 1MXOA 3BFGA 5HFOA 3G30A 1C3BA 5FQJA 3ZVTA 4YFMA 2PU4A 1IEMA 4R3BA 4OPRA 4JXSA 1Q2QA 1LI9A 5HAPA 2XK1A 4MLLA 1LI0A 3BRMA 4U0TA 2WZXA 4QHCA 4FH2A 5L2FA 2WK0A 2EXBA 3IHAA 3V50A 5DF9A 4S2NC 3PBOA 2Y2PA 2HDQA 2J9PA 3G35A 2ZQ8A 1W5DA 2DCFA 4MBFA 2WAFA 1SCWA 3BLMA 3LCEA 2JBFA 3ZFZA 3WS1A 1KE3A 1NXYA 4BL3A 3BFFA 3ZCZA 3IWIA 3E2LA 4KZ5A 1PI4A 3GR2A 4ZJ3A 2OLUA 3BLSA 1Y54A 2P9VA 2WGWA 1ES5A 4KG6A 4KZ6A 4PM9A 2XFSA 4OQIA 4XUZA 1FCMA 3O87A 1FR1A 1GCEA 1OMEA 2X02A 5HX9A 3VMAA 3WS4A 5KZHA 2Y59A 3MZEA 4KZ7A 3HLWA 1NRFA 3OCNA 3SS4A 5CEDA 5DTTA 1ERMA 1YLYA 4X6TA 5I94A 5FA7A 4C6YA 4UA9A 4X55A 3ZG9B 4WEJA 1HD8A 4OP5A 1SDEA 1L0FA 3HLDA 3HLGA 5CHJA 2EFXA 2ZC4B 3IHBA 2Q9MA 5CGXA 5FATA 2R9WA 3N8LA 2HP6A 2C6WB 5CHUA 4DDYA 1PZPA 2IWDA 2QMIA 2EX8A 1K6SA 3V39A 1EI5A 3ZG8B 1YLPA 3C4OA 1ZG4A 3PBSA 1FCNA 1H5XA 1G6AA 4EBLA 5GLDA 3VOYA 4IBRA 4IEDA 3WS5A 3IQAA 1JWVA 3V3RA 2FFYA 1KDSA 4IVIA 3FV7A 2WKEA 3MBZA 3SS3A 2PU2A 3UDXA 2OSUA 3SH8A 1PW1A 3ITBA 4F94A 4LV1A 1VQQA 4HBUA 4R23A 1FQGA 3WRZA 2DNSA 1SDNA 1SKFA 2Y55A 5AQAA 5FASA 5EE8A 1ZKJA 1I2SA 3UE0A 1S6RA 3NCKA 5HAIA 4MBKA 5CERA 3VSKA 1K57C 5FAPA 4KZ3A 4L0LA 2XF3A 4ZBEA 3TSGA 4OOMA 4PM7A 5E2FA 4DE3A 5GLCA 1KGFA 4MEZA 5E2HA 5TFQA 5HAQA 1LLBA 2A3UA 5EPHA 5GLAA 1KVLA 3V5MA 1GA0A 1NY0A 1YLJA 2ZM8A 1JWZA 1XX2A 4KG2A 3M2JA 3UNWA 4JPMA 2WZZA 3MXRA 3GTCA 3PAEA 4KZ8A 1BLCA 3QNBA 2ZC3B 4PPRA 3EQUA 1AXBA 4S2KA 2GDNA 3PTEA 3AGFA 1ESIA 3GV9A 4ID4A 4JXWA 1NZOA 4WMCA 2Y2NA 5A92A 1O07A 1YT4A 1DJCA 4X68A 1DJAA 1KDWA 2WGVA 3V3SA 2Y2MA 4JF5A 3RJUA 3N7WA 1BT5A 2ZQDA 5GHZA 3G4PA 3Q7VA 3N8RA 4WMCD 3VP3A 4OKPA 3FKWA 3M6HA 5FQIA 1M40A 2Y2JA 3PBTA 4WZ5C 2IWBA 4BQMA 1ERQA 4N9LA 1FR6A 4Y0UA 2Z2MB 2ZQ9A 2WAEA 2X01A 3PAGA 5FQQA 4Z9QA 1N9BA 4LV2A 3IWOA 2WKIA 3OC2A 1MPLA 1K25A 2OLVA 2ZQ7A 3VP4A 3Q1FA 1EROA 3A3IA 2HDSA 2C5WB 5FSRA 1DY6A 1I5QA 3DWZA 2FFFB 2WADA 2ZM0A 3BM6A 2EX2A 3CG5A 3P09A 3PBNA 2HP5A 2Y2GA 1K55A 1YM1A 4EV4A 1MKIA 5EVIB 1ES3A 3BYDA 1IYPA 4OLGA 3BECA 3O3VA 3MXSA 4QU3A 1K4EA 3NDEA 3Q82A 3HBRA 2V1ZA 2RCXA 3O86A 4PM6A 3SS5A 1QMFA 4WYYA 2ZJ9A 3IF5A 5HARA 3UY6A 1ZG6A 3HLEA 4WZ4A 2XD1A 2WUQA 5GL9A 4LCLA 4QJGA 5FQKA 5A91A 4GD8A 2XFTA 4JLFA 3BFEA 3LY4A 3SH7A 2UWXA 4DE2A 3IF6B 2XQZA 4K91A 4OPYA 3VP0A 4YINA 3HUMA 1PIOA 4EWFA 2EX9A 3G2YA 3S22A 1IYSA 2I72A 1W8QA 5F1GA 3S1YA 5FI2A 3VOZA 4EBNA 2ZC6B 2JCHA 2H5SA 1WE4A 2Y2LA 3LEZA 3M6BA 4GOGA 3P98A 4WEKA 5EVIC 3UDIA 1JTGA 3VP1A 3W4OA 3WRTA 4DXCA 3ISGA 4QB8A 1KGEA 4HEFA 5KSCA 4E3NA 2QPNA 2XGNA 5CEBA 1GHPA 4X69A 3VP2A 1RGZA 2WYXA 5M18A 1NZUA 3UE3A 5DVAA 3C7VA 5A90A 1ALQA 4OONA 1MWRA 2B5RA 3Q81A 2BLSA 4OPZA 1YMSA 3ZVWA 1JVJA 2G2WA 3UN7A 4OLDA 4GKUA 3VSLA 3D4FA 1KE4A 1K4FA 1L0EA 1WYBA 3N4IA 2XEPA 3Q7ZA 1RCJA 4QY5A 3IF6C 3MZFA 4N92A 4DKIA 5HL1A 1L2SA 4E3MA 3IXBA 2P74A 5DTKA 2Y2IA 1XP4A 1CI8A 3S4XA 4B4ZA 1TEMA 2EXAA 3ZNYA 1XGIA 1YMXA 3A3JA 4PM8A 2WGWB 4IVKA 3FKVA 4H8RA 4RX3A 5JYOA 5F83A 1Z6FA 1NYMA 3MKEA 1IYQA 3SH9A 3WWXA 4CJNA 3RXXA 4N1XA 4LV3A 1DJBA 2J8YA 4EBPA 3I7JA 3C7UA 2PBYA 4UA6A 4BENA 4XXRA 3IWQA 4BD0A 3PBQA 1MWTA 4X53A 3OPHA 5E2GA 4PM5A 3C5AA 5AQ9A 4JKTA 4FCFA 4DDSA 1RP5A 4OOLA 3TOIA 5JYPA 1BLPA 4E3OA 3FWLA 3G34A 4KZBA 4FSFA 4OQHA 1HZOA 3IH9A 4S2NA 2H0YA 3CMZA 5AQBA 1CEFA 1J9MA 1LL9A 2Y4AA 3FZCA 3ZG7B 5FI7A 2V20A 1SHVA 4O7DA 3UPNA 1Q2PA 2J9OA 4E3KA 4ZTKA 3MFDA 3BFCA 4P85A 3B3XA 3Q07A 4XUXA 4KG5A 1BSGA 1HTZA 5EVLA 1JWPA 4A5RA 3OPLA 4DE1A 3E2KA 3G32A 1NJ4A 3NDGA 4K0WA 1MWSA 1BLSA 4KQOA 4WELA 4B88A 2CC1A 3DWKA 4S2JA 2X71A 3IXDA 4GN2A 5U47A 5EUAA 5DF8A
chains in the Genus database with same CATH superfamily
4C3QA 3E0YA 1Y4OA 1TS7A 4OQGA 4QY6A 5CRFA 1XXMA 3NJAA 3HREA 3KX0X 3VE3A 3OPRA 1GHMA 2VGJA 4HQAA 3QHYA 2OWHA 5E2EA 4D60A 3W4PA 1STZA 4U0XA 2Q9NA 4Y3IA 1PW8A 2IA2A 2ZBBA 4Y13A 3ZNTA 4EQ1A 1H0MA 2A24A 2Y91A 3HLFA 3UPOA 3OZHA 4OVDA 1K57A 3W4QA 1PWGA 1LHYA 4BMWA 2EFUA 3A3EA 4B4XA 3CZDA 4S2OA 4FOFA 3LR3A 4HI4A 2HDRA 1K54C 4S2LA 4I5SA 4JGRA 2PRFA 3ZG0A 3HJKA 4ZJ2A 4S2MA 4RX2A 5BOHA 4MCWA 1PI5A 3KYEA 2H0TA 4D2OA 3QP1A 3RXWA 1ZHHB 3MJQA 2M1CA 1VB6A 3BFDA 1RGYA 3NIAA 3N8SA 3UB8A 3OPPA 2DRWA 1FOFA 3MKFA 4E3JA 5HW3A 1X0OA 2XR0A 3BEBA 3VFHA 1VM1A 2J80A 2E8IA 4LV0A 5CGSA 5DF7A 3GMWA 4MBHA 5CECA 2Z6DA 3UMEA 2DMWA 4OOYA 1JTDA 4HESA 1F2KA 2G2UA 4FH4A 4E04A 3VFFA 5TGFA 1S4SA 5HPFA 4E6XA 2Z2LB 2WKRA 4RA7A 4EETB 5HWWA 3AGDA 1YPRA 2OV5A 1GA9A 2XDMA 4H6JA 3CITA 4C75A 2GJ3A 2W3HA 1CI9A 1ES2A 4EUZA 1KE0A 1K6RA 1T1BA 4Y7PA 1XFNA 3DBAA 4R4SA 4EQIA 3T1SA 1W7FA 1CEGA 5A8BA 4X56A 4ETZA 3HLBA 3G30A 3TRCA 3ZVTA 4YFMA 4OPRA 4JXSA 2XK1A 1LI0A 4U0TA 4QHCA 4R6LA 1OTEA 5DF9A 4MDZA 2GX5A 4IHQA 2HDQA 2ZQ8A 1W5DA 3LIAA 1GSWA 2WAFA 3S7QA 3S7OA 1NXYA 4BL3A 3IWIA 1PI4A 3GR2A 4ZRRA 1Y54A 1D7EA 4XUZA 1FR1A 1OMEA 5DJUA 3IBRA 3OCNA 3UB7A 1ERMA 5I94A 3ZG9B 2EFXA 5CGXA 2R9WA 3IS2A 2GZAA 5CHUA 3TJZC 4K08A 2QMIA 3D72A 1EI5A 3C4OA 1ZG4A 1H5XA 1OTBA 5HDDA 3MBZA 2QJ7A 3UDXA 2OSUA 2NUPC 4B9OA 1PW1A 4CLCA 4NXGA 1VETA 4LV1A 5LBRA 4R23A 3WRZA 4F3LA 1SKFA 1PNEA 3NCKA 5CERA 4MBKA 1K57C 4KZ3A 1T1AA 3LR4A 4OOMA 3V67A 3ZQ5A 3U2AA 1LLBA 3U4LP 1KVLA 3JPUA 2ZM8A 4KG2A 3M2JA 4JPMA 3QP5A 2WZZA 4KZ8A 1LSXA 2ZC3B 4PPRA 3EQUA 1Y28A 3PTEA 4ID4A 1NZOA 2Y2NA 3MMHA 4X68A 1G6OA 3T4SA 3G4PA 3ZGAB 2KDKA 5FQIA 1M40A 4BQMA 1ERQA 1FR6A 2ZQ9A 2WAEA 3PAGA 1N9BA 3IWOA 1V9YA 1K25A 2ZQ7A 3A3IA 5FSRA 3DWZA 2FFFB 3OLOA 2WADA 5DKLA 2ZM0A 2EX2A 2HP5A 1YM1A 1MKIA 5EVIB 4NXBA 1ES3A 3DTIA 2D02A 1K4EA 3LIBA 2V1ZA 1QMFA 4WZ4A 4ESPA 4QJGA 3LR5A 2PBDP 4JLFA 2UV0E 3F1OB 3SH7A 3IF6B 2XQZA 4K91A 3QP8A 3G2YA 5F1GA 1CQAA 5FI2A 3M6BA 2H5SA 3IX8A 3UDIA 3P98A 4QB8A 3VP2A 3C7VA 3Q81A 2BLSA 1YMSA 4LFUA 3R7WB 2LB9A 1OTAA 1K4FA 4HJ3A 2ZL1A 2VV7A 3NHQA 3MZFA 3H7WB 1L2SA 2P74A 4IUHA 3FPWA 2HF6A 3IBJA 4IVKA 5DFYA 5F83A 1Z6FA 3WWXA 4LV3A 5TJJA 1AWIA 2PD7A 4BENA 3OPHA 3C5AA 3F1PA 5JYPA 2ZMFA 4FTXA 1HZOA 3RTYA 1F9IA 4B93A 1YSPA 3JVUA 5HZHA 2V20A 1SHVA 3KYQA 5F69A 3SW1A 3JVVA 2PHYA 4PHTA 5EVLA 3E2KA 4KQOA 4B88A 1S1ZA 3IXDA 3CHWP 5DF8A 5KSHA 1WYCA 5TBMB 4N9KA 1U60A 4NK3A 5CXWA 4Y0OA 2QJ5A 1MWUA 3ITAA 3T50A 3TG9A 1BUEA 1YLTA 3T4QA 4LLOB 4KUKA 1W63Q 4CLCC 5G4ZA 3QNCA 1BLHA 1CK3A 5L07A 4P87A 3K3DA 3G6OA 3UE1A 1PWDA 5IT5A 4JGQA 4R0QA 4BL2A 4X25A 1YQSA 5CTMA 4ETXA 1ONGA 3ZDJA 3CPTB 2W1TA 4LENA 1BZAA 1H8ZA 4ZAMA 5M19A 3NY4A 1S4RA 2IWCA 2QWSA 3SOIA 1LT0A 4OPQA 1FSWA 3WS2A 3NC8A 2JKTM 1ZTUA 4JGOA 2NUTC 4QD4A 1K56A 4Q8IA 3H82B 4I3JA 1FIKA 4K0XA 2P9VB 1E3UA 2JC7A 5FDHA 2XLNA 1XKZA 4FD8A 1IYOA 3CLOA 5GHXA 5EOOA 1IKIA 4KZ4A 4EEPA 