1IYSA

Crystal structure of class a beta-lactamase toho-1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Extended-Spectrum beta-Lactamase Toho-1: Insights into the Molecular Mechanism for Catalytic Reaction and Substrate Specificity Expansion
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE TOHO-1
total genus 95
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1iysA00
2EFXA 3C7VA 3V39A 1ESUA 3HLFA 1C3BA 3NIAA 1YT4A 1FSYA 4GOGA 3S22A 1ERQA 4KZ9A 5A92A 3PBQA 1NZUA 4OQ0A 1YLTA 2ZQDA 3P09A 5A93A 4FCFA 1NJ4A 1AXBA 3IF6C 4KZBA 5FAOA 5FQ9A 3SS5A 4WYYA 3NI9A 3QNCA 4GD6A 4X68A 5GLDA 3ZVWA 4XXRA 1FR1A 3BECA 1DJBA 3OCLA 2P9VA 3A3IA 1N9BA 1FOFA 4DXCA 2QZ6A 5M18A 3WS0A 5CHUA 3M2JA 3N8RA 1L0GA 4BL2A 1KVLA 2A3UA 4K0WA 1J9MA 4OLGA 5DTTA 4R4RA 4DE0A 1DJAA 2EFUA 4ZTKA 1JTGA 3MZEA 4UA7A 1K57A 5F1GA 4P87A 5CEBA 2ZQCA 3N7WA 4QHCA 2Y59A 3UNWA 2P9VB 2VGKA 4EBPA 4H8RA 3BRMA 1FSWA 2WGWA 3HLBA 1ZG6A 3UPOA 2Y2HA 4BD1A 3HLWA 1FCMA 2J9PA 3BM6A 5KSCA 3PTEA 3IH8A 3WS4A 1BLSA 1O07A 5FSRA 4GDBA 4QD4A 2XGNA 2JCHA 2IWCA 1LI0A 4EBNA 1K55C 3B3XA 4OQIA 1TDLA 1SCWA 4P85A 1KVMA 1KE0A 2WAEA 5CTNA 4S2JA 4ZJ1A 2Y91A 1SKFA 5HFOA 3FKVA 3CZDA 1L0DA 2JBFA 1SDNA 1EROA 2ZLYA 4XUXA 4YINA 2UWXA 3TG9A 3UO9A 4JLFA 1CEGA 2EXBA 3C4PA 2ZJ9A 3NY4A 4R4SA 3ZNYA 4RX2A 1YLPA 3ZG0A 1K38A 1K4FA 1JTDA 1FCNA 3EQUA 3BFGA 2Y2PA 4B88A 4E3IA 1YLJA 4X56A 2X02A 1CI9A 4IVKA 5EOOA 4OPQA 3BLSA 1N4OA 4MLLA 3OPPA 1PYYA 1RGZA 3MXRA 4WMCA 4QB8A 3MKFA 1TVFA 3E2KA 4A5RA 3O3VA 4E3KA 4JKTA 4ZDXA 1ES5A 4R3BA 5DF9A 4DE3A 3E2LA 4LV0A 4RA7A 3HL9A 1HVBA 1BSGA 1RP5A 3PBOA 1IYQA 2V20A 4FD8A 4OP8A 1KDSA 2Y2MA 5HARA 3TOIA 4S2PA 3BFFA 5M1AA 3IF6A 5AQ7A 1KGFA 4MBHA 3A3JA 4QY6A 3SS4A 2R9XA 3UE1A 2P74A 3DWZA 1XP4A 1WYBA 5FA7A 3IHAA 4F94A 4EWFA 4GDNA 5FI2A 5CTMA 2OLUA 3Q07A 4IEDA 3MKEA 4BQMA 1BLHA 4KZ7A 5EECA 4OLDA 3RXWA 4E3MA 5FQJA 3S1YA 2WGWB 4X6TA 1K54C 3OPRA 5AQ9A 5J8XA 5A91A 4UAAA 3IF5A 2WAFA 2G2UA 3M2KA 3BLMA 1BLPA 3GV9A 3WRTA 3DWKA 3MXSA 3PBRA 1MWUA 3Q7ZA 3A3DA 4KG5A 3HBRA 2IWBA 2XK1A 3OZHA 1HD8A 4YFMA 4QY5A 1JWZA 2J7VA 2PU2A 4B4ZA 5GL9A 3IQAA 4KZ6A 4OOLA 1ZC2A 5JYPA 3O86A 5HX9A 5TGFA 2I72A 4X55A 2Y2KA 1KE3A 2FFYA 5FDHA 3UDIA 1RGYA 3I7JA 3QHYA 5BOHA 4DF6A 3BFDA 5GHYA 1W7FA 3Q82A 4KG2A 4WZ4A 5E2FA 2OLVA 3UE3A 2EX9A 3ZCZA 1PWGA 1NXYA 4N9KA 3ITBA 3IXGA 4WEJA 5TFQA 2HP5A 1YLYA 5TR7A 2ZC3B 5FAPA 1L0FA 5FQQA 1SHVA 3PAEA 4XUZA 3ZVTA 2H10A 1ONHA 1MWSA 4S2LA 2IWDA 5EVIA 3HREA 3AGDA 3HUOA 4HBTA 2OV5A 1XA7A 3VP0A 2WKHA 4P6BA 1S0WA 2XR0A 3OPHA 3ZNTA 2H0YA 2FFFB 2PBYA 5CGSA 3PBNA 1K56A 4HEFA 1GCEA 1PI4A 3Q81A 1K4EA 4OOMA 2RCXA 2XQZA 3NCKA 4RVAA 4S2NA 4BL3A 3NBLA 3GMWA 3UDXA 3C4OA 4EQIA 4GZBA 4DXBA 3IT9A 1ZG4A 4R23A 3N4IA 3G2YA 3CG5A 4N1HA 1VM1A 1YMXA 1TDGA 4UA9A 5HAIA 3VSLA 2C5WB 5CRFA 2J8YA 3UPNA 1MXOA 3LCEA 4R1GA 4S2KA 4E6XA 1IELA 5DTKA 3DTMA 5I94A 3G30A 3C7UA 3N8LA 2ZC5B 3GRJA 2Y2QA 3Q7VA 4FH4A 4DRTA 2WGIA 1YQSA 2Y2NA 3SOIA 5GHZA 1IKIA 4Y0UA 4LENA 4OKPA 3LY4A 4KZ4A 3ZG9B 5KZHA 1ES4A 1GHPA 4ID4A 4KQRA 4L0LA 1W8QA 4PM6A 3FZCA 5E2HA 3HLDA 4GNUA 2DRWA 4NETA 5EOEA 3N8SA 3G35A 4R0QA 1TEMA 2XLNA 3ZDJA 5HL1A 1PZPA 2PU4A 3HLCA 2J9OA 1KGEA 1MY8A 4OPRA 2ZQAA 4BENA 4N1XA 2X01A 3UPPA 2XFSA 3ZG7B 4LV2A 1EI5A 4Q8IA 4R3JA 2XF3A 2XEPA 4GD8A 4DE1A 1CEFA 3G32A 2DNSA 3MZDA 5EUAA 5FASA 3AGEA 4JF6A 1BTLA 1Z6FA 5HAQA 1U60A 1NRFA 3SH7A 5CHMA 3ZG8B 2OSUA 3FKWA 1W79A 4BLMA 4OPZA 2HDQA 4PPRA 3GR2A 2ZD8A 4DDYA 1LHYA 2BLSA 1LLBA 4JF5A 5DF8A 3FWLA 4DE2A 1IYOA 4JXSA 4KZ5A 3ZHHA 2XFTA 3V5MA 4LCMA 4B4XA 2A49A 2ZQ9A 1L0EA 1LI9A 3IXHA 5FAQA 4EUZA 4N9LA 4ZAMA 1LL9A 1ES2A 4OQHA 3RJUA 3SH8A 4U0XA 2HDUA 5CECA 2G2WA 3Q7VB 3NDEA 2V1ZA 1L2SA 4BJPA 3VP3A 1NYYA 2WGVA 5CGXA 5EVLA 1VQQA 1GHMA 1W5DA 5CXWA 4JPMA 4Y7PA 1IKGA 4QU3A 2EX8A 3NDGA 4KZAA 5CERA 3WS2A 1PZOA 4PM7A 2HP6A 5EVIB 3VP2A 3EQVA 3RXXA 4FH2A 1FQGA 3C5AA 2XD5A 3LO7A 3HUNA 4IVIA 3UN7A 2X71A 4GB7A 4Y0OA 4OONA 3IWQA 3S4XA 1S6RA 2QPNA 4JXVA 4JBFA 4PM5A 3FYZA 1MPLA 5GLBA 2R9WA 3CMZA 1I2SA 1BULA 4GN2A 5DVAA 5KMWA 4OH0A 5HW3A 2WK0A 3G31A 1GHIA 1BT5A 1E4DA 2Y2IA 2HPBA 5A90A 1PIOA 5HAPA 1ESIA 1SDEA 2Y55A 1O7EA 4GKUA 2ZC7A 4MBKA 4RX3A 1EWZA 3PAGA 4C3QA 4CPKA 2H5SA 1K6RA 3W4OA 4E3LA 1QMFA 3WS5A 3OPLA 2ZM8A 4Z9QA 3VP4A 5F82A 4BD0A 4MEZA 2ZQ8A 3BYDA 4OPYA 5IHVA 3SH9A 3G4PA 3UDFA 3V50A 1ES3A 4LCLA 2WZZA 3DW0A 4WZ5C 1GA9A 1XPBA 3IH9A 1ZKJA 1K54A 4S2IA 4WEKA 1PW8A 5D3OA 1XKZA 3V3SA 4E3NA 3ITAA 2WKEA 3MZFA 4OQGA 2XDMA 4JF4A 2ZC6B 4S2NC 3W4PA 2JE5A 3O88A 2BG1A 1W8YA 3PBTA 4JXGA 4IBRA 3IWOA 1DY6A 1CI8A 3FV7A 3VMAA 2ZQ7A 4KZ8A 4M3KA 3VOYA 4E3OA 4D2OA 1WE4A 3WS1A 1CK3A 1E25A 2EX2A 2JC7A 2ZMAA 1YLZA 2Y2JA 4MBFA 4DDSA 3MFDA 3M6HA 5GHXA 2H0TA 5G18A 4EBLA 1MKIA 5CHJA 1FCOA 2B5RA 1OMEA 1LL5A 1XX2A 2ZM0A 5EVID 1XA1A 1YMSA 3N6IA 4LV3A 3GTCA 4OVDA 1XGIA 1PWDA 2Z2MB 1MWRA 2Y4AA 3AGFA 3HVFA 5F83A 5GLAA 1I5QA 4ZJ3A 1ONGA 1JWPA 1KGGA 1YM1A 4CJNA 3GVBA 5AQAA 5FATA 4IBXA 2Q9NA 2RL3A 5E2GA 4HESA 3ZGAB 1PI5A 4X69A 4N92A 3IXBA 2ZC4B 4P0MA 4WMCD 1K56D 1KE4A 3W4QA 2WKIA 2V2FF 1IEMA 4PM8A 1Q2QA 5M19A 3ISGA 2XD1A 1HTZA 3JYIA 3LY3A 2HDRA 4ZJ2A 3VP1A 4E6WA 2Y2GA 3IWIA 3A3FA 1DJCA 4O7DA 4C75A 3G2ZA 4RYEA 2VGJA 5CGWA 2WADA 5FQKA 1NYMA 3TSGA 1WYCA 5KSHA 1PW1A 4KZ3A 4OOYA 3VOZA 3LEZA 2WYXA 5EE8A 2GDNA 1ERMA 3BEBA 1M40A 4JXWA 1NZOA 4PM9A 4QJGA 4ZBEA 3SS3A 1MBLA 1K6SA 2QMIA 5FQIA 2Y2LA 4LV1A 2Y2OA 4WBGA 4NK3A 3HUMA 3GSGA 4X53A 2WZXA 5AQBA 1K57C 5FI7A 5L2FA 1IYPA 3BFCA 1JVJA 1K25A 4OP5A 4WZ5A 4WM9A 5JYOA 4K91A 3ZFZA 1MWTA 1XGJA 3UE0A 1I2WA 3ZG5A 5CEDA 3G34A 4KQOA 5FI6A 4DKIA 1H5XA 5E43A 4MNRA 3MBZA 3V3RA 3P98A 5U47A 2EXAA 1E3UA 3PBSA 3M6BA 4S2MA 3CJMA 1QMEA 1GA0A 1G68A 3HLGA 2Q9MA 1HZOA 2WUQA 3BFEA 4EV4A 1K55A 1M6KA 4FSFA 4HBUA 3VFFA 1BLCA 4K0XA 5EPHA 3WRZA 3O87A 1G6AA 2Z2LB 5DTSA 1BUEA 4PMAA 4E3JA 2HDSA 1H8ZA 4S2OA 4UA6A 5EVIC 1Q2PA 3NC8A 2EX6A 3VFHA 4Y0TA 3OC2A 1JWVA 2C6WB 1KDWA 1H8YA 2CC1A 3QNBA 1E3UD 1RCJA 4KG6A 3A3EA 3WWXA 3HLEA 4C6YA 5F1FA 4U0TA 4WELA 1ALQA 4KQQA 3VSKA 3UY6A 1IYSA 1XXMA 1BZAA 2E8IA 2HP9A 5FQMA 3IXDA 5DF7A 5E2EA 4UHUA 3IHBA 3OCNA 4KENB 2DCFA 3GQZA 4U3TA 3D4FA 3IF6B 2XH9A 1NY0A 1Y54A 1PWCA 3W8KA 1YLWA 1FR6A 5GLCA 2ZM2A 3Q1FA
chains in the Genus database with same CATH superfamily
