1IZ7A

Re-refinement of the structure of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 at 1.6 a resolution
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
294
structure length
294
Chain Sequence
b'LGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE, LINB
publication title Haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26: X-ray crystallographic studies of dehalogenation of brominated substrates
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 111
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2002-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iz7A00
5DJ5A 4PSUA 2HM7A 1AMNA 2QKYA 5A7HA 3B5EA 3EQ9A 3DJYA 3QM1A 4ROTA 3G02A 3O9MA 3U1TA 4JEIA 5LZ5A 1JU4A 1E66A 2E3JA 5AOBA 3R3UA 2WHQA 2XUQA 1CPYA 3H19A 4HAIA 1UOPA 4QDTA 4MQLA 2I03A 1E89A 3QMWA 1OCEA 3G0CA 3WKDA 5JIBA 1YAJA 1BU8A 4Y7DA 4QA9A 2D0DA 3ANSA 3PF8A 3I2FA 4W1PA 4L3WA 2R11A 4F0JA 1L7QA 1IUOA 1GKKA 1CUXA 5DYYA 1U8EA 1ETHA 4X91A 1Z68A 1W75A 3WI7A 4ZRDA 2JBWA 1GPNA 4UHFA 1IMJA 5FPPA 2PUJA 3AILA 1QO9A 4PQEA 4A16A 1K6EA 3MGAA 4J0DA 4KAFA 1CUAA 4UHCA 5LKRA 2GZRA 4UHDA 1XRPA 4HXGA 2XLBA 4E46A 2VEOA 4J0IA 4Q3LA 3C87A 4N8SA 5FV4A 3DYVA 1K63A 4BVKA 1DU4A 3PI6A 1YAHA 4ARBA 4B7ZA 5JD6A 2WG1A 5ALRA 2XE4A 3I1YA 2B20A 4AO7A 3A2LA 1D07A 3BDIA 1VOTA 2WTNA 3G0IA 4BATA 1QIDA 1K5PA 1EB9A 4GBGA 5JALA 1SC9A 3WWCA 1CUBA 2QM0A 2VJCA 2XQIA 1XZHA 3H2HA 4W63A 4AN1A 3DEAA 3FSGD 1UOQA 3WK6A 4FOLA 4IH1A 4QDXA 2WHRA 3FNBA 1HL7A 4LKOA 2WSLA 2PPLA 1LPMA 4MEBA 5T4BA 2BGNA 1UK6A 4KE7A 5IKXA 3STYA 4WY8A 3HJUA 4YPVA 2G63A 1R9MA 4XJVA 1IUNA 1PV1A 2WIDA 1F6WA 2EEPA 5AKZA 3WKBA 1T2NA 2EDAA 4JYPA 3BWXA 1JMKC 3WYDA 1G66A 5FP0A 5JZBA 2C5FA 5KREA 2DHEA 3W06A 4E15A 5AK3A 4HZGA 1X2BA 4QLAA 2W22A 1AUOA 4N5HX 2GBCA 1G42A 1H2WA 4C4XA 4B85A 1L7AA 4BCCA 1DT5A 4QEKA 5DTJA 4CIAA 2VJDA 4HVTA 2K2QB 4BYMA 5AKIA 4B0OA 5DNWA 2G4LA 1ZIYA 3G7NA 4B9AA 4P92A 4LIPD 3IA2A 3WJ2A 2WILA 1QIGA 3G0BA 5KBYA 4DM7A 1QIHA 3KOOA 4BCDA 3FWHA 4Y2PA 1XZMA 5EHQA 4YK7A 3WJ1A 2FX5A 3BXPA 2AJBA 4L0CA 2WHPB 5HZGA 1YB6A 4DMKA 1A8QA 1VKHA 2QXTA 2GBIA 4DTCA 2FUKA 4ZGBA 5LLSA 4U2FA 4G5XA 4ZREA 3G0DA 4H7DA 2PU7A 4NVRA 1W4LA 3IBTA 1BN6A 5JZ9A 4HTAA 3IB3A 1ZGCA 4L9AA 2QZPA 5AO9A 2J3QA 1XLVA 2ZVDA 1WB6A 5AM3A 3PICA 3IULA 5D3ZA 4ZXFA 2JF0A 2GYUA 3I2HA 4X90A 1QTRA 1SCKA 4QZVA 1Y7IA 3JWEA 3S8YA 5CT5A 3V48A 3FSGA 4X6UA 3QYJA 2QXUA 1QIFA 3ANTA 2LIPA 2DSNA 5I7UA 3P2MA 2QTBA 2H9YA 4BDSA 5ALGA 4CG2A 4Y2UA 1LBSA 4H18A 4UFOA 4WFKA 3W9UA 5A71A 2WFMA 2WFLB 3D7RA 3ILSA 1CV2A 3R40A 4X97A 2G5PA 1G4HA 4S0XA 3DOHA 1UKAA 2W6CX 1EI9A 5BWBA 2BCEA 3WIBA 1ACJA 3WK8A 3BJRA 4M0FA 4IQ4A 3WK5A 1CUEA 5DTIA 2RHWA 5CT6A 2C0PA 1UXOA 2CZQA 3HI4A 4CFSA 1KEZA 1XZKA 3FAKA 2EDCA 5A7FA 1XZLA 3FYTA 3M82A 5AK5A 3LIPA 3SK0A 3BE8A 3C6ZA 3GA7A 1CUUA 5HF9A 1XZEA 4KE8A 4N8DA 2CMFA 2OQIA 2PSJA 4TGLA 2J4FA 4UBIA 4OB8A 3EIOA 3IIIA 2JEYA 2ZYSA 3GUUA 4IH4A 5LP1A 4DNQA 3DS8A 3QZUA 4AMZA 2H7XA 5ESRA 2HU5A 4MWTA 3ZPXA 2WUGA 4LHEA 4LYEA 2Y1KA 1EDDA 1XKLA 1E8MA 1QIKA 2VJAA 2X76A 2H7YA 1HLGA 1IZ7A 1ZJ5A 4BAZA 1XZDA 3MUOA 1O6GA 2P8SA 5JAPA 1FFCA 3R3WA 1IUPA 2DR0A 1CUWA 1TIBA 3BDVA 3I2KA 3R3XA 1JU3A 3Q0TA 1VZ2A 4EY5A 4G4GA 2XMZA 3E3AA 5ALLA 3WLAA 5J3JA 5ALZA 1WHSA 5K3EA 5ALWA 1VZ3A 3WZLA 1DINA 5EIEA 1EVQA 1VXOA 4DMCA 1UKBA 4MYSA 4ZV7A 4RGYA 1R1DA 3TRDA 4BTVA 3O4GA 4Y2TA 4UBJA 5CTAA 2R8BA 4H77A 1BROA 3KSRA 4KJXA 1ZIXA 1ZOIA 4FLMA 3EQ8A 1C7JA 1WCYA 1OXMA 4DMFA 2DQYA 3CCCA 3D2CA 4ARAA 3KDAA 3VVMA 1S8OA 2VAVA 3I1IA 2HA7A 5IVKA 4V2IA 4BC0A 2XUGA 3EQ7A 1BEZA 3D5EA 1QIEA 2JGIA 1F0PA 3M83A 5JZSA 2O2IA 4GDMA 4IHAA 3B3QA 5C81A 5FDFA 2C58A 3LP5A 1P0QA 4AN0A 3H17A 4X71A 1CQZA 4PF1A 4B83A 2CUTA 2BKLA 2OQVA 2WJ3A 4WDQA 1ORVA 3RK4A 4OB6A 3FLBA 5FXMA 1QE3A 1TKRA 4J0GA 3RARA 2ZYHA 3AIOA 1B6GA 5LZ9A 2Z3ZA 2OCGA 2ZJ6A 2RIPA 1YCDA 2BJHA 4BE9A 3BL8A 3IUMA 2QOEA 5AP9A 2XUKA 2HIHA 1ACLA 3UUEA 6YASA 4EY4A 1CLEA 2XMRA 5JARA 1BS9A 4FKBA 1MU0A 2FJPA 2PVSA 5HK9A 2ZJFA 3I6MA 2WM2A 4OUKX 5F4ZA 2ECFA 4L72A 5IH7A 5AM5A 2GYVA 3QPDA 5C8XA 4Y9SA 4FWBA 1AZWA 2XQGA 4G1FA 1WHTA 1HQDA 5JASA 1ZD3A 2WIJA 2WHPA 4G4IA 1MX1A 1C4XA 4G8DA 3ESAA 1YB7A 4EY8A 3BF8A 3C70A 2XUFA 1P0PA 1GT6A 5KWIA 3VDXA 1H22A 2DQZA 4BDTA 3AIMA 5JATA 1ZD5A 2PSDA 1DX6A 2QVBA 3ZLTA 5DNVA 2G5TA 5AI5A 4UFNA 2RGUA 4HXEB 3DCNA 2WJ4A 3QBJA 1K8QA 1CVLA 1SCIA 4Z49A 2ORYA 3G9TA 2ACEA 4UUQA 2D5LA 3VISA 2XQFA 1IVYA 4KRXA 4DSAA 2PX6A 2VATA 4W9RA 4X92A 3STXA 2HA5A 1ZD4A 3IDAA 4X94A 5CH5A 4Q34A 4I19A 4F5ZA 1B41A 2WFLA 3FCXA 3VXKA 1TCCA 3DOIA 5AI4A 3U0VA 2RHTA 2QMQA 2XT0A 2HFKA 5CT8A 2DFPA 4J03A 5DYTA 1H2XA 4OD0A 4GECA 5EGNA 3C6YA 4B80A 1XQVA 1NU8A 4FTWA 5BWCA 3GBSA 4JYMA 5IVIA 2FJ0A 3TEJA 5HQ3B 1CUYA 3CXUA 4TPKA 5ALVA 5EFZA 4C87A 4FBLA 2JIDA 3C8DA 4FNGA 1DWPA 4E14A 4GW3A 4DNFA 1XZCA 4PSDA 4CCYB 2WQZA 1CUJA 2YH2A 2ZJ7A 4GI1A 1E8NA 2B9VA 2BUAA 1QTIA 2OCKA 3M3DA 1USWA 1XLUA 1TCAA 3RKSA 2XUIA 3V9AA 2CKMA 4Q82A 5E4TA 1QIJA 5ALHA 5C7YA 2C7BA 4HRYA 4KR0A 3R3VA 2QUAA 3K6KA 3PUHA 4KEAA 4K6HA 1A8UA 4QWMA 4B0PA 5AICA 4QDUA 2ZYIA 5CT9A 4C6HA 1GQRA 3JW8A 4K5QA 3E0XA 2DHCA 5K5EA 