1IYZA

Crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
302
structure length
299
Chain Sequence
MKAWVLKRLGGPLELVDLPEPEAEEGEVVLRVEAVGLNFADHLMRLGAYLTRLHPPFIPGMEVVGVVEGRRYAALVPQGGLAERVAVPKGALLPLPEGLSPEEAAAFPVSFLTAYLALKRAQARPGEKVLVQAAAGALGTAAVQVARAMGLRVLAAASRPEKLALPLALGAEEAATYAEVPERAKAWGGLDLVLEVRGKEVEESLGLLAHGGRLVYIGAAEAPIPPLRLMRRNLAVLGFWLTPLLREGALVEEALGFLLPRLGRELRPVVGPVFPFAEAEAAFRALLDRGHTGKVVVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Quinone Oxidoreductase from Thermus thermophilus HB8 and Its Complex with NADPH: Implication for NADPH and Substrate Recognition
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords QUINONE OXIDOREDUCTASE
total genus 88
structure length 299
sequence length 302
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1iyzA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1iyzA01
4NIMA 4DMLA 5KCZA 4J49A 4JN6B 1I3KA 1JWAB 1WMBA 3AUSA 3I4CA 5T5QA 4BO8A 3I6IA 3EHEA 4CQMB 4GQAA 1YB5A 2QRJA 1HYGA 2JL1A 4ALNA 1UDAA 3K2BA 2QW8A 3GH3A 4FCCA 3FTNA 1EFKA 3O8QA 1I3NA 5L7WA 1H94A 5CDSA 5CDGA 3ANLA 1CF2O 2D59A 5G4KB 4BO5A 5ICMA 1O9BA 3ROKA 3WB9A 3IAHA 1LSOA 1X0XA 4IJVA 1GYRA 1NFQA 3KSDO 3AWDA 2EW8A 4PG4A 1OBFO 2O4CA 3EMKA 4TMFA 4R3NA 1DIBA 4WLVA 5B37A 3BMCA 2VRCA 1PEDA 4J0EA 5MDHA 3WFIA 1NQ5A 3L4SO 1BXGA 4EGFA 2BFOA 4BQPA 4B3IA 3DFUA 1KEPA 3OECA 1DRWA 3DMTA 4AJHA 1PWZA 1ENOA 3OJEA 2O50A 2AA3A 2RAFA 4MIEA 1ADFA 5I8ZA 2ZJ1A 3NV9A 3IUPA 4ILKA 1LSSA 2CD9A 2HK7A 3Q9NA 4CMKA 4BMSA 3E9QA 3HDYA 1P33A 3GN1A 3QVSA 3RC7A 2Y1FA 4J0FA 1JKIA 1NPDA 4CLRB 1PQUA 1JVSA 3PYMA 1P1KA 3PFFA 2ZATA 2X58A 3IMFA 5KJFA 2DM6A 1ZSYA 1YBAA 3RIHA 1P45A 4GH5A 3ZWYA 2VYVA 3ASUA 4C7JA 1PR3A 4CV2A 3RD5A 1UP7A 2QYSA 1T1RA 3VPGA 3AOEA 3N58A 3AFNA 3CZRA 3A1NA 4FJ0A 5JYEA 1DJQA 1I0ZA 2NU9A 4B4WA 2P5UA 4IGEA 4YJGB 3DONA 2EW2A 3FRJA 2NWQA 2B0JA 3JQGA 2X86A 1U4OA 1TVEA 2VZ9A 4K6CA 3H4VA 5A3JA 4BKPA 4YDRA 1MGOA 3QVOA 1VJ1A 1Q7GA 4ALKA 1QYVA 3UCEA 3WS7A 1YQGA 3PEFA 4GWKA 1T2FA 3PIDA 1MLDA 1W8DA 4TKMA 1GQ2A 3AUAA 4K28A 1L1FA 1HLPA 7MDHA 3FNGA 2X6TA 5KNLA 1B8UA 3GVXA 1PQPA 4E13A 2HLPA 1JDJA 1LDBA 3MWEB 4E5YA 1ZEJA 3IJRA 3TZHA 3UF0A 4NR0A 2PLAA 3F5SA 3VVCA 3JQGB 4A26A 1ML3A 4S3MA 4UUPA 4AJIA 3EAGA 4KQWA 1O94A 2V7PA 3PWSA 4OOEA 4RLSA 1A27A 4M8SA 1DIRA 4XYGA 3JQ8B 2ZB4A 5K1SA 3ANNA 3MJVA 3NDRA 1KEVA 3G49A 1NTOA 4KWIA 4TZKA 4YVFA 2B4QA 4F3YA 3X2EA 4CM8B 4GLLA 3JYOA 1VPDA 3D64A 5IF3A 2BRUA 3F5QA 4KTTE 4NFHA 5JO0A 2DTDA 4YAEA 4BKRA 4EYEA 4NJMB 2WD8A 2C2YA 1PJSA 2CF6A 1C14A 2RIRA 4WASA 4XKJA 3OA2A 3KEQA 4Q3DA 3RUEA 3AM3A 1LSUA 3FR8A 3ZNQA 3GEDA 1NNUA 1Q7BA 3NJ4A 2VHVA 3PYXA 4YA6A 2EV9A 1Z7BA 3CIFA 4AJOA 3U4DA 1H9AA 4YRDA 1VSVA 3DBVO 3WIEA 4CLDA 2DFDA 1EDOA 1LLCA 1SEPA 3P7MA 3UAGA 1EQUA 1XHLA 2C5EA 3VVBA 3QVXA 1PGPA 4BL5A 1ENYA 4BNMA 2YHIA 4CM5A 1NVTA 5DN9A 5KVCA 4O6VA 3UOGA 1YH3A 2AEJA 1M6HA 2HMTA 1QKIA 3JQBC 3Q1LA 2VT2A 4E5NA 4PN3A 1EVZA 1W73A 3GLQA 3T4EA 1I30A 3D4PA 3OHSX 3LLSA 4YTEA 1E7RA 4I5GA 4JX8A 4XYBA 2ZYDA 2C0CA 2VWPA 4PFJA 2VHYA 3CZMA 3LU1A 4Q39A 4I8XA 4LW8A 1VM6A 3HN7A 4MJLA 3ZWOA 4ND2A 1P1HA 4A27A 2F00A 3ZWNA 4IIVA 2B83A 1LDGA 5DCWA 3ZU2A 1TT7A 4R1UA 2VWGA 4OMUA 3TOZA 1V9LA 2V65A 4G5HA 1O95A 1NWCA 4K6FA 1TB4A 2HCTA 1V8BA 3NEPX 5HRUA 1I10A 1A7AA 1XG5A 4H16A 1QXSA 3ZW8A 3BMQB 3ZH2A 4DLBA 2VWQA 4N5NA 1WDMA 1ZH8A 3ON5A 4WECA 1J4AA 3PK0A 3PZRA 4UVGA 4M54A 1T1SA 4OXKA 5IJZA 3EVNA 3C7CB 1PJ3A 3UGKA 1LQTA 1Z82A 4CM7A 2UUPA 3UFXA 4YEDA 3BHIA 3GFBA 3RFVA 1C0IA 1BVRA 1P74A 3V2GA 4FDAA 3WYBA 3RJ9A 2A35A 2FY8A 1VRWA 3F4LA 2ZTMA 1HSOA 1DAPA 1YBVA 1YVEI 3I1JA 4ZN6A 5KVVA 3K6JA 1HDYA 5B12A 3NAQA 5FYDA 4A73A 1JAYA 2JCVA 5AXBA 1GCOA 1GU7A 4J90A 1FDWA 2DPHA 3OFSA 3MZ0A 1P31A 2O2SA 2Q1SA 3ZV4A 5EN4A 4L0QA 1XR3A 2DBQA 2H63A 1UXIA 3I4FA 3K5PA 1AN9A 1V3UA 4FIZA 5T8KC 1CETA 1SAYA 5IXYA 4YACA 3FF4A 3PQEA 4BNVA 3GRKA 4R69A 3W1VA 4GX2A 2VN8A 2WEKA 5L3ZA 3M2TA 4IZIA 1OOEA 5T57A 4J2HA 4CLOB 1X1EA 1D1TA 1SO8A 3PI7A 1DC6A 3OIGA 4TRMA 2IZ0A 4DYVA 3DDNA 2HUNA 2P9EA 2Z1NA 4J1NA 4Y6SA 4J1SA 4Y6RA 2NVBA 1WW8A 5CEJA 4OHUA 5JLAA 2ZYGA 4QFDA 2NM0A 1UXJA 3OJOA 3LF2A 3U5TA 3VDRA 3BAZA 4BO2A 5COBA 5HM8A 4GX0A 2GUGA 1YGYA 1W4ZA 1Y9AA 3UCFA 1P3DA 3WQRA 3WR5A 3IP1A 3D1LA 4ND5A 4UUOA 2Y93A 3EGOA 3LSYA 3FPCA 3QE3A 3WJ7A 4HXYA 4MVJE 4B4UA 1P9LA 1EVYA 2YDYA 3AOEC 5A5FA 1PZEA 3EZYA 2CVZA 4NQZA 1M67A 5LDHA 3PTZA 2PFGA 2VHXA 4KP7A 1B8PA 3PHHA 4CMBA 2RH4A 4KWHA 4DC1A 5JXWA 5GZ1A 3ITDA 1U9JA 1I2ZA 3MOGA 1E7SA 5LDGA 3QWIA 4XRRA 2DPGA 2Q45A 1XA0A 1QP8A 4ID9A 3RBXA 1DB3A 4FFPA 5DBIA 2J3IA 4Q3AA 4UUNA 4WLOA 3PJGA 1PX0A 4WNIA 1DSSG 2QRKA 3F1KA 1LDEA 3TFQA 4RV9A 5CEFA 4H7PA 1SB9A 2PZKA 1DIHA 4PRKA 5F1PA 2GPTA 2A94A 5U1PA 3AU9A 1N5DA 2NLOA 3NDIA 1EZ4A 1EMDA 5JCJA 8LDHA 1R4NB 2GN8A 5FEUA 3DFZA 3IS3A 4W4TA 3WIDA 1YB1A 2NU7A 3S2GA 4E6PA 1KVUA 3L6DA 2WJPA 1IY8A 4NBVA 1HDCA 1E3LA 2X0NA 3SJ7A 5AOVA 1SB8A 3V2HA 1TT5A 3RBZA 5B4UA 4NFYA 2IRWA 3ZV5A 4O63O 3RKUA 3WBFA 5TLSA 2EWMA 3JYLA 3P5SA 3PHGA 2WYWA 1HF3A 4YQYA 3JQAD 1NPYA 4MVJH 1EQ2A 2Z1MA 4PLVA 2DVMA 1T24A 4XQCA 4R1SA 4J2OA 3HADA 5ITWA 1BXGB 1NX6A 1LDNA 3L0DA 3JYPA 4CQLB 1E5QA 4OKNA 