1IZ7A

Re-refinement of the structure of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 at 1.6 a resolution
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
294
structure length
294
Chain Sequence
LGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE, LINB
publication title Haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26: X-ray crystallographic studies of dehalogenation of brominated substrates
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 111
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2002-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iz7A00
2XMCA 2CZQA 4LHEA 5ALVA 1TK3A 3C70A 2FJPA 2FX5A 4GDMA 4GBGA 1AX9A 3WZLA 5JZSA 1UK7A 3V1NA 1G5FA 2Z8XA 1N1MA 1WB5A 5AI5A 4AMZA 5BWBA 1R88A 2C5FA 5C7YA 1A8QA 4X91A 4N8EA 1XRRA 1CUBA 3KSRA 4P9NA 1H23A 3O9MA 3STYA 2XQFA 2WKWA 5IKXA 2WUDA 2D0DA 3DYVA 2ECFA 4DNPA 2ACEA 1HPLA 3L1HA 2H9YA 2XT0A 3NWOA 1R3DA 1UT6A 2WJ6A 4QDUA 4C4XA 1ACLA 4B85A 3WMRA 2XMBA 2OQVA 2WIKA 4G1FA 4BP8A 3F97A 1QJ4A 4HXFB 3F96A 2B9VA 4MQMA 1IVYA 2C5GA 5AM3A 1QFMA 3R3VA 4UBLA 1Y37A 2Y2UA 1CQWA 4X6YA 1UXOA 1XROA 2DCMA 3PFBA 4U2DA 4B0PA 3FCYA 3NOXA 1AMNA 3B3QA 3H17A 3BIXA 5LKRA 5CMLA 3D4LA 1WHTA 4WFKA 2XE4A 3L1JA 2QXTA 1WHSA 4CG2A 3ZLVA 4X85A 4Y2YA 1LBSA 3BDIA 2EDCA 4G8CA 2WFLA 4BDTA 1BCRA 2WFZA 2WFLB 1EB8A 3BDVA 2VJDA 1AUOA 5AICA 3IUMA 4A16A 2VAXA 2WJ3A 4X3CA 4UPDA 1EDDA 1CUWA 1QGED 5CURA 2AJ8A 5AKHA 4FTWA 1WCYA 3WIOA 4UBKA 4PSUA 4CCWA 4U2CA 2J4CA 1K8QA 4K6KA 4BATA 5JD5A 3I6ZA 1XKTA 2VAVA 4NVRA 2VQ6A 3WK7A 4B83A 4E15A 4XIIA 4Y2XA 7YASA 1XZFA 5FLKA 3WA6A 2HA2A 5FRDA 3VVMA 1AQLA 1XLWA 1U8EA 1PV1A 3I2FA 5A7GA 1ORVA 3H04A 2GZSA 1DT5A 1QIMA 1W76A 1XZGA 1VXOA 1KU6A 3R3YA 5AI4A 4AZ3A 1VZ3A 1O6FA 5JAOA 5ALTA 4G4IA 1U4NA 2VJCA 4LXGA 3W2TA 1CPYA 3BXPA 3R3ZA 5ALZA 3UUFA 5JAPA 3IA2A 1KU0A 3HLKA 4C88A 3TGLA 5ALEA 1R4ZA 3AZQA 1CV2A 3LIPA 1EH5A 1JMKC 1GKLA 3WWPA 5AM0A 4E46A 3ZWQA 3ICVA 1QE3A 4TVKA 2Z3ZA 5CW2A 2VT7A 5K3CA 1AZWA 3A2NA 4J0GA 3QPAA 5ALSA 2WUFA 4YASA 2ACKA 3AIMA 1XRNA 3QBJA 1CUSA 4L9AA 3HABA 5BWCA 3AIOA 1D07A 3F8SA 1JU3A 1QTIA 1QOZA 4Q3LA 2HA5A 5AKJA 4OB7A 5LYYA 4EBBA 4KAJA 4UHCA 1CUUA 4AN0A 5AKGA 3FSGD 3MUOA 4Q34A 4KAAA 3GZJA 5ALJA 1EI9A 1TIBA 4L3WA 5HFAA 5EHQA 2V98A 4GHWA 5DWDA 3ZI7A 4LXIA 4A5SA 3A70A 3QPCA 1FFDA 2PU5A 4WDQA 5K3BA 4B84A 4BVJA 1K4YA 4JUIA 5I8PA 3I6YA 2R8BA 1GQRA 2DQZA 4OU5A 4C4YA 2JIDA 3E3AA 4H7JA 5AKIA 1EK2A 2QT9A 4UBJA 3BJMA 3STXA 5AKYA 3FYUA 3GBSA 2QJRA 4AB1A 4KE8A 3O95A 1ODSA 1VZ2A 2PUHA 1QIGA 2PU7A 4KAFA 5FXMA 1YB7A 1H2ZA 4B81A 3I2KA 3WWCA 3G0IA 2WHPB 1MT3A 2WU4A 2YASA 4C87A 4OPMA 3CN9A 1YB6A 1LPSA 3ICWA 1IUOA 4Q82A 2IX9A 1H2YA 2ZSIA 4X00A 3C6ZA 5ALOA 5C8ZA 2QUAA 4N5IX 2B61A 5AM4A 4YPVA 2HDWA 5ALRA 4ITVA 2GBCA 4Q05A 3RLIA 4PV7A 2DHCA 2HA6A 1ZD5A 5JANA 2QUBA 5FP0A 4H7EA 4PF1A 4PSDA 2PSDA 1S8OA 3I2GA 2QXUA 4GEGA 3DS8A 4MYSA 1XZMA 5HK9A 5ALHA 3C6XA 4UHFA 3EBLA 1XKLA 3BJRA 2WSLA 4H7HA 2QJWA 2HA3A 4EY6A 5CXUA 4FKBA 1X2BA 2QMQA 2ZJFA 3G8YA 3WKDA 4WDRA 2ZSHA 4IH1A 2XUHA 4OD0A 2B4KA 4BDSA 1W1IA 4MXDA 1EVQA 5FUMA 2J3QA 2HFJA 1EK1A 3ZPXA 1XQVA 4QE3A 1ZOIA 1TRHA 1WB4A 1FFBA 3D5EA 5AI6A 3S2ZA 4QLOA 3LIIA 5JZBA 1UKCA 2RGUA 4BVKA 4FLEA 1F6WA 3QPDA 1QIEA 4GECA 4MQLA 5IVIA 2WUEA 1AC5A 1SCKA 1LZKA 2GYUA 2ONCA 4G5XA 5CTAA 3ZLTA 1CUZA 2V9ZA 5DLPA 1ISPA 5E4JA 4KEAA 4WY5A 3I2JA 2PSHA 3R40A 3PDCA 3QVMA 3HZOA 5AKXA 3V1MA 2EEPA 4B80A 5BV7A 1GPLA 3FAKA 2WHQA 3PE6A 3RK4A 1BRTA 1GT6A 1XZAA 1XZDA 3H2GA 3RM3A 3PF8A 4ZGBA 5DTJA 1LPMA 3R3XA 4BC1A 3MVEA 3IVMA 3VJMA 4FFVA 3M3DA 1XRMA 5AOCA 1IZ8A 2OCKA 3D2BA 2VJAA 3E4DA 5D7BA 1P0MA 4C6HA 1CIJA 4ZRDA 2PPLA 4D9JA 1CUCA 1MNAA 1OXMA 4B7ZA 3C5VA 4N5HX 1R50A 1F0PA 3HSSA 1MX9A 2WHRA 1E8MA 4UBNA 2O7VA 4JYMA 4S0XA 2Z8ZA 1LPBB 3K6KA 2OAGA 4MYDA 4EHBA 4QWWA 1XQWA 2WQZA 2BKLA 5K3FB 1CLEA 1XZEA 1WM1A 4MEAA 3FYUC 1J06A 1CUYA 3B12A 3LCRA 1UK8A 3H18A 1G4HA 3W06A 4X97A 1C7JA 5DYTA 4BBZA 4Y2VA 5IVHA 4G8BA 4Y2PA 1OILA 4AZ0A 3HC7A 1AKNA 2E3JA 2V96A 1CUVA 5CT9A 1BS9A 3I28A 1U65A 4B82A 2G5PA 5AP9A 2PKYX 3V1KA 5ALFA 4MWTA 1FFCA 4TGLA 3HEAA 3FNBA 1YS2X 4BVLA 1MN6A 2WM2A 5ALWA 5K3DA 5ALMA 2ZJ7A 5H3HA 2X8BA 4WFJA 3QH4A 3I2IA 5CXXA 2QKYA 3H2HA 1LPNA 1XZBA 3B5EA 1CUAA 3KXPA 4Q3KA 1UZAA 4OUKX 4BRSA 1RYYA 3HYSA 2WG0A 4CI9A 2OQIA 3ESAA 4X95A 4HZGA 1MX5A 1LLFA 3LS2A 3FSGA 1XZCA 3VJLA 3G0BA 4G8DA 3DJYA 2H7XA 4DYHA 2HIHA 1DWOA 1Y7HA 2WUGA 3V48A 4FBLA 1BROA 3DQZA 4DSZA 4X90A 5E4YA 5K3AA 3AILA 5IVDA 3WKCA 4QLAA 2PUJA 4G9EA 5HF6A 2HHAA 4BTLA 5HCUA 2OG1A 4Y2TA 4BB0A 1EX9A 3H0CA 5DYWA 4B9EA 1UOOA 3EIOA 4AO6A 4W63A 2R11A 5CT4A 4W9RA 2XMZA 4Y2UA 4AMYA 1CVLA 1QIDA 1ZJ4A 1MX1A 2XUOA 4OB6A 1K5PA 5AK4A 1XRLA 4H7DA 2NW6A 4I3FA 1XZIA 1GPNA 2ZYHA 3D59A 5CBKA 5LZ9A 5LZ8A 3ESCA 2UZ0A 4DNFA 2W6CX 1VE6A 2X5XA 4JNCA 2RHTA 3WIBA 3A6ZA 1TKRA 5EHNA 3EF3A 3Q8WA 3FWHA 1VOTA 2DSNA 5CH8A 3IUNA 3JWEA 4JH0A 1ZIXA 2BUAA 3IUQA 1W6RA 2GBGA 4H7FA 5I7UA 3G9TA 5ALPA 2YYSA 5KWIA 1JT2A 1C4XA 2AXEA 3VDXA 5JD6A 3DKRA 4DGQA 4HXGA 2Y2VA 1LNSA 3R3UA 5AKLA 2XQKA 4CG1A 3H1BA 3QM1A 3C87A 2HL6A 4AO8A 4ZV9A 3G9XA 4X7BA 4KYVA 