2VLGA 4DXBA 1YSQA 2Q0OA 1DRMA 1IKGA 1T19A 2W27A 3FYZA 2K7SA 2H10A 3NBLA 1K38A 3T4JA 4OP8A 5HSQA 4HBTA 3WS0A 1L0GA 1WA9A 5F1FA 4GDBA 2CMNA 1GHIA 2EWVA 4RVAA 5FL3A 3MZDA 2INWA 3DW0A 5AQ7A 3A3FA 1FCOA 2O9AA 2P7JA 1TVFA 4S2IA 3BQ8A 4P6ZS 3HLCA 2L1MA 1PWCA 4EW7A 1G68A 1E25A 3HCYA 1H8YA 4M3KA 4LCMA 4HH2A 2PR5A 4ARZA 2HJEA 1W8YA 5KIZA 2ZMVA 3IXGA 5HFOA 1TS8A 3EGXC 5FQJA 3O5YA 2PU4A 2JHEA 1Q2QA 2XROA 5HAPA 2R78A 4FH2A 4UQIS 3IHAA 3CUEA 3PBOA 1T1CA 4EUVA 2J9PA 3LEQA 1SCWA 3LCEA 1D1JA 2EA9A 2MJ6A 3E2LA 4KZ5A 2OLUA 3F1NA 3B33A 2P9VA 2WGWA 4OQIA 4UQIM 4GLQA 3LFVA 5HX9A 2PYPA 5KZHA 2Y59A 2VJWA 4EXOA 3K2NA 3SS4A 5DTTA 1YLYA 4X6TA 5AJGA 2XA7S 4GS9B 4X55A 1HD8A 1HLUP 4OP5A 3HLGA 2Q9MA 2K31A 4DN0A 3N8LA 4DDYA 1PZPA 2VX8A 1K6SA 3V39A 3NECA 1YLPA 4EEUA 3MQQA 4EBLA 4IBRA 4IEDA 3WS5A 2JKGA 3IQAA 1JWVA 2VZWA 5AVEA 4O01A 3R4KA 3ITBA 1FQGA 2Y55A 1SDNA 5F6AA 5EE8A 3UE0A 1I2SA 4CLCD 3QP2A 3GDIA 4DE3A 5E2HA 5TFQA 1DP9A 2A3UA 1YAXA 5GLAA 3MFXA 5J7EA 1GA0A 1NY0A 4AFIA 1JWZA 3UNWA 3EWKA 3PAEA 1T18A 2V8CA 3LI9A 5HL6A 1FILA 1ESIA 1UWNX 4JXWA 3E4OA 3MSHA 4WMCA 1DJCA 2P04A 2Y2MA 3RJUA 3N7WA 1N9OA 3PBTA 1XJ3A 1XJ6A 4Y0UA 2X01A 2FZ0A 4LV2A 2WKIA 4X1LA 2OLVA 4DJ3A 3C30A 1EROA 2C5WB 4XT2B 1I5QA 3PBNA 3P09A 1OPXA 3LYXA 1NLZA 3MS6A 2VA0A 3BYDA 3BECA 3MXSA 3NDEA 3Q82A 3MF0A 4PM6A 3SS5A 3IF5A 3UY6A 2XD1A 3MQOA 3BY9A 5GL9A 3PXPA 3PYPA 4LPZA 3BJNA 4YINA 3HUMA 1PIOA 2O0YA 4EWFA 3S1YA 4CQHA 3VOZA 2ZOHA 1G5UA 2W3FA 4QPRA 4EBNA 3LEZA 3UMDA 4WEKA 1TS0A 1JTGA 3WRTA 5KSCA 1KGEA 4HEFA 5CEBA 1GHPA 3T1QB 4BBTA 5M18A 1NZUA 4CLCE 5DVAA 5A90A 4OONA 1MWRA 1JVJA 4OLDA 4GKUA 3VSLA 1L0EA 2XEPA 4N92A 4DKIA 3IXBA 4O0PA 4B4ZA 1TEMA 4PM8A 3FKVA 3KO6A 1NYMA 3MKEA 3UB6A 4CJNA 3RXXA 2W3DA 2J8YA 2W1RA 1TF1A 3CUEC 4HIAA 3ULFA 2PBYA 2Y8HA 4XXRA 3IWQA 4X53A 4HNBA 4HP9A 4DDSA 4WUJA 1RP5A 1BLPA 3FWLA 3G34A 4GHIB 1DP6A 3E4PA 4S2NA 2H0YA 1J9MA 1LL9A 4O7DA 3UPNA 1Q2PA 4G3VA 3MQ0A 3KSIA 3B3XA 4XUXA 2A2LA 1BSGA 1JWPA 1ACFA 4A5RA 3RFBA 4I3AA 4DE1A 2JKTI 1NJ4A 4K0WA 1MWSA 2JN7A 2CC1A 3DWKA 4GN2A 5U47A 3ZHHA 3ZYTA 1MBLA 5F82A 1SKOB 2ZQAA 3C8CA 3T4OA 4KZ9A 5CX7A 4HHDA 1EWZA 4BBUA 4U3TA 3G2ZA 2QHKA 3JYIA 4KQRA 2R9XA 4EU0A 2ZOIA 2PAVP 4UA7A 2XD5A 4KQQA 1IELA 1J3WA 1W79A 4PMAA 2QZ6A 4HP4A 3NI9A 3EOIA 3Q7VB 4DRTA 3M2KA 2Y2HA 1PZOA 3OBFA 4JXGA 1P9WA 5EFWA 4GB7A 1CF0A 4RYEA 2PR6A 4GZBA 4WLAA 2VGKA 3DTMA 4BD1A 1Z09A 4Y2FA 2XRNA 1I2WA 1L3LA 5FEGA 5IS1A 3HL9A 1TDGA 1XJ4A 1XGJA 3HVFA 2QKPA 3LI8A 3AGEA 4GDNA 1E4DA 1KGGA 4DE0A 3TE8A 3VV4A 4II7A 3UPPA 4FUWA 4BWIA 1MY8A 1QMEA 2J3WA 4JBFA 1VEUB 4MMNA 4Z1WA 1K56D 2JKRM 1BTLA 1E3UD 2W3GA 5A93A 1KVMA 2KOIA 5L8MA 5DTSA 2ZD8A 5M1AA 3UO9A 1VHMA 2O9BA 3IT9A 3EGDC 3N6IA 1NYYA 1XA7A 4NETA 4OH0A 4WN5A 2HP9A 3OCLA 4UHUA 4I39A 2ZC5B 4Y5FA 3KSFA 2L4RA 1ESUA 4UEYA 5EVIA 4NXFA 4LRYC 1W63M 1K54A 4R4RA 1A0KA 4N1HA 2WGIA 4BLMA 2J3TC 3ZG5A 5HWTA 4WM9A 2V2FF 3F1OA 1XJ2A 3IF6A 4P0MA 2ZQCA 5D3OA 3LY3A 2ACGA 4GNUA 4P6BA 4L9FA 5GLBA 1MXOA 3BFGA 3UB9A 1IEMA 3L9KA 5EM1A 1LI9A 2QYBA 4MLLA 1NLYA 2WZXA 3T4LA 5L2FA 3PR6A 4S2NC 3R7WA 1GSVA 3QP6A 3BLMA 3ZFZA 3H7WA 3WS1A 1UWPX 2P08A 3H9WA 3ZCZA 2B18A 3CWFA 4ZJ3A 4KZ6A 1N9NA 4KG6A 1FCMA 3VMAA 1GCEA 2X02A 2O99A 2D01A 1NRFA 3B47A 5FA7A 4C6YA 4UA9A 4WF0A 4WEJA 2K2NA 1L0FA 5CHJA 5FATA 2HP6A 2OOLA 2A24B 5IU1A 5J3WA 3ZG8B 3PBSA 4GJ4A 2XSSA 5GLDA 3V3RA 2FFYA 1KDSA 1N9LA 4X1MA 3T4TA 2PYRA 3SS3A 3SH8A 3NOTC 2DNSA 5FASA 2B02A 5TBMA 1S6RA 1F5MA 5HAIA 5FAPA 3VE4A 2XF3A 1DP8A 1H3QA 4MEZA 4EESA 2OAQ1 4O8GA 5HAQA 5EPHA 3V5MA 4Q0JA 4I38A 1XX2A 3MXRA 2KLIA 3QNBA 1AXBA 5A92A 1KDWA 1LSWA 2H28A 5GHZA 5I5LA 4WMCD 3FKWA 3CAXA 4PAUA 2Y2JA 2IWBA 4N9LA 5FDSA 2VKSA 4G3KA 4NEED 3CPTA 3HJIA 4P6ZM 1MPLA 1OJGA 3Q1FA 2HDSA 3BY8A 3BM6A 3CG5A 4KQDA 2Y2GA 1K55A 4EV4A 3A0VA 1IYPA 3O3VA 4QU3A 3HBRA 4H6JB 3IX4A 3O86A 2HZ5A 2V9AA 4WYYA 2HGVA 4IJGA 2Y79A 2WUQA 3H82A 5A91A 4GD8A 2W3EA 2XFTA 3BFEA 5HDCA 2UWXA 4DE2A 3VP0A 4OPYA 2LB5A 2EX9A 3S22A 1IYSA 3UE6A 1H8MA 3VOLA 5EVIC 2Y2LA 2AVXA 4GOGA 3VP1A 3ISGA 2V1AA 1RGZA 2WYXA 3E98A 1PRQA 1ALQA 2G2WA 3K3CA 3UN7A 3D4FA 1KE4A 1WYBA 3UB5P 3IF6C 2XA7M 4E3MA 5DTKA 5DFXA 4LRZE 3ZNYA 5EV0A 1XGIA 1F98A 5JYOA 2J3TD 1IYQA 3LGOA 4EBPA 3I7JA 1BYWA 4BD0A 3KYZA 5E2GA 3D3OA 4JKTA 3IS2B 4OOLA 4E3OA 3LIEA 2E8JA 3IH9A 5AQBA 3FZCA 3ZG7B 1KOUA 5EVEA 4E3KA 2VV6A 4R38A 3MFDA 4P85A 3Q07A 1HTZA 2JKFA 3OPLA 4CLCB 2M7UA 3T1RA 1VETB 1MC0A 3P7NA 4ME4A 4F3LB 2GNXA 3O88A 3LO7A 4CPKA 1O7EA 4OQ0A 4HH3A 2J7VA 4E6WA 2JKRI 5C5KA 2L0WA 1P97A 3W8KA 3GVBA 3IH8A 3C38A 4MNRA 1TS6A 3RH8B 2V8FA 3NOPC 2HPBA 2PT7A 5CHMA 5FQMA 4JF4A 2Y2KA 3DTKA 2WKHA 2EX6A 5FAOA 4Y0TA 3IX3A 1IFQA 2KX6A 4GS9A 4UAAA 5CGWA 4R1GA 1PYYA 2M7VA 1P9RA 2ZC7A 4IUKA 5FI6A 5K5BA 1N4OA 1BULA 1LL8A 2V0WA 3HUNA 3CI6A 1FSYA 1ES4A 1TDLA 4QWOA 4MN5A 5HD5A 3FPVA 4WBGA 1LL5A 3G31A 2BTFP 5F68A 1XA1A 5TR7A 4S2PA 5FAQA 5F5YA 1ONHA 4YWZA 1M6KA 4DF6A 3UDFA 4WZ5A 3EQVA 1YLWA 5CTNA 4BJPA 4WL9A 2BG1A 3EEAA 5KMWA 3EEHA 1K55C 1EW0A 2YKFA 3PHYA 2PDRA 2HDUA 1MKMA 2V1BA 4JXVA 4RQ9A 1IOUA 1UGUA 4KUOA 1XPBA 4DMZA 4ZJ1A 2JE5A 1S67L 3QP4A 2BASA 2ZL1B 3PBRA 2OAP1 2XH9A 4IBXA 2WKPA 1YLZA 5FQ9A 5G18A 3C4PA 3GQZA 3A3DA 3HUOA 2RL3A 2G7UA 3FC7A 4KENB 1HVBA 1SZVA 3GSGA 2VEAA 5EECA 4HJ4A 3MR0A 2Y2OA 3E4QA 4GW9A 5IHVA 4R3JA 3LR0A 4XT2A 4GCZA 1CJFA 5EOEA 5GHYA 2WKQA 4E3IA 3GRJA 3LICA 3IXHA 3CJMA 2ZLYA 3BW6A 1S1YA 2Y2QA 3F1PB 5EVID 1ODVA 3T12B 5E43A 4KZAA 5J8XA 1L0DA 3DTEA 2ZM2A 1JNUA 2ZMAA 4E3LA 2Z6CA 4JF6A 4GD6A 3T1XA 3A0RA 1S66L 1ZC2A 4R3AA 3BQAA 1S0WA 5HD3A 2A49A 1G28A 1C3BA 3ICYA 4R3BA 4NKPA 3BRMA 1TD5A 2WK0A 2EXBA 1PFLA 3V50A 3DAVA 4MN6A 5FEFA 1OTIA 2Y2PA 3G35A 2DCFA 4MBFA 5MC7A 2JBFA 1KE3A 3BFFA 1D06A 3LIFA 3BLSA 2HV1A 4EERA 1OT6A 1ES5A 4PM9A 4BBVA 2XFSA 3O87A 3KSGA 3WS4A 3MZEA 4KZ7A 3HLWA 1NWZA 2YKHA 5CEDA 3NULA 2HJ9C 5L10A 2O9CA 1SDEA 3HLDA 3SZTA 2ZC4B 3IHBA 4L9EA 4Y17A 2C6WB 4R70A 4GHIA 2IWDA 2EX8A 4YNRA 1FCNA 2W1TB 1G6AA 3VOYA 4DJ2A 4IVIA 4PKYA 3FV7A 2WKEA 2VGLS 2PU2A 3FG8A 3B42A 4F94A 5EM0A 1VQQA 4HBUA 3MXQA 5AQAA 1ZKJA 2FH5A 3VSKA 3LIDA 1SKOA 4L0LA 3TSGA 4ZBEA 4PM7A 5E2FA 5GLCA 1KGFA 2VGLM 4Q0IA 5HWVA 2EWWA 1OT9A 5L09A 5G4YA 1XFQA 1YLJA 1NRJA 3GTCA 1YKDA 1BLCA 2PD8A 4S2KA 2GDNA 3AGFA 3GV9A 4HOIA 1O07A 1YT4A 3KSHA 4G3WA 3BWLA 1DJAA 2WGVA 4LGWA 3V3SA 4JF5A 1BT5A 2ZQDA 1OJ5A 3Q7VA 3N8RA 3VP3A 4OKPA 3M6HA 4JGPA 4WZ5C 1OTDA 3C2WA 2Z2MB 5FQQA 4Z9QA 3D9YA 3OC2A 5AVFA 3VP4A 1DY6A 4OLGA 3L7HA 4NG2A 2RCXA 3NOUC 1LSVA 2ZJ9A 1V9ZA 3GECA 5HARA 1ZG6A 3HLEA 5HDSA 3S7PA 4LCLA 2B95A 4MN7A 5FQKA 4HJ6A 3LY4A 3OOVA 1VEUA 2I72A 1W8QA 4ARZB 2ZC6B 2JCHA 1WE4A 3W4OA 4ZDXA 4L9GA 4DXCA 2V0UA 4E3NA 2QPNA 2XGNA 4LRXC 2I9VA 4NXEA 4X69A 3UE3A 3P01A 2B5RA 4OPZA 3ZVWA 5DKKA 2VK3A 3TW8A 3T4KA 3N4IA 3Q7ZA 2W0NA 1RCJA 4QY5A 5HL1A 2OWJA 1MZUA 2Y2IA 1XP4A 1CI8A 4Y15A 3S4XA 4HY8A 2EXAA 4M4XA 3F1NB 1YMXA 3A3JA 2WGWB 4H8RA 4RX3A 3SH9A 4N1XA 1DJBA 3C7UA 1GSXA 4PKYG 4UA6A 3PBQA 1MWTA 4Q0HA 1K0KA 4PM5A 5AQ9A 4FCFA 3TOIA 4KZBA 4FSFA 4OQHA 3CMZA 1P0ZA 1CEFA 2Y4AA 4I3IA 5FI7A 5J4EA 3A0SA 2J9OA 5DJTA 4ZTKA 2VV8A 3BFCA 4KG5A 4YOFA 3LUQA 3G32A 3NDGA 1BLSA 4WELA 3S7NA 4S2JA 2X71A 5EUAA 5HPIA 3W2ZA
