1IZMA

Structure of ygfb from haemophilus influenzae (hi0817), a conserved hypothetical protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
b'LISHSDMNQQLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSNDNHAYPTGLVQPVTELYEQISQTLSDVEGFTFELGLTEDENVFTQADSLSDWANQFLLGIGLAQPELAKEKGEIGEAVDDLQDICQLGYDEDDNEEELAEALEEIIEYVRTIAMLFYSHFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN HI0817
publication title X-ray structure of HI0817 from Haemophilus influenzae: protein of unknown function with a novel fold.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 62
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2002-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03695 UPF0149 Uncharacterised protein family (UPF0149)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.740 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1izmA00
1IZMA 4GYTA
chains in the Genus database with same CATH superfamily
4O6YA 1QQ3A 4PACA 2Q00A 1VB5A 3GWNA 4AK9A 2Q4FA 1HE9A 5A6AA 2ZXRA 4JC7A 4O79A 3Q7GA 3QW1A 2XL4A 4N6CA 4BEMJ 3FDQA 1CPQA 2Q9BA 4I3MA 4O7GA 1T6IA 4JKVA 4U5DE 4U5CE 2R7OA 1JRAA 2XLMA 4XPYA 2YL0A 3OEOA 1C03A 4ULVA 2HMQA 2M64A 2ZXOA 2LCHA 4YL0A 2NUTA 3NYMA 1M56C 256BA 3LESA 5COFA 3ZSUA 5HV9A 1BR1A 3S90A 3ASOC 3EGXB 4LACB 4JJGA 4I1MA 4JTCB 3T6GB 1M2OA 5A69A 1WASA 2MHRA 4U5FE 1ZVZA 4WGYA 4AL0A 1SR2A 3AGTA 4IJJA 3ZTMA 4CSAC 5AC5A 2IXPA 1RCPA 1YVIA 3L1MA 1OW6A 3S27A 1SMYF 1S7ZA 4CX9A 4LLCA 4PJMA 2KQ9A 1MQVA 4JVSA 2R7QA 4BJ5A 4OD4A 4QI0A 3ECSA 1YYXA 4EKWA 1VLTA 2YLGA 5GPGB 2VC9A 1QKRA 2AVKA 4JJFA 4MQ9F 1AUEA 1JAFA 1FAPB 2YVKA 3GODA 1C17M 2QTVA 4R32A 4D4NA 3V5XA 1IW7F 2IOQA 1OQCA 1YAUO 2DYRC 3HNIA 3TJ5A 5KYYB 4YL1A 4XWJA 2VB6A 2A68F 1A7VA 1G4WR 4MVOA 3SXYA 4EBJA 3RVZA 1Z5ZA 3W8HA 4FX5A 1XZPA 2A0UA 3TOMA 1NFNA 1ZHTA 4JIOA 4JZAA 4MNDA 3R7CA 3GWLA 3RH3A 3SXKA 2JD3A 2IXOA 3K66A 3QVZA 2MWQA 4NQFA 3SP1A 3RVYA 5JT4A 1ORYA 2P6VA 5JLIA 3J06A 2J7PD 5F5FA 2GWWA 5KYUA 2XS1A 4XPXA 2W45A 2LIGA 2Q9CA 3DAFA 2XS8A 3IQTA 5L0DA 1RKEB 3EGDA 1DOWA 1OCOC 1I5NA 2A0BA 3K1IC 3M15A 4IWBA 1YYJA 3K7DA 4MTFA 4PK4A 2NUPA 2J9UA 3ZVRA 3I4UA 5DVWA 2Y3HA 3HKKA 4MVRA 4U9EA 2YL7A 1FFHA 2HJ3A 4MS2A 2HUJA 4MW8A 3MFNA 1WATA 4BJTA 5KYWB 3EZHA 2V3CC 4F4BA 1A0BA 2YZSA 3FXHA 3IEEA 4OIQF 2YEVA 4JEAA 1SF8A 1T5OA 3LUTB 4HE8D 1FFTC 2L9JA 1VYKA 3DE8A 3R2PA 4J32B 2XLHA 3HLZA 1A7EA 1BR2A 1BR4A 3BRJA 2OJED 2Y3DA 4YN0B 2R7UA 2VCAA 1H7IA 1VMAA 2KJGA 3NYLA 3EHNA 4JCZA 4JTDB 2YLIA 1B68A 4L6RA 1Q0GA 1L7CA 4FWVA 4HFKB 4OINF 3Q6MA 3JCUQ 3ABLC 5AC4A 4NCQA 4E18A 1W2WA 3DMDA 2OEXA 4ULWA 5F28E 1Z7Qc 5CIVA 2F22A 3B0UX 3U8VA 4CBEA 2H7VC 2KYHA 4QI2A 2PP4A 4KC9A 4BJ1A 2ZPAA 1LKXA 4IB4A 2B0JA 3NMKA 1RXQA 2CW0F 1V54C 4LDQA 5K0IA 3ABKC 4IAOA 3CZ6A 2HSBA 3EZIA 1SZIA 3X1OA 3DD7A 3I5QA 3TK0A 2XM0A 3N24A 2LP4A 4PR9A 2OCCC 2LK4A 4Z9IA 3LS1A 2Y3BA 4J7TA 1R5ID 1UG7A 1K40A 1V74B 2D5RB 4G7ZF 1MNEA 2IM8A 1Z6AA 3ATPA 4MTOA 2B0HA 3RYLA 3C62A 3EG9A 3VRCA 4E0IA 1NU7D 2DI3A 2PBEA 3WAQA 2HZ8A 1D1AA 1OCRC 2ETSA 2X51A 3AOUA 3JRMO 4N6HA 4DBQA 2DB4A 1EA8A 5L0GA 1GGQA 4BJ6C 1QSPA 4KNWA 2EINC 4C3EA 3T4RA 3LAYA 3ASNC 4MVSA 3S9OA 5FCLA 2R02A 3EH2A 3LEVA 4AE4A 1TWAA 5BQHA 1O5HA 4MTGA 4XLNF 4WABA 2KC3A 2VASA 3OWTA 3RKOF 4Q5SF 4YWQA 1LPEA 3O10A 3U3FA 5DS5A 3H65A 3U9JA 2VCCA 2XLWA 4JE9A 1NG1A 3VAYA 1KNYA 3B9QA 3DJUB 2JPUA 3EFOA 3UMKA 3UMIA 2IBFA 2LFFA 1MMNA 1Z3IX 2WZLA 3Q6NA 3SZRA 