4W1RA 5JD4A 4B0OA 3STUA 2XMQA 1CEXA 3DDUA 2O2IA 4Q3OA 4U2EA 4NZZA 4J0HA 1EB9A 3NUZA 5ALNA 4XWGA 5LLSA 4C89A 1XZKA 1A7UA 2AJDA 2V97A 3DOIA 3R0VA 2PL5A 4BAZA 2YH2A 2RAUA 4UBOA 1E66A 1IUNA 1UWCA 3WJ1A 3A2MA 5ALLA 4N8DA 4BP9A 4GI1A 4DTCA 4H77A 1YSCA 2WTNA 1JJBA 3C43A 5KBYA 1NU8A 2XUIA 5C8XA 2C58A 2WILA 3STVA 4INZA 3LP5A 1H2XA 5DTIA 2DQYA 3R3WA 2XMDA 2OCLA 3WK6A 1WPXA 1AGYA 4YX9A 5ESRA 5JAUA 5SYNA 1THTA 4X71A 1YR2A 5EHXA 4J03A 4O08A 1I6WA 1LGYA 2PM8A 3AFIA 4HAIA 4QEKA 4RNCA 2DHDA 5C8VA 5FKJA 3H2KA 1BE0A 2WFMA 3C45A 3C8DA 2JEZA 4DMKA 2WJ4A 1ACJA 3OG9A 1YAHA 4TPKA 5AIAA 3K9BA 4BZZA 3OTQA 4DMFA 2HU7A 1AURA 5AHXA 4K2AA 2XMGA 1USWA 4W1PA 4IH9A 3EQ7A 2Y6UA 1DQYA 2QRUA 3C5WP 1TCBA 4GW3A 2JF0A 1NX9A 2BUBA 5ALQA 3O0DA 3BL8A 5BOVA 3WK8A 2PVSA 4M0EA 3GUUA 1ZGBA 5HK8A 2XUJA 4OU4A 2FUKA 5D3ZA 2IIVA 3HXKA 2WHPA 3M83A 5JARA 1E8NA 2XDWA 4J0KA 1JFRA 3G0GA 2OGZA 4FBMA 1JKMA 5AO9A 3JW8A 4NMWA 1HDEA 3O9VA 3FLAA 2JGKA 3VKFA 3WQHA 5DJ5A 1Y7IA 1XZLA 4BYMA 2WTMA 1XQYA 2XQJA 3HACA 1ODTC 3BE8A 4HTAA 3X3HA 4ZREA 4IQ4A 3M81A 2WG1A 1HQDA 3DLTA 2VATA 4FLMA 2JGFA 1ODCA 4H35A 3N2ZB 3OURA 1Q0ZA 4F60A 3FVRA 1CRLA 1G42A 2O2HA 4U2FA 5ALUA 1HL7A 4J0IA 5CT5A 5FPQA 2OCIA 4FMPA 1ZI9A 2J3DA 2JGIA 3ZLUA 4GWLA 1XRPA 1WB6A 1LBTA 3UMJA 5DNUA 4OSEA 2HM7A 1TCAA 5CT8A 5CRIA 2H1IA 2XB6A 4W1QA 1VA4A 5D3KA 1DTEA 5AK6A 3WLAA 1JJIA 5IVKA 1YASA 3A2LA 1BU8A 1F0NA 1YA4A 4W1SA 5IH7A 4PSCA 1SCIA 1K63A 1QZ3A 3WYDA 1UK6A 3L1IA 4Y7DA 1N5RA 1KEZA 1QTRA 1P0IA 2OLEA 1L7AA 2I3DA 3FVTA 5EIAA 4BE4A 3E0XA 3IURA 4H0CA 1EXWA 1QONA 4IO0A 1ZJ5A 2D5LA 4BAGA 1C7IA 5AM5A 3H2JA 5LZ5A 3O4IA 4EY7A 1EVEA 5LIPA 1GGVA 1SOMA 2AJBA 1VKHA 4FFWA 3AZOA 3IUJA 1T2NA 1N8SA 1UK9A 3I1IA 1TAHA 4WY8A 2DFPA 3WZMA 3G0CA 3D2CA 2XMSA 4KE7A 1QLWA 2IITA 2VF2A 1R9NA 1CQZA 4Q1VA 2CMFA 4OCZA 3WA7A 1IMJA 1DU4A 2WIDA 4ROTA 4EY5A 1CUEA 4KE9A 4L0CA 1PJAA 3W04A 2YXPX 1K6EA 5JAHA 3DOHA 4X6UA 4FNMA 4P92A 3BWXA 1M33A 4WJLA 3VJKA 3OM8A 4J0JA 4BC0A 4EY4A 2GZRA 5T4EA 4XX1A 2EDAA 4UFNA 3STWA 3UUEA 1DWPA 3RARA 4Y2JA 4WFIA 2ZJ6A 2RHWA 5EGNA 1VJ5A 3HI4A 2WIFA 3EQ8A 1GXSA 1ETHA 4KACA 1E3QA 2ZVDA 3K2IA 3C8HA 2O2GA 1VLQA 4A23A 3C6BA 2AJLI 4OYYA 4CIAA 1A8SA 5K3FA 3WL6A 3PF9A 1YS1X 2HFKA 2RIPA 2XUGA 4KE6A 5T4HA 4CFSA 4DNQA 2BFNA 5HQ3A 2VA9A 5HQ3B 4QWMA 4HRYA 3WL7A 1UFOA 5T4FA 3U1TA 3AINA 4EUSA 3IIIA 3NGMA 3BF7A 1VE7A 4DM7A 5HF8A 3ESBA 1QIJA 1MAHA 4LYEA 2J4FA 5C81A 5JYCA 4CG3A 3ANSA 4XVCA 4NS4A 4L72A 2GBIA 4QDTA 2G63A 5A7FA 2Z5GA 1XRQA 1ZI6A 4AQDA 5HF9A 1TQHA 2RONA 3FOBA 4BCBA 2BGNA 4Y2SA 4K6HA 4FHZA 3G02A 5ALDA 2BGRA 4IH4A 1W75A 4H7KA 1Z68A 2WU3A 1WPRA 2P8SA 3IDAA 4ZV7A 3G0DA 1JMYA 5HKBA 3WKAA 4BCCA 5T4BA 1FJ2A 2Y6VA 1EHYA 5CT6A 1JU4A 4MEBA 3WKBA 2OAEA 2HRRA 1R1DA 5JALA 3HRHA 2Q0XA 2JGEA 1E8DA 4UFOA 4CCYA 3D2AA 2XUPA 4ZWNA 4CCYB 3IB3A 5HFNA 1QIKA 3QMMA 5I9IA 2GBFA 2XUKA 5F4ZA 2ZYIA 4HVTA 1IUPA 4UBIA 2ORYA 4Y9SA 4BZWA 5KWJA 2DR0A 3P2MA 2XI4A 1EINA 2B20A 2CJPA 4WCVA 1H22A 4UBMA 5LZ7A 2XQGA 1QIHA 1J1IA 2QOEA 2VT6A 3WWDA 3IBTA 5K5EA 2VTVA 1W4LA 3H1AA 2ZYSA 1YAJA 4BRZA 5FV4A 2C0PA 4FDMA 2HA7A 5JATA 2I78A 1BCSA 3PI6A 4DIUA 4RE5A 1BN6A 2I03A 3I2HA 2BCEA 1XLUA 3FBWA 5JASA 3PFCA 1SC9A 1UOPA 1B41A 1IZ7A 1L7QA 2QS9A 3DCNA 1L7RA 4UHEA 4OYLA 3WK5A 1T4MA 1GPKA 3O4JA 4DMHA 3DKKA 3W9UA 4K6GA 1LPAB 4F21A 3D7RA 3SK0A 3FCXA 3PICA 1MPXA 2I3ZA 2QR5A 5EIEA 1J2EA 3QITA 5AKEA 1FFAA 2CBGA 1EDBA 4UFPA 3KDAA 4JEIA 2QZPA 4Z49A 4ARBA 2CEKA 3OPMA 1RP1A 2LIPA 1CUFA 1MJ5A 1E89A 3QMVA 4AO7A 5KREA 1LPOA 3U0VA 3BF8A 2K2QB 5AKKA 4BCDA 3RKSA 2OCGA 1ZGCA 1WOMA 5JIBA 4UHBA 4RE6A 4PO3X 5DNVA 3PUIA 2XUQA 4C01A 2ES4A 4DSAA 3DL7A 3OOSA 5AI0A 5A71A 3WJ2A 4I19A 3CCBA 1NU6A 3WI7A 4MWSA 4ETWA 1QO7A 4J0DA 1MNQA 1SFRA 1UKBA 1SCQA 4GLBA 4HXEB 1DX6A 1CFJA 1MO2A 3SC2A 3W9BA 4EZIA 5CH5A 4X6XA 2QVBA 3GA7A 3ANTA 3WYNA 2JBWA 3G7NA 3WL8A 1CUXA 3QYJA 4B6GA 2BAGA 2OGTA 5AI8A 4G4GA 4P08A 4RGYA 2PSFA 1LPPA 4LXHA 5HF5A 4BTVA 3QMWA 1F8UA 2JGMA 4E14A 2JGLA 3VXKA 4EA6A 2BUCA 4F5ZA 5ALGA 1BN7A 4PQEA 2ZYRA 4J7AA 4PNZA 2WLSA 4XJVA 4U2GA 3QZUA 1BEZA 5AK5A 1CUJA 3M82A 1A88A 4Y2RA 5A2GA 3I6MA 3KD2A 4QNNA 5EI5A 4ZI5A 4ARAA 2WIJA 4FNGA 4F0JA 3TEJA 3G9UA 2XLBA 3ILSA 5CH3A 3CXUA 2GYWA 5EIHA 4X92A 3C6YA 1N5MA 2OXEA 3DL4A 2BJHA 5FDFA 1U2EA 4LIPD 3TJMA 1DWQA 3VISA 5J3JA 3IULA 5JADA 1QIIA 3AJAA 1J07A 3HJUA 5AOAA 4DMCA 4Y2QA 4QDOA 2FJ0A 1QO9A 1YCDA 4EB0A 1DT3A 4UHDA 3D3NA 5LZ4A 3FYUB 1OCEA 3CN7A 4N8SA 1QFSA 1BEEA 1X2EA 4BE9A 5HKAA 2VJBA 2C4HA 1GQSA 3WWEA 3LLCA 5ALIA 1QIFA 1ZD4A 3FLBA 1P0PA 5HZGA 3KWJA 2XLCA 5LP1A 3BIWA 3GFFA 1MTZA 2XMRA 1VA5A 3D0KA 4UUQA 4FLFA 5AM1A 5K3EA 4P93A 3TRDA 1R9MA 2W22A 4UHHA 4DNOA 1CUHA 1Q0RA 2WG2A 4X93A 3CCCA 1ZIYA 1MAAA 4BAUA 1PFQA 5AOBA 3DYIA 2CKMA 1W52X 2HA0A 4B9AA 1XFDA 3ED1A 2G5TA 1DINA 6YASA 4CIBA 2HA4A 2WIGA 5LKAA 5LZ2A 5EHZA 2PSEA 4J3JA 2XQIA 1O6GA 2JGJA 3AUKA 3DEAA 2G4LA 1TCCA 1XLVA 4J0CA 4PW0A 3ESDA 3GROA 4LKOA 5ALYA 2AJCA 2PBLA 4G4JA 1X70A 2Y1KA 5DNWA 1ZD2P 3Q0TA 2JEYA 1CUDA 1ZICA 1XZJA 3DD5A 4AN1A 5ISMA 1B6GA 3WKEA 3F9CA 2XUAA 2OPHA 1CR6A 4YK7A 4GXNA 5ALXA 4G9GA 1RWQA 3SWWA 1HKHA 3MGAA 3EQ9A 4FWBA 1GKKA 