3C5VA 4RPCA 4X85A 4DMHA 3O9VA 5I9IA 4ZWNA 3KWJA 4LXIA 4GLBA 4WDRA 2XUJA 3T4UA 2I78A 2QR5A 5EI5A 4N8EA 3O95A 3AZOA 1W1IA 2YASA 3UUFA 4C01A 1W52X 3E4DA 1GKLA 3V1LA 3DYIA 3WL7A 1XRNA 3WA6A 1EHYA 3LLCA 1ZICA 3DNMA 4AXBA 2JGLA 5EHZA 4OSEA 4UPDA 4CCWA 4X6XA 1AGYA 3WZMA 4FLFA 5ALFA 2OGTA 2HU8A 5AOAA 3V1KA 1BRTA 3STVA 1XQWA 4AZ0A 4CG3A 5BV7A 4DGQA 5AKXA 1EH5A 2XI4A 1KU6A 3WQHA 3HXKA 2JGFA 3O4HA 5AKGA 4P08A 4BC1A 3V1NA 1DT3A 4Y2VA 4H7FA 1LPAB 3I2GA 1A88A 2ZYRA 3A2MA 3LCRA 1UK7A 1VLQA 2RONA 3DQZA 1DQZA 1N5MA 1FFAA 5ALKA 1FJ2A 4MJ3A 3HABA 1VXRA 5AK4A 1UZAA 5CBKA 3WL8A 1MX5A 4IO0A 4H7IA 1SFRA 3OC0A 3BF7A 2NW6A 4UHBA 4LYDA 2HADA 5E2IA 4OPMA 2XDWA 1F8UA 3HYSA 1CUCA 2Z5GA 4H7EA 4KRYA 1A7UA 1EA5A 1LPNA 3DL7A 1Y37A 4CG1A 1UOOA 1R50A 4WFIA 3FOBA 2HL6A 2OXEA 1XLWA 3FVRA 4Y2XA 5ALYA 3H2KA 3VJMA 4OYYA 3QH4A 5K3CA 4AB1A 2JGJA 2WUEA 5AIAA 5CXUA 1GGVA 1FFDA 4QWWA 3F97A 1ZI8A 2Y2UA 2BUCA 3ED1A 4BZZA 1JFRA 4H0CA 5HFAA 1EINA 1GPLA 1CFJA 1QONA 3K2IA 3WL6A 1Q84A 4J0JA 3HACA 3FBWA 1ZD2P 5ALEA 5A62A 5AH0A 2WUDA 3NOXA 4FLEA 5JAHA 1ORWA 3A70A 1U2EA 1AURA 3KXPA 5D3KA 4AQDA 3YASA 2XMQA 5AKEA 4J7AA 1DWQA 5DLPA 4DNPA 4U2BA 3QPCA 5HCUA 1PFQA 3ZLUA 1DX4A 4C4ZA 4NMWA 1WOMA 2WU4A 1Q0ZA 5H3HA 2DCMA 3H1BA 5CT4A 3DD5A 3CN7A 4BAGA 2RI6A 4DSZA 2GYWA 2XUOA 2OAEA 2OCIA 5HF8A 2IITA 2HA2A 2Z8XA 3L1IA 5C8ZA 4CIBA 5ALTA 4J3JA 4DNOA 4Q3OA 3C43A 2BUBA 3AFIA 2PBLA 2VTVA 4HRXA 5AI6A 4G8CA 1VE7A 3Q8WA 5LKAA 3DKKA 5ALPA 1MN6A 2VQ6A 5IVHA 1LPPA 2JEZA 5ALJA 3O4JA 4UBLA 1LLFA 2CBGA 5I8PA 3WK7A 1ISPA 4AO6A 4FFVA 4X93A 1XRQA 2OAGA 3F67A 5CW2A 3S2ZA 1R9NA 2CJPA 3WA7A 2J3DA 2JGEA 2AJ8A 5EHNA 3FLAA 1T4MA 3IUJA 3TJMA 5HKAA 3AJAA 1THGA 3W2TA 5LZ7A 4C88A 4N5IX 5HQ3A 1NX9A 5FPQA 4QDOA 4U2EA 1P0IA 4PNZA 3L1HA 2VT7A 2I3ZA 1XZBA 1ZJ4A 4PV7A 1QLWA 2AJDA 4CCYA 4PO3X 4CI9A 2XMBA 3EBLA 2QS9A 1XZAA 2ES4A 3F96A 5AOCA 1EXWA 1CUFA 5ISMA 5ALDA 2PSEA 1JJIA 1N8SA 4BP9A 4UBMA 2VF2A 2PM8A 3AUKA 5D7BA 3FVTA 5ALUA 3R3YA 4W1SA 4ITVA 4KACA 4X6YA 3AINA 3E1GA 3R0VA 1ZGBA 1HKHA 2RAUA 4GEGA 4BAUA 2ACKA 1WPRA 1XRRA 1R88A 4Y2RA 4M0EA 1U4NA 3QITA 1WM1A 3A2NA 2O7VA 5A2GA 4WY5A 3STUA 4FNMA 3SC2A 3LS2A 2VSQA 1FFEA 2QUBA 3ZI7A 4AMYA 3D59A 4WCVA 5AKJA 4BCBA 2HRQA 2WLSA 4ZI5A 1XZFA 5C8VA 4PW0A 2XMDA 5CH8A 5HK8A 2WJ6A 1MNQA 4B9EA 1QIIA 3NGMA 5JANA 1P0MA 3WL5A 4G9EA 1EB8A 5CURA 3O4IA 1M33A 2ROQA 4J0CA 2ZSHA 1BCRA 4LXHA 5AM1A 1XRLA 3G0GA 4AX4A 3B12A 3F9CA 4H7KA 4J0HA 4FDMA 2OG1A 1BEEA 1QZ3A 3MVEA 5T4EA 1XZIA 4B81A 3WYNA 1YS1X 3ESBA 1H2ZA 3PF9A 5YASA 1TQHA 5AKYA 3ZV7A 5AK6A 3D4LA 4JUIA 1K4YA 2Z3WA 4E11A 1OILA 3R3ZA 3WWOA 2AJLI 2X5XA 2Z8ZA 4FMPA 1ODCA 3DDUA 5SYMA 1J1IA 2XMCA 4HS9A 3I2IA 5ALXA 2B61A 3C5WP 4GXNA 1R3DA 1LNSA 4UBOA 4U2GA 4H7HA 3VJLA 4KYVA 4Y2YA 1N5RA 1MAHA 3IUNA 3ICWA 4EB0A 4FBMA 3WKCA 3WMRA 2O2GA 5ALMA 4BP8A 3F8SA 3I28A 1FFBA 4X3CA 3GELA 1CQWA 5EHXA 2DHDA 3OPMA 4INZA 2JGKA 2GZSA 5HF5A 4W1QA 4G8BA 3IURA 1WPXA 5HF6A 5ALNA 1GPKA 1THTA 3STTA 5JADA 3ESCA 1LZLA 3BIXA 2Y6VA 3N0TA 1FSSA 4EBBA 5D6OA 4EA6A 5CXXA 2HA3A 3WWEA 3H04A 3HRHA 1XRMA 2HRRA 1QFMA 3FLEA 3W9BA 5K3FB 4A5SA 1MPXA 4LXGA 3FYUB 4KE6A 2Y2VA 1BE0A 3H2IA 4UHEA 4FFWA 1U65A 1H23A 2C0QA 4YASA 4Q1VA 3GROA 4X7BA 1EDBA 4XWGA 1YS2X 4I4CA 3V1MA 1XFDA 4NS4A 3WKAA 1ODTC 4U2DA 4MYDA 2Y6UA 3N2ZB 4BVLA 1H2YA 1DWOA 3WK9A 3VVLA 5LYYA 1E5TA 3STWA 4BTLA 3QMVA 1YA8A 5FKJA 1CUVA 1HPLA 1EDEA 2BGRA 3UMJA 3WK4A 1HBJA 2YXPX 2X8BA 2YYSA 3X3HA 4XVCA 1XQYA 2PKYX 4X95A 3C8HA 1VA5A 4X00A 1UK9A 3A6ZA 2JGMA 4Q05A 3ZLVA 4W1RA 4BRZA 1TRHA 4O08A 1F0NA 1X2EA 2C4HA 3R41A 4QLOA 4MXDA 1PJAA 4UBNA 5LZ8A 2XUPA 2XLCA 3L1JA 4M0MA 3OURA 3OM8A 2WKWA 3PUIA 1JJBA 5CMLA 4QDZA 1QFSA 3M81A 4OB7A 3D2BA 2O7RA 1SCQA 4K6KA 4UFPA 4ETWA 1E3QA 1A8SA 4WJLA 1MO2A 2QJRA 5JYCA 3QPAA 1CRLA 1Y7HA 2BAGA 2CEKA 3WWDA 4EY7A 5LIPA 3EF3A 4EZIA 4B6GA 3PDCA 3D3NA 1Q0RA 3D0KA 2H1IA 2IIVA 3G9XA 2XMGA 3I2JA 2ZSIA 4BBZA 3AZQA 2XB6A 4B84A 1AX9A 2WFZA 4H35A 5KWJA 3VKFA 2WIKA 5AKLA 1CUGA 2V9ZA 1QO7A 1YR2A 3QVMA 5HFNA 3BJMA 5T4HA 1YSCA 1QGED 4G9GA 2PU5A 1BCSA 3RLIA 5FLKA 5ALIA 4JNCA 5AI8A 2ONCA 5HKBA 1EK2A 1XKTA 4DYHA 5LZ2A 1JKMA 4A23A 3PFCA 4MWSA 5ALSA 2WIFA 4G4JA 3H2GA 4RE5A 1QOZA 3ESDA 1YA4A 1CIJA 3C6XA 3DL4A 4DIUA 2QT9A 3OG9A 2WTMA 2VJBA 5CRIA 5FOQA 4Y2QA 3NWOA 1LZKA 3NUZA 5FRDA 2Q0XA 2BFNA 2PSHA 1CUIA 4K6GA 4DLNA 4PSCA 2CB9A 4QNNA 1MJ5A 1LPBB 3HC7A 4MQMA 1ODSA 3HSSA 4EHBA 4EY6A 5E4JA 3KD2A 3VJKA 1E8DA 2GBGA 1UWCA 1MTZA 1R4ZA 1XZJA 5AKKA 1J06A 5EIHA 4BZWA 1AQLA 5CH3A 2PUHA 1O6FA 3O0DA 1LPSA 3SWWA 3WIOA 1JJFA 2V97A 4OYLA 5AKHA 5AIBA 4UHHA 2OGSA 2OCLA 4F21A 3W04A 5AM0A 1XZGA 3C6BA 4OCZA 4MEAA 2HDWA 1IZ8A 4OU4A 5AI0A 4Q3KA 5AM4A 1XROA 2XUAA 5AI9A 3LIIA 1ZI6A 4BVJA 3H2JA 1TCBA 1HDEA 1LPOA 5ALQA 1CUHA 4UBKA 2HU7A 4AZ3A 4B82A 4NZZA 3OTQA 3C45A 4U2CA 2QRUA 3PE6A 1RWQA 4JH0A 2GBFA 3IVMA 1LGYA 1WB5A 4AO8A 4EUSA 1XQXA 2XMSA 1UT6A 1X70A 3T52A 3W05A 2V98A 3SX4A 5JD5A 2V96A 2HA6A 2OLEA 1I6WA 2I3DA 3BIWA 1EVEA 1SOMA 2WU3A 4QE3A 3OOSA 5K3FA 4XIIA 4C89A 3JYHA 1G5FA 4C4YA 5A6VA 5FUMA 3FYUA 1RP1A 5IVDA 4BB0A 1RYYA 4BE4A 2AXEA 2H7CA 7YASA 1DQYA 1GZ7A 3I6ZA 2XUDA 