5DQTA 2WZFA 1GM5A 2R7SA 3AG1C 3GEHA 1YLMA 5A6KA 1YA7O 2KGOA 2BL2A 3CAXA 1O87A 3GEIA 3NKEA 3O55A 4XTKA 4PJLA 3ZQVA 2QE9A 1NFOA 5B1BC 1YZCA 1YA9A 2O9XA 5CI8A 4BPMA 3S84A 3MLGA 2OOCA 4KNVA 1IZMA 2A69F 1OKKA 4MVQA 1FMWA 1JPJA 2I8BA 2L7AA 3K33A 2GFHA 4IRUA 4J30B 1VK5A 2EIKC 2IXMA 4CDAA 3TULA 5B1AC 4G7HF 1EQ1A 1M6TA 3Q7LA 4X0RA 2WVOA 5BQGA 5JSLA 3B0PA 3BEHA 4G7OF 4BJ6A 3E9VA 1ZHZA 2RSEB 4EHPA 4EIYA 5KYNA 2P61A 2NPUA 3ABMC 5E3AA 3V7OA 3U2LA 5KYXA 2BC5A 4MVUA 3KH2A 3LEOA 5AGFA 3N0TA 1E86A 4NC3A 2PFDA 2XL8A 4H4KC 4QDLA 3FOPA 4U5BE 2EPKX 1AVOB 2HS5A 1T01A 1K04A 2R7WA 3W2VA 3C63A 3GORA 5B3IA 3JTLO 4HFFB 4P9TA 2CGEA 1Z63A 4I1OB 2EPLX 3TOLA 2DYSC 2A6HF 3EQLF 2L81A 4G0HA 2R7XA 2TMVP 2UUIA 3SEOA 4C3DA 1LIHA 1OCZC 3KYJA 2CNWD 3G4XA 3MX3A 4U5EE 1LM3B 5IY5C 3KYIA 3CEXA 2EPMX 3GANA 3O6XA 2MYSA 5L0CA 2AP3A 2Z15A 3L8JA 1OXKA 1OXBA 3HJCA 2J9VA 1ZHXA 1TFKB 3JYHA 4Q7CA 3ZIBA 5DLJA 5L3VA 5KYUB 5EHHA 1G8XA 3C18A 3LNMB 1PCXA 1WOLA 1H9GA 4E7SA 4OIOF 4CIHA 2NG1A 2ICWG 3AGUA 3QVYA 1ZU5A 3KMIA 3VM6A 3NKDA 3EGDB 3MBGA 3O39A 1TWCA 3W4YA 2NUPB 3ITFA 3C8GA 1OCCC 3C7JA 5E33A 2IXNA 3KL4A 3DM9B 1J8YF 3T6BA 3ZDLA 4XEFA 2YLDA 5T3TA 5TJ5E 3X2QC 2I15A 1GS9A 4E17A 3TJ6A 3M79A 4YL3A 3H2UA 1ORSC 2H7OA 3WHNA 1HW1A 1SYQA 1MNDA 2AWCA 2E87A 3IQCA 4W8PA 4Z9HA 1E83A 2PX0A 2HMZA 4IAQA 1Y6DA 3B29A 4NTFA 4NY3A 5T1DB 5DS4A 2GAQA 4GEHA 4K1OA 5BQIA 1OR2A 2R05A 1HMOA 1E85A 1VOMA 3S28A 4EBBA 3UNGC 2KNHA 2A6EF 4PFPA 4DVZA 2FFHA 2P7VA 1OW8A 3PMRA 2ZXWC 1V4AA 2R03A 3SNHA 2OG2A 5FZTA 3OA1A 3VF0A 1UFBA 3EJNA 5BUOA 5KYWA 2XSEA 1EI7A 1AEPA 3RQEA 1NLXA 1RKCA 1A41A 1N1CA 1Q0KA 2WB7A 3S0XA 3RIPA 3A9CA 1QLEC 4U9DA 3W2WA 2XXAA 3N2ZB 3HNLA 2J46A 4RD9A 1YJGA 5CI9A 4KI2A 5A6BD 1FTSA 1PD0A 1RJ9A 2YL3A 1LE2A 3LNRA 4XQ1A 4CDYA 1YDIA 2H8AA 1M2VA 5T3WA 1BDJB 1Q0FA 2HFIA 2PF4E 1CGOA 3RFYA 1A7DA 3UMHA 4DVYP 4JCHA 4FAPB 2VCBA 3M1CB 2XLDA 3GEEA 3LS0A 4EBKA 1YZAA 1TFOB 2EPOA 4O6NA 3EHMA 3DM5A 1YARO 3EG9B 1V55C 3IQ6A 4DRHB 4DOZA 4YT2A 1WWPA 1ZYRF 5EGYA 3V5YA 4JURI 1ZHYA 4CJGA 4IARA 2XRHA 2G62A 3E70C 1LI7A 2YWAA 3U3BA 4JRZA 2R25A 3QTHA 2YRFA 2Q7RA 1CGNA 5L3QA 2L6FA 3UR3C 2KSFA 3CSKA 3QMKA 4OD5A 2EIJC 5COGA 3JYYA 1BBHA 1VTMP 4WGZA 4ANJA 2XM4A 5L0HA 4CS9C 2R7VA 3G50A 4CSAA 3W8IA 4N06A 2CDQA 3PCVA 4C7OA 2CYDA 2G3VA 3TD7A 1NSGB 4P6IC 4DXWA 1DOVA 3POVA 1TQGA 5L0JA 4JW1A 3UGPA 2KW3C 3DKAA 3K1IA 4YT4A 2WVQA 2CCYA 3MYIA 4YK5A 3T6JA 2J45A 1QVXA 3RQGA 3NRHA 5COMA 1MMGA 2QY9A 3FAJA 2L6GA 3F46A 1U0BB 1Z23A 2GDCA 2EPNA 4ONSA 4DRJB 3NDBB 4H54A 3AG2C 2OEVA 1CGME 3M4CA 4N4WA 2J0XA 4OIRF 1D0YA 2NUTB 1H9TA 4FESA 2EILC 1G5ZA 1XZQA 4AX2A 3DAGA 4DJ9A 2PX3A 4Z9JA 1WTYA 2OQMA 2WVNA 3L0IA 3DJNB 3NMIA 3RQFA 2RD9A 2XLVA 1Q0MA 1PD1A 1I4ZA 2UUHA 1JMWA 5A6JA 1NBBA 2AU5A 2HV7A 2YKZA 4JEBA 3JT1A 1FNTc 5L0IA 3JSZA 3PDMP 2ZXPA 3KPHA 5D91A 3G4ZA 5KYXB 4CIPA 2R7RA 2W4BA 3HTKC 3U0CA 1LVKA 2YL1A 4PJJA 1LI5A 3F47A 4CS7A 2VH3A 1OW7A 3KKBA 1NZEA 3DWWA 2XLEA 3CQZA 2NSGA 3C8GD 4K7BA 2H7BA 3EGXA 1WN0A 5JP7A 1ZU4A 2QUPA 3ZQYA 1T9KA 3HNJA 4XEVA 4CDVA 4KBLA 4J7YA 4YJWA 2WL8A 3S29A 4MVMA 2IYLD 2KK1A 5B3SC 3NMJA 1MMAA 4XLPF 3FOOA 3K6BA 4HEAJ 3M4BA 4CJOA 4LERA 3H2VA 3T9OA 4I44A 3DE9A 1QZXA 4OIPF 1HY5A 2PNOA 1D0XA 3TQOA 1TKNA 2OKUA 2J9BA 3L8IA 3UGOA 1MMDA 3LJBA 1T6QA 1XWJA 4XEKA 2W4MA 3RF3A 1I4YA 1S05A 3C8GB 4NTAA 4EUKB 5KYYA 4G78A 1LS1A 1GQAA 2P1AA 4JTAB 3EH1A 3DI5A 2FAPB 1HE1A 3FHDA 5JRAA 3DZAA 3K1HA 3FMSA 4A4AA 