4H7IA 5AI9A 2QTBA 3VVLA 1E5TA 4QZVA 3STTA 1VXRA 3W05A 1DQZA 2C0QA 2GYVA 3F98A 1EDEA 1JJFA 3T4UA 3N0TA 5AM2A 1LZLA 4AX4A 5AKZA 4RPCA 3KWFA 2HU5A 1UOQA 3V9AA 1Q83A 1THGA 4QDXA 4X94A 1YA8A 4HRXA 1DX4A 2RI6A 3T52A 1MU0A 2HADA 2XUFA 4FOLA 5AK3A 4EY8A 2CUTA 2Z3WA 1CUIA 1XZHA 2ROQA 5AIBA 5A7HA 5AH0A 3YASA 4KRYA 5A62A 1FSSA 3O4HA 3PUHA 4QA9A 1FFEA 2X76A 3WL5A 5JZ9A 2XUDA 4IHAA 4M0MA 4V2IA 4QDZA 5YASA 2H7CA 3KOOA 2HU8A 3MUNA 3OC0A 1UKAA 3FYTA 2PX6A 4KR0A 5E4TA 5D6OA 3DNMA 4HS9A 3H19A 3R41A 2VSQA 1P0QA 1ZI8A 3SX4A 4DLNA 2HRQA 4LYDA 4ZXFA 3I1YA 3S8YA 1CUGA 3AIKA 2CB9A 3H2IA 3O4GA 4AXBA 1A8UA 4E11A 1HBJA 3AZPA 3JYHA 2H7YA 4I4CA 5SYMA 2DHEA 4M0FA 3E1GA 5EFZA 5FOQA 1Q84A 5DYYA 4OB8A 2OGSA 3WK4A 1G66A 2O7RA 3GELA 4H18A 3V1LA 1ORWA 4JYPA 1ZD3A 4C4ZA 2QM0A 3WWOA 5AJHA 4KRXA 5A6VA 2VEOA 1H2WA 4U2BA 1HLGA 5ALKA 5E2IA 1EA5A 1GZ7A 4KJXA 4MJ3A 1JI3A 3WK9A 3ZV7A 2PSJA 3FLEA 2C7BA 3G9ZA 3F67A 5FPPA 1XQXA 4K5QA
chains in the Genus database with same CATH superfamily
1QH8A 2OE2A 1ULZA 4MITA 1PFWA 1QGUB 3C5HA 2CZQA 4BB6A 3CVYA 4LHEA 3C70A 5JSQA 3K0CC 5LR6A 2A9QA 1K7CA 3NNSA 3GG9A 1L7OA 2IUEA 3K1AB 3MAAC 4G01B 3W79A 4ZQBA 5BXYA 1WUHS 2I2DA 4HNQA 5PNTA 2D7JA 3RSZA 1U63A 1Z82A 3TFOA 1MVOA 1C0KA 1NYRA 1M67A 2WABA 1N25A 2XA9A 1XTQA 2C7GA 4N6GA 4X66B 3ZCSA 5AI5A 5BWBA 3NHPA 5C7YA 2R2AA 2Q1SA 2O2XA 2FZ5A 2W83A 3EMDA 3GUZA 4HDMB 4O25A 3AJDA 3BMNB 3UWMA 1M2JA 1RQGA 1Q20A 1QGYA 4N8EA 2OBMA 3KJQA 3K09C 2IS4A 1U11A 2VJMB 3KSRA 4M36A 4P5PA 1QGOA 2ZSKA 2WKWA 1G6KA 3BD6A 4QUJA 1YCFA 3OPNA 4LMBA 2WUDA 1WY7A 2F3RA 2D0DA 2H5EA 2YHAA 2ECFA 3A1NA 2IHKA 3Q5DA 5TEVA 2ACEA 2A5LA 3DB2A 5LN1A 3JRWA 3OAAA 5F3WB 5KKAA 3L1HA 4UTXA 5IEBA 2PWBA 2V7BA 3CEAA 3OLZA 3DZJA 2N1BA 5IBQA 3TTXA 3CINA 4I3HA 3DHWC 2QSZA 5FBQB 1Z62A 1HG0A 1XL1A 3TUJC 4C4XA 2QM8A 1ACLA 1N9GA 4FR0A 2LW7A 2VDJA 5LCXA 4GMHA 3UWKA 1NYTA 2DPLA 4IHKA 1PBNA 1E1RA 2XF8A 4J6FA 4D0SA 1SVWA 4GOKA 3ZS9A 2B8NA 2GZAA 5FNZA 4IGEA 1WMDA 3L8ZA 4BO0A 2BR3A 5FL7D 3LO8A 4DZZA 1A4IA 3F96A 2B9VA 3ZHTA 3E0QA 3RS0A 3KBOA 4EAQA 1EZ4A 4LOKA 4MQMA 1IVYA 4PLTA 2AYYA 3KYIB 2OBYA 2F00A 4DCJA 3NTVA 1AQIA 1GILA 3R3VA 3T15A 3ZYZA 2Y2UA 5JXHA 1JA0A 5TIIA 2CD9A 3UAGA 4CJXA 1ST2A 4WASA 4BV3A 2XDQA 2DCMA 3WHIA 1G6HA 1KAMA 2AZXA 1FUKA 3ABZA 3FCYA 5C35A 1EWVA 1YZNA 3NOXA 2A8YA 2ZI7A 2C82A 4XX0B 2WVHA 3SY8A 2IYOA 4ZVOA 1E9AA 3M1IA 1XCJA 2V7QD 4MWDA 5BPHA 4L5JA 2PAAA 4LV5B 1J39A 1SC1A 3BK1A 4P82A 5FQNA 4DLWA 1Q1ZA 3I01M 1FUYB 2C2OA 5CMLA 1WHTA 1JHAA 1RHUA 4AUNA 4WFKA 2XE4A 2YBDA 4L5CA 4EHNA 2P0AA 2HWYA 3BREA 1WHSA 5CU7A 3VV2A 5IXYA 2IIBA 3ZG6A 1KF0A 2W4MA 3IVAA 1GNSA 3NBZC 4L16A 1QAMA 4G5HA 1X77A 5DLEA 1KYWA 3LWBA 1GCIA 4IHJB 3HY3A 4G8CA 1NYLA 1VHJA 1BCRA 2FXIA 2WFLA 1ZAYA 1FNDA 3P0HA 3BDVA 3ZW8A 1AUOA 3A1VA 3NYIA 5AICA 3W6ZA 4A16A 1MEEA 4YJ2A 4U6QA 2JCXA 1YBMA 2B30A 2QB5A 5JWOA 1HFKA 4PLCA 3DHEA 2CXSA 3QJYA 1YIOA 2Z56A 5E38A 1CUWA 1ITZA 1A8HA 4LJ6A 5K8IA 4E09A 5CPFA 5CURA 5LBTA 3HRKA 1HYBA 3MQ2A 4CM8B 1G9XA 2NO9A 4BNTA 3ZDXB 4WKBA 3P4UA 5F7XA 4R1OA 3OLVA 2FG6C 1ENYA 1AN9A 4PSUA 3O03A 4GMGA 4CCWA 1HTWA 4CTMA 3O6VA 2WF8A 2C9MA 4MINA 4KKVA 4K6KA 4GMFA 3NRCA 4KMSA 3RC2A 4EPWA 2J41A 4HOYA 4R9NA 1YVPA 1T35A 5TRTA 1SVOA 3CX6A 3FZNA 1U3FA 2TRSB 5DGDA 5LD2C 3B5IA 4O4JA 1SCUA 1T8RA 1O9BA 2QUHA 2YMMA 3B6EA 3FCOA 1KETA 4IDOA 2Y76A 4TXJA 4NVRA 4CM6A 2VQ6A 4YQYA 5BPFA 1AQ6A 2OP0A 1JB1A 1VIYA 2PWZA 3LPMA 5JRJA 5JXJA 4Y7CA 4BX8A 1FYVA 4LF6B 3WGUA 3L7LA 4YP0A 2OWDA 7YASA 2RCNA 1PS8A 3AI3A 2QTRA 1UPUA 2A9FA 4IDGA 2PMFA 5SICE 4ENPA 1DEHA 2HDOA 5JYBA 1Z7GA 1OPXA 5BQ5A 5FRDA 1U8XX 2VKQA 1XLWA 1MO3A 1W87A 1U8EA 3EY4A 3NG1A 3OIVA 1T36A 4HZUA 5KTKA 3VYTB 1P74A 5JQGF 4ZC1A 1UKEA 3CX8A 3H9BA 2IX3A 1Y6FA 3IMGA 2WWVD 2BV3A 4F4IA 3VR4A 1DO8A 2OD7A 3FUTA 1TZCA 1DO2A 3U6KA 2GZSA 3RHZA 1T5TA 2QX9A 4HG2A 3S40A 4CKEA 4HDSA 4I99A 3AR5A 1UPXA 3T0IA 4MRAA 1XZGA 1VXOA 3BERA 2A9OA 5U4QA 2A2ZA 1M1YB 4DG8A 5CEFA 2QVLA 4JL8A 5T3UA 1S3GA 2JIRA 3VUFA 1ADJA 3HCDA 1O6FA 3RF6A 3ZCTA 4C0QC 1PJSA 5DLQC 5ALTA 5FR2A 1G60A 1U4NA 2VJCA 1J0AA 3OZWA 3WSVA 4JLWA 4BFCA 2AOTB 3OKFA 3BXPA 1ZC3A 1DADA 1QZUA 1CRWG 3VR4H 3KQWA 5KPDA 1QTQA 3HB5X 3ZUGA 1N6LA 4RAQA 1KU0A 3GPDG 3JQFC 1GYPA 4CQLB 3SBXA 1HYGA 3FKSA 4MWZA 2HWKA 1RWNA 4WXHA 3RS2A 3VZPA 2EJCA 1EH5A 5K0FA 1UC5B 1Z2CA 4B3CA 3RC7A 2DBQA 1KY5A 1KO4A 1XTUA 4RPHA 2I6GA 4R1NA 4XUDA 3JQAB 4N3AA 2R97A 3WNDA 3WGGA 3COJA 2KW5A 4LGVA 4L27A 1U0FA 2GCOB 2L18A 5KYUA 3UMSA 1K2WA 4C0BA 1UP4A 2FF7A 3DW3X 2WAYA 4E1VA 4TX1A 2FPXA 2I4IA 4EG5A 1Q95A 2GJ4A 2XTJA 2Z3ZA 3OQIA 2IZZA 5CW2A 4EHHA 3ET5A 3JWGA 1I3NA 5DU2A 1WL8A 3RAEC 4JLMA 1EZZA 3C7AA 3NYRA 4KXYA 4QGFA 1OZFA 1VYVA 3M6VA 1J8VA 4FS3A 4J0GA 1NJ8A 4QGHA 4DSUA 4EDFA 3ANMA 5ALSA 2LCIA 4XEUA 3ZI0A 2IEBA 1ISRA 1FF9A 4GH5A 3HJFA 3BK2A 1T43A 1XEFA 3ITEA 3QKRA 1X1BA 3S5UA 5KVCA 2XBMA 1OAKA 3GFTA 3MFQA 1Z0AA 5H59A 3ROFA 4X8MA 3R8XA 3QBJA 3X1XA 3LHSA 3K9LA 1XZNA 4ZAFA 4DCNA 2AG6A 5C37A 3DWGA 1HNWB 4FCTA 4M37A 4Q4JB 3QU9A 2WWFA 1YJBA 1HL3A 5B7NA 5FPTA 2X8JA 2ZRPA 1ZINA 2JFUA 5ERXA 5JNVA 1JU3A 1REQA 2HPZA 2QDKA 4XKJA 3DTYA 3ECAA 1WZCA 