chains in the Genus database with same CATH topology
3O88A 4C3QA 5KSHA 1WYCA 3ZHHA 4OQGA 4N9KA 3LO7A 1MBLA 1U60A 4NK3A 4QY6A 5F82A 2ZQAA 4CPKA 1O7EA 4OQ0A 2J7VA 4E6WA 4KZ9A 5CRFA 5CXWA 4Y0OA 3W8KA 1EWZA 3GVBA 1XXMA 3IH8A 4MNRA 4U3TA 1MWUA 3HREA 3G2ZA 3ITAA 2HPBA 5CHMA 5FQMA 3OPRA 3TG9A 1BUEA 4JF4A 1YLTA 1GHMA 2VGJA 2Y2KA 3JYIA 4KQRA 2WKHA 2EX6A 3QHYA 5FAOA 3QNCA 1BLHA 2R9XA 1CK3A 5E2EA 4P87A 4Y0TA 4UA7A 2XD5A 4KQQA 3UE1A 1IELA 3W4PA 1PWDA 4UAAA 1W79A 4PMAA 2QZ6A 4R0QA 5CGWA 3NI9A 4U0XA 4BL2A 2Q9NA 3Q7VB 4R1GA 1PYYA 4DRTA 1PW8A 2ZC7A 1YQSA 3M2KA 3ZNTA 2Y2HA 5CTMA 2Y91A 3HLFA 1ONGA 3OZHA 1PZOA 3UPOA 5FI6A 4JXGA 4OVDA 3ZDJA 1K57A 4GB7A 4RYEA 3W4QA 1PWGA 1N4OA 4GZBA 4LENA 1LHYA 1BZAA 2EFUA 1BULA 2VGKA 3A3EA 3DTMA 4B4XA 3HUNA 1FSYA 4BD1A 1ES4A 1H8ZA 1TDLA 3CZDA 4S2OA 4ZAMA 2HDRA 1K54C 5M19A 4S2LA 3NY4A 4WBGA 1I2WA 1LL5A 2IWCA 3ZG0A 3SOIA 3G31A 3HL9A 1TDGA 1XA1A 4ZDXA 4ZJ2A 4S2MA 5TR7A 1XGJA 1FSWA 3HVFA 4OPQA 3WS2A 3NC8A 4S2PA 5FAQA 4RX2A 1ONHA 5BOHA 1PI5A 3AGEA 4GDNA 2H0TA 1E4DA 1KGGA 4D2OA 1M6KA 4QD4A 4DE0A 1K56A 4Q8IA 3RXWA 4K0XA 4DF6A 3UDFA 3UPPA 2P9VB 1E3UA 2JC7A 1MY8A 1QMEA 2XLNA 4JBFA 4WZ5A 1XKZA 4FD8A 5FDHA 3BFDA 1YLWA 3EQVA 1IYOA 1RGYA 3NIAA 1K56D 5CTNA 4BJPA 3N8SA 2BG1A 3OPPA 2DRWA 1FOFA 3MKFA 5KMWA 5GHXA 1BTLA 1E3UD 4E3JA 5HW3A 1K55C 5EOOA 5A93A 2XR0A 1KVMA 3BEBA 3VFHA 1IKIA 1VM1A 2E8IA 4KZ4A 2HDUA 5DTSA 2ZD8A 4JXVA 5M1AA 3UO9A 4LV0A 4DXBA 1XPBA 5CGSA 5DF7A 3IT9A 1IKGA 4ZJ1A 2JE5A 3GMWA 3FYZA 4MBHA 5CECA 2H10A 3NBLA 1K38A 3N6IA 3PBRA 1NYYA 2XH9A 4OOYA 4IBXA 1XA7A 4HBTA 4OP8A 4NETA 3WS0A 4OH0A 1L0GA 1JTDA 1YLZA 5FQ9A 4HESA 5G18A 3C4PA 2HP9A 3GQZA 3OCLA 4UHUA 3A3DA 5F1FA 3HUOA 2RL3A 4KENB 2G2UA 1HVBA 3GSGA 5EECA 4FH4A 2ZC5B 2Y2OA 5IHVA 4R3JA 4GDBA 3VFFA 5TGFA 4E6XA 1GHIA 4RVAA 2Z2LB 5EOEA 1ESUA 4RA7A 5EVIA 3MZDA 5GHYA 4E3IA 3GRJA 3AGDA 2OV5A 1GA9A 3DW0A 2XDMA 5AQ7A 3A3FA 3IXHA 3CJMA 1FCOA 2ZLYA 4C75A 2Y2QA 1TVFA 1K54A 4S2IA 4R4RA 5EVID 4N1HA 2WGIA 3HLCA 4BLMA 5E43A 3ZG5A 4KZAA 5J8XA 1CI9A 1ES2A 4EUZA 1KE0A 4WM9A 1K6RA 1L0DA 1G68A 1PWCA 4Y7PA 1E25A 2ZM2A 1H8YA 2V2FF 4M3KA 3IF6A 4LCMA 4P0MA 4R4SA 4EQIA 2ZQCA 2ZMAA 5D3OA 4E3LA 1W7FA 1CEGA 3LY3A 4JF6A 4GD6A 4GNUA 4X56A 4P6BA 1ZC2A 3HLBA 5GLBA 1W8YA 1S0WA 2A49A 3IXGA 3ZGAB 1MXOA 3BFGA 5HFOA 3G30A 1C3BA 5FQJA 3ZVTA 4YFMA 2PU4A 1IEMA 4R3BA 4OPRA 4JXSA 1Q2QA 1LI9A 5HAPA 2XK1A 4MLLA 1LI0A 3BRMA 4U0TA 2WZXA 4QHCA 4FH2A 5L2FA 2WK0A 2EXBA 3IHAA 3V50A 5DF9A 4S2NC 3PBOA 2Y2PA 2HDQA 2J9PA 3G35A 2ZQ8A 1W5DA 2DCFA 4MBFA 2WAFA 1SCWA 3BLMA 3LCEA 2JBFA 3ZFZA 3WS1A 1KE3A 1NXYA 4BL3A 3BFFA 3ZCZA 3IWIA 3E2LA 4KZ5A 1PI4A 3GR2A 4ZJ3A 2OLUA 3BLSA 1Y54A 2P9VA 2WGWA 1ES5A 4KG6A 4KZ6A 4PM9A 2XFSA 4OQIA 4XUZA 1FCMA 3O87A 1FR1A 1GCEA 1OMEA 2X02A 5HX9A 3VMAA 3WS4A 5KZHA 2Y59A 3MZEA 4KZ7A 3HLWA 1NRFA 3OCNA 3SS4A 5CEDA 5DTTA 1ERMA 1YLYA 4X6TA 5I94A 5FA7A 4C6YA 4UA9A 4X55A 3ZG9B 4WEJA 1HD8A 4OP5A 1SDEA 1L0FA 3HLDA 3HLGA 5CHJA 2EFXA 2ZC4B 3IHBA 2Q9MA 5CGXA 5FATA 2R9WA 3N8LA 2HP6A 2C6WB 5CHUA 4DDYA 1PZPA 2IWDA 2QMIA 2EX8A 1K6SA 3V39A 1EI5A 3ZG8B 1YLPA 3C4OA 1ZG4A 3PBSA 1FCNA 1H5XA 1G6AA 4EBLA 5GLDA 3VOYA 4IBRA 4IEDA 3WS5A 3IQAA 1JWVA 3V3RA 2FFYA 1KDSA 4IVIA 3FV7A 2WKEA 3MBZA 3SS3A 2PU2A 3UDXA 2OSUA 3SH8A 1PW1A 3ITBA 4F94A 4LV1A 1VQQA 4HBUA 4R23A 1FQGA 3WRZA 2DNSA 1SDNA 1SKFA 2Y55A 5AQAA 5FASA 5EE8A 1ZKJA 1I2SA 3UE0A 1S6RA 3NCKA 5HAIA 4MBKA 5CERA 3VSKA 1K57C 5FAPA 4KZ3A 4L0LA 2XF3A 4ZBEA 3TSGA 4OOMA 4PM7A 5E2FA 4DE3A 5GLCA 1KGFA 4MEZA 5E2HA 5TFQA 5HAQA 1LLBA 2A3UA 5EPHA 5GLAA 1KVLA 3V5MA 1GA0A 1NY0A 1YLJA 2ZM8A 1JWZA 1XX2A 4KG2A 3M2JA 3UNWA 4JPMA 2WZZA 3MXRA 3GTCA 3PAEA 4KZ8A 1BLCA 3QNBA 2ZC3B 4PPRA 3EQUA 1AXBA 4S2KA 2GDNA 3PTEA 3AGFA 1ESIA 3GV9A 4ID4A 4JXWA 1NZOA 4WMCA 2Y2NA 5A92A 1O07A 1YT4A 1DJCA 4X68A 1DJAA 1KDWA 2WGVA 3V3SA 2Y2MA 4JF5A 3RJUA 3N7WA 1BT5A 2ZQDA 5GHZA 3G4PA 3Q7VA 3N8RA 4WMCD 3VP3A 4OKPA 3FKWA 3M6HA 5FQIA 1M40A 2Y2JA 3PBTA 4WZ5C 2IWBA 4BQMA 1ERQA 4N9LA 1FR6A 4Y0UA 2Z2MB 2ZQ9A 2WAEA 2X01A 3PAGA 5FQQA 4Z9QA 1N9BA 4LV2A 3IWOA 2WKIA 3OC2A 1MPLA 1K25A 2OLVA 2ZQ7A 3VP4A 3Q1FA 1EROA 3A3IA 2HDSA 2C5WB 5FSRA 1DY6A 1I5QA 3DWZA 2FFFB 2WADA 2ZM0A 3BM6A 2EX2A 3CG5A 3P09A 3PBNA 2HP5A 2Y2GA 1K55A 1YM1A 4EV4A 1MKIA 5EVIB 1ES3A 3BYDA 1IYPA 4OLGA 3BECA 3O3VA 3MXSA 4QU3A 1K4EA 3NDEA 3Q82A 3HBRA 2V1ZA 2RCXA 3O86A 4PM6A 3SS5A 1QMFA 4WYYA 2ZJ9A 3IF5A 5HARA 3UY6A 1ZG6A 3HLEA 4WZ4A 2XD1A 2WUQA 5GL9A 4LCLA 4QJGA 5FQKA 5A91A 4GD8A 2XFTA 4JLFA 3BFEA 3LY4A 3SH7A 2UWXA 4DE2A 3IF6B 2XQZA 4K91A 4OPYA 3VP0A 4YINA 3HUMA 1PIOA 4EWFA 2EX9A 3G2YA 3S22A 1IYSA 2I72A 1W8QA 5F1GA 3S1YA 5FI2A 3VOZA 4EBNA 2ZC6B 2JCHA 2H5SA 1WE4A 2Y2LA 3LEZA 3M6BA 4GOGA 3P98A 4WEKA 5EVIC 3UDIA 1JTGA 3VP1A 3W4OA 3WRTA 4DXCA 3ISGA 4QB8A 1KGEA 4HEFA 5KSCA 4E3NA 2QPNA 2XGNA 5CEBA 1GHPA 4X69A 3VP2A 1RGZA 2WYXA 5M18A 1NZUA 3UE3A 5DVAA 3C7VA 5A90A 1ALQA 4OONA 1MWRA 2B5RA 3Q81A 2BLSA 4OPZA 1YMSA 3ZVWA 1JVJA 2G2WA 3UN7A 4OLDA 4GKUA 3VSLA 3D4FA 1KE4A 1K4FA 1L0EA 1WYBA 3N4IA 2XEPA 3Q7ZA 1RCJA 4QY5A 3IF6C 3MZFA 4N92A 4DKIA 5HL1A 1L2SA 4E3MA 3IXBA 2P74A 5DTKA 2Y2IA 1XP4A 1CI8A 3S4XA 4B4ZA 1TEMA 2EXAA 3ZNYA 1XGIA 1YMXA 3A3JA 4PM8A 2WGWB 4IVKA 3FKVA 4H8RA 4RX3A 5JYOA 5F83A 1Z6FA 1NYMA 3MKEA 1IYQA 3SH9A 3WWXA 4CJNA 3RXXA 4N1XA 4LV3A 1DJBA 2J8YA 4EBPA 3I7JA 3C7UA 2PBYA 4UA6A 4BENA 4XXRA 3IWQA 4BD0A 3PBQA 1MWTA 4X53A 3OPHA 5E2GA 4PM5A 3C5AA 5AQ9A 4JKTA 4FCFA 4DDSA 1RP5A 4OOLA 3TOIA 5JYPA 1BLPA 4E3OA 3FWLA 3G34A 4KZBA 4FSFA 4OQHA 1HZOA 3IH9A 4S2NA 2H0YA 3CMZA 5AQBA 1CEFA 1J9MA 1LL9A 2Y4AA 3FZCA 3ZG7B 5FI7A 2V20A 1SHVA 4O7DA 3UPNA 1Q2PA 2J9OA 4E3KA 4ZTKA 3MFDA 3BFCA 4P85A 3B3XA 3Q07A 4XUXA 4KG5A 1BSGA 1HTZA 5EVLA 1JWPA 4A5RA 3OPLA 4DE1A 3E2KA 3G32A 1NJ4A 3NDGA 4K0WA 1MWSA 1BLSA 4KQOA 4WELA 4B88A 2CC1A 3DWKA 4S2JA 2X71A 3IXDA 4GN2A 5U47A 5EUAA 5DF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O88 