4CS8C 4Q4ZF 1LS4A 2QLAA 4CS9A 1WGWA 2NSFA 1TWGA 2M4EA 2X0CA 1G4US 3AG3C 3SYNA 3U9MA 2ASRA 1U89A 2D4UA 1BZ4A 3LLIA 3DXJF 4PFOA 1D0ZA 4RDAA 2GA0A 1E2XA 3ZC4A 2J9WA 4LDRA 1D1CA 5JUAA 1EKYA 2AWYA 4YT5A 4UDVA 2JX0A 1RKEA 1VLSA 2V26A 1Y4CA 1ZZPA 3LLKA 2P0NA 4YT8A 3SXZA 1C02A 3RW0A 4A2NB 4PJNA 2QNLA 4LDKA 3FVYA 3VYWA 4ZLDA 2G3KA 2BE5F 4O6MA 1NU9C 3IPMO 3ZTZA 2CNWA 5JVEA 3IHUA 3QZCA 1VYIA 4NTBA 5E3CA 1O3UA 2HSQA 1E84A 2DGJA 1FR0A 3AG4C 2WZGA 3C8ZA 1ORJA 4AL1A 2XXAB 3B0VC 2YQYA 4MVZA 3ZG1A 2J7PA 3A11A 1JOGA 1JR8A 1CPRA 1ZHWA 3AQCA 3I5PA 3NYJA 5EK0A 5HSWA 1RJ9B 3GM3A 3IQ5A 3WG7C 4ER9A 1M2VB 2Q9AA 1TWHA 4WJ0A 3ZWIA 1K05A 3EPVA 2C04A 4BJ5C 1J8MF 3PHF2 3JSEO 2OJQA 4DRIB 4K0DA 2EIMC 1OR3A 1ZW2A 1T6UA 3JRTA 4P9FA 1LE4A 4D4XA 4E0HA 2XLOA 1M57C 3GM2A 1L3PA 2A1DD 5JS5A 1TR2A 4GQHA 4BEJA 3GM1A 2FGYA 1FMVA 2J8WA 3U5SA 2Q3TA 2HKVA 2W9YA 4U5GA 2LFDA 1QPUA 2LQGA 2ZD9A 4DBRA 4U5HA 2C03A 2HV6A 4AE4B 5F5HA 1APCA 5L0FA 3V5ZA 4C3BA 1KU2A 2YHSA 1OKKD 3QW0A 1ZW3A 1F1MA 2Y39A 2R7TA 3NG1A 4BG0A 4C7OB 1D1BA 3AQBA 1PV3A 5DS6A 5E2QA 3SXMA 3EFOB 3US6A 4ZLCA 2OU6A 3L34A 5D92A 3U8PA 1HMDA 4M63A 5DQZA 1U6HA 2L6HA 4W8KA 2Y3GA 1RMVA 3MYFA 4LLEA 1R4TA 2Y69C 4GYTA 4MW3A 1Q0DA 3WODF 3FAPB 4B6IA 2LD6A 4EWCA 4IGGA 3JZ0A 4CS8A 3HNKA 4RBNA 1ST6A 5A6BA 2LSEA 4E7ZA 2R9RB 1H6GA 3AJMA 2XL6A 3B71A 1JPNA 2HJMA 1KTMA 3U2MA 4XPWA 2J0WA 1HW2A
chains in the Genus database with same CATH topology
4O6YA 4AK9A 2ZXRA 4O79A 3Q7GA 2XL4A 3FDQA 2Q9BA 4I3MA 4O7GA 4U5DE 4U5CE 2R7OA 3OEOA 2ZXOA 2NUTA 3NYMA 1M56C 3LESA 3ZSUA 1BR1A 3ASOC 3EGXB 4LACB 4JJGA 4I1MA 1M2OA 4U5FE 4IJJA 2IXPA 3S27A 1SMYF 1S7ZA 4LLCA 4PJMA 2KQ9A 4BJ5A 4JVSA 2R7QA 4OD4A 4QI0A 3ECSA 4JJFA 4MQ9F 3GODA 2QTVA 1IW7F 2IOQA 2DYRC 5KYYB 4XWJA 2VB6A 2A68F 1Z5ZA 3W8HA 4FX5A 1ZHTA 4JZAA 4MNDA 3RH3A 2JD3A 2IXOA 3K66A 2MWQA 3SP1A 2P6VA 2J7PD 5F5FA 5KYUA 2W45A 2Q9CA 3DAFA 3EGDA 3K1IC 1OCOC 4PK4A 4IWBA 3ZVRA 3K7DA 2NUPA 2J9UA 3I4UA 5DVWA 2Y3HA 1FFHA 4BJTA 5KYWB 3EZHA 2V3CC 4F4BA 3IEEA 2YZSA 4OIQF 2YEVA 1SF8A 4HE8D 1FFTC 2L9JA 1VYKA 4J32B 3HLZA 1BR2A 1BR4A 2Y3DA 4YN0B 2R7UA 3NYLA 1VMAA 2KJGA 4BJ6C 3EHNA 4FWVA 4HFKB 4OINF 3Q6MA 3JCUQ 3ABLC 1W2WA 3DMDA 3B0UX 4ULWA 4CBEA 2H7VC 4QI2A 2PP4A 4KC9A 4BJ1A 2ZPAA 1LKXA 2B0JA 2CW0F 1V54C 3ABKC 4IAOA 3CZ6A 3EZIA 1SZIA 3X1OA 3I5QA 3DD7A 3N24A 2OCCC 3LS1A 2Y3BA 2D5RB 4G7ZF 1MNEA 1Z6AA 3RYLA 3EG9A 1NU7D 1D1AA 1OCRC 4DBQA 2X51A 4C3EA 4KNWA 2EINC 3T4RA 3LAYA 3ASNC 5FCLA 3EH2A 3LEVA 4AE4A 1TWAA 1O5HA 4XLNF 2VASA 3OWTA 3RKOF 4Q5SF 4YWQA 5DS5A 3H65A 3VAYA 1NG1A 3B9QA 3DJUB 3EFOA 3UMKA 3UMIA 1MMNA 1Z3IX 2WZLA 3Q6NA 3SZRA 5DQTA 2WZFA 2R7SA 3AG1C 2KGOA 3NKEA 1O87A 4XTKA 4PJLA 5B1BC 5CI8A 2O9XA 3MLGA 4KNVA 1IZMA 2A69F 1OKKA 1FMWA 1JPJA 2I8BA 3K33A 2GFHA 4IRUA 4J30B 1VK5A 2EIKC 2IXMA 4G7HF 5B1AC 3Q7LA 4X0RA 2WVOA 3B0PA 4G7OF 4BJ6A 3E9VA 1ZHZA 5KYNA 3ABMC 5E3AA 3V7OA 5KYXA 3KH2A 3N0TA 2PFDA 4H4KC 4QDLA 4U5BE 2R7WA 3W2VA 4HFFB 2CGEA 1Z63A 4I1OB 2DYSC 2A6HF 3EQLF 2L81A 4G0HA 2R7XA 3SEOA 4C3DA 1OCZC 4U5EE 3MX3A 2CNWD 5IY5C 3GANA 3O6XA 2MYSA 2Z15A 3HJCA 3JYHA 3ZIBA 2J9VA 1ZHXA 5DLJA 4Q7CA 5KYUB 5L3VA 4CSAC 5EHHA 1G8XA 1PCXA 4E7SA 4OIOF 4CIHA 2NG1A 1ZU5A 3KMIA 3NKDA 3EGDB 3O39A 1TWCA 2NUPB 3ITFA 1OCCC 5E33A 2IXNA 3KL4A 3DM9B 1J8YF 3T6BA 5T3TA 3X2QC 2H7OA 1MNDA 2E87A 2PX0A 4NY3A 5T1DB 5DS4A 4GEHA 1VOMA 3S28A 4EBBA 3UNGC 2KNHA 2A6EF 4PFPA 4DVZA 2FFHA 2P7VA 3PMRA 2ZXWC 3SNHA 2OG2A 