1QTIA 4D4JA 1QOZA 3TQFA 2D8MA 1NI4B 3P9PA 3WGKA 1OLOA 4KAJA 5IBRA 2QIOA 1GZ5A 4Z0NA 1CDOA 3QE2A 4AN0A 1V7QA 2O8NA 2Q6TA 5AKGA 4RVUA 2HC9A 1OAOC 1FS5A 2AC4A 2E4UA 1YRAA 3PR2B 1KFBB 3MMPA 4KC0A 4QNMA 4WLEA 1XNHA 821PA 3DMRA 5DGCA 4EA8A 4Q34A 4KAAA 4QJ5A 4ZP1A 4C78A 1TUEA 4YUZA 3GLFE 2PZ8A 1TJ4A 3GGSA 2X1HA 3W90A 1YBFA 3B53X 1NJFA 4JL6A 3CEMA 3DF9A 1X9HA 7ADHA 1E1RD 2C3PA 4JJGA 4GHWA 5DWDA 3ZI7A 1EWRA 2I8CA 2XADA 3HB4X 5F7JA 2IEIA 1Z88A 3H1GA 4Z9YA 1XZQA 4QYWA 4YJGB 1KI6B 2FLVA 3DCIA 4I5FA 2O5EA 4XLLA 1X7ZB 3DTNA 2J3JA 3ZR4B 1Y5NA 2V5AA 4CI0B 2AZ4A 4WDQA 5K3BA 4JC0A 5JRDS 4FUTA 3LHFA 2BFMA 3NTRA 2Z83A 3OX1A 4ICIA 2P91A 4ZCRA 4OU5A 3V7FA 4JLSA 3E3AA 2QYTA 1G4AE 8ATCA 1Y7PA 4JLKA 2PJRA 2J3EA 5G0VA 3PIRA 1L5MA 4WE3A 2RGAA 3EPHA 2H59A 3AHHA 3JRNA 4D80A 4YR7A 1RADA 1MEJA 2O07A 1G19A 3KDPA 4A2QA 1UH5A 4LYAA 1XTZA 1E94E 4CQMB 2UDPA 5EJ9A 3Q98A 4I50A 5AKYA 1W5BA 2OV1A 3FYUA 3GBSA 3PXDA 4KQJA 3PLRA 4K3VA 4KTVE 4GC5A 3BWEA 3W1WA 3O95A 3DQQA 1ODSA 4Q16A 1VZ2A 3NXSA 4Q19A 1I7SB 3FXAA 1YCHA 3PS9A 4KAFA 3U7IA 1ULBA 3FNIA 3GJZA 3MJCA 3Q3GE 2PO5A 3NYWA 5EGSA 5HA5A 3DONA 1MCZA 2CBZA 3W7VA 1Q2XA 1D1PA 1Q5PA 1Y3HA 2Q62A 2RGBA 2X58A 5KSZA 2GSDA 1VL1A 1WBBA 3I2KA 1CCWA 1ZUWA 2V5VA 4MS3A 4WINA 4TSRA 3WWCA 4ZKDA 1I5OA 1U7WA 4TV8F 3U26A 2Q2QA 4PC1A 4TYPA 3SF8A 1MT3A 3DDHA 3C24A 2V3CC 2YASA 2F3UA 4ZOEA 4C87A 2XUZA 2VSNA 3VHXB 3L77A 3INNA 4YQFA 4LJ8A 1XHFA 3OX2A 5JSUA 1ZH2A 4F5YA 1C3LA 1OZHA 4XRRA 4LQ4A 2V8BA 2C8JA 4Q82A 3QF7A 2R2GA 4ZHQF 2RKOA 2CCGA 2YZMA 3LD9A 2IX9A 5JS2A 3ZTYA 1YDMA 2RGRA 2R6GA 3PFHA 1HG1A 4Z1MA 3ULKA 1CW2B 4QVKA 1UBMS 5MGNA 1YS7A 1XALA 3HDGA 4PQRA 4DHEA 1RU3A 1SK9A 3RRZA 1K97A 1X1CA 1FXWF 2B61A 2HSWA 5TS3A 1L4UA 3U3XA 1QX4A 1IXZA 4HZIA 3NEYA 1F5NA 4AJKA 2FEOA 2VUSA 2IJGX 1I4EB 3LQ2A 1U3VA 5DYGA 3HR7A 4ITVA 4RK5A 1WBJB 3D7NA 2GBCA 3EK2A 3I9KA 5G1NA 2ONJA 3V3KA 5EY5B 3GB9A 3BWVA 3PCXA 4H1WA 2OV8A 4JI7B 2FZCA 1UADA 5JFTA 4Q05A 2VJKA 1K7EB 4OYHA 1EFPA 3LC0A 4NJMB 3V97A 3VR4D 3OCVA 4PV7A 3X1JA 4ZYYA 4J76A 3JVUA 1ADFA 1ZD5A 3O38A 3AB8A 2VLBA 3L4BA 1H65A 3CF2A 2F48A 1IB6A 3CUWA 5BQ3A 4MWOA 2GXSA 2QUBA 3GC6A 4IQFA 4WESA 2VYCA 2H85A 4MP3A 2YV5A 3LWZA 2R84A 4PF1A 2QTAA 3WGJA 2OXTA 2J8ZA 3LVQE 1WB9A 2QE7A 1UZNA 1I1QB 2V55B 2VPWA 3ENWA 3I32A 1LSJA 1D5WA 3JQ7A 2UUOA 4GEGA 4RIEA 5C8YB 3NDBB 3OIUA 4HEA1 1RABA 4FX5A 2VP0A 1JLLA 4FE7A 4L50A 4U0KA 4F5WA 1UBNA 1IZ0A 3VR1A 2O8DB 1I01A 2FI1A 4Q7KA 4PG4A 4IWNA 1GKIA 1XKLA 3BJRA 5KNDA 2GM5A 2B1QA 2HJ9A 2YTZA 2Q8QA 2XIJA 4FK8A 4TWZA 1GRNA 2ZITA 5IBPA 2GF9A 2HA3A 4EY6A 5BWMA 1FX1A 4AMUA 4FKBA 4D45A 2DY0A 5EJ7A 2FETA 1OLXA 1R0LA 3D5QA 5GP1A 3VU9B 3D7KA 2R96A 3I9V1 2FW9A 3DQPA 2X6QA 4WDRA 5FUBA 1M6YA 2L19A 5LQJA 2YRXA 4W5RA 2WWHA 5KNDH 1KVUA 4R8SA 5J40A 3DP7A 5LP6F 1VIAA 2PL3A 5GM1A 2B4KA 2FPSA 2JJ8A 4BDSA 5EUMA 4EMBA 3T7EA 2V3VA 1C7RA 3NP9A 5HJEA 1M9NA 3G7SA 4MXDA 2VP2A 4YMHA 1WKCA 2A1UB 1R0BA 2J3QA 2QTZA 4QOJA 2HFJA 5T67A 3UM9A 3ZPXA 4EX6A 4K86A 2XZDA 4ZAXA 2P0YA 4MVXA 1UZLA 4L4SA 3RSQA 4QUAA 1UM9B 1U2GC 4XLTA 3PXCX 3UMVA 4BP3A 1FFBA 3DVAB 5AI6A 3O7WA 2Z2KA 1YKGA 3IQZA 2VT3A 4FNOA 1QJCA 1X8KA 3LY5A 3QUTA 5CA0A 5SY4A 2X3FA 5MN6A 1U7ZA 2J9RA 5A06A 5JZVA 3CX7A 1YDWA 4LGCA 1P9OA 1OZAA 4RJ2A 2CNKA 4LOLA 2CNWD 2FPGB 1W0JA 3LIIA 1YWGO 4RF2A 4WZBA 1G98A 3U4MA 3PGLA 2C4MA 4GM4A 3U4GA 1K1EA 4QYXA 1EUCB 1G3QA 3PKJA 4GF5A 1Z12A 2JJ1D 3ZWYA 1XCBA 2WNIA 4OHMA 2EP8A 2J6CA 3BB1A 1QIEA 3ITNA 3R1IA 3DM9B 4EFKA 5DISB 3TDKA 3S4YA 4CLRA 2JAPA 3R6LA 3Q12A 5JMPA 2ODNA 2HJSA 2RHGB 2IZOA 2HAEA 4ZOAA 3H4VA 4OH1A 2KYRA 1LZKA 2GYUA 2LUOA 4G5XA 3HCBA 1XX6A 3AESB 1WQ1R 4I1SA 2Q2NA 2QUJA 3O26A 2XF2A 5L7YA 2ZROA 2GPTA 1EFVB 1EPUA 1O97D 2A3NA 2WAOA 4JGBA 4URFA 2X0FA 1CUZA 3GOHA 3MRVA 2DFDA 2Y0DA 3G6WA 5IBCA 4LXQA 4YAGA 1GZDA 1YZHA 5IABA 1YK1A 5CDGA 2FSGA 2PNJA 2F17A 2W71A 2JW5A 4I46A 2ZR9A 1M6VB 1R6DA 1NMQA 3D8NA 3AKCA 1PV2A 1B7GO 3EISA 3FRHA 3I2JA 1G3MA 3PDCA 1IWOA 3R40A 4OQXA 4X20B 3QVMA 3V2HA 1E3EA 1PQPA 1WVMA 2OD2A 4Z2AA 4DCUA 1OH8A 3FAKA 3PE6A 1IG0A 4JBIA 5IRCD 3ETLA 4YJHB 5GVRA 3KR1A 3RK4A 4H3SA 5A3QA 1EGQA 4JLVA 3F9IA 3IVRA 4JUDX 4LCEA 3U7RA 3C3YA 4NH0A 4QOFA 4UNSA 2GM9A 3DFFA 5H3LA 3MVEA 1IBRA 4KXUA 1FDWA 4P22A 4YJFB 2DSTA 1G8AA 3AERA 3SM3A 1N0WA 1UEJA 4J1TA 1WBDA 2BGWA 1B1CA 2CFTA 1J5XA 3BMXA 4FFVA 1NN1A 2PRSA 2HUNA 3CZ9A 5KQPA 2O1EA 4TM8A 4OG2A 4XUGB 3SYRA 1G0OA 1O1YA 4X3PA 2D4HA 3KJIA 4DTIA 3D2BA 2WLTA 1PNQA 4TRMA 2BY4A 1P0MA 4I5IA 4AMVA 4X1KB 2EKBA 4C6HA 2ETXA 4TXLA 2QLLA 3K30A 4KHPB 5DBGA 3E7PA 2R7NA 4WCFB 3R7FA 1PZHA 1S2NA 5CPBA 3HG7A 3EIEA 1UINA 1CIJA 3QV1A 5CAEB 2C57A 4EI8A 2PK3A 4UAVA 4D9JA 2DP4E 4UUBA 5GV8A 1MNAA 5DSTA 1DLJA 1MAUA 1TKBA 1CLUA 2I4NA 2OVBA 4RLSA 1YBAA 1YE5A 3FDFA 2OZKA 3C5VA 4HDNB 5ER9A 5AR1A 5BOSB 5MDHA 1I4LD 2XE7A 4MVJE 3RJ9A 2ZIAA 3KTAB 4UU7A 5F5XA 3PJRA 2VT2A 3P32A 5DK4A 1F0PA 1MFPA 5A9TA 5JYDA 1OY1A 2PR2A 3EVNA 2PUGA 1X80B 2HB6A 2CZCA 2PX2A 1NLZA 4RWZA 2OHHA 1NUTA 1TB4A 3B2NA 3T34A 4JP3A 3K6KA 4ALLA 3PEWA 3Q0IA 3A3KA 3B38A 4CKZA 1I4OA 1NBMD 3M4NA 5AUOB 1XQWA 2PJZA 2Q4EA 1U8AA 3B5JA 3HYCA 5B1HA 5D01A 1PVOA 1JIUA 