4YOFA 4ARZB 1YT4A 1FSYA 2L0WA 4G3VA 2ZQDA 1NJ4A 1IFQA 5FAOA 3NI9A 3QNCA 3ZVWA 4XXRA 3BECA 1S66L 1P9WA 4DXCA 1FOFA 5HWTA 1L0GA 1KVLA 1YSQA 5DTTA 4ZTKA 3MZEA 2VGLM 3E4QA 1K57A 5F1GA 4P87A 5CEBA 1OTBA 2Y59A 3UNWA 4CLCA 4EXOA 4Y5FA 2WGWA 1ZG6A 4BD1A 2W3DA 1BLSA 1O07A 2HZ5A 1T1BA 2V0UA 4QD4A 4B9OA 4KUOA 4P85A 4S2JA 2Y91A 2W3EA 5AVEA 2VEAA 1NRJA 1N9LA 4YINA 3UO9A 3PYPA 3C4PA 3NY4A 4RX2A 3ZG0A 1K4FA 1FCNA 5L8MA 3QP6A 5EOOA 2OAQ1 3BLSA 3PXPA 3EEHA 3IBRA 3QP5A 3NOTC 3O3VA 3KSIA 2PR6A 3DTIA 4D60A 1HVBA 1BSGA 5EVEA 3PBOA 1IYQA 2WKRA 4FD8A 3L7HA 4OP8A 2AVXA 2W1TB 4S2PA 2P74A 4EWFA 5FI2A 5CTMA 5HD5A 1YPRA 4GS9A 2Z6DA 3MKEA 1BLHA 4EU0A 4KZ7A 4EUVA 4CLCD 1K54C 3FG8A 3BY8A 4UAAA 2B95A 1BLPA 3Q7ZA 4KG5A 3CUEC 3HBRA 2LB9A 2XK1A 3OZHA 1HD8A 1T1AA 5JYPA 1OTIA 4X55A 1P9RA 2H28A 2JN7A 5GHYA 5KIZA 4LGWA 1PWGA 2GZAA 5TFQA 3ZVTA 4Q0HA 1MWSA 4S2LA 2IWDA 4LPZA 5EVIA 3NJAA 3AGDA 4HBTA 1LSXA 1S0WA 2H0YA 4BBTA 1GCEA 4OOMA 3NCKA 4I3IA 1T18A 1V9ZA 2ZOHA 3C4OA 4DXBA 3IT9A 3KSFA 3R4KA 2HJEA 5FDSA 2WKQA 2FZ0A 2C5WB 5A8BA 2J8YA 4S2KA 1IELA 3C7UA 2ZC5B 2R78A 2JKRM 4EESA 4Y0UA 3LY4A 3B33A 4KZ4A 4ID4A 1GHPA 1W8QA 3HLDA 4FUWA 5HWWA 2D02A 3N8SA 3ZDJA 2XLNA 3NOUC 3S7QA 1KGEA 1MY8A 5F6AA 3UB9A 5DKLA 4N1XA 2X01A 4BENA 2KLIA 4DE1A 2DNSA 3SH7A 1W79A 3FC7A 5HDCA 3E4OA 4PPRA 2I9VA 2YKHA 4LFUA 1LHYA 2JHEA 4JF5A 4NXFA 1KOUA 3FWLA 3T1XA 2O9CA 2O9AA 4KZ5A 4WL9A 3ZHHA 4EEUA 4LCMA 2A49A 3G6OA 3PR6A 1LL9A 3S7OA 2B18A 4BJPA 4JGOA 5EVLA 3DTEA 5CXWA 2EX8A 3NDGA 4EQ1A 5EVIB 1XFQA 3F1OB 1ZHHB 3IWQA 2QPNA 3UMDA 3FYZA 5EFWA 2R9WA 1TF1A 1BULA 1LSVA 4OH0A 3G31A 1BT5A 2HPBA 5A90A 1PIOA 1O7EA 4MBKA 2PDRA 4CPKA 3W4OA 3S7PA 5K5BA 2FH5A 2ZM8A 5F82A 3G4PA 4WZ5C 1OTAA 3IH9A 4S2IA 1PW8A 3V3SA 3ITAA 2WKEA 2XDMA 2V0WA 4R38A 4S2NC 5CX7A 2JE5A 2BG1A 1W8YA 3IWOA 1CI8A 3A0VA 2ZQ7A 1TS6A 3VOYA 4D2OA 2ZMAA 4HJ3A 2Y2JA 3MFDA 4H6JB 3M6HA 1F9IA 4JGQA 3B42A 2M7VA 1OMEA 1PNEA 1LL5A 2ZM0A 3GTCA 2VV8A 1JWPA 3GVBA 4ETXA 2BTFP 5AQAA 5FATA 2Q9NA 3UB5P 4X69A 3IXBA 1S1YA 2ZC4B 3KO6A 4PM8A 1Q2QA 1TD5A 3LY3A 4E6WA 4O0PA 3A3FA 4O7DA 4C75A 3G2ZA 2O9BA 2VGJA 2W3GA 2V1BA 1NYMA 2L1MA 1PW1A 5TBMA 3LEZA 5EE8A 2GDNA 4ZBEA 2QMIA 4R3AA 1XJ6A 5FI7A 1K57C 3EWKA 4R6LA 1IYPA 3L9KA 1BYWA 1XGJA 1I2WA 5E43A 3NOPC 2DMWA 4NXEA 5J7EA 1GA0A 2Q9MA 1HZOA 2YKFA 4HBUA 1GSVA 4K0XA 3WRZA 3O87A 1G6AA 2WKPA 5DTSA 2HDSA 1H8ZA 3ULFA 3OC2A 2C6WB 3MQ0A 4KG6A 3A3EA 3HLEA 4WELA 4KQQA 3VSKA 5FL3A 3A0RA 3IXDA 5DF7A 4UHUA 3IHBA 4KENB 4UEYA 3D4FA 3VV4A 1NY0A 3CUEA 1Y54A 1YLWA 1D06A 3Q1FA 3V39A 5FEGA 4LRYC 1NWZA 4Y13A 5A92A 4OQ0A 1NZUA 1YLTA 3QP4A 3LFVA 3SS5A 4GD6A 5GLDA 1DJBA 4WN5A 2P9VA 1N9BA 4HP9A 1ODVA 1VETA 3N8RA 2OWJA 4K0WA 4OLGA 4DE0A 2EFUA 4KQDA 2Y79A 4H8RA 3BRMA 3HLBA 1FCMA 3BM6A 3IH8A 2XRNA 5FSRA 2IWCA 1LI0A 4EBNA 5F68A 5CTNA 3FKVA 1L0DA 2JBFA 3RH8B 3LI8A 2ZLYA 2EA9A 4JLFA 3E98A 5HPIA 3LIEA 2ZMVA 4OPQA 3T50A 3OPPA 4WMCA 4QB8A 4ME4A 4JKTA 1ES5A 4R3BA 4DE3A 3E2LA 3HL9A 2V20A 1XJ3A 1KDSA 2Y2MA 3MJQA 1KGFA 4MBHA 4QY6A 3SS4A 2R9XA 1XP4A 1WYBA 2OLUA 4FOFA 4BQMA 1SKOA 2M1CA 3RXWA 5TJJA 5J8XA 3GV9A 2J3TC 3WRTA 3MXSA 3PBRA 4ZRRA 3A3DA 2IWBA 4X1MA 5GL9A 4OOLA 2ZMFA 3QP8A 1TS0A 5TGFA 3BW6A 5BOHA 1RGYA 3I7JA 2CMNA 4DF6A 1DRMA 1W7FA 4KG2A 1NLYA 4WZ4A 5E2FA 2EX9A 2VGLS 1SHVA 3PAEA 2Q0OA 3QP1A 2M7UA 1XA7A 3VP0A 2PD8A 4P6BA 3UE6A 2XR0A 2VJWA 3VE4A 1K56A 2W1RA 1PI4A 2RCXA 4RVAA 3GMWA 2JKTI 4I5SA 4GZBA 3IBJA 1ZG4A 3ZQ5A 4R23A 4N1HA 1VM1A 1YMXA 4IUHA 3OOVA 5CRFA 1MXOA 3LCEA 4I39A 5DTKA 3DTMA 3N8LA 2IA2A 4UQIM 4ESPA 3Q7VA 1YQSA 3SOIA 3HJKA 1IKIA 4OKPA 5LBRA 4L0LA 3FZCA 4HH2A 4GNUA 4M4XA 3IS2B 5HL1A 3LEQA 1MC0A 3LIFA 4OPRA 4LV2A 4Q8IA 4R3JA 2NUPC 2XF3A 5EUAA 3G32A 3MZDA 3AGEA 1SKOB 4JF6A 5CHMA 5DFXA 4BLMA 4EEPA 3GR2A 4DDYA 1LLBA 1D7EA 1G28A 1OPXA 3HJIA 3V5MA 1P0ZA 2ZQ9A 1XFNA 1G6OA 4N9LA 1ES2A 3SH8A 4U0XA 5L10A 2HDUA 2G2WA 3Q7VB 1NYYA 2WGVA 5CGXA 1GHMA 4GLQA 1IKGA 3MR0A 4KZAA 4MMNA 2HP6A 3EQVA 3C5AA 4IVIA 2XD5A 3LO7A 3U2AA 3UN7A 2X71A 4Y0OA 4OONA 3K3CA 3S4XA 1S6RA 4JXVA 4JBFA 3UMEA 1PRQA 3CMZA 4GN2A 4MN6A 5DVAA 5HWVA 3P01A 1PFLA 5HAPA 3F1OA 1SDEA 3KSGA 2Y55A 2ZC7A 4RX3A 4C3QA 4F3LB 2ZBBA 3TE8A 3D72A 3VP4A 4BD0A 4MEZA 2ZQ8A 3BYDA 2V8CA 4OPYA 4BBVA 2VLGA 2WZZA 3MSHA 1K54A 4WEKA 3MZFA 4OQGA 4JF4A 2ZC6B 2J3WA 3W4PA 3O88A 4PKYA 5HD3A 4KZ8A 1WE4A 1YSPA 2JC7A 2EX2A 4CLCB 4DDSA 1W63Q 2H0TA 2VK3A 4HI4A 4HHDA 2B5RA 3RFBA 1XA1A 4LV3A 4GJ4A 5L09A 1EW0A 1PWDA 5GLAA 2Y4AA 1I5QA 3VE3A 1KGGA 1A0KA 4CLCC 3H7WB 1VEUA 3MF0A 2QJ5A 3IX3A 5E2GA 4HESA 3W2ZA 4HH3A 1PI5A 2QJ7A 4N92A 3MS6A 4WMCD 3W4QA 1IEMA 5M19A 4CQHA 2XD1A 3VP1A 4ZJ2A 4DJ2A 3IWIA 1DJCA 5CGWA 2KDKA 3C30A 2WYXA 1WA9A 3BEBA 1M40A 4JXWA 1K6SA 3LR5A 4K08A 3F1PA 4HQAA 4WBGA 2WZXA 4G3KA 1JVJA 3LIDA 4OP5A 3T4TA 3ZFZA 1MWTA 4DKIA 1H5XA 3LUQA 4Z1WA 2JKTM 4EETB 3PBSA 2HJ9C 2KX6A 4PAUA 1NLZA 3O5YA 1BUEA 4E3JA 3CPTB 4KUKA 1H3QA 2EX6A 3VFHA 1JWVA 3KYQA 1H8YA 5F1FA 2XA7M 2QKPA 4U0TA 1ALQA 1LL8A 2OAP1 1XXMA 4P6ZM 1BZAA 2E8IA 2DCFA 3MFXA 3IF6B 1UWNX 4HIAA 3F1PB 3W8KA 1FR6A 2ZM2A 1ESUA 3HLFA 1C3BA 3S22A 3PBQA 4HOIA 4FCFA 4KZBA 5FQ9A 4WYYA 4MDZA 1FR1A 4G3WA 3VOLA 3A3IA 5M18A 1OTEA 4Q0JA 1V9YA 2O0YA 3M2JA 2PRFA 4BL2A 2A2LA 2A3UA 4R4RA 3MQOA 4UA7A 4GS9B 2OWHA 4HJ6A 1J3WA 2P9VB 3UPOA 2Y2HA 3PTEA 3WS4A 2B02A 4HY8A 4GDBA 5G4YA 3B3XA 1TDLA 1SCWA 1KVMA 3IS2A 5HFOA 3BJNA 2PBDP 4XUXA 2EXBA 2ZJ9A 5FEFA 2K31A 4R4SA 3ZNYA 3JVUA 3BFGA 4B88A 5DKKA 4X56A 3CAXA 4QPRA 2X02A 4IVKA 3BY9A 1N4OA 4MLLA 2VV6A 3P7NA 1RGZA 2K7SA 3MXRA 1TS7A 4QWOA 3MKFA 1TVFA 3E2KA 3D3OA 4E3KA 5DF9A 3LI9A 4LV0A 4RA7A 2VV7A 5HARA 3K2NA 2P7JA 3IF6A 2PT7A 3H9WA 3DWZA 5G4ZA 3E0YA 2Y8HA 5FA7A 4F94A 4GDNA 3CWFA 5EECA 4E3MA 3KX0X 3S1YA 2WGWB 4X6TA 5AQ9A 3OPRA 3M2KA 3BLMA 4MN5A 3T1RA 2QYBA 4II7A 4NEED 4YFMA 2PU2A 3S7NA 5I5LA 3IQAA 5TBMB 1JNUA 5IU1A 2I72A 4DJ3A 1H0MA 4NKPA 3BFDA 2OLVA 1NXYA 3ITBA 1GSWA 2HP5A 5TR7A 2ZC3B 5FAPA 4GHIA 3JPUA 4XUZA 1ONHA 4I3AA 3HREA 1N9OA 3NULA 3OPHA 4JGPA 4P6ZS 4BBUA 5J3WA 3ZNTA 3EEAA 4BL3A 3NBLA 3FPVA 3N4IA 3G2YA 1TDGA 4UA9A 5HAIA 3UB6A 3UPNA 4R1GA 4E6XA 1XJ4A 2MJ6A 1OT9A 1ZTUA 3G30A 3MMHA 4FH4A 2WGIA 3RTYA 3CITA 4LENA 2V1AA 4KQRA 1X0OA 5E2HA 2W27A 4NETA 4IHQA 3T4OA 4MCWA 3HLCA 2J9OA 4GCZA 2BASA 3T4JA 3UPPA 2XFSA 2OOLA 1EI5A 4LRXC 3T4SA 4GD8A 1F98A 2XEPA 1CEFA 2P04A 1T1CA 5HAQA 1U60A 3ZG8B 3F1NA 1VETB 2ZD8A 4NG2A 4YWZA 4UQIS 5J4EA 1IYOA 1K0KA 2XFTA 1LI9A 3IXHA 5FAQA 1UGUA 4EUZA 4I38A 4OQHA 2K2NA 3A0SA 3NDEA 2V1ZA 3VP3A 1VQQA 3R7WA 4JPMA 1Z09A 4QU3A 5CERA 4PKYG 5EV0A 3VP2A 3DAVA 4FH2A 2QWSA 2PHYA 1VB6A 4Y2FA 4FTXA 4PM5A 1MPLA 5AJGA 5KMWA 3LGOA 5HW3A 1N9NA 2WK0A 3BQ8A 1GHIA 1E4DA 2Y2IA 3F1NB 2XSSA 3MQQA 3T12B 3PAGA 1K6RA 4E3LA 1OJ5A 4Z9QA 2GJ3A 5IHVA 5HDDA 4LCLA 3DW0A 1GA9A 1XPBA 1ZKJA 4PHTA 4X1LA 5D3OA 4YNRA 3ZYTA 4L9GA 4IBRA 1DY6A 3FV7A 3VMAA 3TJZC 4E3OA 3WS1A 2EWVA 1CK3A 4MBFA 4ARZA 3GDIA 5DFYA 1YMSA 3N6IA 1CF0A 4OVDA 1XJ2A 2PR5A 1XGIA 2Z2MB 1MWRA 3HVFA 2GX5A 1ONGA 1YM1A 4CJNA 3T1SA 2A24B 3H82A 5EM0A 1DP9A 3UB7A 1GSXA 1K56D 1KE4A 5C5KA 4EERA 2HGVA 2LB5A 2INWA 3ISGA 1HTZA 3EOIA 3PHYA 2Y2GA 1VEUB 4RYEA 2XROA 1WYCA 5KSHA 4Y15A 3IX8A 4KZ3A 3VOZA 4PM9A 4EW7A 4QJGA 3SS3A 1HLUP 3CHWP 3CI6A 5FQIA 5EM1A 4LV1A 5F69A 4IJGA 3HUMA 3GSGA 4X53A 5L2FA 4LRZE 3KYZA 2L4RA 4WM9A 5JYOA 3UE0A 1IOUA 3G34A 4MNRA 2ZOIA 3MBZA 3P98A 3LYXA 3TRCA 1E3UA 4S2MA 3MXQA 3LR3A 1G68A 3BFEA 1M6KA 3B47A 2EWWA 5EPHA 5HPFA 3EGDC 4PMAA 3D9YA 3NC8A 4Y0TA 2ACGA 3GECA 3QNBA 3WWXA 4C6YA 