3OA1A 3EJNA 5BUOA 5KYWA 2XSEA 2WB7A 1N1CA 3S0XA 3RIPA 1QLEC 3W2WA 2XXAA 3N2ZB 2J46A 4RD9A 5CI9A 4KI2A 1PD0A 1FTSA 1RJ9A 3LNRA 5T3WA 1M2VA 4DVYP 3RFYA 2PF4E 3UMHA 4JCHA 3M1CB 3LS0A 4O6NA 3EHMA 3DM5A 3EG9B 1V55C 4DOZA 4YT2A 1ZYRF 5EGYA 4JURI 1ZHYA 2XRHA 2G62A 3E70C 5L3QA 3UR3C 3CSKA 3QMKA 4OD5A 2EIJC 4ANJA 4CS9C 2R7VA 4CSAA 3W8IA 4N06A 2CDQA 4C7OA 2G3VA 3TD7A 4P6IC 3POVA 4JW1A 3UGPA 2KW3C 4YT4A 2WVQA 3T6JA 2J45A 3NRHA 1MMGA 2QY9A 3FAJA 3F46A 3NDBB 1Z23A 3AG2C 2J0XA 4OIRF 1D0YA 2NUTB 4FESA 2EILC 4AX2A 3DAGA 2PX3A 3L0IA 2WVNA 3DJNB 1PD1A 2HV7A 3JT1A 3JSZA 2ZXPA 5D91A 5KYXB 2R7RA 2W4BA 3HTKC 1LVKA 4PJJA 3F47A 4CS7A 2VH3A 3KKBA 1NZEA 3CQZA 4K7BA 2H7BA 3EGXA 1ZU4A 4KBLA 4YJWA 2WL8A 3S29A 5B3SC 2IYLD 1MMAA 4XLPF 3K6BA 4HEAJ 4LERA 4I44A 1QZXA 4OIPF 1D0XA 1TKNA 3UGOA 1MMDA 3LJBA 2W4MA 5KYYA 1LS1A 3EH1A 3FHDA 3DZAA 3K1HA 4Q4ZF 4CS8C 4CS9A 1WGWA 1TWGA 2M4EA 3AG3C 3SYNA 3LLIA 4PFOA 3DXJF 4RDAA 1D0ZA 3ZC4A 2J9WA 1D1CA 4YT5A 2V26A 3LLKA 4YT8A 4A2NB 4PJNA 3FVYA 3VYWA 4ZLDA 2G3KA 2BE5F 4O6MA 1NU9C 2CNWA 3QZCA 1VYIA 5E3CA 2DGJA 3AG4C 2WZGA 2XXAB 3B0VC 3ZG1A 2J7PA 3I5PA 1ZHWA 3AQCA 3NYJA 5HSWA 1RJ9B 3WG7C 1M2VB 2Q9AA 1TWHA 4WJ0A 3EPVA 2C04A 4BJ5C 1J8MF 3PHF2 4K0DA 2EIMC 3JRTA 1M57C 2A1DD 1TR2A 4BEJA 2FGYA 1FMVA 2Q3TA 2W9YA 4U5GA 4DBRA 4U5HA 2C03A 2HV6A 4AE4B 5F5HA 4C3BA 1KU2A 2YHSA 1OKKD 2Y39A 2R7TA 3NG1A 4BG0A 4C7OB 1D1BA 3AQBA 5DS6A 5E2QA 3EFOB 4ZLCA 3L34A 5D92A 4M63A 5DQZA 4W8KA 2Y3GA 4LLEA 2Y69C 4GYTA 3WODF 4B6IA 4EWCA 4CS8A 4RBNA 1ST6A 2LSEA 4E7ZA 1JPNA 2J0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZM A;  4GYT A; 
#chains in the Genus database with same CATH topology
 4O6Y A;  1QQ3 A;  4PAC A;  2Q00 A;  1VB5 A;  3GWN A;  4AK9 A;  2Q4F A;  1HE9 A;  5A6A A;  2ZXR A;  4JC7 A;  4O79 A;  3Q7G A;  3QW1 A;  2XL4 A;  4N6C A;  4BEM J;  3FDQ A;  1CPQ A;  2Q9B A;  4I3M A;  4O7G A;  1T6I A;  4JKV A;  4U5D E;  4U5C E;  2R7O A;  1JRA A;  2XLM A;  4XPY A;  2YL0 A;  3OEO A;  1C03 A;  4ULV A;  2HMQ A;  2M64 A;  2ZXO A;  2LCH A;  4YL0 A;  2NUT A;  3NYM A;  1M56 C;  256B A;  3LES A;  5COF A;  3ZSU A;  5HV9 A;  1BR1 A;  3S90 A;  3ASO C;  3EGX B;  4LAC B;  4JJG A;  4I1M A;  4JTC B;  3T6G B;  1M2O A;  5A69 A;  1WAS A;  2MHR A;  4U5F E;  1ZVZ A;  4WGY A;  4AL0 A;  1SR2 A;  3AGT A;  4IJJ A;  3ZTM A;  4CSA C;  5AC5 A;  2IXP A;  1RCP A;  1YVI A;  3L1M A;  1OW6 A;  3S27 A;  1SMY F;  1S7Z A;  4CX9 A;  4LLC A;  4PJM A;  2KQ9 A;  1MQV A;  4JVS A;  2R7Q A;  4BJ5 A;  4OD4 A;  4QI0 A;  3ECS A;  1YYX A;  4EKW A;  1VLT A;  2YLG A;  5GPG B;  2VC9 A;  1QKR A;  2AVK A;  4JJF A;  4MQ9 F;  1AUE A;  1JAF A;  1FAP B;  2YVK A;  3GOD A;  1C17 M;  2QTV A;  4R32 A;  4D4N A;  3V5X A;  1IW7 F;  2IOQ A;  1OQC A;  1YAU O;  2DYR C;  3HNI A;  3TJ5 A;  5KYY B;  4YL1 A;  4XWJ A;  2VB6 A;  2A68 F;  1A7V A;  1G4W R;  4MVO A;  3SXY A;  4EBJ A;  3RVZ A;  1Z5Z A;  3W8H A;  4FX5 A;  1XZP A;  2A0U A;  3TOM A;  1NFN A;  1ZHT A;  4JIO A;  4JZA A;  4MND A;  3R7C A;  3GWL A;  3RH3 A;  3SXK A;  2JD3 A;  2IXO A;  3K66 A;  3QVZ A;  2MWQ A;  4NQF A;  3SP1 A;  3RVY A;  5JT4 A;  1ORY A;  2P6V A;  5JLI A;  3J06 A;  2J7P D;  5F5F A;  2GWW A;  5KYU A;  2XS1 A;  4XPX A;  2W45 A;  2LIG A;  2Q9C A;  3DAF A;  2XS8 A;  3IQT A;  5L0D A;  1RKE B;  3EGD A;  1DOW A;  1OCO C;  1I5N A;  2A0B A;  3K1I C;  3M15 A;  4IWB A;  1YYJ A;  3K7D A;  4MTF A;  4PK4 A;  2NUP A;  