A;  4C3Q A;  5KSH A;  1WYC A;  3ZHH A;  4OQG A;  4N9K A;  3LO7 A;  1MBL A;  1U60 A;  4NK3 A;  4QY6 A;  5F82 A;  2ZQA A;  4CPK A;  1O7E A;  4OQ0 A;  2J7V A;  4E6W A;  4KZ9 A;  5CRF A;  5CXW A;  4Y0O A;  3W8K A;  1EWZ A;  3GVB A;  1XXM A;  3IH8 A;  4MNR A;  4U3T A;  1MWU A;  3HRE A;  3G2Z A;  3ITA A;  2HPB A;  5CHM A;  5FQM A;  3OPR A;  3TG9 A;  1BUE A;  4JF4 A;  1YLT A;  1GHM A;  2VGJ A;  2Y2K A;  3JYI A;  4KQR A;  2WKH A;  2EX6 A;  3QHY A;  5FAO A;  3QNC A;  1BLH A;  2R9X A;  1CK3 A;  5E2E A;  4P87 A;  4Y0T A;  4UA7 A;  2XD5 A;  4KQQ A;  3UE1 A;  1IEL A;  3W4P A;  1PWD A;  4UAA A;  1W79 A;  4PMA A;  2QZ6 A;  4R0Q A;  5CGW A;  3NI9 A;  4U0X A;  4BL2 A;  2Q9N A;  3Q7V B;  4R1G A;  1PYY A;  4DRT A;  1PW8 A;  2ZC7 A;  1YQS A;  3M2K A;  3ZNT A;  2Y2H A;  5CTM A;  2Y91 A;  3HLF A;  1ONG A;  3OZH A;  1PZO A;  3UPO A;  5FI6 A;  4JXG A;  4OVD A;  3ZDJ A;  1K57 A;  4GB7 A;  4RYE A;  3W4Q A;  1PWG A;  1N4O A;  4GZB A;  4LEN A;  1LHY A;  1BZA A;  2EFU A;  1BUL A;  2VGK A;  3A3E A;  3DTM A;  4B4X A;  3HUN A;  1FSY A;  4BD1 A;  1ES4 A;  1H8Z A;  1TDL A;  3CZD A;  4S2O A;  4ZAM A;  2HDR A;  1K54 C;  5M19 A;  4S2L A;  3NY4 A;  4WBG A;  1I2W A;  1LL5 A;  2IWC A;  3ZG0 A;  3SOI A;  3G31 A;  3HL9 A;  1TDG A;  1XA1 A;  4ZDX A;  4ZJ2 A;  4S2M A;  5TR7 A;  1XGJ A;  1FSW A;  3HVF A;  4OPQ A;  3WS2 A;  3NC8 A;  4S2P A;  5FAQ A;  4RX2 A;  1ONH A;  5BOH A;  1PI5 A;  3AGE A;  4GDN A;  2H0T A;  1E4D A;  1KGG A;  4D2O A;  1M6K A;  4QD4 A;  4DE0 A;  1K56 A;  4Q8I A;  3RXW A;  4K0X A;  4DF6 A;  3UDF A;  3UPP A;  2P9V B;  1E3U A;  2JC7 A;  1MY8 A;  1QME A;  2XLN A;  4JBF A;  4WZ5 A;  1XKZ A;  4FD8 A;  5FDH A;  3BFD A;  1YLW A;  3EQV A;  1IYO A;  1RGY A;  3NIA A;  1K56 D;  5CTN A;  4BJP A;  3N8S A;  2BG1 A;  3OPP A;  2DRW A;  1FOF A;  3MKF A;  5KMW A;  5GHX A;  1BTL A;  1E3U D;  4E3J A;  5HW3 A;  1K55 C;  5EOO A;  5A93 A;  2XR0 A;  1KVM A;  3BEB A;  3VFH A;  1IKI A;  1VM1 A;  2E8I A;  4KZ4 A;  2HDU A;  5DTS A;  2ZD8 A;  4JXV A;  5M1A A;  3UO9 A;  4LV0 A;  4DXB A;  1XPB A;  5CGS A;  5DF7 A;  3IT9 A;  1IKG A;  4ZJ1 A;  2JE5 A;  3GMW A;  3FYZ A;  4MBH A;  5CEC A;  2H10 A;  3NBL A;  1K38 A;  3N6I A;  3PBR A;  1NYY A;  2XH9 A;  4OOY A;  4IBX A;  1XA7 A;  4HBT A;  4OP8 A;  4NET A;  3WS0 A;  4OH0 A;  1L0G A;  1JTD A;  1YLZ A;  5FQ9 A;  4HES A;  5G18 A;  3C4P A;  2HP9 A;  3GQZ A;  3OCL A;  4UHU A;  3A3D A;  5F1F A;  3HUO A;  2RL3 A;  4KEN B;  2G2U A;  1HVB A;  3GSG A;  5EEC A;  4FH4 A;  2ZC5 B;  2Y2O A;  5IHV A;  4R3J A;  4GDB A;  3VFF A;  5TGF A;  4E6X A;  1GHI A;  4RVA A;  2Z2L B;  5EOE A;  1ESU A;  4RA7 A;  5EVI A;  3MZD A;  5GHY A;  4E3I A;  3GRJ A;  3AGD A;  2OV5 A;  1GA9 A;  3DW0 A;  2XDM A;  5AQ7 A;  3A3F A;  3IXH A;  3CJM A;  1FCO A;  2ZLY A;  4C75 A;  2Y2Q A;  1TVF A;  1K54 A;  4S2I A;  4R4R A;  5EVI D;  4N1H A;  2WGI A;  3HLC A;  4BLM A;  5E43 A;  3ZG5 A;  4KZA A;  5J8X A;  1CI9 A;  1ES2 A;  4EUZ A;  1KE0 A;  4WM9 A;  1K6R A;  1L0D A;  1G68 A;  1PWC A;  4Y7P A;  1E25 A;  2ZM2 A;  1H8Y A;  2V2F F;  4M3K A;  3IF6 A;  4LCM A;  4P0M A;  4R4S A;  4EQI A;  2ZQC A;  2ZMA A;  5D3O A;  4E3L A;  1W7F A;  1CEG A;  3LY3 A;  4JF6 A;  4GD6 A;  4GNU A;  4X56 A;  4P6B A;  1ZC2 A;  3HLB A;  5GLB A;  1W8Y A;  1S0W A;  2A49 A;  3IXG A;  3ZGA B;  1MXO A;  3BFG A;  5HFO A;  3G30 A;  1C3B A;  5FQJ A;  3ZVT A;  4YFM A;  2PU4 A;  1IEM A;  4R3B A;  4OPR A;  4JXS A;  1Q2Q A;  1LI9 A;  5HAP A;  2XK1 A;  4MLL A;  1LI0 A;  3BRM A;  4U0T A;  2WZX A;  4QHC A;  4FH2 A;  5L2F A;  2WK0 A;  2EXB A;  3IHA A;  3V50 A;  5DF9 A;  4S2N C;  3PBO A;  2Y2P A;  2HDQ A;  2J9P A;  3G35 A;  2ZQ8 A;  1W5D A;  2DCF A;  4MBF A;  2WAF A;  1SCW A;  3BLM A;  3LCE A;  2JBF A;  3ZFZ A;  3WS1 A;  1KE3 A;  1NXY A;  4BL3 A;  3BFF A;  3ZCZ A;  3IWI A;  3E2L A;  4KZ5 A;  1PI4 A;  3GR2 A;  4ZJ3 A;  2OLU A;  3BLS A;  1Y54 A;  2P9V A;  2WGW A;  1ES5 A;  4KG6 A;  4KZ6 A;  4PM9 A;  2XFS A;  4OQI A;  4XUZ A;  1FCM A;  3O87 A;  1FR1 A;  1GCE A;  1OME A;  2X02 A;  5HX9 A;  3VMA A;  3WS4 A;  5KZH A;  2Y59 A;  3MZE A;  4KZ7 A;  3HLW A;  1NRF A;  3OCN A;  3SS4 A;  5CED A;  5DTT A;  1ERM A;  1YLY A;  4X6T A;  5I94 A;  5FA7 A;  4C6Y A;  4UA9 A;  4X55 A;  3ZG9 B;  4WEJ A;  1HD8 A;  4OP5 A;  1SDE A;  1L0F A;  3HLD A;  3HLG A;  5CHJ A;  2EFX A;  2ZC4 B;  3IHB A;  2Q9M A;  5CGX A;  5FAT A;  2R9W A;  3N8L A;  2HP6 A;  2C6W B;  5CHU A;  4DDY A;  1PZP A;  2IWD A;  2QMI A;  2EX8 A;  1K6S A;  3V39 A;  1EI5 A;  3ZG8 B;  1YLP A;  3C4O A;  1ZG4 A;  3PBS A;  1FCN A;  1H5X A;  1G6A A;  4EBL A;  5GLD A;  3VOY A;  4IBR A;  4IED A;  3WS5 A;  3IQA A;  1JWV A;  3V3R A;  2FFY A;  1KDS A;  4IVI A;  3FV7 A;  2WKE A;  3MBZ A;  3SS3 A;  2PU2 A;  3UDX A;  2OSU A;  3SH8 A;  1PW1 A;  3ITB A;  4F94 A;  4LV1 A;  1VQQ A;  4HBU A;  4R23 A;  1FQG A;  3WRZ A;  2DNS A;  1SDN A;  1SKF A;  2Y55 A;  5AQA A;  5FAS A;  5EE8 A;  1ZKJ A;  1I2S A;  3UE0 A;  1S6R A;  3NCK A;  5HAI A;  4MBK A;  5CER A;  3VSK A;  1K57 C;  5FAP A;  4KZ3 A;  4L0L A;  2XF3 A;  4ZBE A;  3TSG A;  4OOM A;  4PM7 A;  5E2F A;  4DE3 A;  5GLC A;  1KGF A;  4MEZ A;  5E2H A;  5TFQ A;  5HAQ A;  1LLB A;  2A3U A;  5EPH A;  5GLA A;  1KVL A;  3V5M A;  1GA0 A;  1NY0 A;  1YLJ A;  2ZM8 A;  1JWZ A;  1XX2 A;  4KG2 A;  3M2J A;  3UNW A;  4JPM A;  2WZZ A;  3MXR A;  3GTC A;  3PAE A;  4KZ8 A;  1BLC A;  3QNB A;  2ZC3 B;  4PPR A;  3EQU A;  1AXB A;  4S2K A;  2GDN A;  3PTE A;  3AGF A;  1ESI A;  3GV9 A;  4ID4 A;  4JXW A;  1NZO A;  4WMC A;  2Y2N A;  5A92 A;  1O07 A;  1YT4 A;  1DJC A;  4X68 A;  1DJA A;  1KDW A;  2WGV A;  3V3S A;  2Y2M A;  4JF5 A;  3RJU A;  3N7W A;  1BT5 A;  2ZQD A;  5GHZ A;  3G4P A;  3Q7V A;  3N8R A;  4WMC D;  3VP3 A;  4OKP A;  3FKW A;  3M6H A;  5FQI A;  1M40 A;  2Y2J A;  3PBT A;  4WZ5 C;  2IWB A;  4BQM A;  1ERQ A;  4N9L A;  1FR6 A;  4Y0U A;  2Z2M B;  2ZQ9 A;  2WAE A;  2X01 A;  3PAG A;  5FQQ A;  4Z9Q A;  1N9B A;  4LV2 A;  3IWO A;  2WKI A;  3OC2 A;  1MPL A;  1K25 A;  2OLV A;  2ZQ7 A;  3VP4 A;  3Q1F A;  1ERO A;  3A3I A;  2HDS A;  2C5W B;  5FSR A;  1DY6 A;  1I5Q A;  3DWZ A;  2FFF B;  2WAD A;  2ZM0 A;  3BM6 A;  2EX2 A;  3CG5 A;  3P09 A;  3PBN A;  2HP5 A;  2Y2G A;  1K55 A;  1YM1 A;  4EV4 A;  1MKI A;  5EVI B;  1ES3 A;  3BYD A;  1IYP A;  4OLG A;  3BEC A;  3O3V A;  3MXS A;  4QU3 A;  1K4E A;  3NDE A;  3Q82 A;  3HBR A;  2V1Z A;  2RCX A;  3O86 A;  4PM6 A;  3SS5 A;  1QMF A;  4WYY A;  2ZJ9 A;  3IF5 A;  5HAR A;  3UY6 A;  1ZG6 A;  