2W1TA 1H8MA 2HP9A 2W3FA 5FQMA 5E2EA 3OCNA 3DTKA 4IUKA 5MC7A 4WEJA 5GLCA 1RP5A 4WF0A 2EFXA 3LR0A 3C7VA 3NIAA 4GOGA 1S4RA 1ERQA 4KZ9A 3P09A 5A93A 2KOIA 1LSWA 1AXBA 3IF6C 4X68A 3H7WA 4HP4A 4Y3IA 3OCLA 2QZ6A 1MZUA 4E04A 3WS0A 5CHUA 5DJUA 3T4KA 1J9MA 4DMZA 1DJAA 1JTGA 2VKSA 4L9FA 2ZQCA 3N7WA 4QHCA 3QP2A 2VGKA 1FSWA 3LIBA 3HLWA 2J9PA 5KSCA 2XGNA 2JCHA 4B93A 1K55C 4OQIA 3LIAA 1KE0A 2WAEA 4ZJ1A 1SKFA 3T1QB 3CZDA 1SDNA 1EROA 5IS1A 2UWXA 3TG9A 1CEGA 1S1ZA 1YLPA 1K38A 1JTDA 3EQUA 4E3IA 2Y2PA 4RQ9A 1YLJA 5L07A 2G7UA 1CI9A 1P97A 1PYYA 2ZL1A 3KYEA 5F5YA 2NUTC 3T4LA 4LLOB 4A5RA 3SW1A 4ZDXA 4DN0A 3NHQA 4L9EA 3TOIA 3BFFA 5M1AA 5AQ7A 3A3JA 4WLAA 3UE1A 3IHAA 3Q07A 4IEDA 4R70A 3HCYA 4OLDA 1W63M 5FQJA 5A91A 3IF5A 2WAFA 1S67L 2G2UA 4H6JA 3DWKA 2VX8A 1MWUA 2JKGA 4F3LA 1CJFA 4QY5A 1JWZA 2J7VA 4B4ZA 4KZ6A 1ZC2A 3O86A 5HX9A 4HNBA 2Y2KA 1KE3A 2FFYA 5FDHA 3UDIA 3QHYA 3EGXC 3Q82A 4ETZA 3UE3A 3ZCZA 4N9KA 3IXGA 5HL6A 1YLYA 1L0FA 5FQQA 2H10A 3HUOA 2OV5A 2WKHA 1ACFA 2FFFB 2PBYA 5CGSA 3NECA 3PBNA 4HEFA 3Q81A 1K4EA 3ICYA 4S2NA 4EBPA 2XQZA 4EQIA 3UDXA 1CQAA 3CG5A 3FPWA 3VSLA 1Y4OA 1STZA 2HF6A 5I94A 3OBFA 3GRJA 2Y2QA 4DRTA 2Y2NA 2V8FA 5GHZA 2ZL1B 5KZHA 3ZG9B 1ES4A 2J80A 4PM6A 2DRWA 3C38A 5EOEA 4HJ4A 3G35A 4R0QA 1TEMA 1PZPA 2PU4A 3T4QA 1OJGA 2ZQAA 3ZG7B 2PYRA 5FASA 1OT6A 4CLCE 3UB8A 1BTLA 1Z6FA 1NRFA 2D01A 2OSUA 3FKWA 4OPZA 2HDQA 1OTDA 3LICA 2BLSA 5DF8A 2GNXA 2W0NA 4DE2A 3C8CA 4JXSA 5DJTA 4O01A 4B4XA 2VA0A 1L0EA 3OLOA 4ZAMA 3RJUA 5CECA 1D1JA 5HZHA 1L2SA 4AFIA 3CPTA 1W5DA 4Y7PA 5AVFA 4XT2A 3WS2A 1PZOA 4PM7A 3K3DA 3RXXA 1FQGA 5HDSA 3HUNA 2QHKA 4Y17A 4GB7A 4GHIB 2XA7S 3E4PA 2V9AA 4NXGA 5GLBA 1I2SA 5HSQA 1ESIA 1VHMA 4GKUA 3BWLA 4BWIA 1EWZA 1YKDA 2H5SA 1QMFA 4GW9A 3WS5A 3OPLA 4MN7A 3JVVA 4I3JA 3SH9A 3UDFA 3V50A 1ES3A 1LT0A 4E3NA 1XKZA 3IX4A 2W3HA 4Q0IA 3BQAA 3PBTA 4JXGA 1F2KA 3LR4A 4M3KA 1E25A 1YLZA 5GHXA 2PYPA 5G18A 4EBLA 1MKIA 5CHJA 1FCOA 1XX2A 5EVID 1F5MA 3AGFA 5F83A 4ZJ3A 2UV0E 1YAXA 2O99A 4IBXA 2RL3A 4X25A 2JKRI 3ZGAB 1FIKA 4NXBA 4P0MA 2WKIA 2V2FF 3KSHA 3V67A 3JYIA 2HDRA 3C2WA 4XT2B 1S4SA 2A24A 3H82B 1SZVA 2P08A 2WADA 5FQKA 3TSGA 3R7WB 4OOYA 1AWIA 2J3TD 1ERMA 1NZOA 1FILA 1MBLA 2Y2LA 2Y2OA 4NK3A 1L3LA 5AQBA 3BFCA 1K25A 4WZ5A 4WUJA 4K91A 1UWPX 1DP8A 3CLOA 3ZG5A 5CEDA 4KQOA 5FI6A 1Y28A 1DP6A 3V3RA 5U47A 2EXAA 3M6BA 3CJMA 1QMEA 3HLGA 2WUQA 4EV4A 1K55A 2VZWA 3U4LP 4FSFA 3VFFA 1BLCA 3DBAA 2E8JA 2Z2LB 2PAVP 1T19A 3SZTA 2PD7A 1MKMA 4S2OA 4UA6A 5EVIC 1Q2PA 1G5UA 2HV1A 1KDWA 2CC1A 1E3UD 1RCJA 2Z6CA 3UY6A 1IYSA 4O8GA 5IT5A 3TW8A 3GQZA 4U3TA 4JGRA 2XH9A 1TS8A 2JKFA 4BMWA 1PWCA
chains in the Genus database with same CATH topology
2EFXA 3C7VA 3V39A 1ESUA 3HLFA 1C3BA 3NIAA 1YT4A 1FSYA 4GOGA 3S22A 1ERQA 4KZ9A 5A92A 3PBQA 1NZUA 4OQ0A 1YLTA 2ZQDA 3P09A 5A93A 4FCFA 1NJ4A 1AXBA 3IF6C 4KZBA 5FAOA 5FQ9A 3SS5A 4WYYA 3NI9A 3QNCA 4GD6A 4X68A 5GLDA 3ZVWA 4XXRA 1FR1A 3BECA 1DJBA 3OCLA 2P9VA 3A3IA 1N9BA 1FOFA 4DXCA 2QZ6A 5M18A 3WS0A 5CHUA 3M2JA 3N8RA 1L0GA 4BL2A 1KVLA 2A3UA 4K0WA 1J9MA 4OLGA 5DTTA 4R4RA 4DE0A 1DJAA 2EFUA 4ZTKA 1JTGA 3MZEA 4UA7A 1K57A 5F1GA 4P87A 5CEBA 2ZQCA 3N7WA 4QHCA 2Y59A 3UNWA 2P9VB 2VGKA 4EBPA 4H8RA 3BRMA 1FSWA 2WGWA 3HLBA 1ZG6A 3UPOA 2Y2HA 4BD1A 3HLWA 1FCMA 2J9PA 3BM6A 5KSCA 3PTEA 3IH8A 3WS4A 1BLSA 1O07A 5FSRA 4GDBA 4QD4A 2XGNA 2JCHA 2IWCA 1LI0A 4EBNA 1K55C 3B3XA 4OQIA 1TDLA 1SCWA 4P85A 1KVMA 1KE0A 2WAEA 5CTNA 4S2JA 4ZJ1A 2Y91A 1SKFA 5HFOA 3FKVA 3CZDA 1L0DA 2JBFA 1SDNA 1EROA 2ZLYA 4XUXA 4YINA 2UWXA 3TG9A 3UO9A 4JLFA 1CEGA 2EXBA 3C4PA 2ZJ9A 3NY4A 4R4SA 3ZNYA 4RX2A 1YLPA 3ZG0A 1K38A 1K4FA 1JTDA 1FCNA 3EQUA 3BFGA 2Y2PA 4B88A 4E3IA 1YLJA 4X56A 2X02A 1CI9A 4IVKA 5EOOA 4OPQA 3BLSA 1N4OA 4MLLA 3OPPA 1PYYA 1RGZA 3MXRA 4WMCA 4QB8A 3MKFA 1TVFA 3E2KA 4A5RA 3O3VA 4E3KA 4JKTA 4ZDXA 1ES5A 4R3BA 5DF9A 4DE3A 3E2LA 4LV0A 4RA7A 3HL9A 1HVBA 1BSGA 1RP5A 3PBOA 1IYQA 2V20A 4FD8A 4OP8A 1KDSA 2Y2MA 5HARA 3TOIA 4S2PA 3BFFA 5M1AA 3IF6A 5AQ7A 1KGFA 4MBHA 3A3JA 4QY6A 3SS4A 2R9XA 3UE1A 2P74A 3DWZA 1XP4A 1WYBA 5FA7A 3IHAA 4F94A 4EWFA 4GDNA 5FI2A 5CTMA 2OLUA 3Q07A 4IEDA 3MKEA 4BQMA 1BLHA 4KZ7A 5EECA 4OLDA 3RXWA 4E3MA 5FQJA 3S1YA 2WGWB 4X6TA 1K54C 3OPRA 5AQ9A 5J8XA 5A91A 4UAAA 3IF5A 2WAFA 2G2UA 3M2KA 3BLMA 1BLPA 3GV9A 3WRTA 3DWKA 3MXSA 3PBRA 1MWUA 3Q7ZA 3A3DA 4KG5A 3HBRA 2IWBA 2XK1A 3OZHA 1HD8A 4YFMA 4QY5A 1JWZA 2J7VA 2PU2A 4B4ZA 5GL9A 3IQAA 4KZ6A 4OOLA 1ZC2A 5JYPA 3O86A 5HX9A 5TGFA 2I72A 4X55A 2Y2KA 1KE3A 2FFYA 5FDHA 3UDIA 1RGYA 3I7JA 3QHYA 5BOHA 4DF6A 3BFDA 5GHYA 1W7FA 3Q82A 4KG2A 4WZ4A 5E2FA 2OLVA 3UE3A 2EX9A 3ZCZA 1PWGA 1NXYA 4N9KA 3ITBA 3IXGA 4WEJA 5TFQA 2HP5A 1YLYA 5TR7A 2ZC3B 5FAPA 1L0FA 5FQQA 1SHVA 3PAEA 4XUZA 3ZVTA 2H10A 1ONHA 1MWSA 4S2LA 2IWDA 5EVIA 3HREA 3AGDA 3HUOA 4HBTA 2OV5A 1XA7A 3VP0A 2WKHA 4P6BA 1S0WA 2XR0A 3OPHA 3ZNTA 2H0YA 2FFFB 2PBYA 5CGSA 3PBNA 1K56A 4HEFA 1GCEA 1PI4A 3Q81A 1K4EA 4OOMA 2RCXA 2XQZA 3NCKA 4RVAA 4S2NA 4BL3A 3NBLA 3GMWA 3UDXA 3C4OA 4EQIA 4GZBA 4DXBA 3IT9A 1ZG4A 4R23A 3N4IA 3G2YA 3CG5A 4N1HA 1VM1A 1YMXA 1TDGA 4UA9A 5HAIA 3VSLA 2C5WB 5CRFA 2J8YA 3UPNA 1MXOA 3LCEA 4R1GA 4S2KA 4E6XA 1IELA 5DTKA 3DTMA 5I94A 3G30A 3C7UA 3N8LA 2ZC5B 3GRJA 2Y2QA 3Q7VA 4FH4A 4DRTA 2WGIA 1YQSA 2Y2NA 3SOIA 5GHZA 1IKIA 4Y0UA 4LENA 4OKPA 3LY4A 4KZ4A 3ZG9B 5KZHA 1ES4A 1GHPA 4ID4A 4KQRA 4L0LA 1W8QA 4PM6A 3FZCA 5E2HA 3HLDA 4GNUA 2DRWA 4NETA 5EOEA 3N8SA 3G35A 4R0QA 1TEMA 2XLNA 3ZDJA 5HL1A 1PZPA 2PU4A 3HLCA 2J9OA 1KGEA 1MY8A 4OPRA 2ZQAA 4BENA 4N1XA 2X01A 3UPPA 2XFSA 3ZG7B 4LV2A 1EI5A 4Q8IA 4R3JA 2XF3A 2XEPA 4GD8A 4DE1A 1CEFA 3G32A 2DNSA 3MZDA 5EUAA 5FASA 3AGEA 4JF6A 1BTLA 1Z6FA 5HAQA 1U60A 1NRFA 3SH7A 5CHMA 3ZG8B 2OSUA 3FKWA 1W79A 4BLMA 4OPZA 2HDQA 4PPRA 3GR2A 2ZD8A 4DDYA 1LHYA 2BLSA 1LLBA 4JF5A 5DF8A 3FWLA 4DE2A 1IYOA 4JXSA 4KZ5A 3ZHHA 2XFTA 3V5MA 4LCMA 4B4XA 2A49A 2ZQ9A 1L0EA 1LI9A 3IXHA 5FAQA 4EUZA 4N9LA 4ZAMA 1LL9A 1ES2A 4OQHA 3RJUA 3SH8A 4U0XA 2HDUA 5CECA 2G2WA 3Q7VB 3NDEA 2V1ZA 1L2SA 4BJPA 3VP3A 1NYYA 2WGVA 5CGXA 5EVLA 1VQQA 1GHMA 1W5DA 5CXWA 4JPMA 4Y7PA 1IKGA 4QU3A 2EX8A 3NDGA 4KZAA 5CERA 3WS2A 1PZOA 4PM7A 2HP6A 5EVIB 3VP2A 3EQVA 3RXXA 4FH2A 1FQGA 3C5AA 2XD5A 3LO7A 3HUNA 4IVIA 3UN7A 2X71A 4GB7A 4Y0OA 4OONA 3IWQA 3S4XA 1S6RA 2QPNA 4JXVA 4JBFA 4PM5A 3FYZA 1MPLA 5GLBA 2R9WA 3CMZA 1I2SA 1BULA 4GN2A 5DVAA 5KMWA 4OH0A 5HW3A 2WK0A 3G31A 1GHIA 1BT5A 1E4DA 2Y2IA 2HPBA 5A90A 1PIOA 5HAPA 1ESIA 1SDEA 2Y55A 1O7EA 4GKUA 2ZC7A 4MBKA 4RX3A 1EWZA 3PAGA 4C3QA 4CPKA 2H5SA 1K6RA 3W4OA 4E3LA 1QMFA 3WS5A 3OPLA 2ZM8A 4Z9QA 3VP4A 5F82A 4BD0A 4MEZA 2ZQ8A 3BYDA 4OPYA 5IHVA 3SH9A 3G4PA 3UDFA 3V50A 1ES3A 4LCLA 2WZZA 3DW0A 4WZ5C 1GA9A 1XPBA 3IH9A 1ZKJA 1K54A 4S2IA 4WEKA 1PW8A 5D3OA 1XKZA 3V3SA 4E3NA 3ITAA 2WKEA 3MZFA 4OQGA 2XDMA 4JF4A 2ZC6B 4S2NC 3W4PA 2JE5A 3O88A 2BG1A 1W8YA 3PBTA 4JXGA 4IBRA 3IWOA 1DY6A 1CI8A 3FV7A 3VMAA 2ZQ7A 4KZ8A 4M3KA 3VOYA 