2J9U A;  3ZVR A;  3I4U A;  5DVW A;  2Y3H A;  3HKK A;  4MVR A;  4U9E A;  2YL7 A;  1FFH A;  2HJ3 A;  4MS2 A;  2HUJ A;  4MW8 A;  3MFN A;  1WAT A;  4BJT A;  5KYW B;  3EZH A;  2V3C C;  4F4B A;  1A0B A;  2YZS A;  3FXH A;  3IEE A;  4OIQ F;  2YEV A;  4JEA A;  1SF8 A;  1T5O A;  3LUT B;  4HE8 D;  1FFT C;  2L9J A;  1VYK A;  3DE8 A;  3R2P A;  4J32 B;  2XLH A;  3HLZ A;  1A7E A;  1BR2 A;  1BR4 A;  3BRJ A;  2OJE D;  2Y3D A;  4YN0 B;  2R7U A;  2VCA A;  1H7I A;  1VMA A;  2KJG A;  3NYL A;  3EHN A;  4JCZ A;  4JTD B;  2YLI A;  1B68 A;  4L6R A;  1Q0G A;  1L7C A;  4FWV A;  4HFK B;  4OIN F;  3Q6M A;  3JCU Q;  3ABL C;  5AC4 A;  4NCQ A;  4E18 A;  1W2W A;  3DMD A;  2OEX A;  4ULW A;  5F28 E;  1Z7Q c;  5CIV A;  2F22 A;  3B0U X;  3U8V A;  4CBE A;  2H7V C;  2KYH A;  4QI2 A;  2PP4 A;  4KC9 A;  4BJ1 A;  2ZPA A;  1LKX A;  4IB4 A;  2B0J A;  3NMK A;  1RXQ A;  2CW0 F;  1V54 C;  4LDQ A;  5K0I A;  3ABK C;  4IAO A;  3CZ6 A;  2HSB A;  3EZI A;  1SZI A;  3X1O A;  3DD7 A;  3I5Q A;  3TK0 A;  2XM0 A;  3N24 A;  2LP4 A;  4PR9 A;  2OCC C;  2LK4 A;  4Z9I A;  3LS1 A;  2Y3B A;  4J7T A;  1R5I D;  1UG7 A;  1K40 A;  1V74 B;  2D5R B;  4G7Z F;  1MNE A;  2IM8 A;  1Z6A A;  3ATP A;  4MTO A;  2B0H A;  3RYL A;  3C62 A;  3EG9 A;  3VRC A;  4E0I A;  1NU7 D;  2DI3 A;  2PBE A;  3WAQ A;  2HZ8 A;  1D1A A;  1OCR C;  2ETS A;  2X51 A;  3AOU A;  3JRM O;  4N6H A;  4DBQ A;  2DB4 A;  1EA8 A;  5L0G A;  1GGQ A;  4BJ6 C;  1QSP A;  4KNW A;  2EIN C;  4C3E A;  3T4R A;  3LAY A;  3ASN C;  4MVS A;  3S9O A;  5FCL A;  2R02 A;  3EH2 A;  3LEV A;  4AE4 A;  1TWA A;  5BQH A;  1O5H A;  4MTG A;  4XLN F;  4WAB A;  2KC3 A;  2VAS A;  3OWT A;  3RKO F;  4Q5S F;  4YWQ A;  1LPE A;  3O10 A;  3U3F A;  5DS5 A;  3H65 A;  3U9J A;  2VCC A;  2XLW A;  4JE9 A;  1NG1 A;  3VAY A;  1KNY A;  3B9Q A;  3DJU B;  2JPU A;  3EFO A;  3UMK A;  3UMI A;  2IBF A;  2LFF A;  1MMN A;  1Z3I X;  2WZL A;  3Q6N A;  3SZR A;  5DQT A;  2WZF A;  1GM5 A;  2R7S A;  3AG1 C;  3GEH A;  1YLM A;  5A6K A;  1YA7 O;  2KGO A;  2BL2 A;  3CAX A;  1O87 A;  3GEI A;  3NKE A;  3O55 A;  4XTK A;  4PJL A;  3ZQV A;  2QE9 A;  1NFO A;  5B1B C;  1YZC A;  1YA9 A;  2O9X A;  5CI8 A;  4BPM A;  3S84 A;  3MLG A;  2OOC A;  4KNV A;  1IZM A;  2A69 F;  1OKK A;  4MVQ A;  1FMW A;  1JPJ A;  2I8B A;  2L7A A;  3K33 A;  2GFH A;  4IRU A;  4J30 B;  1VK5 A;  2EIK C;  2IXM A;  4CDA A;  3TUL A;  5B1A C;  4G7H F;  1EQ1 A;  1M6T A;  3Q7L A;  4X0R A;  2WVO A;  5BQG A;  5JSL A;  3B0P A;  3BEH A;  4G7O F;  4BJ6 A;  3E9V A;  1ZHZ A;  2RSE B;  4EHP A;  4EIY A;  5KYN A;  2P61 A;  2NPU A;  3ABM C;  5E3A A;  3V7O A;  3U2L A;  5KYX A;  2BC5 A;  4MVU A;  3KH2 A;  3LEO A;  5AGF A;  3N0T A;  1E86 A;  4NC3 A;  2PFD A;  2XL8 A;  4H4K C;  4QDL A;  3FOP A;  4U5B E;  2EPK X;  1AVO B;  2HS5 A;  1T01 A;  1K04 A;  2R7W A;  3W2V A;  3C63 A;  3GOR A;  5B3I A;  3JTL O;  4HFF B;  4P9T A;  2CGE A;  1Z63 A;  4I1O B;  2EPL X;  3TOL A;  2DYS C;  2A6H F;  3EQL F;  2L81 A;  4G0H A;  2R7X A;  2TMV P;  2UUI A;  3SEO A;  4C3D A;  1LIH A;  1OCZ C;  3KYJ A;  2CNW D;  3G4X A;  3MX3 A;  4U5E E;  1LM3 B;  5IY5 C;  3KYI A;  3CEX A;  2EPM X;  3GAN A;  3O6X A;  2MYS A;  5L0C A;  2AP3 A;  2Z15 A;  3L8J A;  1OXK A;  1OXB A;  3HJC A;  2J9V A;  1ZHX A;  1TFK B;  3JYH A;  4Q7C A;  3ZIB A;  5DLJ A;  5L3V A;  5KYU B;  5EHH A;  1G8X A;  3C18 A;  3LNM B;  1PCX A;  1WOL A;  1H9G A;  4E7S A;  4OIO F;  4CIH A;  