1YASA 5SYNA 2PL5A 4XX1A 1CEXA 2VA9A 2O2HA 4GHWA 5DNUA 1MX9A 1CUDA 3HZOA 3G9ZA 3K9BA 4KAAA 1W6RA 4FHZA 3FCYA 2J4CA 1QIMA 2XUHA 2PSFA 1EX9A 2WIGA 2XQKA 5AJHA 5K3DA 2QJWA 3IUQA 5A7GA 5AM2A 1MNAA 1JMYA 1VJ5A 2HFJA 1LBTA 5DYWA 4KAJA 4P93A 3HEAA 1UKCA 1BN7A 2OPHA 5BOVA 4J0KA 3ICVA 3FYUC 1UFOA 3CCBA 5EIAA 3RM3A 3TGLA 1JI3A 4GWLA 3GFFA 1AC5A 1GXSA 2IX9A 2C5GA 4HXFB 3AZPA 1QJ4A 3DKRA 2VAXA 4OU5A 3KWFA 4H7JA 3CN9A 3DLTA 1CUZA 1L7RA 2UZ0A 5DWDA 2XQJA 1J07A 1TAHA 5LZ4A 1TK3A 2HHAA 2WG2A 4IH9A 2HA0A 4KE9A 1C7IA 4K2AA 5K3BA 1Q83A 3I6YA 2WUFA 5AHXA 3ZWQA 1ZI9A 4F60A 3F98A 1CR6A 1JT2A 1MT3A 1VA4A 3WWPA 1MAAA 3G9UA 4YX9A 1GQSA 1NU6A 1J2EA 3G8YA 1KU0A 1UK8A 4ZV9A 1WB4A 2OGZA 4Y2JA 3GZJA 4RNCA 1N1MA 5ALOA 5JAOA 5JD4A 3QMMA 5K3AA 4D9JA 3H18A 3H0CA 2WG0A 3PFBA 3D2AA 1AKNA 3AIKA 3WKEA 2HA4A 3HLKA 4I3FA 4WFJA 1EK1A 2VT6A 5T4FA 4BRSA 2B4KA 5JAUA 5E4YA 4RE6A 1W76A 4Y2SA 1DTEA 2AJCA 3MUNA 1CUSA 4P9NA 1VE6A 3H1AA 4TVKA
chains in the Genus database with same CATH superfamily
1SA0B 1FDIA 4K9SA 4PSUA 4BJ1A 5KYTA 4LZOA 1AMNA 2FEMA 2BMJA 4OJMX 5ELLA 4IDFA 2IWRA 1IXRC 1KEWA 3RANA 5LYJF 4B6EA 4D8VA 5ER6A 3B5EA 3AKEA 3I05A 3TKLA 5LIRA 1VPVA 2ONZA 1FMJA 3I53A 3QM1A 3UAWA 4AY5A 5AW5A 4DWJA 3MWJA 1PZGA 2ZIWB 2X40A 1N2IA 2W2KA 1CJKC 3AV3A 3PT5A 3RRNA 1RQXA 1I2ZA 3CU5A 1I5RA 1R4AA 1JU4A 4MX8A 4C7BA 5AOBA 2KHZA 2QD2A 1A7AA 3WV5A 2Y4NA 3R3UA 3UJ3X 2WHQA 3N8HA 2HF8A 3IPYA 3OA2A 4JLSA 2P5UA 4LGVA 3DWGA 1JHQA 3GMTA 1D03A 3SE0A 5K0NA 4CEIB 4ZV4A 1UOPA 3HJRA 4LGMA 4MQLA 3GI1A 3GJRA 3HXPA 1YBVA 3AEXA 3K6SB 2HPZA 3L1KA 1E89A 1T9HA 1P0FA 1TZKA 1ZAKA 2GEFA 2VWGA 3MT7A 3QSGA 3UG6A 2XGJA 2HSGA 4IXNA 2O07A 4MQUA 2V7WA 2GX6A 5LNK1 3WKDA 5L53A 3AKZA 1UFRA 2P90A 4NBRA 3F90A 4YIKA 1P80A 2WYHA 1EJ2A 2BGLA 1BU8A 4MKFA 3LYAA 4KR2A 3MRSA 3A11A 2XVMA 4QA9A 5EIXA 2D0DA 4IFTA 3IT3A 4FYXA 3KETA 1WVIA 1E1CB 2UYGA 2GUWA 2WJAA 3AM5A 3OLCX 3FTQA 5BSTA 3NDBB 4AU1A 3W1EA 1WXQA 2XYVA 1I80A 3PF8A 5KQGA 2CVZA 1E4EB 3ZKAA 4XPIA 5AJTA 1NQVA 3EVEA 1QH0A 2R11A 4L3WA 5DI9A 3ACCA 3FTCA 2IU0A 8ADHA 3PWZA 3EG9B 1DAGA 1I3NA 4WERA 2R1UA 5H5JA 3B2NA 3ZKWB 1UFKA 5KNBA 3KUCA 1L7QA 4EKDA 2B7LA 1L7NA 2YBDA 3RFVA 3X1ZA 1I10A 2OMKA 1F17A 3IUSA 2VJPA 4JXZA 1GUZA 3TWOA 1ESCA 1XX6A 3D4NA 4LX0A 3K16A 5CPBA 1W1WA 1W30A 4REOA 2O2SA 3BRQA 4O4IF 3KSAC 1AHHA 2EATA 4KITB 4MDFA 3QWHA 4WT7A 4X91A 1BE1A 3WI7A 1HFWA 1U8AA 1W85B 1X7YA 3CX8A 4XQ9A 5AHRA 2IYPA 3K8YA 4BB5A 4XDHA 4UHFA 2GLXA 4H31A 5ULLA 1U0EA 1XL1A 2IDZA 3DDHA 2GZ1A 5FPPA 4ZDIA 4LSZA 2XECA 2HSZA 1QO9A 1J2YA 1XN4A 3UAXA 1BXGA 3SP1A 5EMLA 4QLBA 2LP4Y 1QAOA 3IEXA 4KAFA 3VYTB 5HQJA 4U9IS 2DMRA 5EZ5A 3ROMA 4AUEA 5CXQA 2QX8A 1XTZA 5IRCD 1U28A 3OCZA 2N9UA 4V2UA 1CJVC 5A02A 1BHJA 1XRPA 1NJSA 5KSPA 4ZIRA 1JN0A 4C6SA 4D9EA 4IYJA 3VFDA 2F1RA 2RCNA 4MHTA 1Y63A 1YI0A 2XDAA 2C3OA 4LDZA 3HZZA 4L0DA 1E7SA 3PFNA 5ENVA 3U3MA 1SUCA 3I9MA 4X1KB 4LBWA 4RF2A 3E27A 2Q6KA 2X8LA 5HA5A 1ZH4A 1XPOA 1NVGA 1X38A 5LUBA 2H0RA 2F17A 1O5OA 2A9JA 3ZC3A 1KVSA 5UKDA 4BBAA 1TCUA 4Z8YA 3U9TA 4RSRA 3GWZA 2FWNA 5T7BA 1DU4A 3KKZA 4GIBA 3PI6A 4KO2S 4QEDA 3IV6A 4OHRA 2WG1A 4BMCA 5ALRA 3CLUC 3N1UA 1GRRA 2X2PA 5BXYA 3GLGB 2PUWA 2JJQA 4Z0TA 4F5WA 2G5GX 3BDIA 4NCIA 1QIDA 2HSEA 4B8WA 2VCHA 3MGBA 4YQZA 3PHIA 3GAFA 1FFSA 5JJKA 4C06A 4MINA 2OB2A 3MPOA 1DMRA 2HXGA 1EB9A 2PRYA 4GX1A 1E3SA 2DBVO 1B42A 1R18A 3O7WA 1SC9A 1P4JA 2C7VA 2W2MA 3RVSA 3KS9A 5FTLA 2CE7A 2VAPA 1OI7A 4M86A 4BX9A 4JBWA 4AP6A 1NN0A 4M55A 1KZ7B 2VJCA 2P3OA 1XZHA 2RK6A 4EW3A 2GS9A 2VT3A 3N7UA 4DXDA 3DEAA 3RRZA 3SLGA 1PD0A 2B2NA 3KB1A 5KTNA 3EEIA 1XMIA 3UBTA 1ML4A 3WNZA 3KX2A 1SHTX 3FNBA 5C32A 2W0MA 3JQ7B 3KVOA 1HTWA 3OFND 3QXCA 5LDGA 2OFOA 4LKOA 3DAHA 2VHVA 2X0JA 4MEBA 5ICGA 4HGNA 1Z0UA 4XFJA 1KR5A 4QKQA 1VB3A 3FKJA 5DO9A 3WYFA 3HB4X 3K94A 1X42A 2LE0A 2Q2WA 2W8BA 3UJBA 3LNTA 3NLLA 3D5QA 4R98A 4ZU6X 2P9FA 1G8HA 1E9AA 4DNXA 1DKNA 5HJEA 1HLDA 5EQDA 3OPYA 2IXAA 2REQB 4BNUA 1ZVKA 1T29A 4N9WA 4RVNA 4JC8A 2FSFA 2RKWA 2WIDA 1ZJZA 1G2QA 1UFVA 3SYLA 4D4GA 2EEPA 5AKZA 2B6HA 1ONBA 4MV8A 2AHOA 4LJLA 4RQUA 1SN7A 2I9PA 4RZIA 1TC1A 1A5SB 1VHQA 2HMVA 3EQ6A 3O3CA 4O33A 4JYPA 3BWXA 1A7JA 5D8DA 4JLNA 2EP5A 3K8QA 2H1RA 3E7FA 1KAQA 1XYVA 2GOYA 4QXPA 4EUFA 1C1DB 4H1HA 2DHEA 5KREA 3WGOA 1V4NA 4CT4B 4YUZA 3EXHC 4I6GA 1QHIA 1OBFO 2NTVA 2XXAB 2NACA 5JS8A 3QE4A 1D5CA 4IWXA 2YBEA 1MKYA 3FZGA 4LG1A 2ZRDA 2JS7A 4JXJA 4KDFA 4WE3A 5LQMA 4LDPA 4AX8A 4RA9A 2HREA 3CO0S 1X2BA 4WZ6A 2PEYA 3PL5A 5A6SA 2ETVA 2MINB 3BKWA 4W9NA 2W22A 1CS0A 4H7PA 1KL7A 3E22B 3QE9Y 1B14A 3MCVA 5FUXA 3SBDA 2BSAA 1O7JA 1BGWA 2RGBA 4JX9A 2GARA 2Q3CA 1H2WA 2GCEA 4GFDA 4NBKA 2GZHA 5EE9A 3D7MA 4M0KA 5EZSA 4BCCA 4LMAA 3EW9A 4MPJA 1TAQA 2ATXA 1SBCA 3D8RA 3P9NA 5CCBA 5ICSA 4TSFD 2FEOA 4OHVA 4L16A 1RAHA 3KE9A 4LSMA 4CIAA 4OX9B 3GJ3A 2JLWA 5CEJA 3PC4A 4XTRA 1IUKA 2E0IA 3JRXA 3GD7A 1PCXA 2K2QB 3OBBA 4Z4EA 2KPOA 1XCPA 1CJMA 5AKIA 4N1AA 1U9YA 3AKDA 5FFNA 4B6QA 1KZGB 4JB2A 5DNWA 3VO1A 1I13A 4II2A 3Q9LA 1ZIYA 4NPCA 4PZ9A 4HDAA 5JJLA 3BD7A 3GJYA 2FZVA 3QVOA 2WYWA 2ZTSA 3TKAA 3DDWA 4I4NA 1ZWLA 2PH5A 4J1TA 3QWBA 4L50A 3WNVA 4CMEA 1JIJA 3RYFB 