4E3OA 4D2OA 1WE4A 3WS1A 1CK3A 1E25A 2EX2A 2JC7A 2ZMAA 1YLZA 2Y2JA 4MBFA 4DDSA 3MFDA 3M6HA 5GHXA 2H0TA 5G18A 4EBLA 1MKIA 5CHJA 1FCOA 2B5RA 1OMEA 1LL5A 1XX2A 2ZM0A 5EVID 1XA1A 1YMSA 3N6IA 4LV3A 3GTCA 4OVDA 1XGIA 1PWDA 2Z2MB 1MWRA 2Y4AA 3AGFA 3HVFA 5F83A 5GLAA 1I5QA 4ZJ3A 1ONGA 1JWPA 1KGGA 1YM1A 4CJNA 3GVBA 5AQAA 5FATA 4IBXA 2Q9NA 2RL3A 5E2GA 4HESA 3ZGAB 1PI5A 4X69A 4N92A 3IXBA 2ZC4B 4P0MA 4WMCD 1K56D 1KE4A 3W4QA 2WKIA 2V2FF 1IEMA 4PM8A 1Q2QA 5M19A 3ISGA 2XD1A 1HTZA 3JYIA 3LY3A 2HDRA 4ZJ2A 3VP1A 4E6WA 2Y2GA 3IWIA 3A3FA 1DJCA 4O7DA 4C75A 3G2ZA 4RYEA 2VGJA 5CGWA 2WADA 5FQKA 1NYMA 3TSGA 1WYCA 5KSHA 1PW1A 4KZ3A 4OOYA 3VOZA 3LEZA 2WYXA 5EE8A 2GDNA 1ERMA 3BEBA 1M40A 4JXWA 1NZOA 4PM9A 4QJGA 4ZBEA 3SS3A 1MBLA 1K6SA 2QMIA 5FQIA 2Y2LA 4LV1A 2Y2OA 4WBGA 4NK3A 3HUMA 3GSGA 4X53A 2WZXA 5AQBA 1K57C 5FI7A 5L2FA 1IYPA 3BFCA 1JVJA 1K25A 4OP5A 4WZ5A 4WM9A 5JYOA 4K91A 3ZFZA 1MWTA 1XGJA 3UE0A 1I2WA 3ZG5A 5CEDA 3G34A 4KQOA 5FI6A 4DKIA 1H5XA 5E43A 4MNRA 3MBZA 3V3RA 3P98A 5U47A 2EXAA 1E3UA 3PBSA 3M6BA 4S2MA 3CJMA 1QMEA 1GA0A 1G68A 3HLGA 2Q9MA 1HZOA 2WUQA 3BFEA 4EV4A 1K55A 1M6KA 4FSFA 4HBUA 3VFFA 1BLCA 4K0XA 5EPHA 3WRZA 3O87A 1G6AA 2Z2LB 5DTSA 1BUEA 4PMAA 4E3JA 2HDSA 1H8ZA 4S2OA 4UA6A 5EVIC 1Q2PA 3NC8A 2EX6A 3VFHA 4Y0TA 3OC2A 1JWVA 2C6WB 1KDWA 1H8YA 2CC1A 3QNBA 1E3UD 1RCJA 4KG6A 3A3EA 3WWXA 3HLEA 4C6YA 5F1FA 4U0TA 4WELA 1ALQA 4KQQA 3VSKA 3UY6A 1IYSA 1XXMA 1BZAA 2E8IA 2HP9A 5FQMA 3IXDA 5DF7A 5E2EA 4UHUA 3IHBA 3OCNA 4KENB 2DCFA 3GQZA 4U3TA 3D4FA 3IF6B 2XH9A 1NY0A 1Y54A 1PWCA 3W8KA 1YLWA 1FR6A 5GLCA 2ZM2A 3Q1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFX A;  3C7V A;  3V39 A;  1ESU A;  3HLF A;  1C3B A;  3NIA A;  1YT4 A;  1FSY A;  4GOG A;  3S22 A;  1ERQ A;  4KZ9 A;  5A92 A;  3PBQ A;  1NZU A;  4OQ0 A;  1YLT A;  2ZQD A;  3P09 A;  5A93 A;  4FCF A;  1NJ4 A;  1AXB A;  3IF6 C;  4KZB A;  5FAO A;  5FQ9 A;  3SS5 A;  4WYY A;  3NI9 A;  3QNC A;  4GD6 A;  4X68 A;  5GLD A;  3ZVW A;  4XXR A;  1FR1 A;  3BEC A;  1DJB A;  3OCL A;  2P9V A;  3A3I A;  1N9B A;  1FOF A;  4DXC A;  2QZ6 A;  5M18 A;  3WS0 A;  5CHU A;  3M2J A;  3N8R A;  1L0G A;  4BL2 A;  1KVL A;  2A3U A;  4K0W A;  1J9M A;  4OLG A;  5DTT A;  4R4R A;  4DE0 A;  1DJA A;  2EFU A;  4ZTK A;  1JTG A;  3MZE A;  4UA7 A;  1K57 A;  5F1G A;  4P87 A;  5CEB A;  2ZQC A;  3N7W A;  4QHC A;  2Y59 A;  3UNW A;  2P9V B;  2VGK A;  4EBP A;  4H8R A;  3BRM A;  1FSW A;  2WGW A;  3HLB A;  1ZG6 A;  3UPO A;  2Y2H A;  4BD1 A;  3HLW A;  1FCM A;  2J9P A;  3BM6 A;  5KSC A;  3PTE A;  3IH8 A;  3WS4 A;  1BLS A;  1O07 A;  5FSR A;  4GDB A;  4QD4 A;  2XGN A;  2JCH A;  2IWC A;  1LI0 A;  4EBN A;  1K55 C;  3B3X A;  4OQI A;  1TDL A;  1SCW A;  4P85 A;  1KVM A;  1KE0 A;  2WAE A;  5CTN A;  4S2J A;  4ZJ1 A;  2Y91 A;  1SKF A;  5HFO A;  3FKV A;  3CZD A;  1L0D A;  2JBF A;  1SDN A;  1ERO A;  2ZLY A;  4XUX A;  4YIN A;  2UWX A;  3TG9 A;  3UO9 A;  4JLF A;  1CEG A;  2EXB A;  3C4P A;  2ZJ9 A;  3NY4 A;  4R4S A;  3ZNY A;  4RX2 A;  1YLP A;  3ZG0 A;  1K38 A;  1K4F A;  1JTD A;  1FCN A;  3EQU A;  3BFG A;  2Y2P A;  4B88 A;  4E3I A;  1YLJ A;  4X56 A;  2X02 A;  1CI9 A;  4IVK A;  5EOO A;  4OPQ A;  3BLS A;  1N4O A;  4MLL A;  3OPP A;  1PYY A;  1RGZ A;  3MXR A;  4WMC A;  4QB8 A;  3MKF A;  1TVF A;  3E2K A;  4A5R A;  3O3V A;  4E3K A;  4JKT A;  4ZDX A;  1ES5 A;  4R3B A;  5DF9 A;  4DE3 A;  3E2L A;  4LV0 A;  4RA7 A;  3HL9 A;  1HVB A;  1BSG A;  1RP5 A;  3PBO A;  1IYQ A;  2V20 A;  4FD8 A;  4OP8 A;  1KDS A;  2Y2M A;  5HAR A;  3TOI A;  4S2P A;  3BFF A;  5M1A A;  3IF6 A;  5AQ7 A;  1KGF A;  4MBH A;  3A3J A;  4QY6 A;  3SS4 A;  2R9X A;  3UE1 A;  2P74 A;  3DWZ A;  1XP4 A;  1WYB A;  5FA7 A;  3IHA A;  4F94 A;  4EWF A;  4GDN A;  5FI2 A;  5CTM A;  2OLU A;  3Q07 A;  4IED A;  3MKE A;  4BQM A;  1BLH A;  4KZ7 A;  5EEC A;  4OLD A;  3RXW A;  4E3M A;  5FQJ A;  3S1Y A;  2WGW B;  4X6T A;  1K54 C;  3OPR A;  5AQ9 A;  5J8X A;  5A91 A;  4UAA A;  3IF5 A;  2WAF A;  2G2U A;  3M2K A;  3BLM A;  1BLP A;  3GV9 A;  3WRT A;  3DWK A;  3MXS A;  3PBR A;  1MWU A;  3Q7Z A;  3A3D A;  4KG5 A;  3HBR A;  2IWB A;  2XK1 A;  3OZH A;  1HD8 A;  4YFM A;  4QY5 A;  1JWZ A;  2J7V A;  2PU2 A;  4B4Z A;  5GL9 A;  3IQA A;  4KZ6 A;  4OOL A;  1ZC2 A;  5JYP A;  3O86 A;  5HX9 A;  5TGF A;  2I72 A;  4X55 A;  2Y2K A;  1KE3 A;  2FFY A;  5FDH A;  3UDI A;  1RGY A;  3I7J A;  3QHY A;  5BOH A;  4DF6 A;  3BFD A;  5GHY A;  1W7F A;  3Q82 A;  4KG2 A;  4WZ4 A;  5E2F A;  2OLV A;  3UE3 A;  2EX9 A;  3ZCZ A;  1PWG A;  1NXY A;  4N9K A;  3ITB A;  3IXG A;  4WEJ A;  5TFQ A;  2HP5 A;  1YLY A;  5TR7 A;  2ZC3 B;  5FAP A;  1L0F A;  5FQQ A;  1SHV A;  3PAE A;  4XUZ A;  3ZVT A;  2H10 A;  1ONH A;  1MWS A;  4S2L A;  2IWD A;  5EVI A;  3HRE A;  3AGD A;  3HUO A;  4HBT A;  2OV5 A;  1XA7 A;  3VP0 A;  2WKH A;  4P6B A;  1S0W A;  2XR0 A;  3OPH A;  3ZNT A;  2H0Y A;  2FFF B;  2PBY A;  5CGS A;  3PBN A;  1K56 A;  4HEF A;  1GCE A;  1PI4 A;  3Q81 A;  1K4E A;  4OOM A;  2RCX A;  2XQZ A;  3NCK A;  4RVA A;  4S2N A;  4BL3 A;  3NBL A;  3GMW A;  3UDX A;  3C4O A;  4EQI A;  4GZB A;  4DXB A;  3IT9 A;  1ZG4 A;  4R23 A;  3N4I A;  3G2Y A;  3CG5 A;  4N1H A;  1VM1 A;  1YMX A;  1TDG A;  4UA9 A;  5HAI A;  3VSL A;  2C5W B;  5CRF A;  2J8Y A;  3UPN A;  1MXO A;  3LCE A;  4R1G A;  4S2K A;  4E6X A;  1IEL A;  5DTK A;  3DTM A;  5I94 A;  3G30 A;  3C7U A;  3N8L A;  2ZC5 B;  3GRJ A;  2Y2Q A;  3Q7V A;  4FH4 A;  4DRT A;  2WGI A;  1YQS A;  2Y2N A;  3SOI A;  5GHZ A;  1IKI A;  4Y0U A;  4LEN A;  4OKP A;  3LY4 A;  4KZ4 A;  3ZG9 B;  5KZH A;  1ES4 A;  1GHP A;  4ID4 A;  4KQR A;  4L0L A;  1W8Q A;  4PM6 A;  3FZC A;  5E2H A;  3HLD A;  4GNU A;  2DRW A;  4NET A;  5EOE A;  3N8S A;  3G35 A;  4R0Q A;  1TEM A;  2XLN A;  3ZDJ A;  5HL1 A;  1PZP A;  2PU4 A;  3HLC A;  2J9O A;  1KGE A;  1MY8 A;  4OPR A;  2ZQA A;  4BEN A;  4N1X A;  2X01 A;  3UPP A;  2XFS A;  3ZG7 B;  4LV2 A;  1EI5 A;  4Q8I A;  4R3J A;  2XF3 A;  2XEP A;  4GD8 A;  4DE1 A;  1CEF A;  3G32 A;  2DNS A;  3MZD A;  5EUA A;  5FAS A;  3AGE A;  4JF6 A;  1BTL A;  1Z6F A;  5HAQ A;  1U60 A;  1NRF A;  3SH7 A;  5CHM A;  3ZG8 B;  2OSU A;  3FKW A;  1W79 A;  4BLM A;  4OPZ A;  2HDQ A;  4PPR A;  3GR2 A;  2ZD8 A;  4DDY A;  1LHY A;  2BLS A;  1LLB A;  4JF5 A;  5DF8 A;  3FWL A;  4DE2 A;  1IYO A;  4JXS A;  4KZ5 A;  3ZHH A;  2XFT A;  3V5M A;  4LCM A;  4B4X A;  2A49 A;  2ZQ9 A;  1L0E A;  1LI9 A;  3IXH A;  5FAQ A;  4EUZ A;  4N9L A;  4ZAM A;  1LL9 A;  1ES2 A;  4OQH A;  3RJU A;  3SH8 A;  4U0X A;  2HDU A;  5CEC A;  2G2W A;  3Q7V B;  3NDE A;  2V1Z A;  1L2S A;  4BJP A;  3VP3 A;  1NYY A;  2WGV A;  5CGX A;  5EVL A;  1VQQ A;  1GHM A;  1W5D A;  5CXW A;  4JPM A;  4Y7P A;  1IKG A;  4QU3 A;  2EX8 A;  3NDG A;  4KZA A;  5CER A;  3WS2 A;  1PZO A;  4PM7 A;  2HP6 A;  5EVI B;  3VP2 A;  3EQV A;  3RXX A;  4FH2 A;  1FQG A;  3C5A A;  2XD5 A;  