4W9NC 1R4MB 4XB1A 4L75A 2NTJA 1PSDA 3GFGA 3OBBA 3ZWMA 3WLFA 4FJ1A 5TJHA 3H2ZA 4BHTA 2CDBA 2Y1GA 4GX5A 4XQGA 5CDYA 2SCUA 1Z75A 4RVUA 4CM9D 4IM7A 2DTEA 1UZLA 1Y8RB 3JQDA 4RLHA 3DBRA 2ZB8A 4XQ9A 3CE6A 1K6JA 3VDQA 2Q3EA 3JQEA 5A05A 2BI8A 1F8GA 3W4KA 3RBVA 3H6KA 4FQ8A 4QTZA 4B3JA 4DQXA 5HWSA 5CP8A 3RC9A 4QUKA 3OQ6A 4EUFA 4B7CA 2GGSA 1BSVA 1EDZA 5IDQA 1J5PA 3OIFA 4IDGA 4BNHA 5C7OO 3TPCA 2O2YA 4OXYA 3WYCA 3RFTA 2BD0A 3IKTA 1LEHA 5L45A 2Q2QA 1WNTA 4I9UA 5FI5A 2DUWA 2J3JA 2FSVA 5L4SA 6ADHA 3MWDB 3ONDA 2NACA 3PHLA 3L4BA 3HE3A 4UVDA 2AQHA 3ROQA 3ZWAA 1Y7TA 2H6EA 5L51A 2IODA 1PL7A 1O0SA 3O8QB 5G0TA 2DBVO 3L9XA 4NFSA 3I52A 1XLTA 3QWBA 1PWXA 1Y5RA 3GDOA 1VKOA 4Y67A 3KYCA 2HMVA 2G17A 4XEHA 2HDHA 1YOVB 2O4UX 2X5JO 2A9FA 3T7EA 1UR5A 5JAZA 5T64A 1FMCA 1P77A 2AG5A 5JY6A 5DCYA 2HMSA 4RDIA 4WCFB 4Z0HO 4E5KA 3DL2A 3U09A 5L53A 3W4JA 4A0SA 1I3MA 3ZHZA 2AXQA 3MJSA 2LDXA 4L74A 1DC4A 1E6WA 3KLPX 3H65A 2ZTVA 2HK8A 4ZJUA 3PPIA 3V1UA 4J7CA 1PJ2A 3DR3A 4CQMD 5G0VA 2PH3A 1D7OA 5EQDA 2J6IA 3IC5A 1XKQA 2EKLA 5JFOA 4Z6KA 1HRDA 1OAAA 2R2GA 4HFMA 5KJEA 1RYEA 4M89A 3TF5A 4CQMA 3INRA 2AQIA 2FR1A 3D3EA 3RC1A 3LQFA 1GAEO 3KETA 3U0BA 1DOHA 1UDBA 4N18A 1PGNA 4O1MA 4RVFA 4BNLA 3SBOA 1P1FA 4MO2A 5JCJD 2H9IA 4X54A 3D5TA 1DC3A 1E1KA 1U4SA 4I5DA 4NHEA 5CDUA 4B7XA 3K8ZA 1ZZEA 1C1DA 4J4BA 5CPFA 2GF2A 3F3SA 4RCVA 2I3GA 2C82A 4B4OA 4YT8A 1C3VA 3M1AA 1HKUA 1NYTA 5EJ2A 4DYDA 3QRWA 4ROSA 1MFPA 3OJ0A 1B15A 1LC0A 1LBEA 2P9GA 4QEDA 2YFQA 3QWAA 4ND1A 2J3HA 4CMJA 3F6YA 1HDOA 5FF9A 2O48X 1U3UA 5BNFA 1VJ0A 4OAQA 1HE5A 2E37A 4OYRA 4QX6A 5FI3A 3VPXA 3HUDA 1NHWA 2G1UA 4HUJA 3I9KA 2Z5LA 1I33A 1ZK0A 5JDCA 3GMDA 3OA0A 4J3FA 5L7YA 1H5QA 3AUUA 2EGHA 3JYQA 1NQTA 2IDZA 4P4LA 1PZGA 4RGBA 3KSZO 3GHHA 4JBHA 4ESOA 4DPLA 3I9NA 4EW6A 2PK3A 1ULUA 3PLRA 4RDHA 1D3AA 1MC5A 5IXSA 4FFRA 4XWYA 3QW2A 1Q0HA 2B36A 4R54A 2FR8A 2Y1EA 1XELA 2JFFA 4FC6A 2Y99A 2GN9A 4A03A 1BVUA 2FPIA 4B79A 3LT0A 1GADO 3QLJA 1K89A 4D3DA 8ADHA 3FNFA 4CMAA 3WGHA 1B3RA 1E1MA 4DRYA 4JP3A 2Y0CA 1RPNA 1LRKA 4QO7A 3BMCB 2QHXA 4LISA 1GDHA 1HYHA 5COQA 3JQCA 1A72A 3SLGA 4BVAA 1ZK2A 3DWFA 1NAIA 1YL7A 3ZWXA 5J23A 1R66A 3VHRA 4PVCA 5JS6A 3GEGA 2BKAA 3E6AA 1DPGA 2VHWA 4DGSA 1H6CA 4RL6A 1X7HA 5TIIA 4TVOA 4CODB 5K6AA 1O8CA 4J43A 3AFMA 4BO1A 4R51A 4OIMA 5IZCC 1E7WA 3L6EA 5L4LA 1PL8A 2D5CA 1S6YA 1WVGA 3LDHA 3LF1A 4CMIA 4DTIA 3ZHBA 3IL2A 3C3XA 1ADCA 2X0IA 4CV0A 4BNJA 3BA1A 3AI3A 3PGJA 4BB6A 2ZB7A 1PL6A 4HP8A 3FWZA 2ZIZA 3KUXA 3WGGA 5EPOA 1CYDA 1HXHA 2IXBA 5KJ1A 2PY6A 4Y98A 2O23A 4R9SA 5ER9A 4AJJA 4D7AA 4DL9A 4IIUA 4GMGA 3QSGA 1N7GA 1ZFNA 4Z3DA 4JIGA 1AUPA 3AK4A 2DFVA 3JD0A 2YV3A 4CQLA 3VZRA 4WCFC 4YJDA 1ISIA 2GZ3A 3DO5A 4W99A 2WYUA 5A4DA 1I01A 3NDJA 3NT4A 3WNVA 1LX6A 1GTMA 3CSDA 1RM5A 4K26A 4Z9FA 1GCUA 5DNAA 5DDIP 3CKYA 1DFGA 3CTMA 3ROPA 3GGOA 3K73O 3ORFA 4CJXA 3JSAA 2ZB3A 4U0KA 4FB5A 4D0RA 1BMDA 4DREA 1E3WB 1QLHA 1QMGA 2DTXA 5HTOA 2IYPA 4PLYA 3RUCA 3ZHXA 5BT9A 5L9AA 5KTKA 3W6ZA 5B1YA 3E8XA 4UVIA 3MOIA 2I9PA 3UUWA 3WSVA 3HNPA 4TRJA 3BMNA 3GG2A 3H7AA 1LDMA 1EUCA 2BGMA 1QYXA 2C7GA 3ZHYA 1L7EA 3PVZA 3PRJA 2FRDA 2P4HX 4BIIA 3JQ7A 4J9UE 4BKQA 4BO0A 3TFOA 1DBVO 5A9TA 1ULSA 2QX7A 1LTHR 6LDHA 4YJFB 1ZIDA 5A06A 3TZKA 4M1QA 1JAXA 4NH4A 3ZN2A 2Q4BA 1MFZA 4NDNE 3OMLA 3DAGA 1PIWA 1N92A 2QZ9A 2GD1O 1ZVMA 2OP1A 2YUTA 4R5HA 4EZBA 3UXYA 4H3VA 1KY5A 2XXJA 4OSOA 4YWJA 1JU9A 3GPIA 4E0BA 2PKQP 4Q3BA 1U7TA 1VL6A 4D79A 2AW5A 4I1IA 5C7LO 2VUTA 1PJTA 1QV7A 3MJEA 3RAJA 5K0ZA 3U9LA 3JD3A 2Y1OA 3A06A 3DOOA 3UW3A 2AQ8A 4HV4A 1E3SA 3E5MA 5EMHA 1QR6A 5JY1A 4HNHA 4YJGA 1WPQA 5DOVA 3KLMX 3RWBA 5JE8A 2GSDA 3O4RA 3SEFA 4JJGA 4MVJM 3D3WB 4BO9A 2D5AA 4B3HA 3V1TC 1SC6A 4E21A 2JFGA 4AJ4A 4YXFA 2GLXA 1FF9A 1FDSA 2EIHA 1K0UA 2X0RA 4NG5A 3EDMA 3HN2A 5F1KA 2B69A 4KTVE 3GVCA 4N7RA 3S2FA 4N5LA 1UXKA 1KVSA 3F9IA 3WNQA 1XQ6A 4FD3A 1BXKA 2D3TA 3ETEA 1ZO8A 2C54A 3KO8A 2J5RA 2CDCA 5L95A 1U8FO 4CMEC 1GL3A 3ONFA 1SEVA 3Q2KA 4URFA 2X23A 2PNFA 3AU8A 5JAQA 2VTEA 4LSWA 4Y9DA 1Y6JA 4BO3A 4PLCA 1J0XO 3BTUA 4JQCA 1N2SA 2I3AA 3RU9A 2VT3A 4XZ3A 2VZ0A 4E32A 2VOJA 4P4NA 1E77A 2VHZA 4HX5A 2WTBA 4RVDA 4XGKA 3FNEA 1E1NA 1MV8A 3QVWA 4L4RA 4OJNA 4NU5A 3ZDFA 4BGUA 4CPDA 4CUJA 4DBZA 5L40A 1ENZA 4NI5A 1ISJA 3D3WA 4FFMA 4JBGA 4RZHA 2EF1A 5ILGA 1AHIA 1HEUA 4E4YA 5BSEA 1R0KA 3QJ5A 4Y8VA 5JC1A 4NMHA 1UZMA 4WPGA 4DBVO 1ZNQO 2R6JA 4BNKA 4FPXA 4MP3A 4II3A 1SOWA 3LT4A 3PLNA 4AJ1A 4RJTA 3GGGA 2BFMA 1LRJA 1BHSA 2FHSA 4GSLA 3E9NA 4PCVA 2FSSA 3L9WA 1BDMA 1XDWA 4PG8A 4ZVVA 3PQFA 1MG0A 4GVXA 3BTOA 2A92A 4RPLA 4HFJA 3VH2A 5CDTA 2WE8A 5EL0A 3ZU3A 3AY3A 3DB2A 4N5MA 3PHIA 4GMFA 4IJWA 2OL4A 1UJMA 2VZ8A 4LK3A 4R4JA 5KKCA 3TOXA 5G0WA 3QVTA 2NVUA 2VTDA 2O3QA 4BNNA 2HO5A 1A9ZA 5G2OA 3WYEA 3RROA 1HWYA 1QLJA 4OKIA 3VH1A 4L8VA 1W6UA 3AI1A 5K6AC 1E3JA 2DT5A 3CXRA 4U6QA 3ST7A 1NVGA 2Y05A 3JQFA 5DZSA 1YL6A 5K9ZA 1DLJA 4IZHA 3M1LA 4U5QA 1ISFA 3C7DB 2YQ4A 3GUYA 2HRBA 4AJLA 1Z6ZA 4NJOA 3H3JA 1EK6A 3RFXA 1I32A 3JQAB 3INGA 5TSDA 3ETGA 4MOWA 3GOHA 4KDEA 1IPFA 1ZK4A 3LC1O 2OBYA 4XR4A 3KVOA 1ZXLA 4UREA 4IMRA 2DUUA 3DZHA 3UN1A 3H5NA 5ILOA 1V35A 1C1DB 4RZIA 1LC3A 3HFSA 1P44A 1Y1PA 2NVWA 4P22A 3VZQA 