4QL3A 4MWEA 4KO1S 1TMKA 2JVKA 2Q3JA 3NTRA 5AJZA 3IIMA 3KOOA 4LE2A 1X3LA 4GMHA 2ONYA 3P0FA 4LTNA 1G20E 1GSHA 2F90A 3KFLA 1C4KA 3U16A 1Q77A 5EHQA 2FOIA 5GWXA 5A9SA 2ECKA 3OZAA 3WJ1A 2R2AA 1Z6YA 2FX5A 3T3PB 2IXTA 3BXPA 4JLDA 4QDKA 1VG0B 1YB6A 2C2MA 2OBLA 3OIFA 5HZGA 1YOVA 1JB1A 1S2LA 1VKHA 2QTWB 2WEKA 3P4XA 5DI3B 3ZY5A 4BV3A 4ZI7A 5IZ4A 3WAKA 2JLQA 2GXQA 1QAMA 4HNHA 3TUIC 4ZGBA 5BRAA 1FFYA 2CCGA 2DWOA 4GSLA 3KFXA 3Q2OA 3L0PA 4IQ0A 4NX2A 4Y8VA 5DLQC 5A9TA 3VDNB 1DBQA 5BV0A 1FSGA 4B4VA 1VDZA 5F3WB 1T5LA 5DN6D 1K8XB 2PFSA 2CV1A 3NKVA 3ICQB 2VOJA 2G6TA 1KSJA 2QK4A 1W4LA 1I4WA 4PQGA 3WLOA 1BN6A 5DGTA 4CRWB 4E7PA 1WOYA 5B3AA 1CR1A 3EXEB 4QHTA 1G17A 4TWRA 2IPOA 1A76A 3LRPA 4NH4A 5BVGB 3DZGA 1TF7A 4MS3A 4YDQA 4DAOA 4ZEWA 1VE9A 5AR1A 3K6JA 1JAYA 3B3GA 5FTKA 5J5VA 4CM7A 4UXJA 2O8CA 2J0EA 2CNNA 4PYNA 1W29A 4D41A 1OZAA 4IS3A 1NQOA 3SBXA 3AMVA 1XU4A 1BFDA 1DXOA 2X6TA 4IKPA 4ZXFA 1KQNA 2GPTA 4WY2A 4E2WA 4FYKA 4YJDA 4WN9B 3UMSA 1L7OA 5C80A 1KIAA 3DBRB 5AVJA 4B3XA 1NV8A 4X90A 1G7RA 1Z4JA 2O0JA 3T7CA 3QYFA 2C5AA 3TRIA 3L8ZA 3J7AC 1QWOA 2E4XA 1GG5A 5CIWA 1VLVA 4YCMA 2Y8EA 1T24A 4QZVA 2F6RA 2COEA 5BNFA 2ZI5A 4WZZA 2OECA 2RGAA 3QUTA 4X6UA 2P6PA 2XTAA 5TMEA 3ZY6A 3TNLA 1OBVA 2YHAA 3PHJA 1BMFD 2FZLA 2BW0A 1NI3A 4JKIA 4OSOA 1RRMA 1RCFA 3P2MA 2A5FA 2QTBA 1RJ9A 2V0CA 2WAXA 3IJ5A 2Q5LA 1NOKA 4RM3A 4U39A 3M6WA 4BFZA 4DUZB 1E2BA 3HK2A 1CEYA 2AQ8A 4ME6A 3IKLA 2E89A 5JISA 1DO0A 3KQTA 1VRVA 5A71A 4EVRA 4P5PA 2WFMA 1RYZA 1TKBA 1Z6GA 2CXPA 2WC1A 3EBPA 2PZAA 2FFJA 3W6PA 4KLCA 4PAGA 3I9LA 2AD5A 4IEIA 1MRSA 2H1FA 5BUQA 2GHTA 3T3NA 3BSSA 3ET4A 3AF4A 4X97A 1VL2A 4GMKA 5HDQA 1KRWA 5AVRA 5CDTA 3NXKA 4HDKA 4S0XA 2JIZD 3RIEA 4TLLB 1WKVA 5CNMA 3OY2A 4NXNB 2HQSA 4Q4DA 4RO0A 2A3NA 4M9UA 4EGFA 1EI9A 2P2YA 3V4PB 1ZQ1A 1ZJ6A 4J0QA 4JYCA 4ZQFA 3OCWA 5CFZA 2NZYA 1CY4A 3A9UA 3VKVA 3BJRA 1SA0A 3OT1B 3NAZA 4OJKA 1IRIA 3PX2A 4PLWA 1QHHB 4Y1EA 1I4DD 4LYYA 1V39A 3AG6A 2HQBA 2XUZA 3ADOA 5T3YA 5K0ZA 5GADl 3EWNA 5CT6A 5KQLA 3AW9A 3V1TC 4YAOA 1CY8A 1ZNWA 2Y99A 1MC1A 4CFSA 5KPJA 5JI3E 1KYZA 1JQJC 2HT1A 3FAKA 3FWPA 1DIBA 3PKIA 2I54A 5ADVA 4KW7A 3P9PA 4N18A 1T2DA 3RAGA 4BO0A 2GWRA 4IXWA 4NMMA 4FE3A 2ASEA 1G8PA 1TAUA 1XZLA 3PC2A 1F6DA 3JQDA 3LQRA 3JRNA 4P7FA 4KO8A 1OPXA 2ADFA 4LF4B 3VA7A 4CEIA 4KSCA 1Y9DA 4G8JA 2ZUTA 1XPUA 5A0VA 3MRXA 3SK0A 1I3OA 3BK1A 1GRCA 2MYPA 2ZYTX 3K6SA 3DFZA 2XRFA 1IXYA 4N8DA 4D3FA 5B2EA 3FPCA 2IEZA 2PS3A 3E48A 4KYUA 2Q5IA 2BTEA 5F3RA 3QG1A 3OQHA 1GZVA 3LUFA 4F8YA 2QUJA 3KB6A 4PLTA 3S8MA 1UEJA 4AF6A 2C4VA 4Z4GA 1JE1A 5REQB 1E1CA 1R5OA 3IVAA 4JVOA 4YRKA 4OO3A 2PQ0A 1POWA 3QLTA 1NP3A 2QLNA 1WL8A 2EKQA 1T9GR 2GZDA 2HCJB 2YMMA 1C3XA 3EIOA 4FW8A 5HX7A 1E4EA 3D6AA 5DCYA 1XNGA 5DN9A 3S27A 5HMMA 3QZUA 4ND8A 2HCRA 1Q0SA 3I0ZA 1G6HA 4FHFA 3EG9A 2CSXA 1Z4NA 3QI2A 1J21A 3LL7A 3SYNA 3RFCA 3HV2A 3ZKWA 4LHEA 2Y77A 3TIVA 3H0EA 1QPBA 2H65A 1D09A 1KOFA 1P33A 2NO1A 1KS9A 2Y1KA 5MDHA 3TM5A 1E8MA 4FCWA 4GR5A 5E6SB 5A5EA 2VJAA 1WW3A 5JCZA 2WWYA 1NOJA 2X1HA 3DOOA 2QTRA 4RVSA 4RY8A 4JBYA 1VGQA 3MUOA 3GFGA 2P8SA 2ZBUA 3IP1A 4MHSA 6AT1A 1BXRB 3R3HA 3TL2A 4ARZB 5A5GA 5AQ1A 1W85A 4NABA 1HTBA 1UDRA 5DN6A 1M6VB 4GX5A 4PZPA 1EZZA 2B99A 5EEGA 2ZPUA 4I1IA 2PRZA 3LPMA 3M4NA 2X15A 3QFTA 1D6JA 5EHGA 2IXBA 1TFUA 1U2ZA 1QO0D 4NK4A 5LMNB 1VCIA 2NGRA 3BDVA 3QWFA 5FT9A 2WPDD 4RTJA 2H2IA 2Y92A 3I2KA 5I7SA 2Z2YA 3ZW8A 4WNYA 3RVPA 1MG0A 4FR0A 4TV8B 3MGGA 4J9VA 5GY7A 4C0HA 1D0SA 2XWJI 1V3VA 3TNJA 1AF7A 4UHJA 4EB3A 4G4GA 3TR0A 1ISMA 3KEFA 3H2ZA 4HDMB 4X3PA 4YP6A 1P44A 3UPUA 3WLAA 1DAFA 1J9EA 3PL1A 3V7UA 1P6XA 2YW9A 5J3JA 5M04A 1LTQA 5F1YA 4X1KA 1BH2A 1YE3A 4TOIA 4X24A 3EAFA 4YJ3B 1WHSA 3WJ7A 5HDBB 1ZLYA 3M34A 1PTJC 5K3EA 1VZ3A 3G82C 2FPRA 2ORWA 4Q9LA 3VX3A 1DINA 3W2IA 2HPAA 4MO9A 4OQNA 2OXIA 4EVIA 1BMFA 1N9ZA 5EIEA 3IKMB 1SBIA 5BSHA 1R0LA 2OV4A 3MJFA 2F43B 2O06A 3HH8A 3NBAA 4HNQA 4UQOA 5IDYA 1N5KA 2I1QA 3CR3C 4YRAA 3GLGA 1CRZA 2ZKLA 3FMOB 1HDCA 1NPTO 4LN1A 3P27A 4JJ8A 4YJ2B 1E2PA 4HDNB 3PVZA 4C03A 2LDBA 5IAJA 1G9XA 1IY0A 1QV9A 4MIOA 1T4CB 1KI4A 1V8BA 4NKRA 4U8HA 1X8XA 4Q47A 1WIWA 2WRZA 3C0KA 1WABA 5CTAA 3A0RB 4NJOA 1BROA 1QE0A 2VYND 1S2GA 4PTLA 4P3KA 4YV1A 1MRNA 4OHZA 2IHJA 3BMQB 1L5WA 1P72A 4R1MA 4E4YA 1PFUA 3SI7A 1HE5A 2JIZA 2V6GA 1W46A 2X42A 2NOAA 1NOIA 3N0RA 4TTJA 4TS4A 5G0WA 4AZ0B 4B4OA 1V7ZA 2IHKA 4V02A 2ZTLA 4LJ9A 5E1OA 1W9HA 1COWD 3D2CA 1E9EA 4BPRA 1N2CB 1O0BA 4DHEA 1OWLA 1MF7A 2X6RA 2ZK7A 1HDIA 3JQ7A 2FHPA 2J8ZA 4K03A 1CIPA 2XB8A 5MN4A 2G08A 2ZSUA 1QGZA 3EQ7A 3M5PA 2Q1XA 4PBTA 5EXPA 2KLBA 1PR4A 1SVMA 1W5AA 2CE2X 2PBFA 3NYWA 3KAQA 2BTOA 4E21A 3IUBA 4R0MA 2QGNA 1O0CA 2ZXFA 1FTQA 3C7AA 4PC1A 1LCIA 1SZJG 4GDMA 2ERXA 3ITNA 4IHAA 2XBLA 2JDID 4AICA 4OLBA 1JR6A 1QXSA 2BFCB 2WJYA 3C7TA 5IULC 4F6LA 4KR7A 1N7JA 2YYYA 2REQA 5HZKA 2VSXA 4AJOA 5K6TA 4K6OA 1GZUA 7MDHA 5EZYF 1SK9A 1MAWA 4S3MA 3W9SA 4B83A 1Z7EA 1DBIA 1LH0A 3QYPA 1EQAA 2QPTA 3GB9A 3I42A 2BKLA 4PLHA 2TECE 3FPKA 1CVIA 1JIKA 3SF8A 1PV2A 2GN9A 3WGZA 4D99A 4P33A 1BE8A 3N3AC 2Q7OE 1XDGA 1XP5A 2D1QA 5C7LO 1C1DA 1TC2A 1IPHA 4NZ9A 1M76A 4Q1CA 3FLBA 2UKDA 4WPGA 2P9CA 3ME5A 