3LO7 A;  3HUN A;  4IVI A;  3UN7 A;  2X71 A;  4GB7 A;  4Y0O A;  4OON A;  3IWQ A;  3S4X A;  1S6R A;  2QPN A;  4JXV A;  4JBF A;  4PM5 A;  3FYZ A;  1MPL A;  5GLB A;  2R9W A;  3CMZ A;  1I2S A;  1BUL A;  4GN2 A;  5DVA A;  5KMW A;  4OH0 A;  5HW3 A;  2WK0 A;  3G31 A;  1GHI A;  1BT5 A;  1E4D A;  2Y2I A;  2HPB A;  5A90 A;  1PIO A;  5HAP A;  1ESI A;  1SDE A;  2Y55 A;  1O7E A;  4GKU A;  2ZC7 A;  4MBK A;  4RX3 A;  1EWZ A;  3PAG A;  4C3Q A;  4CPK A;  2H5S A;  1K6R A;  3W4O A;  4E3L A;  1QMF A;  3WS5 A;  3OPL A;  2ZM8 A;  4Z9Q A;  3VP4 A;  5F82 A;  4BD0 A;  4MEZ A;  2ZQ8 A;  3BYD A;  4OPY A;  5IHV A;  3SH9 A;  3G4P A;  3UDF A;  3V50 A;  1ES3 A;  4LCL A;  2WZZ A;  3DW0 A;  4WZ5 C;  1GA9 A;  1XPB A;  3IH9 A;  1ZKJ A;  1K54 A;  4S2I A;  4WEK A;  1PW8 A;  5D3O A;  1XKZ A;  3V3S A;  4E3N A;  3ITA A;  2WKE A;  3MZF A;  4OQG A;  2XDM A;  4JF4 A;  2ZC6 B;  4S2N C;  3W4P A;  2JE5 A;  3O88 A;  2BG1 A;  1W8Y A;  3PBT A;  4JXG A;  4IBR A;  3IWO A;  1DY6 A;  1CI8 A;  3FV7 A;  3VMA A;  2ZQ7 A;  4KZ8 A;  4M3K A;  3VOY A;  4E3O A;  4D2O A;  1WE4 A;  3WS1 A;  1CK3 A;  1E25 A;  2EX2 A;  2JC7 A;  2ZMA A;  1YLZ A;  2Y2J A;  4MBF A;  4DDS A;  3MFD A;  3M6H A;  5GHX A;  2H0T A;  5G18 A;  4EBL A;  1MKI A;  5CHJ A;  1FCO A;  2B5R A;  1OME A;  1LL5 A;  1XX2 A;  2ZM0 A;  5EVI D;  1XA1 A;  1YMS A;  3N6I A;  4LV3 A;  3GTC A;  4OVD A;  1XGI A;  1PWD A;  2Z2M B;  1MWR A;  2Y4A A;  3AGF A;  3HVF A;  5F83 A;  5GLA A;  1I5Q A;  4ZJ3 A;  1ONG A;  1JWP A;  1KGG A;  1YM1 A;  4CJN A;  3GVB A;  5AQA A;  5FAT A;  4IBX A;  2Q9N A;  2RL3 A;  5E2G A;  4HES A;  3ZGA B;  1PI5 A;  4X69 A;  4N92 A;  3IXB A;  2ZC4 B;  4P0M A;  4WMC D;  1K56 D;  1KE4 A;  3W4Q A;  2WKI A;  2V2F F;  1IEM A;  4PM8 A;  1Q2Q A;  5M19 A;  3ISG A;  2XD1 A;  1HTZ A;  3JYI A;  3LY3 A;  2HDR A;  4ZJ2 A;  3VP1 A;  4E6W A;  2Y2G A;  3IWI A;  3A3F A;  1DJC A;  4O7D A;  4C75 A;  3G2Z A;  4RYE A;  2VGJ A;  5CGW A;  2WAD A;  5FQK A;  1NYM A;  3TSG A;  1WYC A;  5KSH A;  1PW1 A;  4KZ3 A;  4OOY A;  3VOZ A;  3LEZ A;  2WYX A;  5EE8 A;  2GDN A;  1ERM A;  3BEB A;  1M40 A;  4JXW A;  1NZO A;  4PM9 A;  4QJG A;  4ZBE A;  3SS3 A;  1MBL A;  1K6S A;  2QMI A;  5FQI A;  2Y2L A;  4LV1 A;  2Y2O A;  4WBG A;  4NK3 A;  3HUM A;  3GSG A;  4X53 A;  2WZX A;  5AQB A;  1K57 C;  5FI7 A;  5L2F A;  1IYP A;  3BFC A;  1JVJ A;  1K25 A;  4OP5 A;  4WZ5 A;  4WM9 A;  5JYO A;  4K91 A;  3ZFZ A;  1MWT A;  1XGJ A;  3UE0 A;  1I2W A;  3ZG5 A;  5CED A;  3G34 A;  4KQO A;  5FI6 A;  4DKI A;  1H5X A;  5E43 A;  4MNR A;  3MBZ A;  3V3R A;  3P98 A;  5U47 A;  2EXA A;  1E3U A;  3PBS A;  3M6B A;  4S2M A;  3CJM A;  1QME A;  1GA0 A;  1G68 A;  3HLG A;  2Q9M A;  1HZO A;  2WUQ A;  3BFE A;  4EV4 A;  1K55 A;  1M6K A;  4FSF A;  4HBU A;  3VFF A;  1BLC A;  4K0X A;  5EPH A;  3WRZ A;  3O87 A;  1G6A A;  2Z2L B;  5DTS A;  1BUE A;  4PMA A;  4E3J A;  2HDS A;  1H8Z A;  4S2O A;  4UA6 A;  5EVI C;  1Q2P A;  3NC8 A;  2EX6 A;  3VFH A;  4Y0T A;  3OC2 A;  1JWV A;  2C6W B;  1KDW A;  1H8Y A;  2CC1 A;  3QNB A;  1E3U D;  1RCJ A;  4KG6 A;  3A3E A;  3WWX A;  3HLE A;  4C6Y A;  5F1F A;  4U0T A;  4WEL A;  1ALQ A;  4KQQ A;  3VSK A;  3UY6 A;  1IYS A;  1XXM A;  1BZA A;  2E8I A;  2HP9 A;  5FQM A;  3IXD A;  5DF7 A;  5E2E A;  4UHU A;  3IHB A;  3OCN A;  4KEN B;  2DCF A;  3GQZ A;  4U3T A;  3D4F A;  3IF6 B;  2XH9 A;  1NY0 A;  1Y54 A;  1PWC A;  3W8K A;  1YLW A;  1FR6 A;  5GLC A;  2ZM2 A;  3Q1F A; 
#chains in the Genus database with same CATH topology
 4YOF A;  4ARZ B;  1YT4 A;  1FSY A;  2L0W A;  4G3V A;  2ZQD A;  1NJ4 A;  1IFQ A;  5FAO A;  3NI9 A;  3QNC A;  3ZVW A;  4XXR A;  3BEC A;  1S66 L;  1P9W A;  4DXC A;  1FOF A;  5HWT A;  1L0G A;  1KVL A;  1YSQ A;  5DTT A;  4ZTK A;  3MZE A;  2VGL M;  3E4Q A;  1K57 A;  5F1G A;  4P87 A;  5CEB A;  1OTB A;  2Y59 A;  3UNW A;  4CLC A;  4EXO A;  4Y5F A;  2WGW A;  1ZG6 A;  4BD1 A;  2W3D A;  1BLS A;  1O07 A;  2HZ5 A;  1T1B A;  2V0U A;  4QD4 A;  4B9O A;  4KUO A;  4P85 A;  4S2J A;  2Y91 A;  2W3E A;  5AVE A;  2VEA A;  1NRJ A;  1N9L A;  4YIN A;  3UO9 A;  3PYP A;  3C4P A;  3NY4 A;  4RX2 A;  3ZG0 A;  1K4F A;  1FCN A;  5L8M A;  3QP6 A;  5EOO A;  2OAQ 1;  3BLS A;  3PXP A;  3EEH A;  3IBR A;  3QP5 A;  3NOT C;  3O3V A;  3KSI A;  2PR6 A;  3DTI A;  4D60 A;  1HVB A;  1BSG A;  5EVE A;  3PBO A;  1IYQ A;  2WKR A;  4FD8 A;  3L7H A;  4OP8 A;  2AVX A;  2W1T B;  4S2P A;  2P74 A;  4EWF A;  5FI2 A;  5CTM A;  5HD5 A;  1YPR A;  4GS9 A;  2Z6D A;  3MKE A;  1BLH A;  4EU0 A;  4KZ7 A;  4EUV A;  4CLC D;  1K54 C;  3FG8 A;  3BY8 A;  4UAA A;  2B95 A;  1BLP A;  3Q7Z A;  4KG5 A;  3CUE C;  3HBR A;  2LB9 A;  2XK1 A;  3OZH A;  1HD8 A;  1T1A A;  5JYP A;  1OTI A;  4X55 A;  1P9R A;  2H28 A;  2JN7 A;  5GHY A;  5KIZ A;  4LGW A;  1PWG A;  2GZA A;  5TFQ A;  3ZVT A;  4Q0H A;  1MWS A;  4S2L A;  2IWD A;  4LPZ A;  5EVI A;  3NJA A;  3AGD A;  4HBT A;  1LSX A;  1S0W A;  2H0Y A;  4BBT A;  1GCE A;  4OOM A;  3NCK A;  4I3I A;  1T18 A;  1V9Z A;  2ZOH A;  3C4O A;  4DXB A;  3IT9 A;  3KSF A;  3R4K A;  2HJE A;  5FDS A;  2WKQ A;  2FZ0 A;  2C5W B;  5A8B A;  2J8Y A;  4S2K A;  1IEL A;  3C7U A;  2ZC5 B;  2R78 A;  2JKR M;  4EES A;  4Y0U A;  3LY4 A;  3B33 A;  4KZ4 A;  4ID4 A;  1GHP A;  1W8Q A;  3HLD A;  4FUW A;  5HWW A;  2D02 A;  3N8S A;  3ZDJ A;  2XLN A;  3NOU C;  3S7Q A;  1KGE A;  1MY8 A;  5F6A A;  3UB9 A;  5DKL A;  4N1X A;  2X01 A;  4BEN A;  2KLI A;  4DE1 A;  2DNS A;  3SH7 A;  1W79 A;  3FC7 A;  5HDC A;  3E4O A;  4PPR A;  2I9V A;  2YKH A;  4LFU A;  1LHY A;  2JHE A;  4JF5 A;  4NXF A;  1KOU A;  3FWL A;  3T1X A;  2O9C A;  2O9A A;  4KZ5 A;  4WL9 A;  3ZHH A;  4EEU A;  4LCM A;  2A49 A;  3G6O A;  3PR6 A;  1LL9 A;  3S7O A;  2B18 A;  4BJP A;  4JGO A;  5EVL A;  3DTE A;  5CXW A;  2EX8 A;  3NDG A;  4EQ1 A;  5EVI B;  1XFQ A;  3F1O B;  1ZHH B;  3IWQ A;  2QPN A;  3UMD A;  3FYZ A;  5EFW A;  2R9W A;  1TF1 A;  1BUL A;  1LSV A;  4OH0 A;  3G31 A;  1BT5 A;  2HPB A;  5A90 A;  1PIO A;  1O7E A;  4MBK A;  2PDR A;  4CPK A;  3W4O A;  3S7P A;  5K5B A;  2FH5 A;  2ZM8 A;  5F82 A;  3G4P A;  4WZ5 C;  1OTA A;  3IH9 A;  4S2I A;  1PW8 A;  3V3S A;  3ITA A;  2WKE A;  2XDM A;  2V0W A;  4R38 A;  4S2N C;  5CX7 A;  2JE5 A;  2BG1 A;  1W8Y A;  3IWO A;  1CI8 A;  3A0V A;  2ZQ7 A;  1TS6 A;  3VOY A;  4D2O A;  2ZMA A;  4HJ3 A;  2Y2J A;  3MFD A;  4H6J B;  3M6H A;  1F9I A;  4JGQ A;  3B42 A;  2M7V A;  1OME A;  1PNE A;  1LL5 A;  2ZM0 A;  3GTC A;  2VV8 A;  1JWP A;  3GVB A;  4ETX A;  2BTF P;  5AQA A;  5FAT A;  2Q9N A;  3UB5 P;  4X69 A;  3IXB A;  1S1Y A;  2ZC4 B;  3KO6 A;  4PM8 A;  1Q2Q A;  1TD5 A;  3LY3 A;  4E6W A;  4O0P A;  3A3F A;  4O7D A;  4C75 A;  3G2Z A;  2O9B A;  2VGJ A;  2W3G A;  2V1B A;  1NYM A;  2L1M A;  1PW1 A;  5TBM A;  3LEZ A;  5EE8 A;  2GDN A;  4ZBE A;  2QMI A;  4R3A A;  1XJ6 A;  5FI7 A;  1K57 C;  3EWK A;  4R6L