2J3KA 1EUDA 3G3EA 5JDIA 1A5ZA 4HBGA 2NADA 3F4BA 2V6MA 1XWFA 3E48A 1TXGA 1JTVA 4DA9A 4R1TA 2EG9A 5F5NA 3IIEA 2WYVA 2ZCUA 2C5AA 3S8MA 1VE9A 3DZIA 5AQ1A 1GY8A 4IXWA 2BHLA 3V5NA 1U8XX 5KJ6A 3AI2A 2AQKA 4KUHA 4A5OA 2EEZA 4E5PA 1ZMOA 3M2PA 1LA2A 5TGDA 2OXIA 4E2YA 2E6UX 1HE4A 1U7HA 3AM4A 2VQ3A 4RF3A 4MPDA 1C1XA 3AOGA 1ISGA 3QWHA 2H1SA 3PP8A 5KOIA 3GF4A 2E49A 4IBOA 3WDSA 3JCZA 4LMRA 5EQFA 1YONA 2CMDA 1UP6A 1I2BA 2G5CA 2ZJ0A 5COAA 1GQYA 7ADHA 2I6TA 3D4NA 2DAPA 3GNSA 1FXSA 3JD1A 4R41A 2Y66A 2E82A 2B37A 1GQQA 2GN4A 1X14A 3BMNB 3NGXA 4Q3EA 1OZAA 5JNLA 3NRCA 1ORRA 3MJTA 4AVYA 4GPD1 2I65A 3WGYA 4F6CA 3PHJA 3Q0EA 5TF4A 2VYVD 2FPGA 2X0JA 1NPTO 4KZPA 4PZEA 1QV6A 3BIOA 4R1NA 3C1OA 4BNGA 1OC2A 1ZJYA 2HK9A 4WUVA 1UH5A 3RQSA 4BNXA 4R16A 5THKA 2AG8A 5JMPA 5TJ9A 2VWHA 3INTA 3MTGA 2W2KA 3OSUA 4QECA 5CAEA 2X22A 5A3VA 3QV1A 4CR8A 2JHGA 3DOCA 1XU9A 3BYZA 2NVUB 2QZZA 3PQDA 4TWRA 4WJZA 1F14A 4FFNA 4YCAA 3SLKA 2NQTA 4CM4B 4GKVA 1XU7A 1U28A 4DUPA 1B2LA 4OH1A 4CUZA 5L4NA 1MB4A 1EE2A 5DBGA 3H9QA 3ITKA 3K2EA 3KXDA 3KYDB 1KVTA 3BTSA 4RF2A 2CUKA 1B7GO 4ZQBA 3NKLA 4XDYA 1KEUA 4EI2A 2X4GA 3I9JA 5JC8A 2BFPA 2ZQYA 3DZGA 2C7VA 3B1FA 3OJFA 4RF4A 2CVQA 4BQRA 4IQ0A 2WWRA 4W9NA 3ABIA 3ULKA 4PIVA 1AGNA 1Z73A 2XPCA 4M86A 4RQTA 2OORA 4EEZA 2D4AA 4CMEA 1M66A 4B7UA 5KJCA 3C8MA 2TMGA 5IZCA 1HZJA 1U2GA 3PJDA 3WTCA 2AHRA 4QFCA 3GK3A 3LVFO 2R00C 4GGPA 4J4TA 5T8KA 3HDQA 1E3WA 5I9NA 4IDBA 2NUAA 4PZDA 4J7XA 3GT0A 4C7KA 5JAIA 3GAFA 1YQDA 1G6KA 4DXHA 1XIVA 3MCVA 4MVJD 1KEWA 2LDBA 4I9HA 2NSDA 3N7UA 4BNZA 2OFPA 1ZJZA 4Q3NA 1VL0A 1Z7EA 2OO5A 2Q1UA 2HAEA 2YZ7A 2UUOA 4LMPA 5FFFA 3QQPA 3H5AA 1IOLA 4Z9YA 3SVTA 4GGOA 3GGPA 1SPXA 2POQX 1DIAA 1E3EA 3TZCA 2HQ1A 1TEHA 4W6ZA 3UHAA 2B5WA 3LT2A 1SZJG 1U3TA 4C4OA 5JSFA 3E18A 1TLTA 1H2BA 3PXXA 2P5YA 1OI7A 1BG6A 5A9SA 4UUMA 3DTYA 4ALIA 4LCEA 1PJ4A 3JV7A 3L4BC 2W4QA 3Q11A 3ZGYA 3CINA 1T2EA 2ET6A 4KOAA 4XCVA 3WBBA 1KBZA 3HZZA 3CUKA 5C7IO 2YFHA 4RPJA 3KOUA 2B35A 4CLEA 5A03A 4PZCA 3R1IA 3WGZA 3SJUA 1CRWG 4A7PA 2NU8A 3GHYA 3JQ8A 2BLLA 1VJTA 2X9NA 4DVJA 1DIGA 2FMUA 3K31A 4RVGA 2VOEA 3JQ9C 2OZPA 4RQUA 3MJCA 4NNJA 3NJ8A 4BGVA 5F1OA 4MIYA 1U3WA 1F06A 2J8ZA 2UDPA 3JQFC 2QYTA 4NK4A 1LXCA 3EVTA 3I9LA 3HB4X 4R3WA 3DHYA 3O38A 5A9SB 4L9RA 2C20A 3RUAA 3F47A 3OJLA 5BSHA 1YQXA 1IUKA 3JD4A 1TT5B 3QIVA 3CMCO 2V6BA 3NX4A 1QSGA 3LC7O 1KS9A 3ENKA 3H2SA 2IEBA 2P9CA 4O5OA 1BGVA 4TRRA 2VRCD 3SC4A 1YDEA 4CLHA 1ZW1A 3K96A 4I5FA 3OETA 5G4KA 3JQ7B 1GZ4A 1E6EA 1Q0QA 3ADPA 2W8ZA 3H9UA 4E5MA 4BOYA 4HWKA 5JDIC 5DF1A 3TDKA 2PKRA 1KY4A 3GVHA 3ONEA 5GY7A 2PKQO 1HDZA 4XDZA 4DMMA 2QG4A 4XGNA 2VCYA 3KM0A 2DLDA 1Y5MA 5CG1A 2GYYA 1DRVA 2VNSA 2XOXA 4FS3A 1AE1A 1YO6A 4N54A 4D46A 2EJVA 4A2CA 1YJQA 1ZBQA 3TWOA 2IXAA 1VC2A 4PLWA 4K9DA 4J4HA 1Q1NA 1U5CA 4PVDA 4PG7A 4G65A 5H83A 3RKRA 1DEHA 1WDKA 1KERA 3GQVA 5T67A 1GUZA 4E12A 5KVSA 5AXDA 5ENDA 1PJBA 1LLUA 1Y9EA 1YS4A 3L6OO 3B6ZA 2Q50A 4YBZA 3OIDA 3QP9A 2YV2A 1HDGO 4DC0A 3T4XA 5JDCC 3WQSB 2AEMA 1Y8QA 3BMOB 3KYCB 3SC6A 1KVRA 3ZW9A 4TZTA 3WGIA 1P0CA 4DPMA 1NFRA 3C7AA 4J6FA 2GN6A 1GEEA 2DBZA 3A9WA 3H5RA 5JAMA 4AJPA 2P91A 5L7TA 1E3IA 3E9MA 2X1HA 5HBRA 2DQ4A 4ZHSA 2EERA 4CMCA 4PLTA 5LC1A 4F46A 2P4QA 4CLXA 1PGQA 1Y8RA 1C1XB 1KIFA 1IHXA 4BV8A 4ZRMA 2V6GA 2OBNA 1K6XA 4EITA 1HZZA 2Q2VA 2AMFA 4XIJA 3PYLA 4WLFA 2I5PO 3GN2A 5I9MA 3ROMA 2FZEA 5I7FA 2EGGA 2ZQZA 3C24A 4IJKA 3U3XA 3KTDA 5TS3A 2CNBA 1FDVA 2B4RO 3H8VA 4OOFA 4YAIA 2GDZA 3GVPA 4MINA 4BGEA 2HJSA 4BNTA 1YE3A 5I7SA 4MP8A 1MC4A 4W7IA 5T6BA 1ISMA 3GVIA 1JA9A 2Y0EA 1JW9B 4IDDA 5EINA 1RM3A 2JKVA 4MIOA 1FDUA 4IDCA 4S1VA 3UH1A 2CSUA 1DHTA 4WOKA 4DQUA 1WWKA 2CF5A 1K6IA 1K3TA 2WE7A 3PJEA 4JXKA 2IZ1A 3FTPA 3GDFA 3FWNA 5THQA 2ZK7A 4AICA 1XCBA 1HDRA 1MP0A 3DBLA 4RVSA 1AXEA 2AEFA 4MKZA 4IS3A 4DWVA 2Q2WA 1DFHA 1BW9B 1YBMA 2C59A 3AY7A 1XGKA 5ITVA 2EP7A 2CVOA 2NNLD 1V3TA 1YDWA 3KEOA 2C07A 5B4TA 2AE2A 2BGLA 2JD1A 3ZWVA 4BNIA 4XQEA 1N9GA 4GAEA 3DC2A 2J5QA 1R15A 4MKXA 4IQ8A 5ICSA 1CJCA 3C85A 1RYDA 2JHFA 4XA8A 3DZKA 1UP4A 2WM3A 3HQ4O 3O03A 5C37A 3K92A 5DCUA 3TSCA 3I6QA 2FR0A 3FI9A 4WCFA 1E92A 5I9LA 4AJEA 1LLQA 2A4KA 5BQFA 1WZIA 1BRMA 2FZWA 1GUFA 2PR2A 3H3FA 3T7CA 4XYLA 3DBLB 4ALMA 1GR0A 4B8ZA 2HRZA 5A1TA 2DKNA 4U6SA 4YAGA 5IN4A 3NYWA 2QIOA 3E03A 3HJAA 3QHAA 3FD8A 4XJTA 4BUCA 3GC6A 4HNGA 2JCYA 3GNTA 4J1QA 3BHJA 3SX2A 1Z74A 3IOYA 1J6UA 1B16A 4D3SA 3DQPA 2Q4EA 1TA4A 4PLPA 1R6DA 3DZFA 4PLZA 2BGKA 4E31A 3ZWBA 1B14A 1C0PA 3BTVA 3I83A 1X7DA 2JAPA 1O6ZA 3JQ9A 1C0LA 3ZNOA 3BMQA 3PFWO 3IP3A 4F6LA 3DZBA 3M6IA 1A4UA 1UDCA 3RSHA 4EJ0A 3WWYA 4W82A 3LK7A 3Q9UA 4WOJA 3BZUA 3ETDA 4GKBA 3RCBA 3RVDA 1DFIA 4ALJA 1NQOA 1OMOA 2IYOA 1K2WA 4WK6A 3UVEA 3DAPA 3WSWA 1B3BA 1HYEA 1D8AA 2NV6A 3WTBA 4P4GA 1UXHA 1EVIA 3TN7A 1QORA 2OOSA 1CERA 4BS9A 3NTQA 1V3VA 1PGOA 5AXAA 4EEXA 1XSEA 2OP0A 3WWZA 3NGLA 1NP3A 5CHEA 1VSUA 3RC2A 3S1LA 1I5RA 4Q3CA 1VLLA 2GR9A 4BNUA 5JPIA 5HA5A 1HETA 1NASA 2PWZA 4TSKA 5F5LA 3ZWWA 2Y1DA 4AFNA 4BMNA 2JD2A 5TC4A 1GEGA 3GPDG 4WEQA 1SCUA 3D7LA 4PGFA 2CFCA 4IGFA 4OQZA 3VH4A 1HE2A 1DHRA 3VKUA 3Q2IA 5CPBA 3LZ6A 5I8WA 3P19A 1LUAA 3LC2O 3WOHA 4OGWA 1ZEMA 4BB5A 5DP1A 1CDOA 