3M6AA 2HBYA 4IY1A 1E99A 2B2NA 1CRZA 2JGDA 1TW3A 5IMBA 4KI7A 4IX1A 4NCKA 2YV3A 4YRDA 5DFAA 4ZVTA 3FYUC 1W8IA 3W4JA 3UOWA 4IGFA 4WNIA 1Y8CA 4JUFA 3VO8A 3WADA 4DLYA 5LDHA 3SJCA 2C77A 4FBGA 2RJ3A 3B12A 4Z4QA 3ZCQA 1U9YA 1Z29A 5I7AA 5DEOA 4ZDJA 2EHJA 2HTEA 2ZE8A 2YIDA 4HTFB 4X97A 5HIIA 5DYTA 3W06A 5I9TA 5K8CA 4QBHA 4EDHA 2NLOA 1SUAA 2ZIFA 3WLNA 3JX9A 4IUBS 5IVHA 1PJCA 3DWIA 4OHPA 3L8DA 1XYVA 3QUBA 3WP1B 1F7UA 1ZLXA 4JJEA 3P0FA 4AZ0B 1M8FA 4YAUA 1SIUA 4QICA 4IWYA 1YV9A 5J4VA 2ECQA 3WX0A 1BXKA 1ZONA 2ONYA 3NHUA 4FDLA 1YIDA 4JFAA 4CQJA 4AS1A 3KR9A 3T99A 2ZBUA 2F8LA 1VRWA 4ZMBA 4MWBA 1YZVA 2D6FA 5HUQA 2QV0A 2DHRA 1UUFA 3WDMA 1Y89A 1U65A 3I28A 4B82A 1D4FA 1NM5C 3B6IA 2SHKA 3EYWA 4IIGA 5AP9A 5B64A 3TZHA 1RE1A 3O90A 3GGGA 3CFYA 3P1JA 4TGLA 3C74A 4TTSA 4JI5B 2XCOA 5AQ1A 4P53A 2ORVA 1Y6QA 2PKEA 3OX3A 5LBIA 4BVLA 4EM6A 4RJTA 2QPAA 1NQOA 3CH5A 4GPBA 4TTPA 4ZI2A 1L6RA 3TUZC 1T2CA 1V95A 2EATA 2OBLA 2A0XA 5TMPA 1G5QA 3F0TA 1MC5A 3C1UA 2QGZA 4ND1A 4R2WA 4QGAA 3TSOA 2CLOB 5BYJA 2O2CA 4MYTA 3P2YA 3H2HA 3WICA 4C7VA 2G67A 1MA3A 1XMVA 3KC2A 4W4TA 3TLGB 1NN0A 5IYZB 4JI0B 1XZBA 3RIXA 2RB4A 4HDMA 2IHVA 3MCVA 3BMNA 5L4LA 1XMQB 1H4TA 4LA4A 4OUKX 1FRNA 1RQNA 1K7YA 1FE8A 1NJ2A 3O3MB 1RD4A 1B73A 2WG0A 1KYZA 3HYSA 4J4BA 4ZYWA 4LMAA 3K6SB 1O5IA 2EU8A 4QHSA 3QEJA 4XSGA 3SQWA 1AGNA 3ESAA 3GN2A 3KT3A 4P5DA 1B00A 2DH5A 3L4BC 4DA9A 1VLZA 1RIIA 2X9VA 1PCXA 5KJ6A 4RJLA 2VSFA 5DWQA 2DFLA 5D5HA 1R5BA 1CJTC 2HMWA 3LCJA 1P0CA 4HL6A 2QK4A 2QBYB 5G41A 5JSFA 1JYEA 1NW3A 3FF4A 3CQ9A 2ZJ5A 1NDUA 1OV6A 2D8AA 1X94A 3HR8A 4HSGA 4E5KA 1GVHA 1P5FA 1CKEA 4GPIB 1QO0D 3DXFA 1V8BA 3L7KA 3PXAA 4FFBA 3DJYA 1XJWA 1UDAA 3K31A 3FUCA 3PUVA 2HIHA 4G8DA 3QOXA 4M1KA 3ZY2A 1O95A 5FOXA 3TG8A 4L7VA 1ZSNA 1T0IA 4QG7A 1SWVA 4ZU3A 2VYVA 5K3AA 4Q00A 3TIGA 4DSZA 2WMOB 1T5BA 4OK5A 3ZOZA 1YB1A 3ON5A 1O6CA 6LDHA 4PC2A 3PFIA 4MGIR 2NZWA 3AEQB 5JSZA 2J6IA 4GGPA 1KO1A 1OFTA 3NIFB 2P6MA 5HF6A 4JJ6A 4BFWA 3FM9A 3O47A 3OM0A 4BB0A 1EX9A 3H0CA 3QVGA 5CCDA 4C43A 2VXYA 5JJKA 1UOOA 4XX0A 1XKXA 2GN6A 3ODGA 4BGUA 4KIJA 1TKAA 4ZCIA 5B1YA 2WJJA 2UXCB 4AO6A 5T3YA 2G25A 4UEQA 2WMDA 3QVOA 4DADA 1ZH6A 3BX1A 3RHTA 4P7GA 3GZTB 2WI8A 2G06A 3LXRA 4M54A 3QU5A 1SVIA 1KH3A 3ABOB 1P6QA 2KMLA 3MJVA 2FPLA 2ARKA 2VC2B 3KKLA 4OJMX 3D6JA 5DCUA 3VR6D 4CR8A 1GNQA 5BN4A 1XNRB 3ZV3A 2I71A 1TEXA 4QAQA 2ATIA 4Y2UA 2X6RA 2ZB3A 1IBKB 1VJCA 3PKIA 1TA9A 3ZWWA 2VRCA 4IHJA 1UFRA 5F23A 1MQ8B 1MZVA 4ZT7A 1OZGA 3TFQA 2BSQA 4OLAA 4EHLA 5AK4A 2PYIA 4EO4A 1XRLA 4GXRA 4H7DA 1X1TA 1UXKA 4M4SA 1M8GA 2NW6A 3N2IA 3RRXA 1GPNA 2ZJ8A 1S3SA 3NH9A 3M5DA 4RL6A 3AV0B 3VPGA 3T1HB 4NCBA 3OZTA 1RRCA 3Q0EA 3PNMA 4IEFB 3VVBA 3AH8A 4GE0A 4KR6A 4IKPA 1AB6A 4B45A 1KQ3A 5BWOA 5CCXA 1ZK1A 2VWQA 5LXTF 3PDJA 2IEDA 3LQ4A 4H27A 9LDTA 4TL9A 1J5PA 1VGVA 3N7TA 4JKYA 1IHPA 1R66A 3FR7A 3ITKA 4GBED 4JT4A 2WDZA 2GD1O 3CT4A 3I64A 4B09A 2I91A 4DJ5X 3UV3A 1H2RS 2A78A 3A58B 3HYLA 2GJAA 2FP3A 1XOIA 1BWPA 5EP2A 4DCCA 1IAQA 3R0JA 4GVPA 4R5MA 3T9CA 3TOXA 1WVIA 3I05A 4E7PA 1MIHA 5B7PA 4C1BA 1M2NA 2Z5VA 2Q7DA 2VWHA 4O29A 2IV3A 4PYJA 3FWHA 4P1ZA 2DMRA 3JCZA 2AG5A 2IYNA 2FGKA 3PVSA 4P4UA 3WL4A 5JH7B 1EE9A 3HM9A 1DMSA 4JH0A 4D0RA 4QTUB 2BUAA 4INJA 4K9LA 3IUQA 1AZLA 2EFHB 3GEDA 3JTEA 1UM8A 3GJ4A 3H87A 2YDYA 3H8SA 3B52X 3NHMA 3OCCA 1DG3A 1JAIA 1T1RA 3FFBA 4IDFA 2X23A 1NXXA 5G0SA 3RPEA 2HF2A 3KKQA 5I7UA 4AIIA 5BVGB 1JQJC 4UVHA 2G0NA 1NE7A 2H2AA 4LCBA 4BVAA 4NCJA 5KIAA 2HXSA 2H8KA 2IY9A 4WAUA 4EB6B 4LRWA 1KK2A 1C4XA 3VDXA 5BSMA 4BPRA 1P8AA 4HLQB 1FFWA 1C3OB 1NLUA 2OHVA 2C9YA 4HFJA 1K06A 3G2PA 1KFKB 5DBHX 1T5DX 1ORRA 3L3BA 4DG9A 5AKLA 1MJFA 1T8TA 1T25A 3D0QA 3DM5A 1XQ9A 4MPPA 4CG1A 3FZQA 5K05A 2CXNA 2C7QA 2QWXA 1SPBS 1P7CA 5H68A 3VHQA 1KOGA 1KO8A 1I24A 1M1YA 1Y48E 2BH9A 2C61A 3CVWA 2HL6A 3PNYA 3IMFA 4AO8A 5BQFA 2VPQA 4X7BA 3U4DA 4MQ4A 5KQGA 1SKYB 4ZT5A 3STUA 3WOVA 3R9XB 3EXHB 3H2BA 4F3NA 2QRQA 1QV6A 5B3JA 2XMQA 4MVJA 2OFOA 4XWTA 1NNUA 1V16B 1H05A 1U5CA 1T5SA 2OV3A 1ULAA 3DDUA 3ENQA 1Y8QA 3ESRA 3FVWA 3ZK7A 2O2IA 3DV0B 3NEAA 1N34B 2O48X 4HQFA 1BHJA 3P9NA 4U39A 1KZ1A 3OF3A 4U2EA 4LTMA 4CL2A 4NZZA 3I52A 4Q3DA 1XMJA 1LC0A 1CZUA 2VUHB 2E4ZA 1TU3A 2QMUA 3FHJA 4CEJA 4RETA 5B7QA 3QHQA 3KB6A 1JIQA 1A9OA 3BAZA 3GCWA 3PT9A 4MVJM 3QGMA 4OBBA 4XEHA 4LV6A 4MQFA 4XWGA 1U3DA 2W8BA 3P27A 1H3NA 1T5HX 4DPMA 4O2BB 1XZKA 3FDXA 2BFBA 1H5QA 8MHTA 2ZWPA 2CF6A 3FZGA 4M46A 1KZHA 4DAOA 3LE8A 2V97A 1XDUA 4YP5A 2MSLA 3OTIA 3HO8A 2PL5A 3O8BA 4BAZA 3T35A 5AHOA 4FFRA 3AVUA 2RAUA 5LMNB 2F9FA 3M89A 5TSDA 1UEIA 2B4TO 3TNLA 3R76A 1N33B 1E66A 2JA1A 4FGZA 2C20A 1GTZA 2DUJA 1HXHA 3PJFA 1RI1A 3HDQA 1UWCA 2EQBA 2CHGA 4MQUA 4QUEA 4Y1FA 3VNQA 3OCXA 5BN5B 4KV7A 1RPAA 4PHFA 5ALLA 5BNFA 3RYCB 3LQRA 5F33A 5AUNB 1W9MA 3R5FA 4V0SA 3P0RA 4H0FA 4H77A 3GNLA 5JCPA 5EE1A 2FHPA 5KBYA 5J4YA 1NU8A 3EOZA 5C8XA 2AD5A 3HYRA 2AR9A 2C58A 2WILA 4Q4JA 2DJIA 2AXPA 3LP5A 1E77A 3AUAA 1LF5A 2JIQA 4JCOA 4Q1EA 1ZS9A 4B71A 5DTIA 2DLDA 1R3UA 5FEUA 4M9SA 3AVTA 1Y9EA 4UEJA 2HMYB 2Y68A 3FCUB 3GT3A 2XWBF 3BTVA 1KVRA 1QRRA 3W77A 1R8JA 3MLBA 3VYWA 3CURA 1NI4A 3EWAA 1B2RA 5G02A 2H1OA 1WPXA 3EVTA 