A;  1IYP A;  3L9K A;  1BYW A;  1XGJ A;  1I2W A;  5E43 A;  3NOP C;  2DMW A;  4NXE A;  5J7E A;  1GA0 A;  2Q9M A;  1HZO A;  2YKF A;  4HBU A;  1GSV A;  4K0X A;  3WRZ A;  3O87 A;  1G6A A;  2WKP A;  5DTS A;  2HDS A;  1H8Z A;  3ULF A;  3OC2 A;  2C6W B;  3MQ0 A;  4KG6 A;  3A3E A;  3HLE A;  4WEL A;  4KQQ A;  3VSK A;  5FL3 A;  3A0R A;  3IXD A;  5DF7 A;  4UHU A;  3IHB A;  4KEN B;  4UEY A;  3D4F A;  3VV4 A;  1NY0 A;  3CUE A;  1Y54 A;  1YLW A;  1D06 A;  3Q1F A;  3V39 A;  5FEG A;  4LRY C;  1NWZ A;  4Y13 A;  5A92 A;  4OQ0 A;  1NZU A;  1YLT A;  3QP4 A;  3LFV A;  3SS5 A;  4GD6 A;  5GLD A;  1DJB A;  4WN5 A;  2P9V A;  1N9B A;  4HP9 A;  1ODV A;  1VET A;  3N8R A;  2OWJ A;  4K0W A;  4OLG A;  4DE0 A;  2EFU A;  4KQD A;  2Y79 A;  4H8R A;  3BRM A;  3HLB A;  1FCM A;  3BM6 A;  3IH8 A;  2XRN A;  5FSR A;  2IWC A;  1LI0 A;  4EBN A;  5F68 A;  5CTN A;  3FKV A;  1L0D A;  2JBF A;  3RH8 B;  3LI8 A;  2ZLY A;  2EA9 A;  4JLF A;  3E98 A;  5HPI A;  3LIE A;  2ZMV A;  4OPQ A;  3T50 A;  3OPP A;  4WMC A;  4QB8 A;  4ME4 A;  4JKT A;  1ES5 A;  4R3B A;  4DE3 A;  3E2L A;  3HL9 A;  2V20 A;  1XJ3 A;  1KDS A;  2Y2M A;  3MJQ A;  1KGF A;  4MBH A;  4QY6 A;  3SS4 A;  2R9X A;  1XP4 A;  1WYB A;  2OLU A;  4FOF A;  4BQM A;  1SKO A;  2M1C A;  3RXW A;  5TJJ A;  5J8X A;  3GV9 A;  2J3T C;  3WRT A;  3MXS A;  3PBR A;  4ZRR A;  3A3D A;  2IWB A;  4X1M A;  5GL9 A;  4OOL A;  2ZMF A;  3QP8 A;  1TS0 A;  5TGF A;  3BW6 A;  5BOH A;  1RGY A;  3I7J A;  2CMN A;  4DF6 A;  1DRM A;  1W7F A;  4KG2 A;  1NLY A;  4WZ4 A;  5E2F A;  2EX9 A;  2VGL S;  1SHV A;  3PAE A;  2Q0O A;  3QP1 A;  2M7U A;  1XA7 A;  3VP0 A;  2PD8 A;  4P6B A;  3UE6 A;  2XR0 A;  2VJW A;  3VE4 A;  1K56 A;  2W1R A;  1PI4 A;  2RCX A;  4RVA A;  3GMW A;  2JKT I;  4I5S A;  4GZB A;  3IBJ A;  1ZG4 A;  3ZQ5 A;  4R23 A;  4N1H A;  1VM1 A;  1YMX A;  4IUH A;  3OOV A;  5CRF A;  1MXO A;  3LCE A;  4I39 A;  5DTK A;  3DTM A;  3N8L A;  2IA2 A;  4UQI M;  4ESP A;  3Q7V A;  1YQS A;  3SOI A;  3HJK A;  1IKI A;  4OKP A;  5LBR A;  4L0L A;  3FZC A;  4HH2 A;  4GNU A;  4M4X A;  3IS2 B;  5HL1 A;  3LEQ A;  1MC0 A;  3LIF A;  4OPR A;  4LV2 A;  4Q8I A;  4R3J A;  2NUP C;  2XF3 A;  5EUA A;  3G32 A;  3MZD A;  3AGE A;  1SKO B;  4JF6 A;  5CHM A;  5DFX A;  4BLM A;  4EEP A;  3GR2 A;  4DDY A;  1LLB A;  1D7E A;  1G28 A;  1OPX A;  3HJI A;  3V5M A;  1P0Z A;  2ZQ9 A;  1XFN A;  1G6O A;  4N9L A;  1ES2 A;  3SH8 A;  4U0X A;  5L10 A;  2HDU A;  2G2W A;  3Q7V B;  1NYY A;  2WGV A;  5CGX A;  1GHM A;  4GLQ A;  1IKG A;  3MR0 A;  4KZA A;  4MMN A;  2HP6 A;  3EQV A;  3C5A A;  4IVI A;  2XD5 A;  3LO7 A;  3U2A A;  3UN7 A;  2X71 A;  4Y0O A;  4OON A;  3K3C A;  3S4X A;  1S6R A;  4JXV A;  4JBF A;  3UME A;  1PRQ A;  3CMZ A;  4GN2 A;  4MN6 A;  5DVA A;  5HWV A;  3P01 A;  1PFL A;  5HAP A;  3F1O A;  1SDE A;  3KSG A;  2Y55 A;  2ZC7 A;  4RX3 A;  4C3Q A;  4F3L B;  2ZBB A;  3TE8 A;  3D72 A;  3VP4 A;  4BD0 A;  4MEZ A;  2ZQ8 A;  3BYD A;  2V8C A;  4OPY A;  4BBV A;  2VLG A;  2WZZ A;  3MSH A;  1K54 A;  4WEK A;  3MZF A;  4OQG A;  4JF4 A;  2ZC6 B;  2J3W A;  3W4P A;  3O88 A;  4PKY A;  5HD3 A;  4KZ8 A;  1WE4 A;  1YSP A;  2JC7 A;  2EX2 A;  4CLC B;  4DDS A;  1W63 Q;  2H0T A;  2VK3 A;  4HI4 A;  4HHD A;  2B5R A;  3RFB A;  1XA1 A;  4LV3 A;  4GJ4 A;  5L09 A;  1EW0 A;  1PWD A;  5GLA A;  2Y4A A;  1I5Q A;  3VE3 A;  1KGG A;  1A0K A;  4CLC C;  3H7W B;  1VEU A;  3MF0 A;  2QJ5 A;  3IX3 A;  5E2G A;  4HES A;  3W2Z A;  4HH3 A;  1PI5 A;  2QJ7 A;  4N92 A;  3MS6 A;  4WMC D;  3W4Q A;  1IEM A;  5M19 A;  4CQH A;  2XD1 A;  3VP1 A;  4ZJ2 A;  4DJ2 A;  3IWI A;  1DJC A;  5CGW A;  2KDK A;  3C30 A;  2WYX A;  1WA9 A;  3BEB A;  1M40 A;  4JXW A;  1K6S A;  3LR5 A;  4K08 A;  3F1P A;  4HQA A;  4WBG A;  2WZX A;  4G3K A;  1JVJ A;  3LID A;  4OP5 A;  3T4T A;  3ZFZ A;  1MWT A;  4DKI A;  1H5X A;  3LUQ A;  4Z1W A;  2JKT M;  4EET B;  3PBS A;  2HJ9 C;  2KX6 A;  4PAU A;  1NLZ A;  3O5Y A;  1BUE A;  4E3J A;  3CPT B;  4KUK A;  1H3Q A;  2EX6 A;  3VFH A;  1JWV A;  3KYQ A;  1H8Y A;  5F1F A;  2XA7 M;  2QKP A;  4U0T A;  1ALQ A;  1LL8 A;  2OAP 1;  1XXM A;  4P6Z M;  1BZA A;  2E8I A;  2DCF A;  3MFX A;  3IF6 B;  1UWN X;  4HIA A;  3F1P B;  3W8K A;  1FR6 A;  2ZM2 A;  1ESU A;  3HLF A;  1C3B A;  3S22 A;  3PBQ A;  4HOI A;  4FCF A;  4KZB A;  5FQ9 A;  4WYY A;  4MDZ A;  1FR1 A;  4G3W A;  3VOL A;  3A3I A;  5M18 A;  1OTE A;  4Q0J A;  1V9Y A;  2O0Y A;  3M2J A;  2PRF A;  4BL2 A;  2A2L A;  2A3U A;  4R4R A;  3MQO A;  4UA7 A;  4GS9 B;  2OWH A;  4HJ6 A;  1J3W A;  2P9V B;  3UPO A;  2Y2H A;  3PTE A;  3WS4 A;  2B02 A;  4HY8 A;  4GDB A;  5G4Y A;  3B3X A;  1TDL A;  1SCW A;  1KVM A;  3IS2 A;  5HFO A;  3BJN A;  2PBD P;  4XUX A;  2EXB A;  2ZJ9 A;  5FEF A;  2K31 A;  4R4S A;  3ZNY A;  3JVU A;  3BFG A;  4B88 A;  5DKK A;  4X56 A;  3CAX A;  4QPR A;  2X02 A;  4IVK A;  3BY9 A;  1N4O A;  4MLL A;  2VV6 A;  3P7N A;  1RGZ A;  2K7S A;  3MXR A;  1TS7 A;  4QWO A;  3MKF A;  1TVF A;  3E2K A;  3D3O A;  4E3K A;  5DF9 A;  3LI9 A;  4LV0 A;  4RA7 A;  2VV7 A;  5HAR A;  3K2N A;  2P7J A;  3IF6 A;  2PT7 A;  3H9W A;  3DWZ A;  5G4Z A;  3E0Y A;  2Y8H A;  5FA7 A;  4F94 A;  4GDN A;  3CWF A;  5EEC A;  4E3M A;  3KX0 X;  3S1Y A;  2WGW B;  4X6T A;  5AQ9 A;  3OPR A;  3M2K A;  3BLM A;  4MN5 A;  3T1R A;  2QYB A;  4II7 A;  4NEE D;  4YFM A;  2PU2 A;  3S7N A;  5I5L A;  3IQA A;  5TBM B;  1JNU A;  5IU1 A;  2I72 A;  4DJ3 A;  1H0M A;  4NKP A;  3BFD A;  2OLV A;  1NXY A;  3ITB A;  1GSW A;  2HP5 A;  5TR7 A;  2ZC3 B;  5FAP A;  4GHI A;  3JPU A;  4XUZ A;  1ONH A;  4I3A A;  3HRE A;  1N9O A;  3NUL A;  3OPH A;  4JGP A;  4P6Z S;  4BBU A;  5J3W A;  3ZNT A;  3EEA A;  4BL3 A;  3NBL A;  3FPV A;  3N4I A;  3G2Y A;  1TDG A;  4UA9 A;  5HAI A;  3UB6 A;  3UPN A;  4R1G A;  4E6X A;  1XJ4 A;  2MJ6 A;  1OT9 A;  1ZTU A;  3G30 A;  3MMH A;  4FH4 A;  2WGI A;  3RTY A;  3CIT A;  4LEN A;  2V1A A;  4KQR A;  1X0O A;  5E2H A;  2W27 A;  4NET A;  4IHQ A;  3T4O A;  4MCW A;  3HLC A;  2J9O A;  4GCZ A;  2BAS A;  3T4J A;  3UPP A;  2XFS A;  2OOL A;  1EI5 A;  4LRX C;  3T4S A;  4GD8 A;  1F98 A;  2XEP A;  1CEF A;  2P04 A;  1T1C A;  5HAQ A;  1U60 A;  3ZG8 B;  3F1N A;  1VET B;  2ZD8 A;  4NG2 A;  4YWZ A;  4UQI S;  5J4E A;  1IYO A;  1K0K A;  2XFT A;  1LI9 A;  3IXH A;  5FAQ A;  1UGU A;  4EUZ A;  4I38 A;  4OQH A;  2K2N A;  3A0S A;  3NDE A;  2V1Z A;  3VP3 A;  1VQQ A;  3R7W A;  4JPM A;  1Z09 A;  4QU3 A;  5CER A;  4PKY G;  5EV0 A;  3VP2 A;  3DAV A;  4FH2 A;  2QWS A;  2PHY A;  1VB6 A;  4Y2F A;  4FTX A;  4PM5 A;  1MPL A;  5AJG A;  5KMW A;  3LGO A;  5HW3 A;  1N9N A;  2WK0 A;  3BQ8 A;  1GHI A;  1E4D A;  2Y2I A;  3F1N B;  2XSS A;  3MQQ A;  3T12 B;  3PAG A;  1K6R A;  4E3L A;  1OJ5 A;  4Z9Q A;  2GJ3 A;  5IHV A;  5HDD A;  4LCL A;  3DW0 A;  1GA9 A;  1XPB A;  1ZKJ A;  4PHT A;  4X1L A;  5D3O A;  4YNR A;  3ZYT A;  4L9G A;  4IBR A;  