3HLE A;  4WZ4 A;  2XD1 A;  2WUQ A;  5GL9 A;  4LCL A;  4QJG A;  5FQK A;  5A91 A;  4GD8 A;  2XFT A;  4JLF A;  3BFE A;  3LY4 A;  3SH7 A;  2UWX A;  4DE2 A;  3IF6 B;  2XQZ A;  4K91 A;  4OPY A;  3VP0 A;  4YIN A;  3HUM A;  1PIO A;  4EWF A;  2EX9 A;  3G2Y A;  3S22 A;  1IYS A;  2I72 A;  1W8Q A;  5F1G A;  3S1Y A;  5FI2 A;  3VOZ A;  4EBN A;  2ZC6 B;  2JCH A;  2H5S A;  1WE4 A;  2Y2L A;  3LEZ A;  3M6B A;  4GOG A;  3P98 A;  4WEK A;  5EVI C;  3UDI A;  1JTG A;  3VP1 A;  3W4O A;  3WRT A;  4DXC A;  3ISG A;  4QB8 A;  1KGE A;  4HEF A;  5KSC A;  4E3N A;  2QPN A;  2XGN A;  5CEB A;  1GHP A;  4X69 A;  3VP2 A;  1RGZ A;  2WYX A;  5M18 A;  1NZU A;  3UE3 A;  5DVA A;  3C7V A;  5A90 A;  1ALQ A;  4OON A;  1MWR A;  2B5R A;  3Q81 A;  2BLS A;  4OPZ A;  1YMS A;  3ZVW A;  1JVJ A;  2G2W A;  3UN7 A;  4OLD A;  4GKU A;  3VSL A;  3D4F A;  1KE4 A;  1K4F A;  1L0E A;  1WYB A;  3N4I A;  2XEP A;  3Q7Z A;  1RCJ A;  4QY5 A;  3IF6 C;  3MZF A;  4N92 A;  4DKI A;  5HL1 A;  1L2S A;  4E3M A;  3IXB A;  2P74 A;  5DTK A;  2Y2I A;  1XP4 A;  1CI8 A;  3S4X A;  4B4Z A;  1TEM A;  2EXA A;  3ZNY A;  1XGI A;  1YMX A;  3A3J A;  4PM8 A;  2WGW B;  4IVK A;  3FKV A;  4H8R A;  4RX3 A;  5JYO A;  5F83 A;  1Z6F A;  1NYM A;  3MKE A;  1IYQ A;  3SH9 A;  3WWX A;  4CJN A;  3RXX A;  4N1X A;  4LV3 A;  1DJB A;  2J8Y A;  4EBP A;  3I7J A;  3C7U A;  2PBY A;  4UA6 A;  4BEN A;  4XXR A;  3IWQ A;  4BD0 A;  3PBQ A;  1MWT A;  4X53 A;  3OPH A;  5E2G A;  4PM5 A;  3C5A A;  5AQ9 A;  4JKT A;  4FCF A;  4DDS A;  1RP5 A;  4OOL A;  3TOI A;  5JYP A;  1BLP A;  4E3O A;  3FWL A;  3G34 A;  4KZB A;  4FSF A;  4OQH A;  1HZO A;  3IH9 A;  4S2N A;  2H0Y A;  3CMZ A;  5AQB A;  1CEF A;  1J9M A;  1LL9 A;  2Y4A A;  3FZC A;  3ZG7 B;  5FI7 A;  2V20 A;  1SHV A;  4O7D A;  3UPN A;  1Q2P A;  2J9O A;  4E3K A;  4ZTK A;  3MFD A;  3BFC A;  4P85 A;  3B3X A;  3Q07 A;  4XUX A;  4KG5 A;  1BSG A;  1HTZ A;  5EVL A;  1JWP A;  4A5R A;  3OPL A;  4DE1 A;  3E2K A;  3G32 A;  1NJ4 A;  3NDG A;  4K0W A;  1MWS A;  1BLS A;  4KQO A;  4WEL A;  4B88 A;  2CC1 A;  3DWK A;  4S2J A;  2X71 A;  3IXD A;  4GN2 A;  5U47 A;  5EUA A;  5DF8 A; 
#chains in the Genus database with same CATH topology
 4C3Q A;  3E0Y A;  1Y4O A;  1TS7 A;  4OQG A;  4QY6 A;  5CRF A;  1XXM A;  3NJA A;  3HRE A;  3KX0 X;  3VE3 A;  3OPR A;  1GHM A;  2VGJ A;  4HQA A;  3QHY A;  2OWH A;  5E2E A;  4D60 A;  3W4P A;  1STZ A;  4U0X A;  2Q9N A;  4Y3I A;  1PW8 A;  2IA2 A;  2ZBB A;  4Y13 A;  3ZNT A;  4EQ1 A;  1H0M A;  2A24 A;  2Y91 A;  3HLF A;  3UPO A;  3OZH A;  4OVD A;  1K57 A;  3W4Q A;  1PWG A;  1LHY A;  4BMW A;  2EFU A;  3A3E A;  4B4X A;  3CZD A;  4S2O A;  4FOF A;  3LR3 A;  4HI4 A;  2HDR A;  1K54 C;  4S2L A;  4I5S A;  4JGR A;  2PRF A;  3ZG0 A;  3HJK A;  4ZJ2 A;  4S2M A;  4RX2 A;  5BOH A;  4MCW A;  1PI5 A;  3KYE A;  2H0T A;  4D2O A;  3QP1 A;  3RXW A;  1ZHH B;  3MJQ A;  2M1C A;  1VB6 A;  3BFD A;  1RGY A;  3NIA A;  3N8S A;  3UB8 A;  3OPP A;  2DRW A;  1FOF A;  3MKF A;  4E3J A;  5HW3 A;  1X0O A;  2XR0 A;  3BEB A;  3VFH A;  1VM1 A;  2J80 A;  2E8I A;  4LV0 A;  5CGS A;  5DF7 A;  3GMW A;  4MBH A;  5CEC A;  2Z6D A;  3UME A;  2DMW A;  4OOY A;  1JTD A;  4HES A;  1F2K A;  2G2U A;  4FH4 A;  4E04 A;  3VFF A;  5TGF A;  1S4S A;  5HPF A;  4E6X A;  2Z2L B;  2WKR A;  4RA7 A;  4EET B;  5HWW A;  3AGD A;  1YPR A;  2OV5 A;  1GA9 A;  2XDM A;  4H6J A;  3CIT A;  4C75 A;  2GJ3 A;  2W3H A;  1CI9 A;  1ES2 A;  4EUZ A;  1KE0 A;  1K6R A;  1T1B A;  4Y7P A;  1XFN A;  3DBA A;  4R4S A;  4EQI A;  3T1S A;  1W7F A;  1CEG A;  5A8B A;  4X56 A;  4ETZ A;  3HLB A;  3G30 A;  3TRC A;  3ZVT A;  4YFM A;  4OPR A;  4JXS A;  2XK1 A;  1LI0 A;  4U0T A;  4QHC A;  4R6L A;  1OTE A;  5DF9 A;  4MDZ A;  2GX5 A;  4IHQ A;  2HDQ A;  2ZQ8 A;  1W5D A;  3LIA A;  1GSW A;  2WAF A;  3S7Q A;  3S7O A;  1NXY A;  4BL3 A;  3IWI A;  1PI4 A;  3GR2 A;  4ZRR A;  1Y54 A;  1D7E A;  4XUZ A;  1FR1 A;  1OME A;  5DJU A;  3IBR A;  3OCN A;  3UB7 A;  1ERM A;  5I94 A;  3ZG9 B;  2EFX A;  5CGX A;  2R9W A;  3IS2 A;  2GZA A;  5CHU A;  3TJZ C;  4K08 A;  2QMI A;  3D72 A;  1EI5 A;  3C4O A;  1ZG4 A;  1H5X A;  1OTB A;  5HDD A;  3MBZ A;  2QJ7 A;  3UDX A;  2OSU A;  2NUP C;  4B9O A;  1PW1 A;  4CLC A;  4NXG A;  1VET A;  4LV1 A;  5LBR A;  4R23 A;  3WRZ A;  4F3L A;  1SKF A;  1PNE A;  3NCK A;  5CER A;  4MBK A;  1K57 C;  4KZ3 A;  1T1A A;  3LR4 A;  4OOM A;  3V67 A;  3ZQ5 A;  3U2A A;  1LLB A;  3U4L P;  1KVL A;  3JPU A;  2ZM8 A;  4KG2 A;  3M2J A;  4JPM A;  3QP5 A;  2WZZ A;  4KZ8 A;  1LSX A;  2ZC3 B;  4PPR A;  3EQU A;  1Y28 A;  3PTE A;  4ID4 A;  1NZO A;  2Y2N A;  3MMH A;  4X68 A;  1G6O A;  3T4S A;  3G4P A;  3ZGA B;  2KDK A;  5FQI A;  1M40 A;  4BQM A;  1ERQ A;  1FR6 A;  2ZQ9 A;  2WAE A;  3PAG A;  1N9B A;  3IWO A;  1V9Y A;  1K25 A;  2ZQ7 A;  3A3I A;  5FSR A;  3DWZ A;  2FFF B;  3OLO A;  2WAD A;  5DKL A;  2ZM0 A;  2EX2 A;  2HP5 A;  1YM1 A;  1MKI A;  5EVI B;  4NXB A;  1ES3 A;  3DTI A;  2D02 A;  1K4E A;  3LIB A;  2V1Z A;  1QMF A;  4WZ4 A;  4ESP A;  4QJG A;  3LR5 A;  2PBD P;  4JLF A;  2UV0 E;  3F1O B;  3SH7 A;  3IF6 B;  2XQZ A;  4K91 A;  3QP8 A;  3G2Y A;  5F1G A;  1CQA A;  5FI2 A;  3M6B A;  2H5S A;  3IX8 A;  3UDI A;  3P98 A;  4QB8 A;  3VP2 A;  3C7V A;  3Q81 A;  2BLS A;  1YMS A;  4LFU A;  3R7W B;  2LB9 A;  1OTA A;  1K4F A;  4HJ3 A;  2ZL1 A;  2VV7 A;  3NHQ A;  3MZF A;  3H7W B;  1L2S A;  2P74 A;  4IUH A;  3FPW A;  2HF6 A;  3IBJ A;  4IVK A;  5DFY A;  5F83 A;  1Z6F A;  3WWX A;  4LV3 A;  5TJJ A;  1AWI A;  2PD7 A;  4BEN A;  3OPH A;  3C5A A;  3F1P A;  5JYP A;  2ZMF A;  4FTX A;  1HZO A;  3RTY A;  1F9I A;  4B93 A;  1YSP A;  3JVU A;  5HZH A;  2V20 A;  1SHV A;  3KYQ A;  5F69 A;  3SW1 A;  3JVV A;  2PHY A;  4PHT A;  5EVL A;  3E2K A;  4KQO A;  4B88 A;  1S1Z A;  3IXD A;  3CHW P;  5DF8 A;  5KSH A;  1WYC A;  5TBM B;  4N9K A;  1U60 A;  4NK3 A;  5CXW A;  4Y0O A;  2QJ5 A;  1MWU A;  3ITA A;  3T50 A;  3TG9 A;  1BUE A;  1YLT A;  3T4Q A;  4LLO B;  4KUK A;  1W63 Q;  4CLC C;  5G4Z A;  3QNC A;  1BLH A;  1CK3 A;  5L07 A;  4P87 A;  3K3D A;  3G6O A;  3UE1 A;  1PWD A;  5IT5 A;  4JGQ A;  4R0Q A;  4BL2 A;  4X25 A;  1YQS A;  5CTM A;  4ETX A;  1ONG A;  3ZDJ A;  3CPT B;  2W1T A;  4LEN A;  1BZA A;  1H8Z A;  4ZAM A;  5M19 A;  3NY4 A;  1S4R A;  2IWC A;  2QWS A;  3SOI A;  1LT0 A;  4OPQ A;  1FSW A;  3WS2 A;  3NC8 A;  2JKT M;  1ZTU A;  4JGO A;  2NUT C;  4QD4 A;  1K56 A;  4Q8I A;  3H82 B;  4I3J A;  1FIK A;  4K0X A;  2P9V B;  1E3U A;  2JC7 A;  5FDH A;  2XLN A;  1XKZ A;  4FD8 A;  1IYO A;  