4AF7A 4YX9A 4EG1A 5ESRA 2GJ9A 1UQTA 2MT9A 5FORA 4LXUA 5SYNA 5JAUA 1PWZA 4ZU6X 2YIMA 1SMKA 1VDZA 1YR2A 3HKBA 4JJZA 4RZUA 1HFEL 2CFCA 1YR8A 4J03A 1THZA 2GPJA 2Q6VA 1OBCA 5E3JA 3AFIA 3VOTA 4FD3A 5KPJA 4W8OA 2AVDA 3LOUA 4KW7A 1NXWA 1KP9A 3GLSA 5BYBA 2WFMA 1O5OA 1J24A 1B8NA 2JEZA 1SR8A 4LUCA 3VZBA 4RPGA 4LX0A 2WJ4A 3RTGA 3DLIA 1M5UA 3EXFB 1D3AA 1Z5ZA 1YAHA 4MB6A 3AEKB 3AQIA 4R1UA 2Q1TA 4TPKA 4JVNA 5D2CA 3SZRA 1RDFA 1U7TA 4FJ2A 1II9A 3QFFA 3ANYB 5EN4A 5KTRA 2P67A 1VHQA 5A2QA 4DLXA 4NENB 3QPUA 2R6JA 3RQIA 2CV2A 5I45A 2XE8A 3EQ7A 4P4SA 1JWBB 4WV3A 4O63O 5HJ2A 5ITVA 3NGXA 3GDOA 1I80A 1VI5A 1X92A 5HDQA 3KPUA 4D4MA 3CW8X 1I3MA 4YXWA 3GLHE 5HKKD 1F4PA 1USVA 2G7MC 1C41A 4WA8A 2NPFA 3F9RA 1X1EA 1HT2E 2RHBA 3M8KA 2BUBA 1TRKA 3KZOA 1CR2A 4XUCA 3ZOKA 4CQMA 5LLDA 3MRTA 2PVCA 5ALQA 5G3ZA 5TQ2A 4DQUA 2OHXA 2PX8A 2YYYA 2CSXA 3PGMA 3EW7A 3B48A 2PVSA 2PG3A 2IHZA 3JZIA 2ZJ0A 1MB0A 2FXVA 4M0EA 3JQEA 4DXAA 2HW8A 1NW8A 3NTOA 2I3BA 2VPZA 4URYR 5G40A 1PNOA 3ADPA 4OKSA 1ZGBA 2PLFA 4URZR 5EQDA 3VMFA 4EEZA 5JJLA 4WNYA 2XQVA 4WIAA 2XUJA 3LX8A 4OU4A 2I6TA 3GFQA 4HYTA 2FUKA 1SIWA 3HWX1 2P1ZA 3L43A 3WP0A 1RIFA 5JPDA 3F47A 3R6WA 5A5GA 2I1LA 1CRPA 5ADHA 4X54A 4TLLB 3EEYA 4IRXA 2XDWA 2H1FA 3ZWOA 5G4LA 5HP4A 5HW0A 3VHXA 5GIPE 2ZRAA 1SOWA 1Y34E 3AUXA 1JR6A 3G0GA 3R24A 2UZ1B 1I1NA 2Q3DA 3NVKI 2W48A 2X9GA 4P38A 3I5YA 3HFSA 2BMAA 4X8HA 3DL2A 4GNKA 2Y1OA 2RD2A 4HRAA 3JW8A 1T2AA 5IN5A 4DYVA 1X7WB 3LV8A 3W3ZB 3FLAA 4CV1A 5C3UA 2V7WA 4NFHA 3EAGA 3TQOA 3VKFA 3TEFA 1U0NA 2CNNA 5DJ5A 1Y1RA 2OZEA 3OC6A 4QDJA 1Y7IA 3IEPA 4YAWA 2NQ8A 2B3DA 3BA1A 1TM4E 1HC7A 3H0EA 4TKMA 3ND9A 2HF8A 4DQVA 1EJ2A 5L6LB 1VL5A 3HACA 2PWYA 2AW5A 3N28A 2NVUA 2C42A 4YQEA 5CFLA 3TFWA 4M8SA 4J4HA 3EG9B 1GO2A 4IQ4A 4WW0A 5DV9A 3M81A 1FP2A 1CS4C 2WG1A 1HZZC 1C4WA 3TNFA 1SUDA 3LT0A 2R7MA 2VATA 5JSKA 4YRMA 3RUAA 3QWHA 6REQB 5ED4A 3L7IA 2TMYA 5MF6A 4NJMA 3P71T 4UQPA 4F86A 1D7OA 2EP5A 4H35A 2FPIB 3N2ZB 3ORYA 5C1OA 2FRDA 4N0MA 3GHYA 4LY9A 1YS4A 4M9UA 1TLLA 1ZG3A 2OWEA 3PYLA 4WBNB 2JEOA 1NUSA 4Z51A 2GEUA 5JV5A 3CEHA 2MINB 5K51A 5JISA 2GEDA 1RWMA 2X9QA 2O5RA 3Q15C 2CLHB 3N58A 3N8KA 2XMPA 3EQ6A 4J0IA 2R86A 2OCIA 4A8PA 1EJBA 5KJFA 4FMPA 4L76A 4NRDA 4HMOA 3UG6A 4QPCA 5DGHA 3SOZA 5C18A 2J3DA 3Q2KA 5C8YA 2QNRA 4C4TA 2JGIA 1H1LA 2V7XA 3BHNA 3OKPA 5BR8B 4I4LA 4KN6A 4DY4A 2EZUA 1UOEA 1BH2A 4J8PA 4MDEA 2YQZA 4N03A 3BICA 1ST3A 4WPGA 1IM5A 5J5VA 2O8DA 5BV2P 1K6IA 4XWWA 1LBTA 1LDNA 4OSEA 1WMEA 2H51A 1M66A 3CO5A 1I3LA 1YZYA 1LBIA 2OXCA 1J97A 4C4PA 1TCAA 1W8DA 4BNJA 3KPVA 2JB9A 1I2MA 5CRIA 2XTNA 5E6SB 1N6IA 1VA4A 1T1SA 2VRWA 2QXYA 3EXIB 4PO1A 1DTEA 5D3KA 4O4IF 3UK2A 5AK6A 3IDZA 4WKOA 3IXMA 3WLAA 4Y1RA 1MQSA 1P9WA 2BCJQ 3MCWA 4KNVA 4Q18A 4A1FA 2BKAA 1E1DA 2LDXA 1JBQA 3NC1C 4YACA 1VIDA 1S02A 2VP6A 3A2LA 4B43A 5FO0A 2AYXA 3T7DA 3KHKA 1W46A 4PSCA 4CTKA 1OLSA 5IH7A 1TVKB 2V7VA 3WYDA 3QX8A 4KUEA 3WRXA 3RC3A 3LZDA 4G5SA 5CIWA 1Z6XA 1C2TA 2QLBA 4S1TA 4QVIA 4LY0A 3THYB 4ZOQI 3DT8A 3SHOA 1LK0A 1QTRA 3HEMA 4DLTA 1PR1A 1U3UA 4S2EA 4B46A 2PRIA 4JQOA 5EESA 1AKQA 3SDSA 1O08A 2I3DA 1LS1A 1SIBE 2JFBA 2NXEA 3FVTA 2ZUTA 4BUCA 3DVAA 3G8CA 3WLJA 2PTHA 1Y98A 1PSWA 5C53B 3E9EA 3REFA 3EGXB 1EXWA 4TQUS 2FG5A 3WG9A 2D5LA 3JATB 1TZJA 1KI1A 2AK3A 4BLUA 2F8TA 2OVFA 4C7KA 2C59A 4WX2B 5B3JC 4PLPA 1N6KA 3L6RA 1H0SA 1EUCA 2FF5A 4E30A 5LIPA 1EUDA 3GW8A 2DQKA 3RVJA 1FQJA 4EZEA 4PC3A 1RM0A 5IJ9B 2JBAB 1N77A 1ZCAA 2QQ0A 1P7YA 1ZO8A 4POOA 2BBWA 4ZGGA 2NMVA 5DM2A 1IHUA 5FNVF 1NUUA 1U8FO 2AJBA 1E2MA 1B42A 1G1MA 1XAGA 2WYWA 3CONA 1VKHA 3PTLA 4NU0A 3C1AA 1VCOA 4I4NA 5CFPA 1F4VA 3MWGA 3AZOA 3CRQA 1PU2A 3DC2A 3CZRA 1C2YA 2IT1A 4YMUA 4F5DA 5I8ZA 2Q2VA 1KMCA 2J7PA 1TAHA 4RZHA 1NNLA 4WY8A 4BKUA 3ZVRA 4E5MA 3F90A 4URUR 1KAGA 4V38A 4ED9A 2FWIA 1J0CA 1ESDA 1EUQA 3G0CA 4EQ6B 3D2CA 5AVRA 3A4VA 4KHZA 3S2IA 4IVQA 1BVRA 2FX3A 2ZR0A 3E2MA 1IMOA 1WF3A 1UBFA 1QK4A 1Q11A 2HMUA 1R9NA 1KO7A 5FT9A 1Y82A 1M6VA 3RG8A 3ZHOA 1Q0HA 4L6CA 4OCZA 4A0GA 1IMJA 3TQHA 1J00A 2ZUSA 1VMDA 1DU4A 3K3PA 1XDBA 4B6PA 1G8SA 4E1BA 3ZVLA 2AFVA 1U0SY 4HPWA 3CTMA 3KJXA 1R6VA 3WMEA 1F9EA 1NQ5A 3QP9A 4YJHA 5DP1A 1CUEA 1QKJA 1YRQA 4KE9A 4M0PA 2IPMA 4FZJA 2YXPX 1K6EA 3W04A 3LCUA 4X6UA 3PSHA 1Y7LA 3TIXB 3RGWS 4J16A 4LJ7A 3N6VA 3BWXA 4O4LF 4AD8A 3HN6A 5FWXB 3OOEA 4UQLA 1M33A 3E6AA 4OA5A 2REBA 2JHFA 3OTWA 4KLNA 2HY7A 3F4LA 3GYGA 4OHBA 4K8RB 3SQNA 5BMVF 4MR8B 1T0JB 3VJKA 1PDWA 1PR6A 5F1KA 3I09A 5E9WA 1N7HA 1B6RA 2P3QA 3EMBA 1ZNQO 4IF6A 4L4XA 3H6KA 4HCJA 2QW1A 1C9MA 2JK0A 3GLGA 3IODA 3PT5A 1TO2E 3AM5A 3DOCA 4ND2A 1W96A 5KQMA 1S3FA 1DWPA 4X1KA 1K68A 4TLEA 4COKA 3OCWA 3HNPA 5IX8A 4QBFA 5CAEA 5AHWA 3D8UA 1G1AA 4R68A 3GGJA 1LX7A 2WWIA 4NMXB 3Q3HA 3S2EA 4B4WA 2PDAA 4HFMA 1Z16A 2BM1A 3JYQA 3C41J 3NPMA 3DDNA 3AVYA 2GK3A 1VPDA 4O0MA 5JWHA 3SKVA 3OCJA 4Q3EA 4PGAA 4TOIA 3KTAA 2YRFA 4OOEA 2ZAOA 1XT6A 1E9SA 2FFJA 4LCJA 3BORA 4IG4A 3LQFA 2R6FA 3QTBA 3H9CA 1J4AA 2I6SA 3LUCA 2YJGA 2NO1A 3VR0A 3E81A 2EERA 4K9PA 3F7TA 1KDYA 1Z75A 1L7BA 5IJAA 3AXSA 1OWPA 4G09A 4HYYA 3GAZA 4P35A 1WV0A 3B1XA 4QM6A 1HX7A 3UHPA 3VZQA 3SHQA 3BDAA 1Z45A 3W8RA 2H11A 2XOXA 