3AW9A 3MTJA 4WLNA 5TX7A 1HE3A 1O5IA 3EUWA 4I9NA 4CL3A 4YAJA 1NHGA 1WLYA 2EKQA 5G0UA 4XYEA 3R0IA 1MXFA 3IQDB 4JROA 3VAZA 1IZ0A 2I99A 4XX0A 4BGIA 1QYWA 2R00A 3D0OA 4BV9A 3RI3A 3D4OA 2RBEA 4IJUA 3B20A 1YL5A 1NBOA 2NTNA 1WP4A 3DOJA 4ZQEA 2PD3A 3PZBA 2HJRA 4J1TA 3I3OA 1JN0A 2BI7A 1DJNA 1PJQA 4BO6A 5IDXA 4TKLA 5IAAA 4NJMA 4NBRA 2ZYAA 1P1IA 2PZJA 2FWMX 4OSPA 3S2IA 3VH3A 3OEWA 4E33A 5AVOA 1GD1O 4CMIB 3KYDA 1DDOA 4U8GA 2B4TO 4UAGA 3IKVA 4DLAA 3TZQA 4TRNA 3ZCXA 4LGVA 1ID1A 1DAOA 4B8WA 4WE3A 4ZQFA 3OM9A 5AYVA 3OP4A 4LN1A 2UV8A 3RUIA 2JJYA 4LVUA 1H93A 2DU8A 4BO7A 4YT4A 5BSFA 3FBGA 3AM5A 4Y6PA 2Z95A 2HMWA 1W0CA 3ASVA 4M55A 5CG2A 2C2XA 2O3SA 1LLDA 4E2WA 3JQAA 3OICA 4FSHA 4QQRA 3FBTA 3S55A 4LCJA 3I9OA 2RCYA 2QQ5A 3GEMA 1ONNA 4LVCA 1JKJA 3FNHA 1EE9A 2OGUA 1PR9A 3FCOA 3ZV3A 4CR6A 1TI7A 1XEAA 4HFNA 4CV3A 3UKOA 4ZQGA 2UVDA 3VPFA 1AXGA 1R16A 5AXCA 1UAYA 5DOZA 2XAAA 3GA0A 4RVHA 2B5VA 4WKGA 1J49A 3E82A 1E5LA 2VRBA 4G81A 3F1LA 1CWUA 3G1UA 2VYND 1A9YA 1M76A 1KVQA 4UULA 2ZKLA 4IXTA 3TRIA 1B8VA 3U4CA 4P38A 3S2EA 1M2WA 1PQWA 1RM4A 4LRTB 4NU6A 2W90A 2G82A 1DLIA 1BW9A 3WICA 4PG5A 3ZWCA 2YDXA 1PS8A 1G0NA 1EVJA 4WNCA 5IZ4A 4EUHA 4YRAA 4H15A 1NXQA 4NBTA 3WGTA 3COSA 2XF8A 3NUGA 4WLEA 4UEJA 2PZLA 4CM6A 4IUYA 4MKRA 5I7VA 4FBGA 2O3RA 2VNAA 2JAHA 4JK3A 4R01A 2PV7A 2RHCA 4HADA 2QRLA 1U2DA 1ZCJA 2FOIA 4I5EA 4XB2A 5U9CA 3OF2A 4MVJF 1N7HA 4PG6A 4YYZA 1FDTA 4BNWA 4NZ9A 3K30A 5H82A 4L4XA 4MDHA 4Z0PA 1EEHA 1L7DA 4XIYA 4FR5A 4TROA 4IDEA 4BKOA 5KIAA 1X1TA 3QWFA 1GYQA 1H0KA 2DC1A 2JCXA 3ANMA 2O7QA 2W2KB 3DTTA 2EJWA 1F12A 1FK8A 2O7SA 3V8BA 1KETA 4F45A 5HS6A 4FFOA 3WGQA 3D5QA 4RF5A 3VKVA 3ADOA 1IYZA 4WCDA 3FSRA 1T2DA 2C29D 4PLFA 3ZNPA 4JJFA 1NQAO 1Q7CA 3G1TA 4JBIA 2E48A 1T4DA 1M75A 9LDBA 2RHRA 4Z9XA 1JKFA 4R5MA 2PA3A 1WMAA 1SOVA 4PRLA 2PZMA 3DMYA 1C0KA 4ZD6A 1LQUA 1O89A 4M49A 4K1LA 1RWBA 3JYNA 3OH8A 1LJ8A 4IY1A 3DHNA 3FHLA 5JO9A 4TQGA 1I24A 1NR7A 4IQGA 2D8AA 4PLHA 3NTRA 3U4HA 5ADHA 1KYQA 2Y1CA 3F46A 4QXMA 3WGOA 1GZ6A 5EIOA 5B4VA 1VL8A 4LSMA 2P2SA 4YB8A 3PJFA 4AG3A 3IDSA 2D1YA 2YV1A 4ZQHA 1UZNA 3MEQA 4W7HA 3PGXA 3VOSA 3OQBA 5C5IA 1DXYA 2GNAA 1B0AA 2GASA 3ZZNA 4DPKA 5TNXA 3RU7A 3C1AA 5A04A 1DO8A 1ISHA 2P68A 1DC5A 2I66A 3ICPA 2YJZA 4O59O 1WZEA 1G0OA 4UEKA 3GZNA 1IL0A 1OC4A 4JLWA 4OL9A 2W98A 3JD2A 4OQYA 2F1KA 5F21A 3VC7A 3AY6A 4A10A 1KC3A 3DBRB 1MG5A 3R3JA 2EP5A 3WXBA 3AUTA 3KSUA 4BKUA 4ND3A 4GX1A 1G1AA 4ITUA 1LSJA 1Q0LA 2BMAA 3CEAA 5I7EA 1LI4A 1SMKA 4HFRA 1R12A 1BTOA 4CMGA 1GV0A 4E2ZA 5DULA 5DP2A 4FC7A 5IG2A 2PGDA 3GR6A 1ZMTA 3FPLA 1YRLA 1E7QA 3KZVA 4J91A 5ENVA 3W4IA 5H81A 4DIBA 1A7KA 2Q1WA 3G0OA 3KB6A 3GNQA 3DXFA 1H6AA 3W8FA 3WJAA 4JGBA 1E7YA 1NM5A 1Y81A 2OHXA 1T4BA 3ZNNA 4YAKA 1Q2XA 3NT5A 3RASA 3GZ4A 1IHYA 1T2AA 2Y0DA 1YXMA 4EDFA 2Q1TA 1VI2A 2GRAA 2PGJA 2VUSA 2WD7B 1EBUA 2CZCA 4WGGA 4XYMA 3HSKA 5TT0A 1NWHA 3GMSA 1WXDA 3RUHA 2GZ1A 2BFAA 3DBHB 1R4MA 4GL4A 1T25A 1ZUD1 3IJPA 1QYDA 4ONEA 2GERA 2J5KA 4PLGA 2IE0A 4OM8A 3U49A 1HL3A 2YY7A 2WMDA 2YHIB 3I9MA 3KYBA 4GBJA 4YJHB 3ZWPA 3Q3CA 3GG9A 4KMSA 1WDLA 1R0SA 3MJ4A 2G0TA 4D3FA 4FW8A 4QSMA 3DAFA 3Q6IA 5IFLA 5DT9A 2PD6A 1JWBB 4FGWA 3HB5X 2ZTUA 1CQJA 1IULA 1E1LA 1H6DA 3WX0A 3UCXA 1LDYA 3B1KA 4KUEA 4BNYA 2YYYA 4HKTA 2ILTA 3QY9A 4RPKA 1S7CA 3KHUA 2EKPA 5JW6A 3PIIA 3VPSA 3GAZA 3P2YA 4J7UA 4D41A 1B26A 4WLUA 4AJKA 2YHUA 4UEOA 1H6BA 1MA0A 5KVQA 1A71A 1UAGA 3HWRA 2TMDA 3CH6A 4JP2A 4IINA 5IDWA 1BXZA 4FGSA 1CIVA 5G4LA 4YPOA 5A9RA 1VKNA 1PS9A 3JQ6A 5A02A 3V2UA 1D4FA 3I23A 5IN5A 4IDFA 2O3TA 1JLLA 1ONOA 3RUDA 3ENNA 3KRTA 2IZZA 3WMXA 1N1GA 3VZSA 3IUSA 1N8KA 4L73A 4RO0A 4XJSA 2ZTLA 5JMWA 4KDFA 1Z45A 3GY0A 1KC1A 1K5HA 3PDUA 4GVLA 4EJ6A 4DLLA 1M6WA 2NTVA 4BMVA 3A4VA 4D45A 4OO3A 1T2CA 2BF7A 2W2LA 3TNLA 4CLOA 5HS4A 3H9JA 4G2NA 5F3RA 3GRPA 4QO8A 1E6UA 5EERA 1KOLA 2I67A 2YW9A 3OEYA 4AJNA 2E4AA 3OQ1A 1Y8QB 1ZKMA 3BMOA 5BSGA 4D0SA 1I2CA 1JQBA 1XYGA 2PGLA 2VUUA 3GUCA 4MVJA 1IZ9A 3WQQA 2EHDA 2GO1A 4XD2A 4XGIA 5CEEA 2O3JA 4BO4A 1HDXA 3U62A 4QT0A 1N9GB 3EYWA 5MGBA 3FR7A 5KKAA 1P1RA 1OFGA 1ZK1A 4FN4A 1P0FA 4WEOA 5BNIA 4GWGA 5ER6A 3K9QO 2ZCVA 4D44A 1QYCA 1HSZA 3CMMA 4OXNA 3JQBA 4D42A 4NBUA 1ONPA 1F0YA 3FN4A 4D43A 1YB4A 1YKFA 1ZSNA 1GV1A 1P1JA 1RM0A 4XR9A 1U3VA 1ZK3A 4IS2A 4EBFA 3A14A 1HT0A 1GFSA 2UYYA 1DRUA 1R0LA 3LLVA 4LRSB 1I36A 5JYDA 4FFLA 4GI2A 3G17A 4INAA 2X9GA 2HKIA 1XQ1A 1GUYA 3PWKA 3TQHA 1MUUA 4GSKA 2DBRA 3VPHA 3LYLA 3ZI0A 4E2XA 3DMTC 4TVBA 1CQIA 4XRGA 5TRTA 4EUEA 1F8FA 2NU6A 4RPGA 1U1IA 4KQXA 4MVJG 1PTJA 2X5OA 4B4VA 1SNYA 2O3UA 3ZU5A 3NTOA 4CV1A 3EY4A 9LDTA 4KUGA 3P2OA 5BR7A 4FOOA 3JTMA 4MVJI 1I3LA 4YJFA 1X7GA 1RJWA 1D1SA 3BXXA 4DIOA 1PU2A 3W8DA 4ZICA 2Q99A 2UAGA 3L77A 4E3ZA 4AJ2A 1BWSA 1NAHA 2H5LA 4HY3A 4Z0TA 4IMPA 1U5AA 3X2FA 1NVMB 3QA9A 4ZU3A 4L4SA 1NR1A 5TT1A 1IPEA 2VYNA 5G0SA 3I5MA 1PJLA 1FJHA 3WFJA 1R4NA 2AE1A 2BELA 1MXHA 4MP6A 3V1YA 2Q46A 3EW7A 3UICA 4J9VA 1MX3A 4CM9A 4U7WA 1HTBA 1I8TA 2X8LA 3HDHA 4CM4A 1ENPA 4I08A 3ZU4A 3PDJA 3KV3O 4NK5A 1H9BA 1ADGA 3EC7A 2CDAA 1ZSVA 1H2HA 4ZA2A 1UUFA 4ALLA 3VTFA 3N74A 5EESA 5TQVA 3DBHA 2FPPA 3C1TA 2NQ8A 3G79A 4Q9NA 5FWNA 3B70A 1GPJA 2FN7A 2FP4A 3STHA 