4RK4A 5AW1A 4JT9A 2ANCA 1CE8B 3B8HA 3OM1A 1QORA 2XXAA 3H5OA 2IUTA 4BKQA 2DFKB 1U7HA 1ZOOA 2Y1OA 3ITDA 3ZDAA 1NJ2A 3HYTA 4DQXA 5TDHA 2PO7A 4FDVA 5ADUS 2XBUA 2GA8A 1B26A 3H97A 2MINA 3IO3A 3VPXA 3BXXA 3EY9A 4BE9A 3P2OA 2ZS9A 1U8ZA 3EGOA 3VR5D 2X9NA 3E22A 3W1VA 5BP7A 1RKXA 3H75A 2PBZA 3GP3A 3B48A 3MOIA 2OBNA 5HCNA 3C85A 2QOEA 2ARKA 1G3IA 2PX2A 3CSDA 3L7JA 4YBRA 2G67A 3L84A 3PEWA 2DFDA 5EMJA 4V0OA 5FWNA 1KO7A 2Q3DA 1CLEA 4JLKA 2GERA 4R6WA 4UQPA 1TYDE 5B4TA 1ST2A 4U63A 5J47A 1PZEA 2PRSA 3KZNA 4C0JA 4UKDA 1SIOA 621PA 4O2BB 3EPLA 2VRNA 4JZKA 1U02A 3ZI0A 5HK9A 2JZNA 4YP9A 1P6QA 1YZUA 3A28A 3IT0A 2ECOA 2ZROA 4D5GA 2PL1A 5ICMA 2I6QA 2ZJFA 4UVIA 3PR1A 2X19A 5B1HA 1Y4SA 3A1CA 3TO5A 5DF1A 1FTSA 1KEEB 1NC1A 2ECFA 2WSSD 1OFUX 2M9MA 3OT5A 4K0RA 4O1IA 3REGA 1P3DA 2AFIE 4B87A 4C4SA 3IA7A 5AFSA 1DC3A 4GPEA 2ANBA 5IH7A 2IS2A 1VG8A 4Y6SA 1Z2EA 3RSHA 1JXMA 5AM5A 4CM1A 1FB5A 5EKXA 2GYVA 1QO0A 4WOBA 2H8KA 3RYFA 1MXFA 2TMKA 1M0EA 2WPDA 3Q40A 4RXUA 3FCAA 3V32A 2BBSA 4FWBA 3DFKA 1ZG3A 3UJ7A 4G1FA 1O97D 3DBVO 1TT7A 4QUKA 4AZSA 2BDTA 1HQDA 3LZCA 4NCKA 3WS7A 5JASA 3IKJA 3FSJX 5LYJB 4EGCB 4LZAA 2OBMA 1PGQA 4QGFA 4RK0A 5DI3A 3ESAA 2R7AA 3KZXA 4HQFA 5CFQA 4MKXA 4GUAA 4DV0B 5FEUA 4KR6A 2OV1A 2JFHA 4OQYA 4EY8A 1I9GA 1KDRA 2CV2A 2W71A 4FUTA 4LY6A 3K73O 4GR9A 4Q3DA 1H0KA 4V0MA 1WF3A 4JBHA 1Y7TA 1JPUA 3MHPA 3H5AA 3HR7A 3TD9A 1GT6A 2HYIC 1NJGA 3BTUA 3Q2KA 4L8GA 3VDXA 4G5GA 1YJXA 2YHUA 3AIMA 3AVOA 4UW9A 4BDTA 1CRPA 1DX6A 3VM6A 2D13A 2C4WA 2L17A 3EVAA 1Z6ZA 3DUFB 4GICA 2X41A 3EXEA 2QVBA 2UAGA 4WLOA 5F98A 3PQ8A 5LJLA 1JA9A 1GL7A 3NIDB 4UE3S 5BVGA 4N48A 3MWLA 4U0JA 5DNVA 3SXPA 2OK8A 3P97A 4MK4A 2K87A 2O1XA 4MMYB 1MX3A 3LOUA 5F9HA 4LJAA 4EKIA 3PITA 2INGX 1XJ5A 2J5BA 5AI5A 3ULKA 1NIJA 2B35A 5BY2A 4NF2A 2CHFA 1E7QA 2PT9A 1AQNA 4WN9A 1M6NA 2WJ4A 2ZU0C 3Q5DA 2VPPA 4LXQA 1Y48E 4HGQA 2B69A 5FD8A 1QQTA 1YD7A 1AIPA 1K8QA 1K68A 1C1YA 1KKLA 1NLZA 1T8WA 2WP0A 3EVFA 2C7QA 3GFRA 2Q2OA 4OA8A 2V1XA 4Z49A 4CKWB 3N87A 1YRQA 1TB4A 2ACEA 3BRCA 4JR1A 5J9FA 3DZKA 1W4AA 1WRBA 2ONKA 3SBOA 5A4KA 3PTAA 4UUQA 1U8YA 5FBRB 1CF4A 4YJGB 2XQFA 1PNVA 4QASA 4XYGA 1OIXA 3KSMA 5A1TA 4R2KA 1H4QA 2PX6A 2DPXA 3ZWMA 4BMNA 3TF5A 3QX8A 2ZAIA 3BGDA 1LJUA 5NLLA 4QBTA 3GW8A 1CP3A 4NY1A 1PX0A 4ZVMA 4LBYA 2HA5A 1QF9A 3PHBE 1P1BA 4MGHA 1YBFA 3IVCA 4Q34A 2JDIA 1Q1QA 4X1OA 2AG8A 2PMWB 4Q0MA 2ZAOA 3VXKA 2DOKA 2CLSA 2W2XA 1UF9A 1TOAA 4KG7A 3R75A 3RS9A 4MUJA 5B4VA 1OY1A 1V4VA 1KYIA 3ZGNA 3FD8A 1GHTA 4HF7A 2V4UA 3RRXA 2CJXA 4GPD1 4N65A 3M33A 1G64A 1O8CA 1JEJA 1NN1A 3IL2A 2QRJA 2CVOA 3L6UA 1H2XA 2IEDA 4AZWA 5IK2D 1DAKA 1Z3CA 5HIAA 5IS2A 3IEKA 4GNKA 4XM2A 1G16A 1X87A 2FMKA 2IP1A 4TWJA 4ZJZA 3A9CA 4LFBB 2ODEA 1OB2A 3OT1A 4FTWA 1KE2A 1TUEA 5HJ7A 4UAGA 2HJSA 1QHHA 4A2CA 3GBSA 4RFVA 4WL0A 2D7JA 4GAEA 1GQFA 2GA9A 1DC7A 1R74A 1CUYA 2EU8A 1IVSA 4EF6A 1RR6A 2QY9A 5EFZA 1F0KA 3GGCA 2O5EA 2PJDA 1IEXA 3G2KA 3I3SR 4JLWA 1D6NA 3VR5A 4GKBA 2R97A 4YRQA 1QC5B 2HD4A 3N2KB 1HQYE 1TE2A 3F6SA 4PSDA 3K0EA 4FW9A 4CCYB 1GPYA 3GLFE 2WQZA 2YH2A 2ZJ7A 4FINA 3N86A 1QTIA 1IHDA 2W90A 1P18A 1Z4MA 4LDRA 1XLUA 2ZBDA 1G18A 1TQ4A 1TCAA 1QVAA 3H05A 1MA3A 1Z08A 3RJ9A 2HK8A 5CX4A 4G0WA 1E9BA 1N3YA 4ZAVA 1FSPA 2TYSB 3DVAB 2CDBA 2TMGA 3ZVKA 1OFGA 4HBZA 3GMIA 5FO0A 4NONA 5ALHA 4ZO4A 1V96A 3FSEA 1U2GA 3HMQA 4I1VA 1SVLA 3A4TA 2C7BA 2WSSA 4KVZA 5IT5A 1ZSYA 2GCGA 3HBFA 2IH2A 5REQA 1TTHA 2W6ID 2JJYA 4Q9NA 1DKQA 1BGVA 3W2GA 4DBLC 4MMZB 3L41A 1BC5A 2A9FA 2XOEA 1ISJA 5KOIA 2XCOA 5HS6A 4KO4S 4UM7A 3DHEA 4B0PA 1FK8A 1SRQA 5KJFA 5AICA 3PQ7A 1PJLA 1QM5A 2W6JD 4KNWA 1U81A 4MS1B 4R9VA 4RULA 4LA4A 1IEWA 3AR7A 3U39A 1FFWA 1IH8A 1JTEA 3GARA 5H59A 4QDUA 4BO8A 2LV8A 1FNBA 2Q3HA 5CT9A 5E6SA 1WCV1 3W4JA 2AFHE 2VDQB 3MQFA 3UB4A 1M8GA 4HGZA 2WT4A 3KHKA 4HL6A 3V1YA 3Q3IA 5K5EA 1RAEA 3ENNA 1BXRA 3CJQA 3R6LA 4HAOA 1GGNA 4ARZA 3ELYA 3H5NA 4DMHA 4C2UA 1HT3A 1PLLA 1ZO8A 3TQTA 1H2EA 1DJOA 3GBVA 5U4XA 5BWNA 1M6VA 1VPTA 5K2OA 3I52A 3GZNB 2ZCUA 2ZS8A 3GDGA 5HZMA 1XD8A 4B2PA 2E82A 3TCNA 3IMKA 4YT2A 4XQCA 2G80A 3BJZA 3VDQA 3E53A 4HQKA 1T1EA 4LRWA 5IF9A 1GLVA 1NVVR 1R4MB 2C7GA 4J16C 4N8EA 3GOHA 1CD5A 4L95C 2J32A 4TV8A 4TSKA 1IBRA 2Q9CA 3N7TA 3SVTA 1FFHA 2XITA 1CF2O 3DZDA 1O54A 3T35A 1GNVA 2SCUA 1ZFNA 5B7GA 2LXNA 3DJFA 2F9FA 1C2TA 2JANA 2R84A 4IVPA 4IYRA 5GJWC 3AVVA 4HDMA 5LBIA 4DBLE 1CC1S 4JITA 4PLZA 3WFZA 1JQKA 4U02A 2JLCA 1Y3BE 4XRGA 4IL5A 1M2WA 3E4DA 3LWBA 1LK0A 1E96A 3V1LA 3CKKA 2GD6A 3GGDA 4YJ3A 2XZLA 1ZCBA 2A3RA 1PX2A 3NMUF 3LVQE 4KVFA 4ZDJA 3ZE9A 4C7OB 3QQPA 2YJNA 4OI1A 1AO0A 2OZVA 4FE7A 5BUZA 2F43A 4QPCA 1V6SA 2RSLA 4KN5A 4MUEA 3ZX5A 4EZEA 5CFPA 3TGPA 1RKUA 1L3BA 4CHGA 1P1RA 3NXSA 5GZ6A 3CX3A 2JGLA 4GH5A 4YJ2A 4RTQA 1MLDA 4LWZA 4ARVA 4COKA 1XTUA 4WINA 4RX1A 2ZB8A 3ZS8A 5IYZB 4PTYA 4YONB 3TZBA 1IBCA 1IPEA 4BB6A 1AGYA 1DRJA 1T4CA 2CFCA 1YVUA 3OM9A 2VYVD 3BERA 3HB7A 2GXAA 3SOPA 4GQAA 4IJKA 4HEQA 5JSHA 2JK0A 1V45E 3PWSA 1R27A 3EPHA 1NFQA 4X5OA 1NG1A 3BMQA 4MRSA 3T6KA 1SZDA 2HU8A 3R6TA 3D6NB 2IHNA 1JUDA 5JOQA 1QHFA 1EX1A 4E09A 1EYZA 2WT9A 1B73A 1Q7EA 1T6XA 3CA8A 2HGSA 1L4YA 2OKGA 3PHCA 3MNFA 4AZ0A 1QRUA 