1DY6 A;  3FV7 A;  3VMA A;  3TJZ C;  4E3O A;  3WS1 A;  2EWV A;  1CK3 A;  4MBF A;  4ARZ A;  3GDI A;  5DFY A;  1YMS A;  3N6I A;  1CF0 A;  4OVD A;  1XJ2 A;  2PR5 A;  1XGI A;  2Z2M B;  1MWR A;  3HVF A;  2GX5 A;  1ONG A;  1YM1 A;  4CJN A;  3T1S A;  2A24 B;  3H82 A;  5EM0 A;  1DP9 A;  3UB7 A;  1GSX A;  1K56 D;  1KE4 A;  5C5K A;  4EER A;  2HGV A;  2LB5 A;  2INW A;  3ISG A;  1HTZ A;  3EOI A;  3PHY A;  2Y2G A;  1VEU B;  4RYE A;  2XRO A;  1WYC A;  5KSH A;  4Y15 A;  3IX8 A;  4KZ3 A;  3VOZ A;  4PM9 A;  4EW7 A;  4QJG A;  3SS3 A;  1HLU P;  3CHW P;  3CI6 A;  5FQI A;  5EM1 A;  4LV1 A;  5F69 A;  4IJG A;  3HUM A;  3GSG A;  4X53 A;  5L2F A;  4LRZ E;  3KYZ A;  2L4R A;  4WM9 A;  5JYO A;  3UE0 A;  1IOU A;  3G34 A;  4MNR A;  2ZOI A;  3MBZ A;  3P98 A;  3LYX A;  3TRC A;  1E3U A;  4S2M A;  3MXQ A;  3LR3 A;  1G68 A;  3BFE A;  1M6K A;  3B47 A;  2EWW A;  5EPH A;  5HPF A;  3EGD C;  4PMA A;  3D9Y A;  3NC8 A;  4Y0T A;  2ACG A;  3GEC A;  3QNB A;  3WWX A;  4C6Y A;  2W1T A;  1H8M A;  2HP9 A;  2W3F A;  5FQM A;  5E2E A;  3OCN A;  3DTK A;  4IUK A;  5MC7 A;  4WEJ A;  5GLC A;  1RP5 A;  4WF0 A;  2EFX A;  3LR0 A;  3C7V A;  3NIA A;  4GOG A;  1S4R A;  1ERQ A;  4KZ9 A;  3P09 A;  5A93 A;  2KOI A;  1LSW A;  1AXB A;  3IF6 C;  4X68 A;  3H7W A;  4HP4 A;  4Y3I A;  3OCL A;  2QZ6 A;  1MZU A;  4E04 A;  3WS0 A;  5CHU A;  5DJU A;  3T4K A;  1J9M A;  4DMZ A;  1DJA A;  1JTG A;  2VKS A;  4L9F A;  2ZQC A;  3N7W A;  4QHC A;  3QP2 A;  2VGK A;  1FSW A;  3LIB A;  3HLW A;  2J9P A;  5KSC A;  2XGN A;  2JCH A;  4B93 A;  1K55 C;  4OQI A;  3LIA A;  1KE0 A;  2WAE A;  4ZJ1 A;  1SKF A;  3T1Q B;  3CZD A;  1SDN A;  1ERO A;  5IS1 A;  2UWX A;  3TG9 A;  1CEG A;  1S1Z A;  1YLP A;  1K38 A;  1JTD A;  3EQU A;  4E3I A;  2Y2P A;  4RQ9 A;  1YLJ A;  5L07 A;  2G7U A;  1CI9 A;  1P97 A;  1PYY A;  2ZL1 A;  3KYE A;  5F5Y A;  2NUT C;  3T4L A;  4LLO B;  4A5R A;  3SW1 A;  4ZDX A;  4DN0 A;  3NHQ A;  4L9E A;  3TOI A;  3BFF A;  5M1A A;  5AQ7 A;  3A3J A;  4WLA A;  3UE1 A;  3IHA A;  3Q07 A;  4IED A;  4R70 A;  3HCY A;  4OLD A;  1W63 M;  5FQJ A;  5A91 A;  3IF5 A;  2WAF A;  1S67 L;  2G2U A;  4H6J A;  3DWK A;  2VX8 A;  1MWU A;  2JKG A;  4F3L A;  1CJF A;  4QY5 A;  1JWZ A;  2J7V A;  4B4Z A;  4KZ6 A;  1ZC2 A;  3O86 A;  5HX9 A;  4HNB A;  2Y2K A;  1KE3 A;  2FFY A;  5FDH A;  3UDI A;  3QHY A;  3EGX C;  3Q82 A;  4ETZ A;  3UE3 A;  3ZCZ A;  4N9K A;  3IXG A;  5HL6 A;  1YLY A;  1L0F A;  5FQQ A;  2H10 A;  3HUO A;  2OV5 A;  2WKH A;  1ACF A;  2FFF B;  2PBY A;  5CGS A;  3NEC A;  3PBN A;  4HEF A;  3Q81 A;  1K4E A;  3ICY A;  4S2N A;  4EBP A;  2XQZ A;  4EQI A;  3UDX A;  1CQA A;  3CG5 A;  3FPW A;  3VSL A;  1Y4O A;  1STZ A;  2HF6 A;  5I94 A;  3OBF A;  3GRJ A;  2Y2Q A;  4DRT A;  2Y2N A;  2V8F A;  5GHZ A;  2ZL1 B;  5KZH A;  3ZG9 B;  1ES4 A;  2J80 A;  4PM6 A;  2DRW A;  3C38 A;  5EOE A;  4HJ4 A;  3G35 A;  4R0Q A;  1TEM A;  1PZP A;  2PU4 A;  3T4Q A;  1OJG A;  2ZQA A;  3ZG7 B;  2PYR A;  5FAS A;  1OT6 A;  4CLC E;  3UB8 A;  1BTL A;  1Z6F A;  1NRF A;  2D01 A;  2OSU A;  3FKW A;  4OPZ A;  2HDQ A;  1OTD A;  3LIC A;  2BLS A;  5DF8 A;  2GNX A;  2W0N A;  4DE2 A;  3C8C A;  4JXS A;  5DJT A;  4O01 A;  4B4X A;  2VA0 A;  1L0E A;  3OLO A;  4ZAM A;  3RJU A;  5CEC A;  1D1J A;  5HZH A;  1L2S A;  4AFI A;  3CPT A;  1W5D A;  4Y7P A;  5AVF A;  4XT2 A;  3WS2 A;  1PZO A;  4PM7 A;  3K3D A;  3RXX A;  1FQG A;  5HDS A;  3HUN A;  2QHK A;  4Y17 A;  4GB7 A;  4GHI B;  2XA7 S;  3E4P A;  2V9A A;  4NXG A;  5GLB A;  1I2S A;  5HSQ A;  1ESI A;  1VHM A;  4GKU A;  3BWL A;  4BWI A;  1EWZ A;  1YKD A;  2H5S A;  1QMF A;  4GW9 A;  3WS5 A;  3OPL A;  4MN7 A;  3JVV A;  4I3J A;  3SH9 A;  3UDF A;  3V50 A;  1ES3 A;  1LT0 A;  4E3N A;  1XKZ A;  3IX4 A;  2W3H A;  4Q0I A;  3BQA A;  3PBT A;  4JXG A;  1F2K A;  3LR4 A;  4M3K A;  1E25 A;  1YLZ A;  5GHX A;  2PYP A;  5G18 A;  4EBL A;  1MKI A;  5CHJ A;  1FCO A;  1XX2 A;  5EVI D;  1F5M A;  3AGF A;  5F83 A;  4ZJ3 A;  2UV0 E;  1YAX A;  2O99 A;  4IBX A;  2RL3 A;  4X25 A;  2JKR I;  3ZGA B;  1FIK A;  4NXB A;  4P0M A;  2WKI A;  2V2F F;  3KSH A;  3V67 A;  3JYI A;  2HDR A;  3C2W A;  4XT2 B;  1S4S A;  2A24 A;  3H82 B;  1SZV A;  2P08 A;  2WAD A;  5FQK A;  3TSG A;  3R7W B;  4OOY A;  1AWI A;  2J3T D;  1ERM A;  1NZO A;  1FIL A;  1MBL A;  2Y2L A;  2Y2O A;  4NK3 A;  1L3L A;  5AQB A;  3BFC A;  1K25 A;  4WZ5 A;  4WUJ A;  4K91 A;  1UWP X;  1DP8 A;  3CLO A;  3ZG5 A;  5CED A;  4KQO A;  5FI6 A;  1Y28 A;  1DP6 A;  3V3R A;  5U47 A;  2EXA A;  3M6B A;  3CJM A;  1QME A;  3HLG A;  2WUQ A;  4EV4 A;  1K55 A;  2VZW A;  3U4L P;  4FSF A;  3VFF A;  1BLC A;  3DBA A;  2E8J A;  2Z2L B;  2PAV P;  1T19 A;  3SZT A;  2PD7 A;  1MKM A;  4S2O A;  4UA6 A;  5EVI C;  1Q2P A;  1G5U A;  2HV1 A;  1KDW A;  2CC1 A;  1E3U D;  1RCJ A;  2Z6C A;  3UY6 A;  1IYS A;  4O8G A;  5IT5 A;  3TW8 A;  3GQZ A;  4U3T A;  4JGR A;  2XH9 A;  1TS8 A;  2JKF A;  4BMW A;  1PWC A; 
#chains in the Genus database with same CATH homology
 2EFX A;  3C7V A;  3V39 A;  1ESU A;  3HLF A;  1C3B A;  3NIA A;  1YT4 A;  1FSY A;  4GOG A;  3S22 A;  1ERQ A;  4KZ9 A;  5A92 A;  3PBQ A;  1NZU A;  4OQ0 A;  1YLT A;  2ZQD A;  3P09 A;  5A93 A;  4FCF A;  1NJ4 A;  1AXB A;  3IF6 C;  4KZB A;  5FAO A;  5FQ9 A;  3SS5 A;  4WYY A;  3NI9 A;  3QNC A;  4GD6 A;  4X68 A;  5GLD A;  3ZVW A;  4XXR A;  1FR1 A;  3BEC A;  1DJB A;  3OCL A;  2P9V A;  3A3I A;  1N9B A;  1FOF A;  4DXC A;  2QZ6 A;  5M18 A;  3WS0 A;  5CHU A;  3M2J A;  3N8R A;  1L0G A;  4BL2 A;  1KVL A;  2A3U A;  4K0W A;  1J9M A;  4OLG A;  5DTT A;  4R4R A;  4DE0 A;  1DJA A;  2EFU A;  4ZTK A;  1JTG A;  3MZE A;  4UA7 A;  1K57 A;  5F1G A;  4P87 A;  5CEB A;  2ZQC A;  3N7W A;  4QHC A;  2Y59 A;  3UNW A;  2P9V B;  2VGK A;  4EBP A;  4H8R A;  3BRM A;  1FSW A;  2WGW A;  3HLB A;  1ZG6 A;  3UPO A;  2Y2H A;  4BD1 A;  3HLW A;  1FCM A;  2J9P A;  3BM6 A;  5KSC A;  3PTE A;  3IH8 A;  3WS4 A;  1BLS A;  1O07 A;  5FSR A;  4GDB A;  4QD4 A;  2XGN A;  2JCH A;  2IWC A;  1LI0 A;  4EBN A;  1K55 C;  3B3X A;  4OQI A;  1TDL A;  1SCW A;  4P85 A;  1KVM A;  1KE0 A;  2WAE A;  5CTN A;  4S2J A;  4ZJ1 A;  2Y91 A;  1SKF A;  5HFO A;  3FKV A;  3CZD A;  1L0D A;  2JBF A;  1SDN A;  1ERO A;  2ZLY A;  4XUX A;  4YIN A;  2UWX A;  3TG9 A;  3UO9 A;  4JLF A;  1CEG A;  2EXB A;  3C4P A;  2ZJ9 A;  3NY4 A;  4R4S A;  3ZNY A;  4RX2 A;  1YLP A;  3ZG0 A;  1K38 A;  1K4F A;  1JTD A;  1FCN A;  3EQU A;  3BFG A;  2Y2P A;  4B88 A;  4E3I A;  1YLJ A;  4X56 A;  2X02 A;  1CI9 A;  4IVK A;  5EOO A;  4OPQ A;  3BLS A;  1N4O A;  4MLL A;  3OPP A;  1PYY A;  1RGZ A;  3MXR A;  4WMC A;  4QB8 A;  3MKF A;  1TVF A;  3E2K A;  4A5R A;  3O3V A;  4E3K A;  4JKT A;  4ZDX A;  1ES5 A;  4R3B A;  5DF9 A;  4DE3 A;  3E2L A;  4LV0 A;  4RA7 A;  3HL9 A;  1HVB A;  1BSG A;  1RP5 A;  3PBO A;  1IYQ A;  2V20 A;  4FD8 A;  4OP8 A;  1KDS A;  2Y2M A;  