4AL4A 4CLRA 5JBIA 1ARZA 4ZRNA 1X13A 4NBWA 4JCOA 4CMHA 1LRLA 3CPSA 4UVEA 3H9GA 3ZV6A 2HSDA 1GZ3A 1LNQA 1EFLA 1YWGO 2G76A 1GPDG 4M87A 2GCGA 1PGJA 4YT2A 3HG7A 5GZ6A 3RJ5A 1JVBA 2GZ2A 2WSBA 1PZFA 2X5KO 3EZLA 2D0IA 2CY0A 1CEQA 3HFGA 1IB6A 2YQ5A 4J16A 4II2A 3R3SA 3SXPA 1BDBA 3W6UA 1HLDA 3O26A 1EBFA 4IDAA 4CL8A 1N1EA 1LU9A 2D2IA 1PS0A 4BNFA 5DBFA 2Y67A 5A5EA 5U4QA 4CM3A 5BNTA 1E0DA 3WLEA 1E7MA 2HMUA 4UVHA 2EXXA 2IEDA 4YRBA 2W2LD 4L76A 2JFHA 5LCXA 4E30A 1EK5A 3W8EA 3DHEA 1ADBA 4P8RA 4CM8A 1X0VA 3B1JA 4R68A 2JD0A 3L07A 1UXGA 4CUKA 2OUIA 3EK2A 4FJ2A 3ICCA 3DEYX 5ES3A 1QG6A 3DZJA 5C3MA 1GYPA 2PH5A 1PJCA 2WD7A 1RKXA 1EUZA 1T26A 2V6FA 4O0LA 3O9ZA 4JJIA 4YJHA 5GMOA 3TL2A 4YT5A 4CR7A 5IDYA 2HU2A 1AHHA 1IE3A 4R9RA 5GZ3A 3KBOA 4DIFA 2BH9A 1PZHA 3GZNB 4NPCA 1YOVA 3TJRA 1X15A 3E5RA 1YJ8A 4ZGWA 5CFZA 3R6DA 3AJRA 1V0JA 4YQZA 4EJMA 1WAMA 4IPTA 3H9EO 3LT1A 3GDGA 2X9VA 4GLOA 3WG9A 4YR9A 4CM1A 3VZPA 2Q49A 5KWEA 1F17A 1ZXBA 3HHPA 4DQVA 3PWZA 1V6AA 4Z3KA 4JNKA 3BHMA 3TZ6A 4MVJP 3TL3A 3WMWA 2PD4A 2XXBA 5JCXA 2PTGA 4RORA 1QRRA 3RUFA 3HDJA 3NT2A 4RPHA 2RH8A 4FOSA 4U0JA 2I76A 2Y68A 1NFFA 4ND4A 2WDZA 1SBYA 2X7HA 3VTZA 3A28A 3U4IA 1A4IA 3E1KA 2OMEA 1R37A
chains in the Genus database with same CATH superfamily
2NP7A 2H16A 2YJNA 4HXFB 3V32A 4D1YA 1J20A 2PSFA 3H99A 2RSLA 1I3KA 2RI1A 1WMBA 2ST1A 3N87A 4J49A 4TT8A 5T5QA 4ZIRA 3EHEA 1KFEB 2Q0QA 2PZEA 4QXOA 3RU3A 2OCGA 4GQAA 4CQMB 3N2ZB 1ZMRA 2YY5A 5HJ7A 5JXGA 4IZOA 2HL6A 1BDJA 2JL1A 3FFAA 3K1JA 3VMFA 4AZWA 3H19A 1KRXA 3K2BA 4FYPA 4QOEA 1NQUA 3O8QA 4P0PB 1I3NA 1CFJA 1Z33A 3PC7A 3V4OA 5L7WA 4R1PA 5AK6A 2CCJA 4ZVLA 4BO5A 2UYOA 2ONJA 1O9BA 4M9XA 2IZ5A 3G2QA 1R18A 3WB9A 1MVLA 3RV3A 4ESHA 3KSDO 3Q7EA 3BOSA 1OBFO 5LXTF 4CKCA 2O4CA 2IXDA 4YUYA 3Q40A 4WKCA 1Z2EA 8ATCA 1DIBA 3WLTA 3IR7A 5B37A 5I7UA 2XDQB 1OSNA 1Y3FE 2Q4DA 3TJZA 1HBJA 2QAGA 1PEDA 2G1PA 2OE2A 4R1LA 3ZPXA 4BQPA 1GL6A 2BEVB 2E55A 1BKSB 3RSFA 2HWUA 5E3JA 3OECA 3QI7A 4BLVA 1OJLA 2O50A 1GNLA 3NFRA 2OBXA 3WHPA 4HRXA 2YV4A 2ACKA 4A0QA 4M1SA 4ILKA 1LSSA 3PGVA 2QV7A 3GLHA 2HK7A 2OLKA 3I5XA 1RBMA 16PKA 2BMFA 1R8SA 2R7AA 4BQIA 3CB4A 4GP9A 1BXRB 2OESA 4JR2A 5HJ5A 4EM6A 4CLRB 1MOPA 2Q29A 1TVKB 1JVSA 5LA6B 3FDIA 4I7EA 2O0LA 3HWWA 4MTLA 1P45A 1Y7IA 1T8YA 3ASUA 1P7CA 4C7JA 5EHGA 4KAFA 4LDNA 4CV2A 4OLHA 3RTBA 1J0DA 1CBUA 1XJ5A 2PMDA 3BQMB 4BWVA 3CZRA 5FOQA 3UIEA 1YMUA 3FHCB 3OKPA 4LWPA 5CCDA 3T1YB 1I0ZA 3NBFA 2C2GA 1SRRA 5F3DA 4IGEA 4P98A 3OWOA 2QXYA 5KC9A 3T9FA 1ZHHA 3IQHX 3FRJA 1LPSA 3R76A 2CLHB 3NBYC 2GM9A 3ZIAA 3ONWA 3EODA 3DVRX 1G6HA 3FKSA 1TVEA 2P5TB 4MGZR 5A3JA 2FRDC 3ZXXA 1ATZA 4JBWA 3DMPA 3K7EA 1NVEA 1MGOA 3QVOA 3MMXA 3Q7TA 3O3NB 1QYVA 4B8ZA 1JR3E 3L0PA 4ZQCB 3UHOA 1G7SA 4DHEA 3TIIA 3EZ2A 5G1PA 5TVKA 1RMQA 1QGAA 5BURA 3DMHA 5IARA 1N6IA 1M7HA 1M72A 4HBZA 2A14A 4LXHA 1PQ4A 2BR4A 4OX9B 1JR2A 1HLPA 1Q3KA 3SS9X 2PVPA 3FNGA 5KNLA 1B8UA 2QMZA 1NUQA 4ZI7A 4HQ6A 4JUCA 3L46A 3U39A 1JDJA 3A70A 1ZMXA 2ZSBA 4E5YA 1H23A 1WCV1 1QOPB 3VO8A 4TTVA 1SY7A 1MEEA 2PLAA 2WVJA 4HHEA 1N6RA 4CF6A 4FYIA 2P75A 3IAUA 4RLSA 4REQA 4WUTA 1OV4A 3LX5A 2ZGVA 4WZ6A 3RJZA 1M6YA 5LZ2A 4BV2A 3PEVA 4OM7A 3MJVA 1RPJA 4TZKA 1EVQA 2Y1XA 4WOCA 4B3XA 4J0DA 1KBQA 4F3YA 3C5WP 2A7QA 5BSKA 3X1XA 1VPDA 3D64A 4X8LA 2F1IA 2EF0A 3V1KA 5CFNA 1N2CB 1TZJA 2C3MA 3OP1A 3T15A 3U7IA 5JO0A 4EYEA 3U4AA 2J0VA 1VOTA 2WBLC 4JB3A 3QUCA 3FROA 1NV9A 1FPMA 3U19A 5AUNB 4DCNA 2YW2A 3OQJA 2I33A 1ORVA 3AM3A 2SECE 2IJGX 1LSUA 3QF4B 5FLKA 4QFMA 4FYXA 2IHKA 3NJ4A 3PYXA 3W2IA 2VHVA 3GJZA 1YZVA 3CIFA 1H9AA 4MWDA 4OHWA 3MT0A 5A6VA 1VSVA 3DWGA 4UFNA 1NBIA 1XQVA 4CLDA 3QK7A 1Z6TA 1LLCA 3UTCA 3UV7A 3UAGA 1EQUA 4HGRA 4IH1A 1Z7YA 3F96A 1ABFA 3D6JA 2RHOA 3C5HA 2YHIA 4GP6A 4O4LA 4CM5A 3KT0A 4JC4A 3I53A 4CKEA 3OZTA 4O6VA 5IHPA 1Q20A 4C20A 1T1EA 2PRIA 4ZEMA 1E8DA 1W9MA 3S4YA 4IMJB 4PN3A 2K2QB 2BTOA 1FS4A 3T4EA 5M5BA 3D4PA 1H66A 3PG5A 2A6PA 2KB0A 1C4WA 5MFZA 4Q7EA 4FHZA 3CZMA 3NIDB 5FL3A 1P2GA 4N0EA 3WBKA 4CGZA 3IPCA 3QX9A 4MVXA 4MJLA 1MO3A 3ZWOA 1P1HA 1SKYB 2G25A 4IIVA 1LDGA 3EVBA 4R1UA 5HKBA 2VWGA 4W1SA 1A9XA 4UARA 1J0BA 1Z6GA 4OMUA 1FQKA 1V9LA 4Q9IA 1F6WA 4MDYA 2V65A 3NBKA 3BGDA 3M9XA 4OHOA 4EKDA 2WF6A 2R1UA 2IUSA 2I03A 4G5XA 5IAKA 3FHJA 2BM1A 1A7AA 1GIAA 1XG5A 1ZITA 4QOIA 2D00A 1WY5A 1ZC4A 3GMIA 4LXTA 4N8EA 4Q9LA 3ZW8A 3AR9A 1C9MA 1DCFA 4DLBA 2HA2A 3C4QA 4U2CA 1WDMA 2W2VA 1LBHA 1HDIA 2VP0A 2IYWA 2FFRA 3O1IC 4HG2A 1I7DA 3TTSA 3UJ8A 4L95C 3C7CB 3GRZA 5I9TA 3EVZA 2CUNA 2OD2A 4U2FA 5D8DA 3L79A 3I58A 1Z4MA 4KE7A 5CT8A 1TKAA 2OHHA 2UUPA 3DE5X 2VDUE 3E70C 1DEKA 1C0IA 3GFBA 2NPFA 3FUUA 3WYBA 1QVWA 3RJ9A 2UXDB 4Q66C 1EFUA 1BQ3A 2A35A 1U0NA 3E81A 3TZLA 2VAPA 3R3VA 3HO6A 3NPMA 5JNVA 1RP1A 4BE9A 2FWRA 4KU4A 1U63A 2N0SA 1Q84A 3I1JA 5DMHA 5KVVA 1ODLA 4P2GA 5JZ9A 1G5QA 1YR2A 5A0TA 1F20A 3NAQA 2X8JA 1JAYA 1VBKA 4B2LA 1QNFA 3STTA 3NVKI 4F2DA 1BJRE 1GCOA 5CYOA 5EE5B 1QRDA 2YVKA 2OBBA 1SM4A 4IDQA 3F7NA 1JDBC 4ZOLA 3KZCA 1UWCA 2PBRA 4JP5A 4AMBA 4YCDA 4MWZA 4D8WA 4LHWA 1WSAA 2ZXUA 3MOSA 1V3UA 4FIZA 2H59A 5IF9A 2JEZA 5T8KC 1SAYA 4MYRA 4GZ5A 4QXAA 3PQEA 1PUIA 2NU7B 5CH3A 3GRKA 1U0GA 1DINA 1IG3A 1KZ1A 2POCA 