4N0DA 3T9AA 3IHKA 1PEDA 1BHQ1 2RIPA 4JK3A 4IQGA 4RSGA 5A5VA 2JLBA 1C3JA 1L4EA 2BFNA 1F14A 4TS4A 4LZLA 2FDCA 3R23A 2FPKA 5CLQA 1VB5A 4ENRA 2NWQA 3AG5A 4QQNA 421PA 5CBPB 2HBRA 1QAQA 5J5CA 3VR2A 1JEYA 3GGPA 3NAMA 1GAEO 1EFTA 5CR9A 3VPAA 3FDIA 2ODTX 5KHOC 1P44A 3KFVA 5T4FA 4L5YA 2CJWB 7AT1A 1BXZA 3SJBA 3NGMA 3BF7A 2I2AA 4O2AA 1VE7A 4DLRA 2J3LA 1MGOA 2W6ID 4PCAA 4Q93A 1QIJA 2R8ZA 3T7SA 3KKZA 4ZYLA 5I7EA 3QXXA 1SXQA 1Q1AA 4LYEA 1UBGA 5J2UA 2J4FA 1J0EA 1ZJYA 2AS0A 4CG3A 3ANSA 2PS1A 3U0BA 3OT5A 4PRLA 4NS4A 4TRJA 2GXUA 3TXYA 2ZI5A 1EP3B 3CZMA 1V4NA 2D54A 4H60A 1KYYA 4PLWA 4HNVA 2FJUA 3OMLA 3GRVA 1XRQA 1N5OX 8LDHA 5CGQB 4AJIA 1TQHA 3FOBA 3E8MA 4BCBA 4GOMD 4P54A 4C7OB 5KOJA 4TLCA 4Y2SA 2YJ5A 1MV5A 5EZYF 1AQNA 2P6NA 4Y9RA 3TK1A 3H5NA 1T3SA 2BM0A 1W75A 1WCXA 2IUYA 3MJFA 4B4UA 1I4TD 5HIKA 3WYFA 1KTVA 1A2KC 3WR5A 1XXLA 1Z7EA 2Q45A 3CISA 2II6A 4C0AC 1NW4A 2WU3A 4G37A 4LHYA 1DC6A 4Q6WA 2OM2A 4IKOA 3RUHA 4ZD6A 3VNSA 4GKBA 2GKSA 5CVDA 3ZHYA 4C03A 1NZDA 1C3VA 1V7CA 5GM2A 2GRAA 4ZV7A 3K70C 2X1VA 3G0DA 5HKBA 3H5IA 3IL2A 3KQMA 5E1MA 4BCCA 5A9SA 1Z22A 4KU4A 3W78A 1NXVA 1UXHA 3GU3A 1APBA 2F7SA 4PYLA 1OT5A 4TMXA 4BMYA 2NP6A 1FJ2A 2A0FA 3S2GA 3DDZX 1U80A 4IFIA 1U04A 4MA0A 2OORA 5A9RA 3K6SA 1HE1C 5G4KB 2JJYA 2Y1FA 3TXXA 3JD1A 2Y1GA 1QG6A 1DJQA 3RVQA 2GBLA 1AUVA 4RHFA 1E1QA 1ODIA 1OWLA 1VPVA 2CDAA 2FRDC 1I94B 2HCFA 2PGAA 3T4EA 3O1JC 4PZ9A 3WKBA 5KSYA 1A71A 1P72A 2OAEA 1IWBB 3IPCA 4ENQA 3D5TA 1NP3A 4Y2GA 1B0UA 4NARA 4NNOA 2QBYA 4IBOA 1F9AA 3NVMB 3OPVA 4C4AA 1EFLA 3NM5A 5I7RA 1E8DA 3Q1KA 1XK7A 3KLNA 4J2TA 5TF0A 1MDFA 4ZWNA 1KQNA 4CCYB 2B1IA 3FKJA 1COWD 3LBIA 2BHSA 2H1WA 4U7TB 1IXKA 3RSGA 1A9XB 4Q9JA 3EODA 3THWA 1NC1A 4Q47A 1RM5A 3CNNA 4Q1CA 4A82A 4ALNA 3P2OA 5D00A 3T4PA 3QBDA 1UCFA 3KPYA 3I1JA 4XPIB 4D3SA 1OV4A 2ZYIA 2GVNA 2ORYA 1KOFA 1QHIA 1RWKA 2HDNB 2VEDA 1L5YA 3L6EA 2A0WA 4JJIA 1RLJA 5K7SA 2OBFA 3BM5A 1RJGA 3CG4A 4G0XA 4BZWA 1F8YA 1JKFA 1KI8A 3AEQA 1M7GA 3LHIA 2XI4A 3RGGA 4EG6A 2NSHA 3L46A 2FZEA 4H6WA 3CLSD 1H22A 3TLZA 1T15A 1M6NA 2TECE 5I6DA 1BMQA 4GC9A 2ZTVA 1KEEB 2VT6A 3AYXB 3ETHA 3KUXA 2NPIA 3PWKA 1C9DB 1YIAA 3B3AA 4R41A 3VO2A 3OEEA 1JEAA 3KPJA 2HRDA 3EGDB 1IIRA 5IF9A 1ZH8A 1NZJA 1TMKA 3WRXC 1X38A 2P7HA 1QRDA 5K5EA 4XVQA 3PEVA 5CLLA 1OX6A 1RMQA 3CUSA 3SQXA 2GJSA 1XMSA 2FX2A 2D3TA 3SIPA 5F9HA 4PFQA 6ABPA 1NXOA 1Z06A 3JQ8A 4KTTE 4BRZA 4EHDA 5FV4A 2X5OA 2HA7A 1J7KA 4XLZA 5JATA 3EPJA 1AH2A 2AHRA 1FU4A 1BCSB 3FOEC 5EVJA 4MPDA 2GTIA 4RE5A 5EQJB 3H3JA 4NESA 4B3SB 4K9QA 4Q66C 3IRVA 1QR6A 1GGJA 2P75A 2GILA 3DBIA 1K5GA 4NE9A 3X1DA 3D3WA 4G5OA 1XLUA 3FBWA 5KJEA 1KMQA 1KSFX 2JIPA 3SHTA 4EMUA 4KLRA 3RRFA 2X77A 3B1ZA 1QRUA 3L0SA 5JCJA 2XWQA 2NAPA 4UHEA 3UHOA 4O2RA 3AGQA 1QP8A 2FFQA 1TUGA 5LUAA 2Y1CA 1CY0A 4CFZA 2D59A 4N7JA 1U9IA 4KDRA 4ZZ1A 1NMSA 1GPKA 1NW5A 1XVAA 2L42A 2PLRA 1SQ0A 5FYQA 3CLSC 4DMHA 4RF4A 1GNVA 5JBQA 5JH7A 1NGSA 1LPAB 2XCLA 4TN1A 3K71B 2I6QA 4OP3A 2FWRA 1HE3A 2OYSA 4F21A 4HX9A 1G8FA 4IOKA 4TV9F 4F1WA 5DMHA 1QHSA 1QDUA 2XZTA 3PICA 2QTNA 3T1NA 4LBWA 4KO8A 5AKEA 5DGXA 4Q02A 4HDQB 4TKZA 3W4KA 2CBGA 1IVSA 3FSEA 1XTSA 4CRWB 4IOLA 3DUFB 1F60A 2ABWA 2ALJA 1ZNXA 3KZ1E 3NUQA 1WCWA 3RUIA 4WOCA 4Z49A 4YT2A 4P0PB 1BVHA 2JVIA 1GCAA 2O50A 2XJ9A 2B98A 2ZYAA 3DDWA 4G07A 1FUIA 5EKXA 1C3OA 4RVNA 3W6UA 1EDZA 1U4OA 1QP7A 2LIPA 1GAWA 1FTGA 1CUFA 1TJ3A 3FMOB 3Q6MA 4OIMA 2HPAA 4ZPXA 5DTMA 3RSOA 3UAXA 3ZKWB 4J16C 3U0VA 4B8WA 4EGQA 3INTA 5K9ZA 5KREA 4PEVA 3RASA 1B8UA 3IDSA 5AKKA 4ZDWA 5IKOA 2OCGA 3MRSA 1KHHA 3LSYA 4YIHA 5FTWA 3KE8A 3NBQA 2FMIA 4RE6A 2QX7A 8ABPA 1NNEA 3CKYA 3OJLA 3PQEA 1QYRA 3OE7A 4Z0HO 3EXHA 4TYQA 3V8VA 1AF4A 2BZSA 3QY9A 3A06A 4DZRA 4RPKA 1VKJA 1V16A 5HUHA 3A7EA 2F3TA 3OHSX 1N0IA 2NUAA 3DV0A 4ZVQA 2D0OB 3N2KB 1LJLA 1WZNA 3OOSA 4YP6A 4BNLA 4DRXB 1XPOA 3R75A 4BRWA 2DQSA 2I6XA 5HE8A 3TKLA 4ZT6A 1P4RA 1I3CA 2RCYA 2YMLA 3KSDO 4FGSA 1MQAA 4XYGA 4C4OA 4F04A 5CFZA 3PFWO 1T4BA 3OP1A 2YZ7A 3CUTA 1SU6A 1QO7A 3QVSA 1JHZA 5A05A 2YXEA 4CUJA 1LJ8A 5NLLA 2NACA 4JNKA 4U6SA 4HXEB 1HORA 2J5QA 2P8JA 1P3Y1 2XOKA 1MO2A 4CIYA 4CDMA 5CJPA 1YU9A 3BE6A 3HS3A 4ZT2A 2J08A 1GG8A 4U6NA 3HO6A 4H3HB 1FDRA 4XGIA 2I54A 3TZBA 5TJ9A 3IBSA 3TLJA 3PDIA 2TMKA 5C4IA 1ZK4A 5H9VA 4E5UA 4L5IA 2Z2JA 1QNLA 4BLQA 2J4DA 4X6XA 1MJHA 2Z4SA 2D1YA 4A2WA 4E4RA 2W37A 1OB5A 4EPYA 1ECCA 5ENVA 3U31A 4XB6B 2QVBA 4UZFA 4M8IA 1U2TA 3LWNA 2O52A 2XWSA 4BASA 3ANTA 1D0IA 4RD6A 3WL8A 2GQ0A 1KR2A 5BSHA 2SECE 2ZXEA 2BAGA 2HI0A 4ZQIA 4ZEOA 5EVCA 3IOBA 3C98A 1Y7TA 2CCKA 4P08A 1XAIA 3K0EA 4G1VA 1LPPA 2JKZA 3DFKA 4EJMA 3K8ZA 1FNSA 1E6WA 1M1NB 1NRJB 1FNNA 2WKRA 3H3XA 4YRFA 4DIMA 1F8UA 2VTEA 2D5BA 3K96A 2E49A 5ECWA 2FQWA 4RZQA 3UXEA 4C4SA 2J9FB 2N47A 5ESXA 1NUQA 1QKIA 4DLAA 1VC2A 5FF9A 3EZXA 4WBSA 1NVUQ 1FYXA 1NY5A 2GBPA 3WGZA 1DBRA 2CE2X 4QOGA 3E7FA 1B0AA 1CQIB 2G3YA 1GN9A 2YV1A 4F5ZA 2GPWA 2FZVA 2P62A 3FFTA 4JA2A 4XD7A 3QUCA 4PQEA 4D2IA 5BV0A 5IEJA 3VJRA 5IAEA 2BBOA 2ZYRA 4B7CA 4L0MA 5J4HA 5JCXA 2HJGA 3SZLA 4DM4A 3PXEA 3A6JA 1MB4A 1UPTA 4TV8B 4FR5A 4US2R 2WWYA 4MIKA 3FRJA 4GBMA 1WEHA 5FTMA 1Z5OA 4XJVA 2J07A 2PL1A 3L84A 1PD0A 1RJ9B 