2J4DA 5IK2A 5L9AA 1O0SA 3W8FA 2P5YA 1WMBA 1DE0A 4XCXA 3RIGA 1QCZA 2XI4A 1P81A 1OLSB 5AK0A 4ZPXA 3ZV5A 4D9IA 4JJFA 3UY4A 3MMNA 3ENWA 3NM4A 1CNMA 2FMUA 3HXKA 2WR8A 2QQEA 1IL0A 2BDEA 3IVXA 3TUZC 1CQIA 2ZJ0A 1DS6A 5AKGA 1XXLA 2FR1A 2GZ2A 1DT3A 1S0UA 3O31A 2WF6A 2O3SA 1LPAB 3CUTA 4Y2VA 4ZPJA 3L7OA 3ZVLA 3FOZA 5EP3A 4HTFB 4YRDA 2FW6A 2RGNA 3A2MA 4GZMA 2VAMA 3I6QA 1QKJA 3VOTA 5JMTA 5AW3A 1YIDA 4GPAA 2BFCA 2VC2B 1M34E 2RONA 2I8CA 1XO1A 2APJA 2HWUA 4BYGA 2D1TA 2CD7A 1FJ2A 2QL6A 3LKZA 4KXNA 3HABA 3DBHB 2R00C 4C05A 4A9AA 2JL1A 2TS1A 3K15A 3QXXA 5TGZA 2EVWX 3ZD9A 3HM9A 2PGJA 2R86A 3K09A 3T7KA 4B3SB 5E7QA 2NTNA 4YBZA 3RJMA 4BWGA 3BF7A 3ROTA 3E7WA 4C3UA 4MVJM 2AOVA 2O8FA 3IP6A 4QTXA 3SICE 3ZWNA 1Y8QB 1E32A 1WNTA 3RS8A 1OC4A 1Q19A 2QE7D 4N0MA 1CE8A 1F8UA 2QN1A 1TJYA 3GEBA 5H9VA 3SXJA 2DPLA 4XWKA 4EITA 1U7TA 5KVAA 2NV6A 1X1AA 1K86A 2PMCA 5EP2A 2DG2A 3ROQA 3ZCPA 5LQUA 1E9VA 1RT9A 1F5SA 3DL7A 1AHIA 3UJAA 2W6IA 5EMHA 3U6BA 1B8NA 3DE3X 2ECPA 3NYRA 1V16B 4QRIA 1TJ5A 4FIDA 4I1YA 1U8XX 1F20A 1O6ZA 4KLRA 2ZRCA 4CDMA 4DR7B 3FOBA 2HL6A 1OZHA 1OREA 3FNIA 2EL7A 3IAAA 1O94C 2C9CA 1XLWA 2W6JA 1DEOA 3LFUA 3H2KA 4NFLA 5ALYA 3WGMA 4BQIA 1A4RA 4U7GA 4OYYA 3IXMA 1J2RA 1L4GA 5ES3A 4ZVSA 3MCAA 3FJOA 3PDUA 5K7SA 2I33A 5THQA 1RJEA 1W48A 3EDQA 5IT0A 2PH3A 3BWVA 5K3CA 1Y5RA 4JL5A 4TXNA 4O2BA 1BWSA 2JGJA 2WUEA 1LQUA 4NYIQ 5AIAA 4PN7A 3F97A 1ZI8A 3KUDA 2A1TR 1J42A 1R37A 2JH8A 2XRMA 2ZRGA 3BPSA 1ZK0A 3QPUA 4IF6A 1P8JA 3T4PA 5IASA 2BFOA 3ED1A 1T34A 4FEEA 5K2MA 1WPGA 2P11A 3H2YA 1ZHHA 1KEEA 3PJFA 2WYUA 2OHHA 3DEFA 1CFJA 3IOYA 4JVNA 4F56A 1Q84A 3W5BA 2V0GA 2GSWA 3L7KA 1ZD2P 1XTVA 2ZUCA 3PC7A 5FAKA 3AHCA 1KETA 4Z1MD 5D3MB 1HMPA 4HATA 4OFXA 3G23A 5BT9A 2AB0A 1MVOA 5JJCA 4PSKA 3D4OA 2OTCA 4ABTA 4F46A 2HEIA 3HNOA 4RELA 5AJXA 2CC2A 1E94E 2OV8A 4DR6B 3LQKA 4BVBA 3G68A 4S1OA 4PR3A 4M8IA 4EHHA 4LFAB 4YCBA 3O93A 2RHBA 2ZTMA 3V42A 5LYJA 5F76A 4X7PA 5IAGA 4UJ5A 4ES6A 3AVUA 3OZRA 3OIUA 4ZT7A 1ZRSA 4NOLA 1E69A 1KTVA 3I04A 5M3BA 1EESA 5HCUA 1URPA 3V4ZA 2BH9A 5F4BA 4EOGA 1E3JA 4LNAA 1ZMRA 3ROZA 4C4ZA 1W0KD 2X2FA 1KEVA 2NAFA 4BUJA 1XCOA 1ZAYA 4PZ0A 2ZR7A 1GUBA 4OXNA 5TSDA 1YZ3A 2P4UA 5FHRA 1C3LA 4FN4A 3WDLA 1PT7A 3BH6A 1R8XA 2PX8A 3DUFA 4DSZA 4NU6A 1MC5A 3CPJB 4YMUA 1DC5A 1ISGA 2XUOA 2OAEA 5B1DA 2JLBA 4WLNA 2CL5A 4BMPB 1YGPA 3OZTA 2Z8XA 1G20B 4CIBA 4H60A 4JCOA 2VYVA 1SKAA 4E70A 3G5UA 3VR6H 1T0JB 1XR3A 2Q0QA 2RARA 4R05A 5TGDA 3RABA 3U4CA 1YU9A 4ALMA 4BNZA 4JR0A 2C59A 4ZZ1A 4P83A 4ZOBA 3P20A 4GBED 3AFIA 3HCEA 4HRXA 5AI6A 1DKLA 2Z98A 4CKWA 1QLHA 3Q8WA 2PUBA 3DKKA 1P1IA 3CVUA 5FUWA 4Y6RA 1ZX1A 2O0KA 2H4JA 2O7SA 3GLIB 2NPIA 3HGTA 3INNA 2AS0A 3I37X 4YJGA 2LBPA 5E2BA 2G0NA 3HKDB 5IBPA 3KOMA 3WRYA 2YTZA 1R0SA 3AM3A 2A58A 4BWYA 4E31A 4EYKA 2LUOA 1AZLA 1W73A 3USCS 1V2GA 1H65A 2CBGA 1PWXA 2M1ZA 1Y3DE 2CFOA 3C8MA 1TMYA 4FXPA 2QD3A 1B8PA 4PC2A 1CNFA 2GN0A 5DYGA 3RRJA 3WNQA 4YXFA 3Q8MA 4QXOA 4O4IA 1VJGA 3S44A 4ZDKA 2JGDB 3DBIA 2PUCA 1DL5A 3G85A 1VPWA 1FFGA 3HSYA 1XRQA 2YYAA 4YP0A 2C20A 1FOEB 3IEIA 3WA7A 3OE7D 1J8YF 1XGKA 2AJ8A 4RH3A 3EULA 1YJQA 2VHXA 1OFTA 1H6CA 2W0SA 2BISA 5JRJA 3MBOA 2GD1O 4MW5A 3FOEC 3FLAA 1T4MA 2O1WA 4QQRA 3IUJA 3V46A 4R84A 4W8GA 3WRXA 2J6IA 2XVAA 5DTEA 1EFHA 5ELMA 3TNFA 4FB4A 3P94A 2ZQYA 4X1IB 4Z5XA 3SEQA 3S5JA 5U9CA 1NONA 3Q7IA 3K8ZA 1FX0A 5AVWA 1SQSA 4LJ5A 4QVGA 1T8TA 2QE7A 3ZJ5A 2ZE8A 3IBCA 1SUIA 2B98A 1NX9A 1KBQA 4UDNA 4P2BA 5FPQA 5FBQB 4QDOA 4YCCA 2FKAA 4U2EA 2WMYA 2NIPA 1WB9A 3RVNA 1PTKA 4CN8A 3H1GA 4DA6A 2D8MA 2NO9A 2CLFB 2HHJA 2V5UA 1K7YA 3KK0A 3KEMA 3L7AA 4DFDA 3X1KA 3GRYA 2HI0A 1KMQA 1P9NA 3P9YA 4QFMA 1QC5A 1XZBA 3N2KA 1RSZA 4PV7A 4IQFA 1KAOA 2ZYVX 2AJDA 1MIOB 2CUNA 3PQCA 3F5MA 3VBCA 3VUEA 4PO3X 3PUJA 1U6JA 3R6WA 4CCYA 3HP1A 2FMFA 2XMBA 1JGTA 4WESB 5LBUA 2F3TA 1CETA 1QQ5A 3AFHA 3UFBA 1OAOC 1YQEA 1V7PC 1JVBA 3F96A 2XTZA 4Y0VA 4HUTA 2QW8A 1JYFA 1P4SA 3KU1A 3BXOA 1G8FA 4U9UA 1EXWA 1CUFA 2MOKA 1G4UR 2ATEA 2ZYUX 3DVAA 3NO4A 2FWAA 4ND4A 1R16A 3ZJYA 4CV2A 5C1PA 2PLRA 2PSEA 4XAQA 4UBMA 3UOAB 3L06A 2W2OA 3QE0A 4OMFG 2PM8A 2PGNA 3AUKA 1S3FA 5ALUA 3VR1A 4FFMA 1G8YA 3WHKA 1K8RA 3NWBA 1ESMA 4Z1MA 2DFTA 4W1SA 3L46A 3O6VA 4ITVA 4LBVA 4M88A 4KXFB 3RG8A 1N0HA 4KACA 3VNSA 4X6YA 3R0VA 2H4YA 5A03A 1HKHA 1SD5A 2HWXA 3GLTA 3FPBA 3QU4A 4MS1A 3TAHA 3IP7A 1P2VA 4NBUA 4PYIA 1F2UB 5EQFA 4X6LA 4ZDWA 3TGWA 6ADHA 2V5VA 2X7XA 2XPCA 3ZNNA 3QXJA 1R88A 2VF5X 3I9FA 4Q6WA 3C5CA 3NZEA 3NAMA 4CKBB 4CM6A 4RJIA 1DQPA 1IJEA 3GCXA 3G59A 2P1ZA 5FA8A 2R1TB 4HJXA 4U8GA 3K5PA 2P78A 3RCBA 3ROXA 1WM1A 4I2NA 3E1SA 4EY3A 5THXA 3LDGA 3EWIA 2QVZX 2FTKE 4F06A 3BX1A 1UP7A 4IUBS 2Z4TA 2FMIA 3BGWA 2QZ4A 1ECBA 4LOIA 4LX8A 5DLEA 5FA5A 1W0KA 4R83A 2D59A 5EZYB 3GZNA 4EO7A 3MAAC 2FA9A 2RI0A 2Y9MB 2GJSA 1FFEA 2YJ3A 4AMYA 2VG8A 4M21A 3C15C 4ZP1A 1E2KA 2X1MA 3GG2A 2I4NA 3QBVA 4WCVA 4ZOLF 5AKJA 5IX8A 3K4QA 4P34A 1YFKA 3K96A 5CAEB 1MQ8B 3ZV6A 1R4MA 2WLSA 4ABYA 2J0VA 3NIFB 2XMDA 1Z7BA 3H1EA 1I14A 1V3QE 2IKQA 5CNKA 5CH8A 4GDFA 4KLNA 2WJ6A 4I50F 2QW1A 4I0WB 3UANA 1B8VA 3TS1A 3EHEA 4PANA 4DMGA 5BPFA 5JANA 4LOJA 1JDPA 2Y1WA 5IT4A 1MV8A 5AXDA 1Z6QA 4Y3UA 