3CLO A;  5GHX A;  5EOO A;  1IKI A;  4KZ4 A;  4EEP A;  2VLG A;  4DXB A;  1YSQ A;  2Q0O A;  1DRM A;  1IKG A;  1T19 A;  2W27 A;  3FYZ A;  2K7S A;  2H10 A;  3NBL A;  1K38 A;  3T4J A;  4OP8 A;  5HSQ A;  4HBT A;  3WS0 A;  1L0G A;  1WA9 A;  5F1F A;  4GDB A;  2CMN A;  1GHI A;  2EWV A;  4RVA A;  5FL3 A;  3MZD A;  2INW A;  3DW0 A;  5AQ7 A;  3A3F A;  1FCO A;  2O9A A;  2P7J A;  1TVF A;  4S2I A;  3BQ8 A;  4P6Z S;  3HLC A;  2L1M A;  1PWC A;  4EW7 A;  1G68 A;  1E25 A;  3HCY A;  1H8Y A;  4M3K A;  4LCM A;  4HH2 A;  2PR5 A;  4ARZ A;  2HJE A;  1W8Y A;  5KIZ A;  2ZMV A;  3IXG A;  5HFO A;  1TS8 A;  3EGX C;  5FQJ A;  3O5Y A;  2PU4 A;  2JHE A;  1Q2Q A;  2XRO A;  5HAP A;  2R78 A;  4FH2 A;  4UQI S;  3IHA A;  3CUE A;  3PBO A;  1T1C A;  4EUV A;  2J9P A;  3LEQ A;  1SCW A;  3LCE A;  1D1J A;  2EA9 A;  2MJ6 A;  3E2L A;  4KZ5 A;  2OLU A;  3F1N A;  3B33 A;  2P9V A;  2WGW A;  4OQI A;  4UQI M;  4GLQ A;  3LFV A;  5HX9 A;  2PYP A;  5KZH A;  2Y59 A;  2VJW A;  4EXO A;  3K2N A;  3SS4 A;  5DTT A;  1YLY A;  4X6T A;  5AJG A;  2XA7 S;  4GS9 B;  4X55 A;  1HD8 A;  1HLU P;  4OP5 A;  3HLG A;  2Q9M A;  2K31 A;  4DN0 A;  3N8L A;  4DDY A;  1PZP A;  2VX8 A;  1K6S A;  3V39 A;  3NEC A;  1YLP A;  4EEU A;  3MQQ A;  4EBL A;  4IBR A;  4IED A;  3WS5 A;  2JKG A;  3IQA A;  1JWV A;  2VZW A;  5AVE A;  4O01 A;  3R4K A;  3ITB A;  1FQG A;  2Y55 A;  1SDN A;  5F6A A;  5EE8 A;  3UE0 A;  1I2S A;  4CLC D;  3QP2 A;  3GDI A;  4DE3 A;  5E2H A;  5TFQ A;  1DP9 A;  2A3U A;  1YAX A;  5GLA A;  3MFX A;  5J7E A;  1GA0 A;  1NY0 A;  4AFI A;  1JWZ A;  3UNW A;  3EWK A;  3PAE A;  1T18 A;  2V8C A;  3LI9 A;  5HL6 A;  1FIL A;  1ESI A;  1UWN X;  4JXW A;  3E4O A;  3MSH A;  4WMC A;  1DJC A;  2P04 A;  2Y2M A;  3RJU A;  3N7W A;  1N9O A;  3PBT A;  1XJ3 A;  1XJ6 A;  4Y0U A;  2X01 A;  2FZ0 A;  4LV2 A;  2WKI A;  4X1L A;  2OLV A;  4DJ3 A;  3C30 A;  1ERO A;  2C5W B;  4XT2 B;  1I5Q A;  3PBN A;  3P09 A;  1OPX A;  3LYX A;  1NLZ A;  3MS6 A;  2VA0 A;  3BYD A;  3BEC A;  3MXS A;  3NDE A;  3Q82 A;  3MF0 A;  4PM6 A;  3SS5 A;  3IF5 A;  3UY6 A;  2XD1 A;  3MQO A;  3BY9 A;  5GL9 A;  3PXP A;  3PYP A;  4LPZ A;  3BJN A;  4YIN A;  3HUM A;  1PIO A;  2O0Y A;  4EWF A;  3S1Y A;  4CQH A;  3VOZ A;  2ZOH A;  1G5U A;  2W3F A;  4QPR A;  4EBN A;  3LEZ A;  3UMD A;  4WEK A;  1TS0 A;  1JTG A;  3WRT A;  5KSC A;  1KGE A;  4HEF A;  5CEB A;  1GHP A;  3T1Q B;  4BBT A;  5M18 A;  1NZU A;  4CLC E;  5DVA A;  5A90 A;  4OON A;  1MWR A;  1JVJ A;  4OLD A;  4GKU A;  3VSL A;  1L0E A;  2XEP A;  4N92 A;  4DKI A;  3IXB A;  4O0P A;  4B4Z A;  1TEM A;  4PM8 A;  3FKV A;  3KO6 A;  1NYM A;  3MKE A;  3UB6 A;  4CJN A;  3RXX A;  2W3D A;  2J8Y A;  2W1R A;  1TF1 A;  3CUE C;  4HIA A;  3ULF A;  2PBY A;  2Y8H A;  4XXR A;  3IWQ A;  4X53 A;  4HNB A;  4HP9 A;  4DDS A;  4WUJ A;  1RP5 A;  1BLP A;  3FWL A;  3G34 A;  4GHI B;  1DP6 A;  3E4P A;  4S2N A;  2H0Y A;  1J9M A;  1LL9 A;  4O7D A;  3UPN A;  1Q2P A;  4G3V A;  3MQ0 A;  3KSI A;  3B3X A;  4XUX A;  2A2L A;  1BSG A;  1JWP A;  1ACF A;  4A5R A;  3RFB A;  4I3A A;  4DE1 A;  2JKT I;  1NJ4 A;  4K0W A;  1MWS A;  2JN7 A;  2CC1 A;  3DWK A;  4GN2 A;  5U47 A;  3ZHH A;  3ZYT A;  1MBL A;  5F82 A;  1SKO B;  2ZQA A;  3C8C A;  3T4O A;  4KZ9 A;  5CX7 A;  4HHD A;  1EWZ A;  4BBU A;  4U3T A;  3G2Z A;  2QHK A;  3JYI A;  4KQR A;  2R9X A;  4EU0 A;  2ZOI A;  2PAV P;  4UA7 A;  2XD5 A;  4KQQ A;  1IEL A;  1J3W A;  1W79 A;  4PMA A;  2QZ6 A;  4HP4 A;  3NI9 A;  3EOI A;  3Q7V B;  4DRT A;  3M2K A;  2Y2H A;  1PZO A;  3OBF A;  4JXG A;  1P9W A;  5EFW A;  4GB7 A;  1CF0 A;  4RYE A;  2PR6 A;  4GZB A;  4WLA A;  2VGK A;  3DTM A;  4BD1 A;  1Z09 A;  4Y2F A;  2XRN A;  1I2W A;  1L3L A;  5FEG A;  5IS1 A;  3HL9 A;  1TDG A;  1XJ4 A;  1XGJ A;  3HVF A;  2QKP A;  3LI8 A;  3AGE A;  4GDN A;  1E4D A;  1KGG A;  4DE0 A;  3TE8 A;  3VV4 A;  4II7 A;  3UPP A;  4FUW A;  4BWI A;  1MY8 A;  1QME A;  2J3W A;  4JBF A;  1VEU B;  4MMN A;  4Z1W A;  1K56 D;  2JKR M;  1BTL A;  1E3U D;  2W3G A;  5A93 A;  1KVM A;  2KOI A;  5L8M A;  5DTS A;  2ZD8 A;  5M1A A;  3UO9 A;  1VHM A;  2O9B A;  3IT9 A;  3EGD C;  3N6I A;  1NYY A;  1XA7 A;  4NET A;  4OH0 A;  4WN5 A;  2HP9 A;  3OCL A;  4UHU A;  4I39 A;  2ZC5 B;  4Y5F A;  3KSF A;  2L4R A;  1ESU A;  4UEY A;  5EVI A;  4NXF A;  4LRY C;  1W63 M;  1K54 A;  4R4R A;  1A0K A;  4N1H A;  2WGI A;  4BLM A;  2J3T C;  3ZG5 A;  5HWT A;  4WM9 A;  2V2F F;  3F1O A;  1XJ2 A;  3IF6 A;  4P0M A;  2ZQC A;  5D3O A;  3LY3 A;  2ACG A;  4GNU A;  4P6B A;  4L9F A;  5GLB A;  1MXO A;  3BFG A;  3UB9 A;  1IEM A;  3L9K A;  5EM1 A;  1LI9 A;  2QYB A;  4MLL A;  1NLY A;  2WZX A;  3T4L A;  5L2F A;  3PR6 A;  4S2N C;  3R7W A;  1GSV A;  3QP6 A;  3BLM A;  3ZFZ A;  3H7W A;  3WS1 A;  1UWP X;  2P08 A;  3H9W A;  3ZCZ A;  2B18 A;  3CWF A;  4ZJ3 A;  4KZ6 A;  1N9N A;  4KG6 A;  1FCM A;  3VMA A;  1GCE A;  2X02 A;  2O99 A;  2D01 A;  1NRF A;  3B47 A;  5FA7 A;  4C6Y A;  4UA9 A;  4WF0 A;  4WEJ A;  2K2N A;  1L0F A;  5CHJ A;  5FAT A;  2HP6 A;  2OOL A;  2A24 B;  5IU1 A;  5J3W A;  3ZG8 B;  3PBS A;  4GJ4 A;  2XSS A;  5GLD A;  3V3R A;  2FFY A;  1KDS A;  1N9L A;  4X1M A;  3T4T A;  2PYR A;  3SS3 A;  3SH8 A;  3NOT C;  2DNS A;  5FAS A;  2B02 A;  5TBM A;  1S6R A;  1F5M A;  5HAI A;  5FAP A;  3VE4 A;  2XF3 A;  1DP8 A;  1H3Q A;  4MEZ A;  4EES A;  2OAQ 1;  4O8G A;  5HAQ A;  5EPH A;  3V5M A;  4Q0J A;  4I38 A;  1XX2 A;  3MXR A;  2KLI A;  3QNB A;  1AXB A;  5A92 A;  1KDW A;  1LSW A;  2H28 A;  5GHZ A;  5I5L A;  4WMC D;  3FKW A;  3CAX A;  4PAU A;  2Y2J A;  2IWB A;  4N9L A;  5FDS A;  2VKS A;  4G3K A;  4NEE D;  3CPT A;  3HJI A;  4P6Z M;  1MPL A;  1OJG A;  3Q1F A;  2HDS A;  3BY8 A;  3BM6 A;  3CG5 A;  4KQD A;  2Y2G A;  1K55 A;  4EV4 A;  3A0V A;  1IYP A;  3O3V A;  4QU3 A;  3HBR A;  4H6J B;  3IX4 A;  3O86 A;  2HZ5 A;  2V9A A;  4WYY A;  2HGV A;  4IJG A;  2Y79 A;  2WUQ A;  3H82 A;  5A91 A;  4GD8 A;  2W3E A;  2XFT A;  3BFE A;  5HDC A;  2UWX A;  4DE2 A;  3VP0 A;  4OPY A;  2LB5 A;  2EX9 A;  3S22 A;  1IYS A;  3UE6 A;  1H8M A;  3VOL A;  5EVI C;  2Y2L A;  2AVX A;  4GOG A;  3VP1 A;  3ISG A;  2V1A A;  1RGZ A;  2WYX A;  3E98 A;  1PRQ A;  1ALQ A;  2G2W A;  3K3C A;  3UN7 A;  3D4F A;  1KE4 A;  1WYB A;  3UB5 P;  3IF6 C;  2XA7 M;  4E3M A;  5DTK A;  5DFX A;  4LRZ E;  3ZNY A;  5EV0 A;  1XGI A;  1F98 A;  5JYO A;  2J3T D;  1IYQ A;  3LGO A;  4EBP A;  3I7J A;  1BYW A;  4BD0 A;  3KYZ A;  5E2G A;  3D3O A;  4JKT A;  3IS2 B;  4OOL A;  4E3O A;  3LIE A;  2E8J A;  3IH9 A;  5AQB A;  3FZC A;  3ZG7 B;  1KOU