2VN8A 5L3ZA 4KR6A 3FKJA 3GRCA 3M2TA 3PNOA 1KMCA 5LZ7A 3DV2A 3IKMB 2EFHB 3TR5A 1X1EA 2NT3A 4WKBA 2QXTA 4IG4A 4JBLA 4ZYXA 3DDNA 3MLAA 1U0HC 3EA0A 4WVLA 1QZXA 5ALSA 1OFUA 4R40A 2Z1NA 3I04M 6CHYA 4J1SA 1LH0A 1R5NA 5ENZA 1DP4A 4LE0A 4ZGBA 1WW8A 3CX6A 1YASA 5CURA 1UJ4A 4Z8YA 4CG0A 2VDRB 1VA5A 3E27A 5LLDA 1WHSA 4C7XA 1JEQA 3LW8A 5COBA 1ZN9A 4ZU1X 1QF9A 4U63A 3IILA 1YGYA 2J33A 4AKSA 1JB1A 2WP0A 1Y9AA 3L5OA 3PQ5A 3SY8A 3NWJA 1SURA 1OUMA 4LNAA 3IP1A 1CZUA 2CNOA 4ND5A 4ZCLA 5JS2A 3ZVLA 5JAOA 1JE0A 4RY8A 1HPLA 4ZXFA 1KRHA 3QY0A 1U02A 3QE3A 4Q9AA 3AOEC 2YDYA 3OU6A 3A3NA 1PZEA 1CUCA 4ZO8A 3S2YA 2IEIA 4NQZA 2BY4A 1SVMA 3SE7A 2HTEA 3PTZA 1LBTA 2VHXA 4KP7A 4RENA 4EIWA 2O5CA 4NE7A 2RH4A 4Z4HA 2OSBA 4DC1A 4B3SB 1E7SA 1KJJA 3V8RA 3AL0C 3QWIA 3L8EA 4XRRA 3LTNC 2RI0A 2XODA 2A5FA 4LPKA 3FCCA 4X45A 3GT4A 4FFPA 4O2BA 4MZXA 2XA1A 1WKBA 4KJXA 5JCZA 1PKEA 4WDRA 2WJJA 3BX1A 4TT3A 2WM2A 2QM7A 4M7WA 3TR6A 4S35A 2QRKA 3OQVA 1BGXT 4YP9A 3TFQA 3O3MB 5AJWA 1NJSA 5J2TF 4RV9A 3M34A 3HCEA 3NNDA 4H7PA 1MHTA 3GCGA 4TXHA 3G13A 3S1AB 1IBLB 2QRUA 4ZAVA 4UTNA 2JCBA 3DVSX 3REOA 8LDHA 1R4NB 3L3BA 3BCHA 2QEQA 2CZQA 3DFZA 1P2FA 2AOTA 4U2BA 2JI6A 3WIDA 5A4IS 1QS0B 1KDRA 2PUBA 1X9HA 2VK1A 4TMWA 1M2JA 4E51A 3GJQA 3HDGA 4KBGA 2WJPA 3GBVA 4MV9A 3BGOS 5EXTA 3V7WA 4E6PA 4QODA 1P1BA 1K06A 3QGMA 1T2VA 1TT5A 1QGED 2ZOSA 1QGZA 1H4SA 1U90A 2P9BA 4L27A 1MX1A 1ZUNB 4N9WA 5GGYA 3ZQKA 3TW8A 1R6TA 2H52A 4GSYA 2SKEA 4IFTA 4O63O 5FJIA 3RYHA 3ZCTA 1MOSA 5A0VA 2PSHA 2GEUA 2ZWIA 5IAEA 3VSCA 3P5SA 1KDTA 3UY4A 3PHGA 1Z4IA 1QAQA 2WYWA 3L0ZA 4MZDA 3BBPA 1AUVA 3RADC 1JJBA 1B93A 1K27A 1N6NA 1RQPA 2JA1A 3C41J 4OAOA 4H1WA 1A8UA 4PLVA 2DVMA 1I0IA 1WQ3A 3VSDA 1RCUA 3HADA 4GECA 4J2OA 1NX6A 1LDNA 2C8VA 4UQOA 4CQLB 1CQPA 2J9GA 1VLMA 1BJKA 3QUSA 4LRQA 1A50B 3VR6H 4V38A 1T0BA 3AHGA 3FCAA 5DLEA 1JQKA 4TMTA 3S8EA 3OBBA 1KTIA 4ANFA 4MW1A 3H4TA 4BHTA 3OAAA 2GLUA 3OX3A 1FUKA 2P78A 5LP6B 2RG7A 1QIHA 5EJ8A 2CL7X 1AQJA 2WFLB 1F51E 3OTOB 2PU5A 2SCUA 4LRYA 4E7OA 2RI6A 4CM9D 5IM4A 4YS6A 3RVRA 4NS4A 1UZLA 1K75A 1KQNA 1EZZA 4FFVA 2QJWA 4RLHA 1DTWA 4J75A 2ZB8A 2YKGA 1UWLA 3DDHA 4BMOB 1K6JA 2RB4A 1J1UA 3BB1A 1HDEA 1L7MA 2Q2NA 3FGPA 4JDPA 5D2CA 3VAAA 1BHQ1 3WLIA 4DWOA 4KK4A 4AKIA 3EBOA 3RBVA 4BTEA 4FU0A 3LGAA 4FQ8A 2W6OA 4ES6A 1NM5C 3BE8A 3SOZA 2JKZA 3RC9A 3T0IA 4MV5A 3B6IA 4B7CA 5IDQA 1BSVA 1BGWA 3K9FC 2V7XA 1OXSC 2ARKA 3N0XA 5JJ5A 5C7OO 3LWNA 2WINI 1RHJA 1BX3A 2O2HA 3WYCA 2M32A 3VJMA 1GQRA 1P75A 1WNTA 4I9UA 2DUWA 1JBQA 1RHMA 5GM2A 5KWJA 1GRCA 2R1TB 2FSVA 3G5AA 3M6LA 3ONDA 4K81B 4LBVA 5EFOA 1EGAA 1UJ6A 2AQHA 3AESA 3SHQA 3ZWAA 3PXUA 1TTTA 1Y7TA 2CXUA 1OI2A 3VNVA 1O0SA 3O8QB 2DE0X 3I52A 1UFRA 2W5UA 1TAUA 3Q7QA 1PWXA 4UASA 2J0SA 5AJHA 3TBKA 2NTYC 1LFAA 4BPBA 2XJ4A 1NDUA 3N5KA 4P4TA 2G8NA 3F3MA 5K8IA 1JEDA 3TTUA 1YOVB 1LK5A 2X5JO 1DKMA 2MHCA 1UR5A 3EXG2 5K0BA 5T64A 3DT9A 4LK2A 5K20A 1FMCA 1U80A 1W5EA 4CN8A 2VYCA 4H1HA 4LY9A 5G1OA 4RDIA 3FDZA 1QM5A 2BBOA 3FTQA 4E5KA 3U09A 2AZXA 3LCVB 1RJDA 2G28A 1JXMA 3TNDA 2AXQA 2LDXA 1ULBA 1E6WA 2WAOA 2YBEA 5T4HA 4ASUA 4Q9DA 3QKWA 2I4LA 3L41A 1VE6A 3QX3A 1LJUA 2E4ZA 1OWPA 2F7SA 3DR3A 3SC2A 5EQDA 2O2XA 4RANA 1QU3A 3BILA 3IC5A 3QYFA 1SUWA 3AUFA 3HDVA 3C3PA 4Z53A 5GIOE 2EKLA 1BFUA 1MENA 2AOUA 1OKKD 1OAAA 3LCRA 1GPMA 1KYVA 3P52A 5ULLA 1PZNA 1XA3A 3KAQA 1U5BB 4RSRA 1VQ1A 1I51A 1RYEA 2W6CX 2H4WA 4AUEA 1GNRA 2GBCA 3NKFA 3I3SR 4GFDA 1U0JA 4XSGA 4CQMA 3INRA 3BBLA 1DE0A 2V96A 2FR1A 4V0NA 3TO5A 1H3FA 4D9EA 4ZO7A 4E88A 1PT5A 2XF2A 2OD9A 5D5PA 5ALYA 5HRAA 3MWGA 1I1NA 5EMJA 1L4HA 1P6UA 4LECA 1OZFA 4EA8A 3L7NA 2WTEA 3SBOA 1P1FA 4Q82A 3ENQA 4OQ4A 4JBNA 2XSZD 1G63A 1U7DA 4BJ1A 2ZI9A 5BOSA 3M4NA 2W2MA 1RRFA 1E1KA 1U4SA 3IAS6 4I5DA 4QD3A 3VV2A 3WYGA 5CDUA 4ESVA 4UM7A 1I1QB 1XLVA 3K8ZA 4F8YA 3ANYB 4AO8A 1JVNA 4I9FA 4K9KA 4PX5A 3NNNA 1CQIB 5CPFA 3GRAA 1CNEA 4X61A 4C14A 2OSVA 2EJUA 4LC1A 2VJAA 4WXMA 4YT8A 4A15A 1C3VA 3DSRA 1QTQA 4KW7A 3TRHA 3WDMA 5BSRA 1Z0SA 5EJ2A 1DUSA 3GEBA 3BEOA 4EDHA 4ROSA 1MFPA 3U7QB 1YS1X 1PD1A 2R84A 2NV2B 3QUQA 1XTRA 1RVDA 3IYLW 2ZREA 4B6SA 2H06A 2J3HA 3INYA 2PEYA 2H51A 1HDOA 4IHJA 3MMNA 3ODGA 4RVNA 1VHQA 2BGWA 2O48X 1L6IA 1U3UA 2CBGA 5BNFA 5KYUB 1HE5A 5FI3A 4OYRA 4N82A 2G5GX 4FI3F 4NX2A 4ACBA 4CEHA 3P5BA 4Y2RA 3BFJA 4O2RA 1LK0A 3WP1B 4HX2A 4BVBA 1FS5A 2WR8A 1G2PA 2BFCA 2R5WA 3A26A 4J3FA 2EGHA 2G1KA 1NW9B 3JYQA 1MQ9A 1JKJB 2IDZA 3LQ1A 3OKFA 4QSHA 1Z63A 4P4LA 2PPVA 4ER3A 1JX6A 2FG7C 2VHEA 3L0SA 4ESOA 1Y1KE 3HH8A 4B31A 4HQLA 4IWYA 1EM6A 1R2QA 3LWBA 5CYGA 1GPYA 4MEAA 4EW6A 2PK3A 1SKBA 2O05A 3U3MA 5BN4A 4XVHA 3FG9A 4EPXA 4PCLA 1ULUA 3PLRA 4RDHA 2YXEA 1D3AA 2RHBA 3Q5EA 2OA0A 3VX3A 5IXSA 5L3QA 5AI4A 3OPVA 1TMYA 4LGYA 1J99A 1Q57A 2FRVA 2PSDA 4L2IA 4R54A 4EFKA 3VNSA 1CUAA 3R5XA 3SFVA 5KQPA 3VAYA 3LYAA 2YN4A 4A03A 1IBKB 4X7PA 1BVUA 3N39C 3MCZA 3LT0A 4GW3A 8ADHA 1GM5A 4URZR 2XWSA 3HDTA 3RW9A 2ODBA 3P4YA 2G06A 2HMAA 4RULA 1I4OA 2RK6A 3IKJA 4ZT7A 2PGOA 3IRUA 4LISA 5DM1A 3MBKA 5IVPA 5KDOA 1C80A 3DOHA 5GWXA 2V3WA 1X7XB 5FLYA 4C03A 3MGKA 1CR4A 4NVRA 3A6PC 4C78A 5J23A 1R66A 4XX1A 3LHFA 4RKFA 4DV0B 1XMJA 5EJ6A 4ZT2A 2FW9A 1EFTA 3A9TA 1DPGA 2AR9A 