5G3ZA 1EB8A 4NLLA 2LTAA 1FJGB 2PYDA 3ABIA 2YC4C 2EZTA 1XOIA 3Q88A 3G9QA 1A4UA 1P2SA 1W5FA 2GFHA 1VLZA 2IQIA 4AURA 4B7AA 2W37A 3SEAA 4DCSA 4E2XA 1DRWA 1JBQA 3FPHA 5DX8A 3GJ8A 3HP4A 4WK0B 4Z86A 3SS9X 2YZ2A 2I2FA 3G0GA 1HYHA 1JR4A 4WK6A 4DPMA 3R8XA 3B12A 2NO5A 5L45A 2DT8A 1TECE 1U1GA 3B8EA 4KTTE 4FDMA 2AA3A 1K5DA 4FR5A 1BEEA 4AJPA 5FX2A 3CVVA 2I6GA 3PD0A 1SR8A 1BVRA 3COVA 4PIVA 1SQ5A 4HNAB 1QZ3A 4EYOA 4C2AA 2F9LA 1XZIA 5IYZA 3BG5A 3PQEA 4GGMX 3X2EA 4EKNB 3WYNA 1YS1X 2HOQA 3UPDA 4O4LF 4F38A 4ZK2A 1QGAA 2YC2C 1H2ZA 5C5CA 1IG0A 2IBMA 2QDXA 2PQMA 3OE7A 4GVXA 4Q3NA 3P2IA 2CNBA 3PF9A 1YR3A 3CVJA 1K7SN 4LNHA 3GJTA 4JEMA 3ZHOA 1KI1A 5EQJB 3ZV7A 4DXAA 4CNBA 4BGUA 4TKUB 5J43A 1K4YA 2UXCB 1C81A 3RHSA 2ZSAA 4E11A 2NVWA 3R3ZA 3S8EA 1HMYA 1RPAA 1OLSA 2X5XA 4DLUA 5HIJA 1IOVA 1E2DA 4O2AF 4ZYXA 4R16A 3FOAA 5P21A 3OOEA 4F3KA 2K4MA 1FU8A 3UO8B 1IQRA 1YR9A 5A2QA 1Z5GA 2DRIA 4MV9A 2B61A 2BONA 3OPNA 1IAVA 3C5WP 3ZXYA 3LT1A 3OQNA 1JR2A 2V59A 1EMDA 1LNSA 4UBOA 4U2GA 1Y0BA 2P6OA 4RA6B 4D3SA 2OV3A 3R9XB 5KB3A 5B6PA 2IHZA 4UNIA 3KWMA 5BN5A 3ZGLA 3R8FA 3G2QA 1PGPA 4QUDA 3UAZA 2FEXA 1MO5A 1Q3TA 4PFKA 4TMZA 1MAHA 2IJGX 3CRNA 3IUNA 5CNIA 4A27A 4B1FA 5LUAA 3MJHA 4UTXA 2ZBPA 3I73A 3DBHA 3GIWA 1LLUA 2YIMA 4AZ3B 1RKVA 4K1XA 4EB0A 4M6WB 2G28A 1GCUA 4F8EA 5KVCA 1BTOA 2D8AA 1PGNA 4PBRA 1V25A 1WQ4A 3O8CA 2GDJA 3H99A 3LUKA 1QGOA 5ALMA 1TYCA 2QRLA 4ITRC 5G3YA 3RREA 4BP8A 2AX3A 3FDFA 1Y8QA 3LBYA 1GFZA 3VO8A 2H63A 4E5SA 1UXKA 3DW1X 3GELA 3ITEA 4FS3A 2DHDA 1U5CA 1J49A 1VIAA 3OPMA 2VLIA 4M87A 2QRHA 3OHSX 1G5QA 4Q21A 1RABA 3II6X 2HMUA 1JU9A 1FRQA 2CSUA 1Y8ZA 3ONEA 3M7IA 4K40A 1ESDA 4DVGA 2O23A 4FKMA 1WPXA 5K8TA 1XVAA 1V16A 1PQYA 1OFIA 4M1SA 4MVJI 1R12A 2C3UA 5JZVA 3V7FA 2VQDA 4KRFA 1B74A 1ND6A 3IQWA 4YDRA 4US1R 1JKJB 4J90A 1THTA 3W5HA 3RSSA 1KWKA 2V0NA 3QLVC 4CETA 3STTA 3RS0A 4KSBA 1LZLA 1XCJA 3SHWA 3VH4A 1J23A 2Y6VA 1YULA 3PNBA 2QN3A 5FQNA 3VOSA 3TG8A 1RPTA 3BIOA 4MR8B 3CLTC 4EBBA 3F74A 2VHJA 2F3QA 5CXXA 1N2BA 2VBFA 5JXHA 4TRJA 1HY3A 1MOQA 3SYTA 2B82A 3MMZA 3TLGB 2O8EB 1C4WA 2QYTA 3OQ6A 4GS5A 3P9QA 2HRRA 2HHLA 4LKRA 2XRYA 4UVEA 2DKFA 1OXTA 4FSDA 3RAPR 3VTFA 3ZXIA 4YRPA 4DC1A 3H9GA 1BSVA 1XZNA 3E58A 4KGXA 3CPEA 4NRDA 3KJZA 4M0PA 4NWIA 5F5XA 3FYUB 1Q0PA 2QYHA 3CUUA 1HRDA 4OHBA 3O7MA 3LT0A 3NYIA 1Z6TA 3PEFA 1BE0A 1SCAA 3B20A 4E5YA 5L95A 4C2BA 5D3MA 1U65A 1X80A 1H23A 3ESRA 3KPVA 3TLXA 2C0QA 4RZSA 1DAEA 1WZIA 4HDSA 3GROA 2A5YB 3RC2A 1MAUA 1EDBA 4XSGA 1GDHA 2B5WA 2ISSD 5KHAA 5T3UA 3DWIA 3H87A 4QTTB 3K35A 3V1MA 2X23A 4RHYA 5L3QB 1UODA 3B82A 1Q5PA 2C61A 3DGFC 3Q0EA 2IUUA 3AQ4A 1IBSA 3WDSA 4U2DA 1SJ9A 1OWNA 2IZOA 3R4VA 3KQOA 2C0CA 4MYDA 4TZKA 2QVGA 2WM8A 3EWSA 4HPJB 1RTKA 3ZHTA 4BVLA 4EKEA 4PZLA 4L8FA 2PFGA 3F3KA 3E8XA 3GFPA 3OVMA 5JRDS 5K09A 1C3VA 4FU0A 1YQTA 5EIBC 3WK9A 2Z5LA 3NDPA 2KBFA 2PS9A 3L8HA 4MCHA 3VVLA 4EG3A 1CQJB 1O4WA 3EIXA 1MBZA 5LD2B 2VK4A 2R25B 3H84A 2CLEB 4ZOCA 4Q1EA 3R5XA 4PSVA 3LQQA 4F4UA 4QYXA 2AFIB 1BKDR 1BX1A 1GLNA 1NVEA 1LDBA 2PT7A 1YA8A 4I46A 4C4PA 2DGDA 3KLOA 3A6LA 2QIOA 5J1SB 3HGQA 1L7XA 2R9VA 3RFFA 3GJXC 4RZHA 2BGRA 4QREA 3TQQA 3RIXA 4FSHA 1HBJA 1DAMA 1YL5A 1G20A 3X1WA 3FTDA 5MF6A 2FQQA 3E9ZA 1N25A 4HGRA 1GV0A 3ZW7A 2ZYAA 4X95A 3ICPA 4L57A 2YVUA 1L5QA 5DYNA 3RYIB 3LPDA 3A6ZA 3K0HA 5FLEX 4X41A 3DMTC 1FA9A 4I4LA 1I36A 1PHRA 3DCYA 1V71A 4Q05A 2PTHA 3M6AA 2O6LA 1MO3A 5IC5A 3ZLVA 4BRZA 3BAFA 2H52A 1VRCA 2YFHA 4UCXA 4UMEA 5ESWA 1DRVA 2GDZA 4Z7NB 1GXSB 1A72A 2YUIA 2C4HA 2IBSA 1JJ7A 3PNYA 1PJAA 1A2QA 1PGOA 1WUTA 4MXDA 4S12A 3DFMA 4UBNA 1WUYA 2JRLA 4Q1AA 4BXOB 4OH7A 4MPDA 2XLCA 1VCNA 4RAQA 3RIHA 1YBAA 3WIDA 3NATA 5JQGF 3L1JA 2HMTA 1YRLA 5K6AC 4PS1A 4RUKA 2JAHA 1K0FA 3OM8A 4J76A 2JGDA 5EXTA 2PANA 4KXLA 3MTJA 1P74A 3T0IA 2VUUA 4JBXA 3TR5A 2VZ9A 4M1MA 3PG5A 1HYBA 1QV6A 1Z82A 3QY9A 3I09A 1XZ8A 1O57A 3K20A 3VI4B 4ZI2A 2PWYA 5E3JA 1TADA 4RVGA 5AHOA 4R8RA 1SZCA 2RFLA 1GVNB 2QN6A 2XE7A 1FUYB 3CY6A 4OM8A 4RD3A 2Q8NA 4XSHA 1SUWA 2AMFA 1A8SA 3CRVA 1YONA 5JYCA 2BL4A 2HTFA 2M6RA 1MW8X 3FTFA 4X1IA 1N6LA 2XTNA 3M8KA 4E32A 2H2HA 2Z4RA 4AUNA 3KR9A 4IIYA 2WVAA 3LXRA 1JG7A 3JWIA 3Q72A 1L5MA 4GLJA 3VKUA 5DM60 1M2KA 2J7KA 2XVXA 1A50B 1K88A 3VR4A 4EZIA 1G2PA 1TTQB 3RS7A 5IW8A 2BOVA 3FDXA 4HWSA 4QO7A 3TLEA 3TLZA 1R0KA 1XEWX 1GGJA 1ECFA 4M8LA 1FVHA 3UK7A 4BBZA 4JSRA 1Q21A 2GKOA 3AZQA 4OXIA 5AWFC 5KS2A 1DAOA 2XB6A 2PQ2A 2WNIA 1MH1A 1OYOA 1KP2A 3CINA 2WFZA 4E2YA 8MHTA 3RHZA 2PR2A 1MIOA 3JCZA 2NSJA 1OU0A 2H29A 1KOLA 4V39A 4F9GA 5JXJA 3QF4B 2IKSA 3ZZUA 2HO5A 2Q5FA 4LISA 4R9SA 2IK8A 4G0MA 5EEHA 4UAVA 4JI0B 1TM3E 3OSUA 4L51A 3ML1A 4X8OA 2B4YA 3BBPA 1IG3A 1QO7A 1U1IA 2I7TA 1F4PA 5K0LA 3T3OA 2CXRA 4M9XA 1YR2A 4REQB 4C76A 3MFQA 5TNXA 1ECCA 5HFNA 3BJMA 1O95A 4JFRA 3B53X 3H4IA 2F3SA 2IIQA 2J3JA 3LUAA 3P19A 3ZCTA 4IRUB 4GEKA 1BCSA 4TM8A 1RHMA 1ULZA 4N7MA 5K4AA 4HV4A 3B1ZA 4PVDA 3CG0A 4FP9A 5M2QA 1WLSA 4B6OA 2WAOA 3MFYA 2EAUA 2GRUA 3EC7A 4JI1B 5TRTA 4JUBA 1JBKA 1JG6A 2JD0A 2VP2A 3AL2A 3SLRA 1NBWB 2H51A 3GVHA 1F2UA 2PYIA 4AC9A 2FG6C 2J0QA 3TIGA 3BVPA 1TW3A 1JYSA 1DEAA 3GLFB 4RHCA 4UQLA 3MLBA 5TMDA 4M4SA 5TT0A 