A;  5EVE A;  4E3K A;  2VV6 A;  4R38 A;  3MFD A;  4P85 A;  3Q07 A;  1HTZ A;  2JKF A;  3OPL A;  4CLC B;  2M7U A;  3T1R A;  1VET B;  1MC0 A;  3P7N A;  4ME4 A;  4F3L B;  2GNX A;  3O88 A;  3LO7 A;  4CPK A;  1O7E A;  4OQ0 A;  4HH3 A;  2J7V A;  4E6W A;  2JKR I;  5C5K A;  2L0W A;  1P97 A;  3W8K A;  3GVB A;  3IH8 A;  3C38 A;  4MNR A;  1TS6 A;  3RH8 B;  2V8F A;  3NOP C;  2HPB A;  2PT7 A;  5CHM A;  5FQM A;  4JF4 A;  2Y2K A;  3DTK A;  2WKH A;  2EX6 A;  5FAO A;  4Y0T A;  3IX3 A;  1IFQ A;  2KX6 A;  4GS9 A;  4UAA A;  5CGW A;  4R1G A;  1PYY A;  2M7V A;  1P9R A;  2ZC7 A;  4IUK A;  5FI6 A;  5K5B A;  1N4O A;  1BUL A;  1LL8 A;  2V0W A;  3HUN A;  3CI6 A;  1FSY A;  1ES4 A;  1TDL A;  4QWO A;  4MN5 A;  5HD5 A;  3FPV A;  4WBG A;  1LL5 A;  3G31 A;  2BTF P;  5F68 A;  1XA1 A;  5TR7 A;  4S2P A;  5FAQ A;  5F5Y A;  1ONH A;  4YWZ A;  1M6K A;  4DF6 A;  3UDF A;  4WZ5 A;  3EQV A;  1YLW A;  5CTN A;  4BJP A;  4WL9 A;  2BG1 A;  3EEA A;  5KMW A;  3EEH A;  1K55 C;  1EW0 A;  2YKF A;  3PHY A;  2PDR A;  2HDU A;  1MKM A;  2V1B A;  4JXV A;  4RQ9 A;  1IOU A;  1UGU A;  4KUO A;  1XPB A;  4DMZ A;  4ZJ1 A;  2JE5 A;  1S67 L;  3QP4 A;  2BAS A;  2ZL1 B;  3PBR A;  2OAP 1;  2XH9 A;  4IBX A;  2WKP A;  1YLZ A;  5FQ9 A;  5G18 A;  3C4P A;  3GQZ A;  3A3D A;  3HUO A;  2RL3 A;  2G7U A;  3FC7 A;  4KEN B;  1HVB A;  1SZV A;  3GSG A;  2VEA A;  5EEC A;  4HJ4 A;  3MR0 A;  2Y2O A;  3E4Q A;  4GW9 A;  5IHV A;  4R3J A;  3LR0 A;  4XT2 A;  4GCZ A;  1CJF A;  5EOE A;  5GHY A;  2WKQ A;  4E3I A;  3GRJ A;  3LIC A;  3IXH A;  3CJM A;  2ZLY A;  3BW6 A;  1S1Y A;  2Y2Q A;  3F1P B;  5EVI D;  1ODV A;  3T12 B;  5E43 A;  4KZA A;  5J8X A;  1L0D A;  3DTE A;  2ZM2 A;  1JNU A;  2ZMA A;  4E3L A;  2Z6C A;  4JF6 A;  4GD6 A;  3T1X A;  3A0R A;  1S66 L;  1ZC2 A;  4R3A A;  3BQA A;  1S0W A;  5HD3 A;  2A49 A;  1G28 A;  1C3B A;  3ICY A;  4R3B A;  4NKP A;  3BRM A;  1TD5 A;  2WK0 A;  2EXB A;  1PFL A;  3V50 A;  3DAV A;  4MN6 A;  5FEF A;  1OTI A;  2Y2P A;  3G35 A;  2DCF A;  4MBF A;  5MC7 A;  2JBF A;  1KE3 A;  3BFF A;  1D06 A;  3LIF A;  3BLS A;  2HV1 A;  4EER A;  1OT6 A;  1ES5 A;  4PM9 A;  4BBV A;  2XFS A;  3O87 A;  3KSG A;  3WS4 A;  3MZE A;  4KZ7 A;  3HLW A;  1NWZ A;  2YKH A;  5CED A;  3NUL A;  2HJ9 C;  5L10 A;  2O9C A;  1SDE A;  3HLD A;  3SZT A;  2ZC4 B;  3IHB A;  4L9E A;  4Y17 A;  2C6W B;  4R70 A;  4GHI A;  2IWD A;  2EX8 A;  4YNR A;  1FCN A;  2W1T B;  1G6A A;  3VOY A;  4DJ2 A;  4IVI A;  4PKY A;  3FV7 A;  2WKE A;  2VGL S;  2PU2 A;  3FG8 A;  3B42 A;  4F94 A;  5EM0 A;  1VQQ A;  4HBU A;  3MXQ A;  5AQA A;  1ZKJ A;  2FH5 A;  3VSK A;  3LID A;  1SKO A;  4L0L A;  3TSG A;  4ZBE A;  4PM7 A;  5E2F A;  5GLC A;  1KGF A;  2VGL M;  4Q0I A;  5HWV A;  2EWW A;  1OT9 A;  5L09 A;  5G4Y A;  1XFQ A;  1YLJ A;  1NRJ A;  3GTC A;  1YKD A;  1BLC A;  2PD8 A;  4S2K A;  2GDN A;  3AGF A;  3GV9 A;  4HOI A;  1O07 A;  1YT4 A;  3KSH A;  4G3W A;  3BWL A;  1DJA A;  2WGV A;  4LGW A;  3V3S A;  4JF5 A;  1BT5 A;  2ZQD A;  1OJ5 A;  3Q7V A;  3N8R A;  3VP3 A;  4OKP A;  3M6H A;  4JGP A;  4WZ5 C;  1OTD A;  3C2W A;  2Z2M B;  5FQQ A;  4Z9Q A;  3D9Y A;  3OC2 A;  5AVF A;  3VP4 A;  1DY6 A;  4OLG A;  3L7H A;  4NG2 A;  2RCX A;  3NOU C;  1LSV A;  2ZJ9 A;  1V9Z A;  3GEC A;  5HAR A;  1ZG6 A;  3HLE A;  5HDS A;  3S7P A;  4LCL A;  2B95 A;  4MN7 A;  5FQK A;  4HJ6 A;  3LY4 A;  3OOV A;  1VEU A;  2I72 A;  1W8Q A;  4ARZ B;  2ZC6 B;  2JCH A;  1WE4 A;  3W4O A;  4ZDX A;  4L9G A;  4DXC A;  2V0U A;  4E3N A;  2QPN A;  2XGN A;  4LRX C;  2I9V A;  4NXE A;  4X69 A;  3UE3 A;  3P01 A;  2B5R A;  4OPZ A;  3ZVW A;  5DKK A;  2VK3 A;  3TW8 A;  3T4K A;  3N4I A;  3Q7Z A;  2W0N A;  1RCJ A;  4QY5 A;  5HL1 A;  2OWJ A;  1MZU A;  2Y2I A;  1XP4 A;  1CI8 A;  4Y15 A;  3S4X A;  4HY8 A;  2EXA A;  4M4X A;  3F1N B;  1YMX A;  3A3J A;  2WGW B;  4H8R A;  4RX3 A;  3SH9 A;  4N1X A;  1DJB A;  3C7U A;  1GSX A;  4PKY G;  4UA6 A;  3PBQ A;  1MWT A;  4Q0H A;  1K0K A;  4PM5 A;  5AQ9 A;  4FCF A;  3TOI A;  4KZB A;  4FSF A;  4OQH A;  3CMZ A;  1P0Z A;  1CEF A;  2Y4A A;  4I3I A;  5FI7 A;  5J4E A;  3A0S A;  2J9O A;  5DJT A;  4ZTK A;  2VV8 A;  3BFC A;  4KG5 A;  4YOF A;  3LUQ A;  3G32 A;  3NDG A;  1BLS A;  4WEL A;  3S7N A;  4S2J A;  2X71 A;  5EUA A;  5HPI A;  3W2Z A; 
#chains in the Genus database with same CATH homology
 3O88 A;  4C3Q A;  5KSH A;  1WYC A;  3ZHH A;  4OQG A;  4N9K A;  3LO7 A;  1MBL A;  1U60 A;  4NK3 A;  4QY6 A;  5F82 A;  2ZQA A;  4CPK A;  1O7E A;  4OQ0 A;  2J7V A;  4E6W A;  4KZ9 A;  5CRF A;  5CXW A;  4Y0O A;  3W8K A;  1EWZ A;  3GVB A;  1XXM A;  3IH8 A;  4MNR A;  4U3T A;  1MWU A;  3HRE A;  3G2Z A;  3ITA A;  2HPB A;  5CHM A;  5FQM A;  3OPR A;  3TG9 A;  1BUE A;  4JF4 A;  1YLT A;  1GHM A;  2VGJ A;  2Y2K A;  3JYI A;  4KQR A;  2WKH A;  2EX6 A;  3QHY A;  5FAO A;  3QNC A;  1BLH A;  2R9X A;  1CK3 A;  5E2E A;  4P87 A;  4Y0T A;  4UA7 A;  2XD5 A;  4KQQ A;  3UE1 A;  1IEL A;  3W4P A;  1PWD A;  4UAA A;  1W79 A;  4PMA A;  2QZ6 A;  4R0Q A;  5CGW A;  3NI9 A;  4U0X A;  4BL2 A;  2Q9N A;  3Q7V B;  4R1G A;  1PYY A;  4DRT A;  1PW8 A;  2ZC7 A;  1YQS A;  3M2K A;  3ZNT A;  2Y2H A;  5CTM A;  2Y91 A;  3HLF A;  1ONG A;  3OZH A;  1PZO A;  3UPO A;  5FI6 A;  4JXG A;  4OVD A;  3ZDJ A;  1K57 A;  4GB7 A;  4RYE A;  3W4Q A;  1PWG A;  1N4O A;  4GZB A;  4LEN A;  1LHY A;  1BZA A;  2EFU A;  1BUL A;  2VGK A;  3A3E A;  3DTM A;  4B4X A;  3HUN A;  1FSY A;  4BD1 A;  1ES4 A;  1H8Z A;  1TDL A;  3CZD A;  4S2O A;  4ZAM A;  2HDR A;  1K54 C;  5M19 A;  4S2L A;  3NY4 A;  4WBG A;  1I2W A;  1LL5 A;  2IWC A;  3ZG0 A;  3SOI A;  3G31 A;  3HL9 A;  1TDG A;  1XA1 A;  4ZDX A;  4ZJ2 A;  4S2M A;  5TR7 A;  1XGJ A;  1FSW A;  3HVF A;  4OPQ A;  3WS2 A;  3NC8 A;  4S2P A;  5FAQ A;  4RX2 A;  1ONH A;  5BOH A;  1PI5 A;  3AGE A;  4GDN A;  2H0T A;  1E4D A;  1KGG A;  4D2O A;  1M6K A;  4QD4 A;  4DE0 A;  1K56 A;  4Q8I A;  3RXW A;  4K0X A;  4DF6 A;  3UDF A;  3UPP A;  2P9V B;  1E3U A;  2JC7 A;  1MY8 A;  1QME A;  2XLN A;  4JBF A;  4WZ5 A;  1XKZ A;  4FD8 A;  5FDH A;  3BFD A;  1YLW A;  3EQV A;  1IYO A;  1RGY A;  3NIA A;  1K56 D;  5CTN A;  4BJP A;  3N8S A;  2BG1 A;  3OPP A;  2DRW A;  1FOF A;  3MKF A;  5KMW A;  5GHX A;  1BTL A;  1E3U D;  4E3J A;  5HW3 A;  1K55 C;  5EOO A;  5A93 A;  2XR0 A;  1KVM A;  3BEB A;  3VFH A;  1IKI A;  1VM1 A;  2E8I A;  4KZ4 A;  2HDU A;  5DTS A;  2ZD8 A;  4JXV A;  5M1A A;  3UO9 A;  4LV0 A;  4DXB A;  1XPB A;  5CGS A;  5DF7 A;  3IT9 A;  1IKG A;  4ZJ1 A;  2JE5 A;  3GMW A;  3FYZ A;  4MBH A;  5CEC A;  2H10 