221PA 2H54A 3R77A 1ML4A 2ZSAA 1AQYA 2QNBA 3ZGOA 4RLHA 1VBMA 3EXFA 3T3MB 1XD2B 2GDZA 2IEZA 3F73A 2IS6A 3AEKA 4KVFA 4U7WA 2FE4A 5AK5A 4ISCA 1E6KA 2WTXA 3UTDA 2GN2A 1CUJA 1WXEA 2DTXA 4ZHQB 1BE6A 2D2XA 3M3PA 1GJRA 2WAAA 4KGVA 2QQFA 4R1PA 5E1BA 3UJ6A 4E6PA 1RJWA 2N75A 4N3NA 1YQUA 1ZCFA 4NENA 2V0NA 5AVUA 5EI5A 1ORDA 4WHMA 1ZIPA 2EW1A 3G9UA 1BVUA 3VC3A 4E3WA 3ST7A 4HNTA 3JYNA 2PJDA 3ILSA 5B37A 4NG4A 1ACMA 1F06A 2ZRKA 4Y0NA 1IPEA 5EIHA 2IF2A 1TZKA 2H4HA 2OORC 3I0MA 1WCIA 4H2DA 5TPZA 1X15A 3G8AA 1X14A 1OJ7A 4MUEA 4B33A 3FHLA 4CL8A 4MW1A 2C2HA 5B6IA 4LJ5A 2IS2A 1VJDA 4QFMA 4O1MA 5JLAA 2BJHA 4KXXA 1Q3TA 1I4WA 5E95A 3OIGA 3X44A 2GEJA 1OKKA 3KSBC 2DPYA 3ZGXA 4DQLA 4GG1A 3TYXA 4LHSA 5JADA 3IJEB 2Q4BA 4L2IB 4ZTUB 2FEWB 5AOAA 3MQFA 4Y2QA 1G21B 5HCIA 3SSMA 4BGDA 3RC1A 1DAEA 5I7HA 3STHA 4IMJB 5FAXA 2C92A 2JAWA 2QT0A 1Z4JA 1SCBA 3V2IA 1TE2A 1IY2A 1I10A 1N8NA 1VE5A 4WBXC 3RHFA 3ZJYA 4FFNA 2NP7A 2EX0A 1L5LA 2R62A 1FSPA 3N7UA 5BR1A 4LZZA 5B57C 2UZ1A 1YR7A 2B8TA 1A9XA 1LKZA 4RLQA 4YUWA 1BDMA 1X1AA 1N3LA 3G13A 1XA3A 3HVJA 1MHPA 3RVMA 3HUDA 1X2EA 1P33A 4Q9AA 1PL0A 3T3PB 2KI5A 2JHPA 3T7JA 3P97A 4MULA 2X2EA 1SWWA 1X7WA 3EB9A 1E62A 2E87A 1VSQA 2XNCA 5CDTA 1XTTA 3LLCA 5TMEA 4ADSG 3NMUF 1HETA 1LWOA 1MXFA 5ALIA 4Z4GA 3ZNPA 1KS9A 3LGSA 2DEUA 1RRGA 3QUQA 3TO5A 3UJ9A 1OE0A 3NBYC 5TT1A 2Y1EA 5LP6B 5A4AA 4NFLA 1AN0A 3KWJA 4Q21A 1XCLA 1SXIA 4CTJA 1FDOA 2JJ2D 1ZCJA 1FMTA 2BMDA 2QTVA 1YR1A 3D3EA 3D0KA 2XA2A 4PGHA 3JPYA 1JWLA 4M87A 1MAVA 5A03A 1LA2A 5DYIA 3Q85A 3LKDA 2ACVA 3DMFA 2Z6VA 4YAJA 5K99A 1P9RA 2FN8A 1M2EA 1QH1B 2F2TA 1TA4A 2G1UA 2BMVA 2X0KA 3F6SA 1OVMA 1TDJA 2JI4A 3F5MA 3MJDA 4HDKB 2YOFA 4DNOA 5K0GA 2WG2A 2SNIE 4IMPA 4MS1B 1FMJA 2NVWA 1UMBA 4HPXB 1SVKA 2BKUA 4IEIA 4NK5A 1ZIYA 2ZQ5A 1P2FA 1S9DA 2AV6A 2DR3A 2FEPA 2GR9A 3OJXA 5DHAA 1I6LA 2Z04A 3K0BA 3DYIA 4KO2S 1A9ZA 1C1HA 2FSPA 1JSZA 4WNAA 5I4BA 2AOUB 3E1SA 1Q57A 4I4TF 4GUAA 2YXNA 4QQFA 3H5RA 2O0JA 4N1AA 2HSZA 4RV9A 5IUNC 2VNAA 2ILTA 5DSXA 3KKPA 4BEVA 6YASA 3I9LA 2HA4A 4I2NA 1N8TA 3QVXA 4QTXA 4UCQA 5LKAA 5HZMA 3WGHA 2PZAA 4AK9A 3PQ3A 3BEDA 1U9IC 4P3NA 4R0VA 3GZNB 1DJOA 3GARA 3VSBA 4M8KA 1R0SA 2BLNA 3AUKA 4XASA 1GTSA 3SKYA 3FB1A 1ZU4A 2JCYA 4OOFA 3W5JA 2AOWA 2BEUB 3PC8A 4IINA 5AVSA 4JI8B 1RI2A 4I6GA 1EKXA 1XTRA 4XI9A 1XLVA 3UG7A 4XQCA 5F5NA 1OH7A 4JQSA 4NE7A 4ZO4A 4QGGA 1N6NA 3C8MA 2F8MA 2PFKA 3GROA 4ARVA 4D4IA 4MCIA 3SXJA 3NBUA 2DERA 4ILEA 1QOQB 1WR8A 4RH1A 4WZ6A 2H9AA 2ZVJA 2G5CA 1FDTA 1X8XA 2V65A 2XOKD 3RYFB 4XR4A 2MDTA 4L4RA 1R9JA 1YZGA 2W98A 3ETDA 4WGFA 1FTQA 4ZVPA 5H02A 3BWYA 3X1MA 2VTBB 2FEXA 1JHUA 1TVKA 2Y1KA 1BMTA 4AUKA 4D3DA 1G3IA 2ERXA 4HB4A 1ZD2P 2QAGA 4J2OA 1P2SA 2RKWA 1UMDB 3JQGB 3HBLA 3FYHA 1A96A 1ELOA 1V96A 2PZLA 2VHEA 2ZPUA 3WIUA 3X2EA 5K0ZA 4QG3A 4Z4EA 2G17A 2QG6A 3K0AB 4BEBA 1U0GA 1Z2OX 1WZIA 1W0KD 2NX2A 1OI7A 1B6GA 1OA0A 1SUBA 3DSRA 4R1QA 1L8OA 2DQ4A 1NF3A 1GUYA 1JR2A 5GWXA 2HCRA 2OPHA 1FEZA 2LP4Y 1OX5A 4H6VA 4BMSA 2D1QA 2GRUA 2OHJA 4GXNA 4G9GA 1RWQA 4WN3A 1LVUA 5FFFA 3VR5A 3GCXA 4PTZA 1C9EA 4LNUA 1EG2A 4HJRA 3VGJA 4O4HF 2QTBA 4RXMA 5AI9A 4CLOB 1E5TA 1KQGA 5EWLA 1H2FA 4HP8A 4OBEA 1KPHA 4CIWA 2QY6A 4E2WA 3QW2A 1D4OA 4D9BA 1KRXA 3R44A 3Q3EA 2FW1A 3QKSA 2ZATA 3L1VA 4F2PA 121PA 4EA7A 1AS0A 2ATXA 1ZXBA 3VR5H 3REGA 4AP6A 3R9KA 4AURA 1VG0B 1JJFA 2WT9A 4LQDA 3T4UA 1X7YA 3WNBA 1YR3A 4FNAA 4P36A 1SHLA 3GFGA 3ZXIA 4D0LB 1QP4A 1WMBA 3CKKA 4EQ6A 2YXDA 3KB1A 4Y6SA 4H9GA 1XQ6A 1JHDA 1OBVA 1QGDA 4ANFA 1OC2A 3G88A 4AX4A 4BU0A 4IL5A 5CA1B 4BY9E 2F8SA 1WSBA 2WHXA 1KJNA 4OSOA 2XZLA 4RPCA 1Q0SA 2WD9A 3R5KA 2GAIA 4G0OA 2HU5A 4LE2A 1UOQA 3HV0A 4JODA 1P1FA 1V3VA 4U7PB 4D4KA 2WIAA 4DEXA 2SBTA 5EUQB 3A1EA 1Z4KA 3EBOA 4UREA 1HE4A 3S55A 4GYKA 1CY4A 4F6LA 4CWAA 3KLPX 4AF6A 1VIVA 1V9CA 1VQ1A 4M9ZA 1T9AA 3L4KA 1J8FA 1ZMOA 2W8ZA 5AW4A 2ZW9A 5FWXA 4ND7A 1ETUA 4CZ2A 1FQKA 1O54A 5DOZA 3V2UA 4B34A 4DV2B 4IVPA 4HY3A 1E7YA 3CTPA 1IQPA 4AT1A 5KYVA 2WHYA 1AK2A 1W93A 1W85B 1PT5A 3N1UA 4LGMA 4M6WB 4BNUA 2HNBA 4F6RB 5CM9C 2WB2A 3QSYA 1CEQA 1KK0A 1E6EA 3CLVA 4H1VA 4TVOA 1RMYA 3S70A 4RTLA 5IHPA 4TSKA 4PNPA 1SUSA 4KRYA 3FFWA 3TRKA 5CIQA 1FNMA 5A62A 1VI6A 1S0UA 1Q12A 4D9NA 2R68A 4QA9A 1SB9A 2ZP1A 1OX4B 5C80A 1DEKA 3EIXA 5IK2D 4DV7B 4HQ0A 3KXDA 4QU0A 1RZRD 3AKZA 1UP6A 3UMRA 1G41A 2AX3A 3TG2A 4HEQA 4OP2A 4MUBA 4V2IA 3R6TA 4UM7A 3HL0A 3MUNA 1A5AB 4LXYA 4REMA 1QYXA 3EMKA 1UKAA 3L0PA 4RGQA 4RSRA 3SZOA 4M98A 3TCKA 2HMSA 3IKLA 3JD2A 4LZAA 3IOCA 3C15C 5E4TA 5KJ1A 5TV2A 4IUYA 1D2HA 3OT1B 3HU5A 3U4AA 4UNIA 1Q6YA 2EJWA 4E6EA 3EXG1 4KDFA 2ZJ1A 3DZCA 2WSBA 3WYAA 2I22A 5BWLA 1ANKA 2DBYA 4G86A 1WW3A 2VYND 4L1KA 1ESNA 1N2CB 2H4ZA 5H82A 1Z2AA 3V5NA 3AR3A 4YI5A 2ZYTX 4HX5A 3JAWB 4JAVC 1UBCA 5CNIA 3S8YA 3K5WA 1KI9A 3PQ6A 3L7YA 1EVYA 3ZD9A 1J6UA 2IZ7A 4DUGA 4EF5A 1T6NA 2A6PA 4MRMA 5IW8A 5A1TA 1E2LA 4WY2A 2D5IA 4IQ8A 2WSSD 3K9WA 1JVNA 3MEQA 5EPEA 1KS2A 5FBVB 5CBPA 2JFHA 4E11A 2O1WA 2F64A 3V8NA 4DLSA 5KTTA 1HFWA 4QXOA 2HEGA 2G28A 1IZ9A 1JU9A 4FN4A 3AZPA 3RSSA 3U7HB 5UKDA 2ADOA 1TU4A 4AWBA 2CJWA 2OEPA 3CUUA 4BNHA 3KEOA 1P62B 4I4CA 1XG5A 5JAMA 4RA9B 1QQTA 4N41A 4M0FA