2NG1 A;  2ICW G;  3AGU A;  3QVY A;  1ZU5 A;  3KMI A;  3VM6 A;  3NKD A;  3EGD B;  3MBG A;  3O39 A;  1TWC A;  3W4Y A;  2NUP B;  3ITF A;  3C8G A;  1OCC C;  3C7J A;  5E33 A;  2IXN A;  3KL4 A;  3DM9 B;  1J8Y F;  3T6B A;  3ZDL A;  4XEF A;  2YLD A;  5T3T A;  5TJ5 E;  3X2Q C;  2I15 A;  1GS9 A;  4E17 A;  3TJ6 A;  3M79 A;  4YL3 A;  3H2U A;  1ORS C;  2H7O A;  3WHN A;  1HW1 A;  1SYQ A;  1MND A;  2AWC A;  2E87 A;  3IQC A;  4W8P A;  4Z9H A;  1E83 A;  2PX0 A;  2HMZ A;  4IAQ A;  1Y6D A;  3B29 A;  4NTF A;  4NY3 A;  5T1D B;  5DS4 A;  2GAQ A;  4GEH A;  4K1O A;  5BQI A;  1OR2 A;  2R05 A;  1HMO A;  1E85 A;  1VOM A;  3S28 A;  4EBB A;  3UNG C;  2KNH A;  2A6E F;  4PFP A;  4DVZ A;  2FFH A;  2P7V A;  1OW8 A;  3PMR A;  2ZXW C;  1V4A A;  2R03 A;  3SNH A;  2OG2 A;  5FZT A;  3OA1 A;  3VF0 A;  1UFB A;  3EJN A;  5BUO A;  5KYW A;  2XSE A;  1EI7 A;  1AEP A;  3RQE A;  1NLX A;  1RKC A;  1A41 A;  1N1C A;  1Q0K A;  2WB7 A;  3S0X A;  3RIP A;  3A9C A;  1QLE C;  4U9D A;  3W2W A;  2XXA A;  3N2Z B;  3HNL A;  2J46 A;  4RD9 A;  1YJG A;  5CI9 A;  4KI2 A;  5A6B D;  1FTS A;  1PD0 A;  1RJ9 A;  2YL3 A;  1LE2 A;  3LNR A;  4XQ1 A;  4CDY A;  1YDI A;  2H8A A;  1M2V A;  5T3W A;  1BDJ B;  1Q0F A;  2HFI A;  2PF4 E;  1CGO A;  3RFY A;  1A7D A;  3UMH A;  4DVY P;  4JCH A;  4FAP B;  2VCB A;  3M1C B;  2XLD A;  3GEE A;  3LS0 A;  4EBK A;  1YZA A;  1TFO B;  2EPO A;  4O6N A;  3EHM A;  3DM5 A;  1YAR O;  3EG9 B;  1V55 C;  3IQ6 A;  4DRH B;  4DOZ A;  4YT2 A;  1WWP A;  1ZYR F;  5EGY A;  3V5Y A;  4JUR I;  1ZHY A;  4CJG A;  4IAR A;  2XRH A;  2G62 A;  3E70 C;  1LI7 A;  2YWA A;  3U3B A;  4JRZ A;  2R25 A;  3QTH A;  2YRF A;  2Q7R A;  1CGN A;  5L3Q A;  2L6F A;  3UR3 C;  2KSF A;  3CSK A;  3QMK A;  4OD5 A;  2EIJ C;  5COG A;  3JYY A;  1BBH A;  1VTM P;  4WGZ A;  4ANJ A;  2XM4 A;  5L0H A;  4CS9 C;  2R7V A;  3G50 A;  4CSA A;  3W8I A;  4N06 A;  2CDQ A;  3PCV A;  4C7O A;  2CYD A;  2G3V A;  3TD7 A;  1NSG B;  4P6I C;  4DXW A;  1DOV A;  3POV A;  1TQG A;  5L0J A;  4JW1 A;  3UGP A;  2KW3 C;  3DKA A;  3K1I A;  4YT4 A;  2WVQ A;  2CCY A;  3MYI A;  4YK5 A;  3T6J A;  2J45 A;  1QVX A;  3RQG A;  3NRH A;  5COM A;  1MMG A;  2QY9 A;  3FAJ A;  2L6G A;  3F46 A;  1U0B B;  1Z23 A;  2GDC A;  2EPN A;  4ONS A;  4DRJ B;  3NDB B;  4H54 A;  3AG2 C;  2OEV A;  1CGM E;  3M4C A;  4N4W A;  2J0X A;  4OIR F;  1D0Y A;  2NUT B;  1H9T A;  4FES A;  2EIL C;  1G5Z A;  1XZQ A;  4AX2 A;  3DAG A;  4DJ9 A;  2PX3 A;  4Z9J A;  1WTY A;  2OQM A;  2WVN A;  3L0I A;  3DJN B;  3NMI A;  3RQF A;  2RD9 A;  2XLV A;  1Q0M A;  1PD1 A;  1I4Z A;  2UUH A;  1JMW A;  5A6J A;  1NBB A;  2AU5 A;  2HV7 A;  2YKZ A;  4JEB A;  3JT1 A;  1FNT c;  5L0I A;  3JSZ A;  3PDM P;  2ZXP A;  3KPH A;  5D91 A;  3G4Z A;  5KYX B;  4CIP A;  2R7R A;  2W4B A;  3HTK C;  3U0C A;  1LVK A;  2YL1 A;  4PJJ A;  1LI5 A;  3F47 A;  4CS7 A;  2VH3 A;  1OW7 A;  3KKB A;  1NZE A;  3DWW A;  2XLE A;  3CQZ A;  2NSG A;  3C8G D;  4K7B A;  2H7B A;  3EGX A;  1WN0 A;  5JP7 A;  1ZU4 A;  2QUP A;  3ZQY A;  1T9K A;  3HNJ A;  4XEV A;  4CDV A;  4KBL A;  4J7Y A;  4YJW A;  2WL8 A;  3S29 A;  4MVM A;  2IYL D;  2KK1 A;  5B3S C;  3NMJ A;  1MMA A;  4XLP F;  3FOO A;  3K6B A;  4HEA J;  3M4B A;  4CJO A;  4LER A;  3H2V A;  3T9O A;  4I44 A;  3DE9 A;  1QZX A;  4OIP F;  1HY5 A;  2PNO A;  1D0X A;  3TQO A;  1TKN A;  2OKU A;  2J9B A;  3L8I A;  3UGO A;  1MMD A;  3LJB A;  1T6Q A;  1XWJ A;  4XEK A;  2W4M