A;  3NBL A;  1K38 A;  3N6I A;  3PBR A;  1NYY A;  2XH9 A;  4OOY A;  4IBX A;  1XA7 A;  4HBT A;  4OP8 A;  4NET A;  3WS0 A;  4OH0 A;  1L0G A;  1JTD A;  1YLZ A;  5FQ9 A;  4HES A;  5G18 A;  3C4P A;  2HP9 A;  3GQZ A;  3OCL A;  4UHU A;  3A3D A;  5F1F A;  3HUO A;  2RL3 A;  4KEN B;  2G2U A;  1HVB A;  3GSG A;  5EEC A;  4FH4 A;  2ZC5 B;  2Y2O A;  5IHV A;  4R3J A;  4GDB A;  3VFF A;  5TGF A;  4E6X A;  1GHI A;  4RVA A;  2Z2L B;  5EOE A;  1ESU A;  4RA7 A;  5EVI A;  3MZD A;  5GHY A;  4E3I A;  3GRJ A;  3AGD A;  2OV5 A;  1GA9 A;  3DW0 A;  2XDM A;  5AQ7 A;  3A3F A;  3IXH A;  3CJM A;  1FCO A;  2ZLY A;  4C75 A;  2Y2Q A;  1TVF A;  1K54 A;  4S2I A;  4R4R A;  5EVI D;  4N1H A;  2WGI A;  3HLC A;  4BLM A;  5E43 A;  3ZG5 A;  4KZA A;  5J8X A;  1CI9 A;  1ES2 A;  4EUZ A;  1KE0 A;  4WM9 A;  1K6R A;  1L0D A;  1G68 A;  1PWC A;  4Y7P A;  1E25 A;  2ZM2 A;  1H8Y A;  2V2F F;  4M3K A;  3IF6 A;  4LCM A;  4P0M A;  4R4S A;  4EQI A;  2ZQC A;  2ZMA A;  5D3O A;  4E3L A;  1W7F A;  1CEG A;  3LY3 A;  4JF6 A;  4GD6 A;  4GNU A;  4X56 A;  4P6B A;  1ZC2 A;  3HLB A;  5GLB A;  1W8Y A;  1S0W A;  2A49 A;  3IXG A;  3ZGA B;  1MXO A;  3BFG A;  5HFO A;  3G30 A;  1C3B A;  5FQJ A;  3ZVT A;  4YFM A;  2PU4 A;  1IEM A;  4R3B A;  4OPR A;  4JXS A;  1Q2Q A;  1LI9 A;  5HAP A;  2XK1 A;  4MLL A;  1LI0 A;  3BRM A;  4U0T A;  2WZX A;  4QHC A;  4FH2 A;  5L2F A;  2WK0 A;  2EXB A;  3IHA A;  3V50 A;  5DF9 A;  4S2N C;  3PBO A;  2Y2P A;  2HDQ A;  2J9P A;  3G35 A;  2ZQ8 A;  1W5D A;  2DCF A;  4MBF A;  2WAF A;  1SCW A;  3BLM A;  3LCE A;  2JBF A;  3ZFZ A;  3WS1 A;  1KE3 A;  1NXY A;  4BL3 A;  3BFF A;  3ZCZ A;  3IWI A;  3E2L A;  4KZ5 A;  1PI4 A;  3GR2 A;  4ZJ3 A;  2OLU A;  3BLS A;  1Y54 A;  2P9V A;  2WGW A;  1ES5 A;  4KG6 A;  4KZ6 A;  4PM9 A;  2XFS A;  4OQI A;  4XUZ A;  1FCM A;  3O87 A;  1FR1 A;  1GCE A;  1OME A;  2X02 A;  5HX9 A;  3VMA A;  3WS4 A;  5KZH A;  2Y59 A;  3MZE A;  4KZ7 A;  3HLW A;  1NRF A;  3OCN A;  3SS4 A;  5CED A;  5DTT A;  1ERM A;  1YLY A;  4X6T A;  5I94 A;  5FA7 A;  4C6Y A;  4UA9 A;  4X55 A;  3ZG9 B;  4WEJ A;  1HD8 A;  4OP5 A;  1SDE A;  1L0F A;  3HLD A;  3HLG A;  5CHJ A;  2EFX A;  2ZC4 B;  3IHB A;  2Q9M A;  5CGX A;  5FAT A;  2R9W A;  3N8L A;  2HP6 A;  2C6W B;  5CHU A;  4DDY A;  1PZP A;  2IWD A;  2QMI A;  2EX8 A;  1K6S A;  3V39 A;  1EI5 A;  3ZG8 B;  1YLP A;  3C4O A;  1ZG4 A;  3PBS A;  1FCN A;  1H5X A;  1G6A A;  4EBL A;  5GLD A;  3VOY A;  4IBR A;  4IED A;  3WS5 A;  3IQA A;  1JWV A;  3V3R A;  2FFY A;  1KDS A;  4IVI A;  3FV7 A;  2WKE A;  3MBZ A;  3SS3 A;  2PU2 A;  3UDX A;  2OSU A;  3SH8 A;  1PW1 A;  3ITB A;  4F94 A;  4LV1 A;  1VQQ A;  4HBU A;  4R23 A;  1FQG A;  3WRZ A;  2DNS A;  1SDN A;  1SKF A;  2Y55 A;  5AQA A;  5FAS A;  5EE8 A;  1ZKJ A;  1I2S A;  3UE0 A;  1S6R A;  3NCK A;  5HAI A;  4MBK A;  5CER A;  3VSK A;  1K57 C;  5FAP A;  4KZ3 A;  4L0L A;  2XF3 A;  4ZBE A;  3TSG A;  4OOM A;  4PM7 A;  5E2F A;  4DE3 A;  5GLC A;  1KGF A;  4MEZ A;  5E2H A;  5TFQ A;  5HAQ A;  1LLB A;  2A3U A;  5EPH A;  5GLA A;  1KVL A;  3V5M A;  1GA0 A;  1NY0 A;  1YLJ A;  2ZM8 A;  1JWZ A;  1XX2 A;  4KG2 A;  3M2J A;  3UNW A;  4JPM A;  2WZZ A;  3MXR A;  3GTC A;  3PAE A;  4KZ8 A;  1BLC A;  3QNB A;  2ZC3 B;  4PPR A;  3EQU A;  1AXB A;  4S2K A;  2GDN A;  3PTE A;  3AGF A;  1ESI A;  3GV9 A;  4ID4 A;  4JXW A;  1NZO A;  4WMC A;  2Y2N A;  5A92 A;  1O07 A;  1YT4 A;  1DJC A;  4X68 A;  1DJA A;  1KDW A;  2WGV A;  3V3S A;  2Y2M A;  4JF5 A;  3RJU A;  3N7W A;  1BT5 A;  2ZQD A;  5GHZ A;  3G4P A;  3Q7V A;  3N8R A;  4WMC D;  3VP3 A;  4OKP A;  3FKW A;  3M6H A;  5FQI A;  1M40 A;  2Y2J A;  3PBT A;  4WZ5 C;  2IWB A;  4BQM A;  1ERQ A;  4N9L A;  1FR6 A;  4Y0U A;  2Z2M B;  2ZQ9 A;  2WAE A;  2X01 A;  3PAG A;  5FQQ A;  4Z9Q A;  1N9B A;  4LV2 A;  3IWO A;  2WKI A;  3OC2 A;  1MPL A;  1K25 A;  2OLV A;  2ZQ7 A;  3VP4 A;  3Q1F A;  1ERO A;  3A3I A;  2HDS A;  2C5W B;  5FSR A;  1DY6 A;  1I5Q A;  3DWZ A;  2FFF B;  2WAD A;  2ZM0 A;  3BM6 A;  2EX2 A;  3CG5 A;  3P09 A;  3PBN A;  2HP5 A;  2Y2G A;  1K55 A;  1YM1 A;  4EV4 A;  1MKI A;  5EVI B;  1ES3 A;  3BYD A;  1IYP A;  4OLG A;  3BEC A;  3O3V A;  3MXS A;  4QU3 A;  1K4E A;  3NDE A;  3Q82 A;  3HBR A;  2V1Z A;  2RCX A;  3O86 A;  4PM6 A;  3SS5 A;  1QMF A;  4WYY A;  2ZJ9 A;  3IF5 A;  5HAR A;  3UY6 A;  1ZG6 A;  3HLE A;  4WZ4 A;  2XD1 A;  2WUQ A;  5GL9 A;  4LCL A;  4QJG A;  5FQK A;  5A91 A;  4GD8 A;  2XFT A;  4JLF A;  3BFE A;  3LY4 A;  3SH7 A;  2UWX A;  4DE2 A;  3IF6 B;  2XQZ A;  4K91 A;  4OPY A;  3VP0 A;  4YIN A;  3HUM A;  1PIO A;  4EWF A;  2EX9 A;  3G2Y A;  3S22 A;  1IYS A;  2I72 A;  1W8Q A;  5F1G A;  3S1Y A;  5FI2 A;  3VOZ A;  4EBN A;  2ZC6 B;  2JCH A;  2H5S A;  1WE4 A;  2Y2L A;  3LEZ A;  3M6B A;  4GOG A;  3P98 A;  4WEK A;  5EVI C;  3UDI A;  1JTG A;  3VP1 A;  3W4O A;  3WRT A;  4DXC A;  3ISG A;  4QB8 A;  1KGE A;  4HEF A;  5KSC A;  4E3N A;  2QPN A;  2XGN A;  5CEB A;  1GHP A;  4X69 A;  3VP2 A;  1RGZ A;  2WYX A;  5M18 A;  1NZU A;  3UE3 A;  5DVA A;  3C7V A;  5A90 A;  1ALQ A;  4OON A;  1MWR A;  2B5R A;  3Q81 A;  2BLS A;  4OPZ A;  1YMS A;  3ZVW A;  1JVJ A;  2G2W A;  3UN7 A;  4OLD A;  4GKU A;  3VSL A;  3D4F A;  1KE4 A;  1K4F A;  1L0E A;  1WYB A;  3N4I A;  2XEP A;  3Q7Z A;  1RCJ A;  4QY5 A;  3IF6 C;  3MZF A;  4N92 A;  4DKI A;  5HL1 A;  1L2S A;  4E3M A;  3IXB A;  2P74 A;  5DTK A;  2Y2I A;  1XP4 A;  1CI8 A;  3S4X A;  4B4Z A;  1TEM A;  2EXA A;  3ZNY A;  1XGI A;  1YMX A;  3A3J A;  4PM8 A;  2WGW B;  4IVK A;  3FKV A;  4H8R A;  4RX3 A;  5JYO A;  5F83 A;  1Z6F A;  1NYM A;  3MKE A;  1IYQ A;  3SH9 A;  3WWX A;  4CJN A;  3RXX A;  4N1X A;  4LV3 A;  1DJB A;  2J8Y A;  4EBP A;  3I7J A;  3C7U A;  2PBY A;  4UA6 A;  4BEN A;  4XXR A;  3IWQ A;  4BD0 A;  3PBQ A;  1MWT A;  4X53 A;  3OPH A;  5E2G A;  4PM5 A;  3C5A A;  5AQ9 A;  4JKT A;  4FCF A;  4DDS A;  1RP5 A;  4OOL A;  3TOI A;  5JYP A;  1BLP A;  4E3O A;  3FWL A;  3G34 A;  4KZB A;  4FSF A;  4OQH A;  1HZO A;  3IH9 A;  4S2N A;  2H0Y A;  3CMZ A;  5AQB A;  1CEF A;  1J9M A;  1LL9 A;  2Y4A A;  3FZC A;  3ZG7 B;  5FI7 A;  2V20 A;  1SHV A;  4O7D A;  3UPN A;  1Q2P A;  2J9O A;  4E3K A;  4ZTK A;  3MFD A;  3BFC A;  4P85 A;  3B3X A;  3Q07 A;  4XUX A;  4KG5 A;  1BSG A;  1HTZ A;  5EVL A;  1JWP A;  4A5R A;  3OPL A;  4DE1 A;  3E2K A;  3G32 A;  1NJ4 A;  3NDG A;  4K0W A;  1MWS A;  1BLS A;  4KQO A;  4WEL A;  4B88 A;  2CC1 A;  3DWK A;  4S2J A;  2X71 A;  3IXD A;  4GN2 A;  5U47 A;  5EUA A;  5DF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...