2VHWA 5JOQA 1EYZA 3RS9A 4RL6A 4DLSA 1X7HA 2OWEA 1G17A 3PDHA 5H4HA 5TIIA 3ZVNA 3R0VA 4QATA 3J80A 3AFMA 1DC7A 4G63A 1NMYA 3L82B 1K6MA 3EPKA 2DBYA 3DE6X 4R51A 1PL8A 3AVWA 5SY6A 1I2AA 3LL7A 1XCGB 4LSZA 3LDHA 3EFOB 3LF1A 3HGMA 3LOUA 1KO1A 4DTIA 3C3XA 1WB5A 1KI6B 4JR0A 4L9WA 1PV4A 1T2NA 1YU9A 3D8NA 1MHPA 3FFWA 5TDHA 1LNZA 1D0VA 3BA1A 3MJFA 4BNJA 1DAGA 2FCRA 1OLXB 4XPIB 4UFPA 3H16A 1Y9ZA 3I6ZA 4QJ5A 2PIDA 1FW6A 3FWZA 3ORSA 2CK3D 3I8SA 1AKEA 3L06A 1HXHA 4UAUA 2QAGC 4Q19A 3GYGA 2HSZA 5KJ1A 4NCBA 4Y98A 5EIEA 1Q1BA 4TS4A 2WHYA 4FYHA 1M8GA 4DL9A 3RE1A 1NDQA 4KR0A 4GMGA 1RJEA 3QSGA 1ZFNA 4JIGA 2CUZA 1AUPA 4S1OA 3HR8A 3QFHA 4YJDA 4KGZA 4LJ7A 4W99A 3ND6A 3RNLA 3HV0A 4X65B 3SZRA 4LF5B 2TMYA 5LWHA 4I8IA 4HH3C 4HNSA 5T6MA 4L6AA 2A78A 4TTPA 4QM6A 4JLUA 3WNVA 4KQJA 1T15A 3CSDA 1GCUA 3RT9A 4E09A 1AO3A 4QVGA 2YJ6A 5JJKA 2IV3A 1I2MA 2ZB3A 4U0KA 4Q1DA 2H5JA 2XQVA 2BE9A 4KSBA 5DT2A 2B1IA 3A6GA 2QTAA 4ZT3A 1BMDA 2WP8J 4RFSB 4BE4A 4XIGS 4GEKA 3RRBA 2NAPA 1QMGA 1RI3A 3C74A 3CIOA 3L7MA 5HTOA 5A5DA 4MWGA 1U2SA 3ETLA 2IOHA 2YNMC 3GROA 5L9AA 4MLDA 3ZYCA 2O8EA 2C1EA 3E8XA 1C2TA 4MV6A 4IGAA 5AKJA 3MOIA 1CJMA 4G36A 1VP9A 3SF8B 1GFWA 1GVNB 4TRJA 4WVFA 2JFWA 3GG2A 4EECA 2G40A 4BDTA 4ZANA 3VZBA 2LE0A 2VC2B 3KPUA 2HNAA 1HG0A 3RYFB 4FBLA 1EUCA 3L1UA 3U0VA 1PT6A 3N8HA 4FLEA 4CCYA 1L7EA 4ZYVA 4DSTA 3PVZA 1R0YA 3KQYA 3T4UA 2P4HX 2QTCA 1P3Y1 3JQ7A 4J9UE 1WD7A 2P4EA 1EH5A 3WRVA 4BKQA 4BO0A 2I4RA 3TLKA 4C06A 1ULSA 4CEIA 3BJRA 3MPOA 5A06A 4NH4A 3ZN2A 4XH9B 3H1PA 2Z9DA 1MFZA 3MGBA 1DI0A 1SHZA 4P53A 5AK3A 1C9NA 4L02A 1BH6A 2P1RA 2I6FA 3OQIA 5K3FA 5C1IA 1DV1A 3UOAB 5KU1A 2GD1O 2QZ9A 2ZAGA 3EUFA 2YUTA 2RHHA 3QU4A 4JDUA 4RIGA 4EZBA 3CKKA 5FOWA 4KR2A 3WB2A 4YK7A 2C0PA 5ALWA 2ZYSA 3IAAA 1QE3A 2IHBA 2PKQP 4YRPA 4R9NA 3UJ7A 4RA9B 1DEOA 1KAHA 4U3JA 2VUTA 1PJTA 4UW9A 4DDWA 2OM2A 1JPVA 2M6RA 3TLGA 1L7OA 4IGKA 4KFCA 1EDDA 4BVLA 2PGAA 5EMHA 5A7FA 5BN3B 2GXQA 1DMRA 4EOGA 5TR9A 2VP2A 4W63A 4DMRA 1IOZA 4HNHA 3QYAA 4L8GA 5DOVA 4NOMA 2CEKA 4HGYA 1NL3A 1V37A 3IAXA 3SQNA 3V4PB 3SEFA 4B6OA 5JSQA 2I8LA 2R5FA 2X42A 3ZE7A 4EJSB 5HZHA 4WL0A 2D5AA 1H8EA 3K1TA 1XP5A 4Z9AA 3RS7A 4XX0B 4B44A 3V1TC 4HTFA 1X1RA 4AJ4A 1GQOA 1BS2A 1FF9A 3LGSA 1FTSA 4HDCA 3AONB 1TAQA 3W9YA 2L69A 3I9V1 2CUTA 3V4SA 5FL7D 4EF6A 3R9WA 4JJ6A 4I4CA 5F1KA 4PZYA 3DDSA 3GVCA 4N7RA 4PYKA 2E85A 5BXYA 3WNQA 4AU1A 2FQQA 4QQKA 2D3TA 1TNDA 3ETEA 1JILA 3IDAA 3LTEA 2CDCA 1Z0ZA 5KNDD 5JXHA 3W3AA 5L95A 4KPYA 3ONFA 5B3JC 1AOXA 3KXIA 3R5TA 3QQ5A 1Z0JA 1K5DA 3C3BA 3ECSA 1R0CA 1H2WA 1Y6JA 3Q0IA 1RCFA 3I2JA 1QFXA 4ZVOA 3E9YA 2HMYB 3NHLA 4OG2A 121PA 4BO3A 4PLCA 1I6MA 3B38A 5ESDA 3C4JA 3KB8A 4NZYA 5AW5A 1F3OA 4HAZA 2FDRA 4J1TC 3G85A 4W5OA 2ZBGA 3HP1A 4RVDA 3C6YA 4I55B 5JVDF 1E1NA 4RA6B 2IE8A 4OJNA 1PHPA 4YRGA 2PBFA 4DBZA 3GO4A 2GOYA 4KGXA 3ZBTA 6YASA 4RY9A 3D3WA 4UHBA 2QBYA 4E4YA 1AHIA 1HEUA 2JH3A 3NHKA 5BSEA 4FW9A 3C3YA 3NHPA 4EL5A 4K9NA 3O1JC 2JGRA 2QNRA 2LKCA 8MHTA 3M9LA 4DV3B 1W1WA 3D6NB 4WPGA 4KIUA 5LJIA 1Y1SA 4FPXA 4II3A 4RJTA 3DUFA 1IN6A 3GGGA 1X87A 2QRNA 1F60A 1CY4A 1DXHA 3AGPA 3FSGD 3K4PA 1DBSA 4X1KB 3ZLVA 1XN1A 3PQ6A 1TAGA 1GDTA 4I6GA 1SKMA 4Q9KA 5E1DA 1O6BA 4UTZA 3SM9A 5A62A 5ISMA 4TKUA 3E8MA 1T3ZA 4PCVA 3MRVA 1W2WB 3CR8A 4WIAA 1BDMA 3YASA 4YV0A 4PG8A 1MZVA 4GXRA 4QU5A 2GVNA 3HBLA 1ZJ6A 3FMPB 3KL4A 2R8YA 3L6BA 3VH2A 2WE8A 2EJBA 3ZU3A 5AKXA 5FUYA 1Z5NA 2FMXA 2IHZA 3ZKWA 4NPAA 4GMFA 4E5VA 3ZLBA 1YZHA 2OL4A 1WJGA 1TEVA 3TOXA 3TNJA 2O8BB 1N36B 3U7EB 2NVUA 1SHJA 3AUYA 4GUDA 5A7HA 4HAYA 3C87A 2XE6A 2DMRA 3DHWC 3K9CA 3LXUX 3PR3A 5AMXA 3RROA 4A0FA 3AVPA 2GJAA 4HWSA 4ZV4A 1JEYB 4ZZ1A 3E22B 2EC5A 4BCDA 4QNNA 4F3CA 1W19A 3RB8A 3CO5A 5HDQA 2Y05A 3T38A 4CG1A 1RWVA 4HLUC 1YL6A 2BM0A 3PUXA 4J29A 1DLJA 2JJMA 4IZHA 3VR4H 5K9ZA 2PRKA 1JT2A 1OE0A 2AZDA 1S3IA 4G1UC 3GUYA 4AJLA 1Z6ZA 2F8MA 3RFXA 1TIKA 3QE0A 4EZIA 1K7FB 3OOHA 4R2KA 5TSDA 3ETGA 3A7DA 4MOWA 1M0SA 2JFPA 4D8XA 2DFLA 3GOHA 3RH0A 4MGHA 4JT8A 1AKVA 3RYHB 1CUWA 2EBFX 3D59A 5BVGA 5EWLA 4IQ4A 3OE7D 5EP4A 4UREA 2OC9A 3M83A 4X3CA 1PDVA 2DUUA 3D6TB 2H1WA 3KQTA 4FE4A 5CB8A 1UBEA 3H5NA 5DGTA 3P71T 1Y80A 4M9UA 2W6JD 1C9YA 1C1DB 4MUJA 3KQWA 5EQTA 5ALZA 1V26A 2NVWA 4ZEXA 2J3KA 4K6OA 1IZ8A 2H9AA 3SZGA 4BLUA 3IVRA 3F4BA 3WI7A 2GX6A 4YV2A 1DVRA 3K9WA 1TXGA 1JTVA 1OZGA 4R1TA 4Y0VA 1IEQA 3L84A 3B7GA 3I09A 5BW5A 3TAHA 4MV8A 2WYVA 8ABPA 3DLBA 3R9XB 2O8VA 3GJ0A 1BQ4A 3DQZA 3NPAA 2RDMA 5AQ1A 3D31A 5ARDA 4B6RA 4PC2A 1QIJA 3MELA 4TKVA 2EEZA 2HUPA 3T3HA 1L5HA 3GRFA 5J2UB 3V33A 4QLBA 1IY2A 4DM4A 5TGDA 2OXIA 2VP3A 4PNZA 2HZ7A 1HE4A 1T6ZA 3MUFA 5TEWA 3K0BA 3AF5A 3CQ9A 1UBTS 2XRFA 1ISGA 4L8YA 3QWHA 1QANA 4X1KA 5CLQA 4Q4JB 3CW2A 5GOTA 3VSEA 1PBNA 3TE6A 5KOIA 3AIIA 1RKBA 2I4OA 3WDSA 2CNWD 1MPTA 3A6ZA 2HRRA 3JCZA 3KU1A 3OIWA 3EFBA 1FRVA 4RACA 3UPDA 5KTTA 1UC4B 2FPIB 5EJ4A 2ZJ0A 1WU8A 1GQYA 3W6NA 4LWQA 1A8HA 2A1IA 3D4NA 1UCFA 3EFHA 4UTVA 1W36B 2DAPA 3AIMA 1FXSA 1GR1A 3JZIA 1GAWA 5AP9A 4JYMA 3PL5A 2JBHA 3QEKA 3PDWA 5AVZA 1Q83A 1ZUIA 1X14A 2O5VA 5HJ2A 5B58T 4PFKA 3Q0TA 4DIKA 4AM8A 2ZJ7A 4NC9A 1HOTA 3IE1A 2I65A 3WGYA 1NW6A 4CCYB 2XB2A 2JZCA 1BX1A 2WJ6A 2FPGA 3NWEA 