A;  3RF3 A;  1I4Y A;  1S05 A;  3C8G B;  4NTA A;  4EUK B;  5KYY A;  4G78 A;  1LS1 A;  1GQA A;  2P1A A;  4JTA B;  3EH1 A;  3DI5 A;  2FAP B;  1HE1 A;  3FHD A;  5JRA A;  3DZA A;  3K1H A;  3FMS A;  4A4A A;  4CS8 C;  4Q4Z F;  1LS4 A;  2QLA A;  4CS9 A;  1WGW A;  2NSF A;  1TWG A;  2M4E A;  2X0C A;  1G4U S;  3AG3 C;  3SYN A;  3U9M A;  2ASR A;  1U89 A;  2D4U A;  1BZ4 A;  3LLI A;  3DXJ F;  4PFO A;  1D0Z A;  4RDA A;  2GA0 A;  1E2X A;  3ZC4 A;  2J9W A;  4LDR A;  1D1C A;  5JUA A;  1EKY A;  2AWY A;  4YT5 A;  4UDV A;  2JX0 A;  1RKE A;  1VLS A;  2V26 A;  1Y4C A;  1ZZP A;  3LLK A;  2P0N A;  4YT8 A;  3SXZ A;  1C02 A;  3RW0 A;  4A2N B;  4PJN A;  2QNL A;  4LDK A;  3FVY A;  3VYW A;  4ZLD A;  2G3K A;  2BE5 F;  4O6M A;  1NU9 C;  3IPM O;  3ZTZ A;  2CNW A;  5JVE A;  3IHU A;  3QZC A;  1VYI A;  4NTB A;  5E3C A;  1O3U A;  2HSQ A;  1E84 A;  2DGJ A;  1FR0 A;  3AG4 C;  2WZG A;  3C8Z A;  1ORJ A;  4AL1 A;  2XXA B;  3B0V C;  2YQY A;  4MVZ A;  3ZG1 A;  2J7P A;  3A11 A;  1JOG A;  1JR8 A;  1CPR A;  1ZHW A;  3AQC A;  3I5P A;  3NYJ A;  5EK0 A;  5HSW A;  1RJ9 B;  3GM3 A;  3IQ5 A;  3WG7 C;  4ER9 A;  1M2V B;  2Q9A A;  1TWH A;  4WJ0 A;  3ZWI A;  1K05 A;  3EPV A;  2C04 A;  4BJ5 C;  1J8M F;  3PHF 2;  3JSE O;  2OJQ A;  4DRI B;  4K0D A;  2EIM C;  1OR3 A;  1ZW2 A;  1T6U A;  3JRT A;  4P9F A;  1LE4 A;  4D4X A;  4E0H A;  2XLO A;  1M57 C;  3GM2 A;  1L3P A;  2A1D D;  5JS5 A;  1TR2 A;  4GQH A;  4BEJ A;  3GM1 A;  2FGY A;  1FMV A;  2J8W A;  3U5S A;  2Q3T A;  2HKV A;  2W9Y A;  4U5G A;  2LFD A;  1QPU A;  2LQG A;  2ZD9 A;  4DBR A;  4U5H A;  2C03 A;  2HV6 A;  4AE4 B;  5F5H A;  1APC A;  5L0F A;  3V5Z A;  4C3B A;  1KU2 A;  2YHS A;  1OKK D;  3QW0 A;  1ZW3 A;  1F1M A;  2Y39 A;  2R7T A;  3NG1 A;  4BG0 A;  4C7O B;  1D1B A;  3AQB A;  1PV3 A;  5DS6 A;  5E2Q A;  3SXM A;  3EFO B;  3US6 A;  4ZLC A;  2OU6 A;  3L34 A;  5D92 A;  3U8P A;  1HMD A;  4M63 A;  5DQZ A;  1U6H A;  2L6H A;  4W8K A;  2Y3G A;  1RMV A;  3MYF A;  4LLE A;  1R4T A;  2Y69 C;  4GYT A;  4MW3 A;  1Q0D A;  3WOD F;  3FAP B;  4B6I A;  2LD6 A;  4EWC A;  4IGG A;  3JZ0 A;  4CS8 A;  3HNK A;  4RBN A;  1ST6 A;  5A6B A;  2LSE A;  4E7Z A;  2R9R B;  1H6G A;  3AJM A;  2XL6 A;  3B71 A;  1JPN A;  2HJM A;  1KTM A;  3U2M A;  4XPW A;  2J0W A;  1HW2 A; 
#chains in the Genus database with same CATH homology
 4O6Y A;  4AK9 A;  2ZXR A;  4O79 A;  3Q7G A;  2XL4 A;  3FDQ A;  2Q9B A;  4I3M A;  4O7G A;  4U5D E;  4U5C E;  2R7O A;  3OEO A;  2ZXO A;  2NUT A;  3NYM A;  1M56 C;  3LES A;  3ZSU A;  1BR1 A;  3ASO C;  3EGX B;  4LAC B;  4JJG A;  4I1M A;  1M2O A;  4U5F E;  4IJJ A;  2IXP A;  3S27 A;  1SMY F;  1S7Z A;  4LLC A;  4PJM A;  2KQ9 A;  4BJ5 A;  4JVS A;  2R7Q A;  4OD4 A;  4QI0 A;  3ECS A;  4JJF A;  4MQ9 F;  3GOD A;  2QTV A;  1IW7 F;  2IOQ A;  2DYR C;  5KYY B;  4XWJ A;  2VB6 A;  2A68 F;  1Z5Z A;  3W8H A;  4FX5 A;  1ZHT A;  4JZA A;  4MND A;  3RH3 A;  2JD3 A;  2IXO A;  3K66 A;  2MWQ A;  3SP1 A;  2P6V A;  2J7P D;  5F5F A;  5KYU A;  2W45 A;  2Q9C A;  3DAF A;  3EGD A;  3K1I C;  1OCO C;  4PK4 A;  4IWB A;  3ZVR A;  3K7D A;  2NUP A;  2J9U A;  3I4U A;  5DVW A;  2Y3H A;  1FFH A;  4BJT A;  5KYW B;  3EZH A;  2V3C C;  4F4B A;  3IEE A;  2YZS A;  4OIQ F;  2YEV A;  1SF8 A;  4HE8 D;  1FFT C;  2L9J A;  1VYK A;  4J32 B;  3HLZ A;  1BR2 A;  1BR4 A;  2Y3D A;  4YN0 B;  2R7U A;  3NYL A;  1VMA A;  2KJG A;  4BJ6 C;  3EHN A;  4FWV A;  4HFK B;  4OIN