5CVUA 3VTKA 1NTOA 2G70A 2R1TA 3W4IA 1JHAA 1EZ1A 3D0RA 5ALSA 3H2GA 1L7DA 3DWEX 2ZUSA 1P4AA 2B7BA 3ESDA 1R9GA 2YN2A 3FETA 4RSMA 4XB6B 3X3HA 4ERNA 1EDOA 1WF6A 3G2HA 4ZVNA 1IVNA 1CIJA 4CYMA 5JNLA 4GYJA 4OXYA 4NARA 2AC7A 4DWWA 1CJBA 2ZBGA 2V54A 4L8VA 1CERA 5EZYA 3JWJA 2QT9A 4I1SA 3ZHVA 1EFUA 1GD1O 2NYAA 3OG9A 1KA9H 1DC4A 4DWOA 2I3GA 3K70B 4JJEA 3OIGA 1D2MA 1DQNA 4V0QA 5BYJA 5CAEA 3FB1A 3ABSB 1ZBDA 3GRVA 4RKWA 1EFRD 4YUAA 3BB1A 4TKLA 1CYDA 5AVOA 1Y3FE 5FRDA 1S9HA 2EJBA 2O4UX 1IOZA 4PRYA 1AB5A 4B6FA 3PGXA 1FDWA 2Q5JA 3V9PA 1IIBA 2J6BA 3VJRA 1K7FB 1EP3B 5BUCA 3LX4A 1JI0A 1MJ5A 2AFHB 3FR7A 4NMHA 2W5UA 4MI3A 4WASA 5A06A 3F6BX 2JCYA 3AR4A 3NRJA 4LS3A 1LPBB 2AYXA 4MQMA 4TQGA 3HSSA 3N2IA 5TF4A 3W8RA 4RJKA 2IHTA 4LC0A 2KSQA 2DWCA 3EUEA 4AMBA 4XR9A 2NAPA 5DSTA 1I7QB 5BSVA 2VNAA 1E8DA 2HMAA 1NG9A 1UINA 4RD6A 1XZJA 4IUDS 2X2EA 4BVHA 4LHZA 3H6KA 4TQ9A 4YMGA 4Z9XA 3RJTA 3OTIA 2YX1A 4HNAA 1UBLS 2H17A 5AVSA 4NENB 3O0DA 2VBGA 4WVLA 2MR6A 3L8MA 3OSZA 4ENSA 3SWWA 1JJFA 4D74A 2I6XA 1ESNA 4NBSA 4EI7A 5AIBA 1BVHA 5EUQB 1KVTA 4CUZA 3RWBA 1IYZA 1E1RD 3SQLA 3FOCA 3MINB 3NBFA 4EEZA 2YOHA 5AJUA 1C9KA 3L6EA 3S2FA 4OCZA 2JATA 2OB1A 3BB4A 1X86B 2BMEA 4TKUA 3B78A 2I6UA 4MEAA 2HDWA 4YAEA 4P80A 4ATNA 5I7VA 1Y8AA 3C41J 3CH4B 3G7SA 1PK9A 5AI0A 3DEJA 5E9WA 4K3UA 3RYCB 5C52B 2Y3IA 1ZZEA 4JA0A 3SBEA 1UBRS 1F7VA 3KJGA 4ZT2A 4MRMA 1NLMA 2BMDA 2XUAA 5CIYA 3CEAA 4LQDA 1WWKA 1BDMA 3PFHA 5B1YA 4TYYA 4PRLA 1CHDA 2PA0A 5CLIA 3DEIA 1Q12A 1GR1A 2B2XA 2C5LA 2G8NA 3MWDB 3NC0C 4IJUA 1BXKA 4A6EA 1YIAA 3HWSA 3K5IA 2VNSA 4IFEA 4CCSA 2A4MA 4D26A 1Z8DA 1ZI6A 2CVHA 2PWBA 1NR7A 4GE3A 3JV7A 2P77A 3BGOS 4RA6A 1YV9A 3IR5A 3TQFA 1XHEA 2F59A 4HQNA 5DPMA 2AH5A 2PO5A 1EE1A 1P2UA 2O3QA 3B38A 2RB5A 2ZRBA 3NCHA 4YQFA 2KQUA 1IBLB 2PWPA 3F2VA 3FRIA 3KL2A 5SV2A 4UBKA 1PG5A 4AZ3A 1EBFA 2YV4A 4M6WA 2ZANA 5CK5A 2YJGA 5DVZA 3KKMA 1WTCA 3OTQA 2XRZA 4U2CA 1TJPB 3JVEA 3WGYA 1R6BX 4EGJA 4F9FA 4IIHA 5B2FA 5BRJA 1KMIY 3FYDA 4H4EA 1JEYB 5LDHA 1EWYA 2QRUA 2I4RA 1JIQA 3ORFA 3NV9A 3PE6A 4UAUA 4C0BA 1RWQA 3AY0A 1EFVB 3LBFA 1WU8A 1TFRA 2D0OB 1FF9A 2ZIZA 3DLHA 5CDFE 1BYUA 1AHNA 2FE4A 3F5DA 4I4IA 1E5QA 1S8NA 4X0EA 1PU2A 1ILWA 2VDPB 1HV8A 5DGHA 1X7HA 4DIFA 2Z2XA 4X61A 1RPJA 4Q9HA 5L3VA 4AG5A 8GPBA 1X70A 1JKJA 2QRVB 1ISRA 1EUCB 1M6EX 1PIWA 1M34B 2XCLA 2OV2A 4P54A 5AUQA 3SX4A 5EJ5A 2BKUA 2V96A 2C82A 1GNSA 4F9TA 1QJCA 4F9EA 3ID6C 2I3DA 5KYWB 4XIFA 3R9KA 4JSYA 4RAOA 3SLKA 1RZRD 1SOMA 3E18A 1JLRA 1L9KA 1WCIB 4MR8A 4TT3D 4Z51A 2CFIA 4Y30A 1ST3A 3RE1A 3TLGA 2O8EA 1JHOA 2FVYA 2ZLBA 5CDUA 1SY7A 1C0IA 3OOSA 1ULSA 5B1IA 4XIIA 1JDTA 3RK0A 3TL3A 3DDOA 5BW8A 2PH1A 2HCFA 4HH3C 4OJQA 2B1GA 1Z0IA 1EP9A 1K2VN 1UKZA 1VL0A 2QEQA 3AP2A 3FYUA 4DNQA 5FUMA 4RFSB 3I4FA 2B92A 4AJJA 4A0FA 4PCLA 4I1OA 2XNDD 3OQVA 3KTAB 4QSMA 1DQYA 4NOJA 3PJRA 3GFBA 4RXTA 4R1LA 4HN2A 1HLPA 1Z18A 4RL6A 4XX1A 5FJJA 1USKA 2VL7A 1T1GA 4OQQA 4YC7A 2C1XA 3GLKA 3NBQA 3AY6A 5IUKC 3X1YA 4AECA 1Q6ZA 5CVEA 1KDOA 3TQSA 2VDKB 1MX9A 4OIMA 1KPHA 3M3PA 1YDFA 2H3EA 4AXXA 1KQGA 3HZOA 3JQCA 1RACA 4NOKA 4BX8A 5L3QA 4EBFA 2V7TA 1Y9AA 1HNZB 2ZRJA 1PSWA 1G8KA 4R4JA 1JDNA 1THMA 4KAAA 2BC9A 3HUEA 1MT0A 1JHXA 4KGDA 3MJVA 3RGGA 4B4KA 1KWGA 3EASA 1TA9A 2FDXA 2ZU6A 5TVKA 5C53B 1QIMA 1AKUA 2WHEA 4QODA 5D01A 2ADOA 3QENA 2WWHA 3LX8A 4ALKA 4OJNA 1CT9A 2HKIA 2A0FA 4B7CA 2JLSA 1CQJA 3BQ9A 2GHRA 2PKEA 5DCLA 2QJWA 4G89A 3IEVA 3IUQA 4EELA 4FR2A 3LZ6A 4QGBA 4XGRA 2AFIA 2QW0X 3AP1A 3ZWOA 4GL4A 4N01A 5AM2A 3HKCB 2A1IA 5KNDD 4GX2A 1SB8A 4L76A 4WLVA 1R6AA 3K70D 5LQRA 1X1CA 1YQWA 4TUYF 1NVMB 1U0NA 2QX9A 4UUMA 3DBLB 2CEAA 5TQ2B 5JR3A 2HZBA 5DYWA 2HK7A 3PDIB 1ZPDA 2H11A 4H6PA 4P93A 1OOEA 1H0RA 4HWTA 1V8FA 4C7MA 3TVTA 1IN1A 1ACMA 1V5WA 1S7CA 1BAPA 1U8CB 2AEFA 2SICE 3GG9A 1E1RA 3LY5A 3NT4A 4JQOA 4LAFA 4A5OA 1QQAA 1BN7A 1P1FA 5IWAB 3EGXA 3RYIA 3AUSA 2W6PA 2VCYA 3O8BA 2YWHA 4OP2A 4KWIA 4URHA 1JG2A 2M2IA 2OXCA 2PQ6A 3PJGA 3WMWA 2IYVA 1DPGA 3L1UA 4JK3A 4K8RB 1M6WA 2W2QA 3G2OA 2ZSBA 4LXUA 4Q12A 3T9DA 3RM3A 4INJA 1E4VA 3ND8A 5C35A 3H0KA 1GXSA 4MV4A 4E4RA 3COJA 3Q9UA 1JHZA 4MVWA 3RU7A 5JCXA 4QUBA 2HUPA 3DEYX 2QVLA 3CCFA 1QJ4A 3K5HA 5KC8A 4N3AA 4BXOA 1OFHA 5JHHB 4G0UA 1ZOPA 3UUGA 4WOKA 3HE3A 5BRNA 4EX6A 4P7JA 1E6CA 2O14A 3MMSA 1VP9A 3P26A 4H7JA 1K3TA 2VP6A 3DLTA 3UJ9A 3AT1A 2XQJA 1RJDA 4L1KA 4PRZA 3CB4A 4Z0PA 3HJFA 3IEPA 1M7HA 1OWPA 4HLUC 1J07A 1I6LA 1RWNA 2LCIA 1TAHA 5DH9A 5FPHA 5LZ4A 2HHAA 2DY0A 5ICFA 4Q6BA 3EEBA 2FETA 2R7MA 3KJNA 4LGYA 5C51B 3LVBA 4K2AA 1T9GS 4A92A 3E0QA 3VMFA 3ADDA 1RHRA 1B0UA 4L08A 1KAHA 3EMBA 2RAPA 4ZOLB 1FX1A 5HUQA 3UHFA 1ZCFA 5MGBA 1S3SA 1YRBA 4MB0A 1ZI9A 1M8FA 4F60A 1GPDG 1CR6A 1VA4A 2DC1A 3WWPA 1F3LA 2DQSA 5CFMA 2UZIR 1RWXA 1HYEA 4KLAA 4KQIA 1S02A 2J41A 3AEKB 1RE1A 4KLZA 4RVCA 5DHRA 1JHDA 4DE5A 4PGMA 1A95A 1UK8A 4R9NA 3R76A 1MB3A 3HWRA 3TL6A 3NHWA 4OQLA 3CX4A 2ZIXA 1WSBA 4YVFA 3RH0A 3I0MA 4MWDA 4RS4A 2NU8B 3ZLJA 3EVGA 4JJ4A 3CEPB 2CLHB 4QBGB 3KQMA 3FMGA 3TTVA 5JAOA 4F72A 1E2FA 1NVTA 4OQPA 4PLYA 1NI5A 3GRRA 2WAAA 1U1FA 3LUBA 3QMMA 2DH5A 3QVTA 1RXIA 4M1TA 5K3AA 4BNXA 2Y68A 1IZ0A 4PPGA 2FMTA 3TE6A 3PCXA