2WF8A 3H1EA 5ARBA 1EU1A 4O4HF 4LBWA 4XWOA 4PZEA 4BY9E 3ZTTA 2SNIE 2RHLA 1QIFA 2BDEA 2H00A 5I6DA 1UH5A 5HXAA 2ZSIA 3OEED 1Y6QA 5JMPA 1SH7A 1NMEA 3UWOA 5FOUA 5BSMA 5CAEA 5A3VA 2WSMA 4JQZA 1HZZC 3QV1A 4MWSA 1SA0A 3ESBA 2R7LA 2JHGA 3RVLA 4KYIB 1XRPA 3I9V6 1V25A 4OP3A 4R0NA 3RNOA 2C2KA 1E9EA 4GEGA 2D13A 3IUYA 3PQDA 4CTJA 4K6MA 3HGTA 1XJWA 4W1RA 3FUVA 2PH7A 3N8GA 2ZT7A 4EG7A 4Z7OB 3GLIB 1XKXA 3VVMA 1F9EA 3KT6A 1U28A 4GKVA 4MW4A 3WYAA 2BFEA 4YGYA 1RLMA 3E8SA 5L4NA 5DBGA 1EE2A 4R84A 1EWKA 5KOJB 3K2EA 2EATA 3AJEA 4LZZA 1POWA 2NO4A 3KYDB 1KVTA 2QT0A 4COOA 5IKMA 2XBMA 1GVHA 3DBIA 1E5TA 4B73A 4XDYA 5KQRA 2QZ4A 4LYEA 2X4GA 3RS8A 3THSA 5ALPA 5FO0A 5DTMA 1CLUA 1CFZA 2BFPA 4L78A 3DZGA 2C7VA 4BQRA 4TXJA 3RK0A 4W9NA 4JLNA 2PL3A 2RGNA 2RHWA 3TMAA 5K4AA 1AGNA 2VT7A 2V7QA 4B1FA 4M86A 2OORA 1XTPA 3CVJA 1NKVA 2D4AA 1JIUA 5BN5B 1UBCA 2J85A 3ESYA 3MTEA 3R3UA 4MS3A 3C8MA 1JIVA 1JYFA 2TMGA 3OQPA 5IZCA 2ZBPA 1H3EA 5FPSA 2AHRA 2OYCA 5CXUA 1QWSA 1Y3CE 2FEWB 2FFHA 4UCFA 4LI3X 4J7XA 2I80A 5C53B 1C50A 4O8ZA 5DSXA 3PRYA 3SM3A 1ZNYA 1G6KA 4AXBA 1FVXA 1XIVA 2X4LA 1T8SA 1GG5A 3KKLA 3MCVA 2FPMA 4HPJB 4X6UA 2I2CA 2LDBA 5ESWA 5E8RA 2FDXA 1J25A 4BNZA 1XUOA 3NEYA 4JLPA 2XRZA 1D0SA 1JQAA 1VL0A 2OZEA 2Q1UA 2UUOA 4F56A 5ALOA 1NVVR 2AJDA 3WKBA 3SVTA 2QP4A 4NZMA 1ISSA 4OI4A 2POQX 3MUNA 3C3AA 5LJLA 1E3EA 1Y6ZA 2FOLA 2BF4A 2HQ1A 5HK9A 1TEHA 3PNSA 3OOYA 1SZJG 3EN0A 4C4OA 1PTJC 3K6SA 5BN5A 3E18A 2AFVA 4NCHA 1QH9A 1M2OA 3ZLTA 3NU1A 2P5YA 3AZQA 1BG6A 3BGWA 1T3GA 1JR4A 2VDWA 3S7TA 3AFOA 3HY4A 1PJ4A 2BZSA 1ZAYA 4C4RA 3Q5DA 1S9DA 4EA6A 3KJNA 5BUCA 3O9VA 1JAHA 3CINA 3NKVA 3MRTA 5TS2A 2C4WA 3WBBA 2ZRHA 4O0MA 3RT7A 3FH0A 2YFHA 4IXMA 4CLEA 5LVAA 4Z7NB 2XUAA 4PZCA 1M1XB 5CT6A 1RNLA 3SJUA 1CRWG 4Y9TA 3FX2A 2ZITA 5JSHA 1HM5A 2FMUA 2VJDA 4IZ6A 1E2JA 2H4ZA 2IUFA 1JQLB 1R0RE 3WWPA 2OZPA 4RQUA 1XDUA 3IT2A 3Q7IA 4X63A 2GZDA 2JW5A 5F1OA 4UZEA 3QPUA 4MIYA 2R1TA 4EY6A 1U3WA 1WVMA 2RJ3A 3BJEA 5ALIA 4F06A 3AF6A 2QYTA 3D3KA 1MDBA 2X3YA 1W4BA 3UJAA 3EVTA 3WO0A 3H8SA 1Q5PA 5E9WA 1RAAA 3F7OA 2JLSA 4HAXA 3O38A 1JWLA 1T5BA 2BDUA 2QX8A 5J47A 3D1JA 5E7IA 2BCGY 1YQXA 2CNWA 3NBQA 3T5MA 3DEAA 1B23P 1X1DA 3EGXB 1VMIA 3CMCO 4II7A 3LRXA 4KQMA 4DMUB 4MUFA 4QG3A 5I9IA 1U7XA 1KS9A 1X1BA 2EW1A 3H2SA 1YTLA 2PGXA 3HYNA 3TBFA 2XA2A 1BGVA 3KR0A 1M2GA 1IK6A 2VRCD 1N75A 2GSWA 2XOEA 4MW2A 3SC4A 4CCAA 5CFLA 4HH1A 1DC8A 1PR5A 5TB5A 2YC2C 5CIYA 3B5IA 2A4MA 1F8XA 1V5IA 3FSEA 1BO6A 1GZ4A 1E6EA 2B3DA 2ID7A 4MPRA 1EI9A 4JITA 2C03A 3HACA 5IC6A 4OV6B 3R7BA 4BOYA 3VBCA 2BGIA 3AHIA 5DF1A 1AKQA 2DWUA 3FZQA 1DBQA 4GR9A 1YZGA 3G2KA 3UJHA 3AF2A 4MICA 4AY4A 2GRJA 5BVGB 1ZI6A 1N5RA 1XZGA 3R41A 5DX8A 3ICWA 4YMVA 3K09C 2DLDA 1F0NA 2BFCB 4HN2A 4I6EA 3NASA 5HCIA 2AC2A 1KHHA 1EA5A 4B3FX 3HVIA 3R6GA 4FNGA 1PFKA 4WOPA 3X0DA 2C2BA 4JBXA 1ECCA 2A5LA 4JSYA 2C5LA 5AVSA 2UUCB 1R8YA 1VC2A 4IR7A 1Q1NA 1U5CA 2QJOA 5C8YB 3N28A 4PO1A 2B4AA 1E1YA 1AC5A 3C98A 5KHAA 3RKRA 3EFEA 4TMZA 1IUNA 1WDKA 4E12A 2ZIGA 2B7BA 2CHVA 3ERCA 5LUBA 3BIXA 3ASYA 4YMWA 1DEXA 3QOXA 3DJYA 3L6OO 4KCGA 4RA6A 1P9RA 3QU2A 2FZCA 5IANA 5A71A 2AI3A 3QP9A 2XV1A 5CCXA 3KDSE 1FYVA 4DC0A 3NDPA 3WSTA 4X8HA 2NZYA 2ZWMA 3MRXA 4HT3B 1OBOA 3WQSB 2LTAA 4JOCA 3BMOB 2C96A 2FUNB 4AN4A 4QGSA 1NFRA 2OENG 4IGIA 4XARA 1ADYA 3HXTA 1NG9A 4B6EA 1TYAE 5JAMA 1WHSB 4AJPA 3RPEA 5L7TA 3GLIE 1Z2NX 4EF5A 2Q5LA 1BEUB 3K72B 2X1HA 3JWPA 4GOMD 5E7MA 4PZLA 5HBRA 3WK9A 1Q6ZA 3SU8A 2AMYA 4CMCA 1YRWA 1MTOA 3SICE 4EGCB 5C46F 1FBTA 4F46A 3R7WB 1UKYA 4YASA 4NARA 4PXYA 4DOMA 1N0WA 2JEOA 3TM5A 5F3WB 3O2NA 2V6GA 2YXNA 5KTPA 1N78A 3LW7A 1SU8A 3ZKWB 1VCIA 1XMXA 5HTKA 4O5AA 2QRGA 2AKEA 4DR4B 2KI5A 2CVHA 3CRVA 3UT5A 2YVQA 1YUBA 1T4MA 3OPMA 3C24A 3U3XA 4YCLA 5BW4A 3KTDA 5C8XA 3HLTA 3R7LA 1OHHA 1ZR2A 2FMIA 3NWBA 4A1FA 1EFHA 4ZAGA 2GDZA 3KQVA 4WZBA 4MMZB 2VATA 3CURA 3ER6A 4BGEA 2JJ8A 4AG5A 4BNTA 1WKCA 1JI3A 1YE3A 2X9QA 5KTRA 1IN5A 4W7IA 3QLUA 1G21E 2XCRB 1ISMA 4QWWA 1GN8A 1ZOPA 1C9KA 4RZSA 4ZI2A 3OZBA 1YZYA 4MIOA 1FDUA 4IDCA 4M6WA 5AK4A 2GETA 2J9YB 2GEFA 2PAFA 3F6RA 2WE7A 4UHFA 4EQ6A 4G37A 3ZWKA 4CU2A 1FA9A 3GDFA 3F6EX 1USKA 2WIFA 3VU8A 3GCDA 4LJAA 3LRPA 5THQA 4AICA 1XCBA 1HDRA 2HJVA 3OLWA 5FBLB 1ZD8A 5JXIA 1RWNA 4IS3A 1DFHA 521PA 2C59A 1A69A 1R4ZA 5ITVA 4R8RA 1AS2A 5KBYA 3U60B 2NNLD 1YB6A 1ATIA 4IHAA 1V3TA 1TPZA 3TCNA 3ETCA 3KDAA 1T36B 4Y7DA 1UBMS 2AE2A 2JD1A 3PICA 4ZAXA 2Z56A 4CKCB 4RL4A 2CXNA 2WICA 4DKJA 4ND6A 3QVJA 1ZGGA 4CI0B 1HT1E 3NOOA 5A3QA 3KTOA 4QDTA 5CXSA 3TINA 3O73A 4MKXA 1QC5B 1IPHA 3IE2A 3C85A 1R00A 2Y1KA 4FDLA 1U6JA 4IQ8A 4JAVC 5ICSA 4TTIA 3AC0A 3RYFA 1FJGB 4YBRA 5H68A 2FUEA 5HHTA 5AI6A 2PT7A 4NE9A 3T7JA 4JXXA 1P2SA 3H8WA 4MQEB 5TGTA 5BQFA 5IW8A 1EP1B 1PG5A 2PM8A 2ANCA 1BRMA 4KXXA 2PR2A 4QRIA 4UCWA 4RS4A 2GAOA 1FLDA 1PQYA 1X3SA 3CCBA 2IHVA 3THOA 2HRZA 2CZGA 2XUKA 2QIOA 1CR6A 4G0MA 3MTDA 3OTIA 4XJTA 1JHPA 1O8BA 2XQFA 4V0RA 3SBXA 1N2OA 2C9MA 1TRHA 4GNKA 1W4RA 2BGGA 3IOYA 1VPWA 4L5CA 1J6UA 1PK8A 2O1SA 3M70A 3DQPA 1Z15A 5THXA 2FK8A 5AJZA 5FBVB 1U6IA 1HOXA 4REMA 4E31A 3DZFA 5EEHA 3UC5A 2BGKA 3ZE9A 1B14A 1NLZA 5HF5A 3ZXIA 3C5CA 4U9HS 3ZNOA 5J5AA 3D4IA 1L4LA 3RVPA