5HAR A;  3TOI A;  4S2P A;  3BFF A;  5M1A A;  3IF6 A;  5AQ7 A;  1KGF A;  4MBH A;  3A3J A;  4QY6 A;  3SS4 A;  2R9X A;  3UE1 A;  2P74 A;  3DWZ A;  1XP4 A;  1WYB A;  5FA7 A;  3IHA A;  4F94 A;  4EWF A;  4GDN A;  5FI2 A;  5CTM A;  2OLU A;  3Q07 A;  4IED A;  3MKE A;  4BQM A;  1BLH A;  4KZ7 A;  5EEC A;  4OLD A;  3RXW A;  4E3M A;  5FQJ A;  3S1Y A;  2WGW B;  4X6T A;  1K54 C;  3OPR A;  5AQ9 A;  5J8X A;  5A91 A;  4UAA A;  3IF5 A;  2WAF A;  2G2U A;  3M2K A;  3BLM A;  1BLP A;  3GV9 A;  3WRT A;  3DWK A;  3MXS A;  3PBR A;  1MWU A;  3Q7Z A;  3A3D A;  4KG5 A;  3HBR A;  2IWB A;  2XK1 A;  3OZH A;  1HD8 A;  4YFM A;  4QY5 A;  1JWZ A;  2J7V A;  2PU2 A;  4B4Z A;  5GL9 A;  3IQA A;  4KZ6 A;  4OOL A;  1ZC2 A;  5JYP A;  3O86 A;  5HX9 A;  5TGF A;  2I72 A;  4X55 A;  2Y2K A;  1KE3 A;  2FFY A;  5FDH A;  3UDI A;  1RGY A;  3I7J A;  3QHY A;  5BOH A;  4DF6 A;  3BFD A;  5GHY A;  1W7F A;  3Q82 A;  4KG2 A;  4WZ4 A;  5E2F A;  2OLV A;  3UE3 A;  2EX9 A;  3ZCZ A;  1PWG A;  1NXY A;  4N9K A;  3ITB A;  3IXG A;  4WEJ A;  5TFQ A;  2HP5 A;  1YLY A;  5TR7 A;  2ZC3 B;  5FAP A;  1L0F A;  5FQQ A;  1SHV A;  3PAE A;  4XUZ A;  3ZVT A;  2H10 A;  1ONH A;  1MWS A;  4S2L A;  2IWD A;  5EVI A;  3HRE A;  3AGD A;  3HUO A;  4HBT A;  2OV5 A;  1XA7 A;  3VP0 A;  2WKH A;  4P6B A;  1S0W A;  2XR0 A;  3OPH A;  3ZNT A;  2H0Y A;  2FFF B;  2PBY A;  5CGS A;  3PBN A;  1K56 A;  4HEF A;  1GCE A;  1PI4 A;  3Q81 A;  1K4E A;  4OOM A;  2RCX A;  2XQZ A;  3NCK A;  4RVA A;  4S2N A;  4BL3 A;  3NBL A;  3GMW A;  3UDX A;  3C4O A;  4EQI A;  4GZB A;  4DXB A;  3IT9 A;  1ZG4 A;  4R23 A;  3N4I A;  3G2Y A;  3CG5 A;  4N1H A;  1VM1 A;  1YMX A;  1TDG A;  4UA9 A;  5HAI A;  3VSL A;  2C5W B;  5CRF A;  2J8Y A;  3UPN A;  1MXO A;  3LCE A;  4R1G A;  4S2K A;  4E6X A;  1IEL A;  5DTK A;  3DTM A;  5I94 A;  3G30 A;  3C7U A;  3N8L A;  2ZC5 B;  3GRJ A;  2Y2Q A;  3Q7V A;  4FH4 A;  4DRT A;  2WGI A;  1YQS A;  2Y2N A;  3SOI A;  5GHZ A;  1IKI A;  4Y0U A;  4LEN A;  4OKP A;  3LY4 A;  4KZ4 A;  3ZG9 B;  5KZH A;  1ES4 A;  1GHP A;  4ID4 A;  4KQR A;  4L0L A;  1W8Q A;  4PM6 A;  3FZC A;  5E2H A;  3HLD A;  4GNU A;  2DRW A;  4NET A;  5EOE A;  3N8S A;  3G35 A;  4R0Q A;  1TEM A;  2XLN A;  3ZDJ A;  5HL1 A;  1PZP A;  2PU4 A;  3HLC A;  2J9O A;  1KGE A;  1MY8 A;  4OPR A;  2ZQA A;  4BEN A;  4N1X A;  2X01 A;  3UPP A;  2XFS A;  3ZG7 B;  4LV2 A;  1EI5 A;  4Q8I A;  4R3J A;  2XF3 A;  2XEP A;  4GD8 A;  4DE1 A;  1CEF A;  3G32 A;  2DNS A;  3MZD A;  5EUA A;  5FAS A;  3AGE A;  4JF6 A;  1BTL A;  1Z6F A;  5HAQ A;  1U60 A;  1NRF A;  3SH7 A;  5CHM A;  3ZG8 B;  2OSU A;  3FKW A;  1W79 A;  4BLM A;  4OPZ A;  2HDQ A;  4PPR A;  3GR2 A;  2ZD8 A;  4DDY A;  1LHY A;  2BLS A;  1LLB A;  4JF5 A;  5DF8 A;  3FWL A;  4DE2 A;  1IYO A;  4JXS A;  4KZ5 A;  3ZHH A;  2XFT A;  3V5M A;  4LCM A;  4B4X A;  2A49 A;  2ZQ9 A;  1L0E A;  1LI9 A;  3IXH A;  5FAQ A;  4EUZ A;  4N9L A;  4ZAM A;  1LL9 A;  1ES2 A;  4OQH A;  3RJU A;  3SH8 A;  4U0X A;  2HDU A;  5CEC A;  2G2W A;  3Q7V B;  3NDE A;  2V1Z A;  1L2S A;  4BJP A;  3VP3 A;  1NYY A;  2WGV A;  5CGX A;  5EVL A;  1VQQ A;  1GHM A;  1W5D A;  5CXW A;  4JPM A;  4Y7P A;  1IKG A;  4QU3 A;  2EX8 A;  3NDG A;  4KZA A;  5CER A;  3WS2 A;  1PZO A;  4PM7 A;  2HP6 A;  5EVI B;  3VP2 A;  3EQV A;  3RXX A;  4FH2 A;  1FQG A;  3C5A A;  2XD5 A;  3LO7 A;  3HUN A;  4IVI A;  3UN7 A;  2X71 A;  4GB7 A;  4Y0O A;  4OON A;  3IWQ A;  3S4X A;  1S6R A;  2QPN A;  4JXV A;  4JBF A;  4PM5 A;  3FYZ A;  1MPL A;  5GLB A;  2R9W A;  3CMZ A;  1I2S A;  1BUL A;  4GN2 A;  5DVA A;  5KMW A;  4OH0 A;  5HW3 A;  2WK0 A;  3G31 A;  1GHI A;  1BT5 A;  1E4D A;  2Y2I A;  2HPB A;  5A90 A;  1PIO A;  5HAP A;  1ESI A;  1SDE A;  2Y55 A;  1O7E A;  4GKU A;  2ZC7 A;  4MBK A;  4RX3 A;  1EWZ A;  3PAG A;  4C3Q A;  4CPK A;  2H5S A;  1K6R A;  3W4O A;  4E3L A;  1QMF A;  3WS5 A;  3OPL A;  2ZM8 A;  4Z9Q A;  3VP4 A;  5F82 A;  4BD0 A;  4MEZ A;  2ZQ8 A;  3BYD A;  4OPY A;  5IHV A;  3SH9 A;  3G4P A;  3UDF A;  3V50 A;  1ES3 A;  4LCL A;  2WZZ A;  3DW0 A;  4WZ5 C;  1GA9 A;  1XPB A;  3IH9 A;  1ZKJ A;  1K54 A;  4S2I A;  4WEK A;  1PW8 A;  5D3O A;  1XKZ A;  3V3S A;  4E3N A;  3ITA A;  2WKE A;  3MZF A;  4OQG A;  2XDM A;  4JF4 A;  2ZC6 B;  4S2N C;  3W4P A;  2JE5 A;  3O88 A;  2BG1 A;  1W8Y A;  3PBT A;  4JXG A;  4IBR A;  3IWO A;  1DY6 A;  1CI8 A;  3FV7 A;  3VMA A;  2ZQ7 A;  4KZ8 A;  4M3K A;  3VOY A;  4E3O A;  4D2O A;  1WE4 A;  3WS1 A;  1CK3 A;  1E25 A;  2EX2 A;  2JC7 A;  2ZMA A;  1YLZ A;  2Y2J A;  4MBF A;  4DDS A;  3MFD A;  3M6H A;  5GHX A;  2H0T A;  5G18 A;  4EBL A;  1MKI A;  5CHJ A;  1FCO A;  2B5R A;  1OME A;  1LL5 A;  1XX2 A;  2ZM0 A;  5EVI D;  1XA1 A;  1YMS A;  3N6I A;  4LV3 A;  3GTC A;  4OVD A;  1XGI A;  1PWD A;  2Z2M B;  1MWR A;  2Y4A A;  3AGF A;  3HVF A;  5F83 A;  5GLA A;  1I5Q A;  4ZJ3 A;  1ONG A;  1JWP A;  1KGG A;  1YM1 A;  4CJN A;  3GVB A;  5AQA A;  5FAT A;  4IBX A;  2Q9N A;  2RL3 A;  5E2G A;  4HES A;  3ZGA B;  1PI5 A;  4X69 A;  4N92 A;  3IXB A;  2ZC4 B;  4P0M A;  4WMC D;  1K56 D;  1KE4 A;  3W4Q A;  2WKI A;  2V2F F;  1IEM A;  4PM8 A;  1Q2Q A;  5M19 A;  3ISG A;  2XD1 A;  1HTZ A;  3JYI A;  3LY3 A;  2HDR A;  4ZJ2 A;  3VP1 A;  4E6W A;  2Y2G A;  3IWI A;  3A3F A;  1DJC A;  4O7D A;  4C75 A;  3G2Z A;  4RYE A;  2VGJ A;  5CGW A;  2WAD A;  5FQK A;  1NYM A;  3TSG A;  1WYC A;  5KSH A;  1PW1 A;  4KZ3 A;  4OOY A;  3VOZ A;  3LEZ A;  2WYX A;  5EE8 A;  2GDN A;  1ERM A;  3BEB A;  1M40 A;  4JXW A;  1NZO A;  4PM9 A;  4QJG A;  4ZBE A;  3SS3 A;  1MBL A;  1K6S A;  2QMI A;  5FQI A;  2Y2L A;  4LV1 A;  2Y2O A;  4WBG A;  4NK3 A;  3HUM A;  3GSG A;  4X53 A;  2WZX A;  5AQB A;  1K57 C;  5FI7 A;  5L2F A;  1IYP A;  3BFC A;  1JVJ A;  1K25 A;  4OP5 A;  4WZ5 A;  4WM9 A;  5JYO A;  4K91 A;  3ZFZ A;  1MWT A;  1XGJ A;  3UE0 A;  1I2W A;  3ZG5 A;  5CED A;  3G34 A;  4KQO A;  5FI6 A;  4DKI A;  1H5X A;  5E43 A;  4MNR A;  3MBZ A;  3V3R A;  3P98 A;  5U47 A;  2EXA A;  1E3U A;  3PBS A;  3M6B A;  4S2M A;  3CJM A;  1QME A;  1GA0 A;  1G68 A;  3HLG A;  2Q9M A;  1HZO A;  2WUQ A;  3BFE A;  4EV4 A;  1K55 A;  1M6K A;  4FSF A;  4HBU A;  3VFF A;  1BLC A;  4K0X A;  5EPH A;  3WRZ A;  3O87 A;  1G6A A;  2Z2L B;  5DTS A;  1BUE A;  4PMA A;  4E3J A;  2HDS A;  1H8Z A;  4S2O A;  4UA6 A;  5EVI C;  1Q2P A;  3NC8 A;  2EX6 A;  3VFH A;  4Y0T A;  3OC2 A;  1JWV A;  2C6W B;  1KDW A;  1H8Y A;  2CC1 A;  3QNB A;  1E3U D;  1RCJ A;  4KG6 A;  3A3E A;  3WWX A;  3HLE A;  4C6Y A;  5F1F A;  4U0T A;  4WEL A;  1ALQ A;  4KQQ A;  3VSK A;  3UY6 A;  1IYS A;  1XXM A;  1BZA A;  2E8I A;  2HP9 A;  5FQM A;  3IXD A;  5DF7 A;  5E2E A;  4UHU A;  3IHB A;  3OCN A;  4KEN B;  2DCF A;  3GQZ A;  4U3T A;  3D4F A;  3IF6 B;  2XH9 A;  1NY0 A;  1Y54 A;  1PWC A;  3W8K A;  1YLW A;  1FR6 A;  5GLC A;  2ZM2 A;  3Q1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...