F;  3Q6M A;  3JCU Q;  3ABL C;  1W2W A;  3DMD A;  3B0U X;  4ULW A;  4CBE A;  2H7V C;  4QI2 A;  2PP4 A;  4KC9 A;  4BJ1 A;  2ZPA A;  1LKX A;  2B0J A;  2CW0 F;  1V54 C;  3ABK C;  4IAO A;  3CZ6 A;  3EZI A;  1SZI A;  3X1O A;  3I5Q A;  3DD7 A;  3N24 A;  2OCC C;  3LS1 A;  2Y3B A;  2D5R B;  4G7Z F;  1MNE A;  1Z6A A;  3RYL A;  3EG9 A;  1NU7 D;  1D1A A;  1OCR C;  4DBQ A;  2X51 A;  4C3E A;  4KNW A;  2EIN C;  3T4R A;  3LAY A;  3ASN C;  5FCL A;  3EH2 A;  3LEV A;  4AE4 A;  1TWA A;  1O5H A;  4XLN F;  2VAS A;  3OWT A;  3RKO F;  4Q5S F;  4YWQ A;  5DS5 A;  3H65 A;  3VAY A;  1NG1 A;  3B9Q A;  3DJU B;  3EFO A;  3UMK A;  3UMI A;  1MMN A;  1Z3I X;  2WZL A;  3Q6N A;  3SZR A;  5DQT A;  2WZF A;  2R7S A;  3AG1 C;  2KGO A;  3NKE A;  1O87 A;  4XTK A;  4PJL A;  5B1B C;  5CI8 A;  2O9X A;  3MLG A;  4KNV A;  1IZM A;  2A69 F;  1OKK A;  1FMW A;  1JPJ A;  2I8B A;  3K33 A;  2GFH A;  4IRU A;  4J30 B;  1VK5 A;  2EIK C;  2IXM A;  4G7H F;  5B1A C;  3Q7L A;  4X0R A;  2WVO A;  3B0P A;  4G7O F;  4BJ6 A;  3E9V A;  1ZHZ A;  5KYN A;  3ABM C;  5E3A A;  3V7O A;  5KYX A;  3KH2 A;  3N0T A;  2PFD A;  4H4K C;  4QDL A;  4U5B E;  2R7W A;  3W2V A;  4HFF B;  2CGE A;  1Z63 A;  4I1O B;  2DYS C;  2A6H F;  3EQL F;  2L81 A;  4G0H A;  2R7X A;  3SEO A;  4C3D A;  1OCZ C;  4U5E E;  3MX3 A;  2CNW D;  5IY5 C;  3GAN A;  3O6X A;  2MYS A;  2Z15 A;  3HJC A;  3JYH A;  3ZIB A;  2J9V A;  1ZHX A;  5DLJ A;  4Q7C A;  5KYU B;  5L3V A;  4CSA C;  5EHH A;  1G8X A;  1PCX A;  4E7S A;  4OIO F;  4CIH A;  2NG1 A;  1ZU5 A;  3KMI A;  3NKD A;  3EGD B;  3O39 A;  1TWC A;  2NUP B;  3ITF A;  1OCC C;  5E33 A;  2IXN A;  3KL4 A;  3DM9 B;  1J8Y F;  3T6B A;  5T3T A;  3X2Q C;  2H7O A;  1MND A;  2E87 A;  2PX0 A;  4NY3 A;  5T1D B;  5DS4 A;  4GEH A;  1VOM A;  3S28 A;  4EBB A;  3UNG C;  2KNH A;  2A6E F;  4PFP A;  4DVZ A;  2FFH A;  2P7V A;  3PMR A;  2ZXW C;  3SNH A;  2OG2 A;  3OA1 A;  3EJN A;  5BUO A;  5KYW A;  2XSE A;  2WB7 A;  1N1C A;  3S0X A;  3RIP A;  1QLE C;  3W2W A;  2XXA A;  3N2Z B;  2J46 A;  4RD9 A;  5CI9 A;  4KI2 A;  1PD0 A;  1FTS A;  1RJ9 A;  3LNR A;  5T3W A;  1M2V A;  4DVY P;  3RFY A;  2PF4 E;  3UMH A;  4JCH A;  3M1C B;  3LS0 A;  4O6N A;  3EHM A;  3DM5 A;  3EG9 B;  1V55 C;  4DOZ A;  4YT2 A;  1ZYR F;  5EGY A;  4JUR I;  1ZHY A;  2XRH A;  2G62 A;  3E70 C;  5L3Q A;  3UR3 C;  3CSK A;  3QMK A;  4OD5 A;  2EIJ C;  4ANJ A;  4CS9 C;  2R7V A;  4CSA A;  3W8I A;  4N06 A;  2CDQ A;  4C7O A;  2G3V A;  3TD7 A;  4P6I C;  3POV A;  4JW1 A;  3UGP A;  2KW3 C;  4YT4 A;  2WVQ A;  3T6J A;  2J45 A;  3NRH A;  1MMG A;  2QY9 A;  3FAJ A;  3F46 A;  3NDB B;  1Z23 A;  3AG2 C;  2J0X A;  4OIR F;  1D0Y A;  2NUT B;  4FES A;  2EIL C;  4AX2 A;  3DAG A;  2PX3 A;  3L0I A;  2WVN A;  3DJN B;  1PD1 A;  2HV7 A;  3JT1 A;  3JSZ A;  2ZXP A;  5D91 A;  5KYX B;  2R7R A;  2W4B A;  3HTK C;  1LVK A;  4PJJ A;  3F47 A;  4CS7 A;  2VH3 A;  3KKB A;  1NZE A;  3CQZ A;  4K7B A;  2H7B A;  3EGX A;  1ZU4 A;  4KBL A;  4YJW A;  2WL8 A;  3S29 A;  5B3S C;  2IYL D;  1MMA A;  4XLP F;  3K6B A;  4HEA J;  4LER A;  4I44 A;  1QZX A;  4OIP F;  1D0X A;  1TKN A;  3UGO A;  1MMD A;  3LJB A;  2W4M A;  5KYY A;  1LS1 A;  3EH1 A;  3FHD A;  3DZA A;  3K1H A;  4Q4Z F;  4CS8 C;  4CS9 A;  1WGW A;  1TWG A;  2M4E A;  3AG3 C;  3SYN A;  3LLI A;  4PFO A;  3DXJ F;  4RDA A;  1D0Z A;  3ZC4 A;  2J9W A;  1D1C A;  4YT5 A;  2V26 A;  3LLK A;  4YT8 A;  4A2N B;  4PJN A;  3FVY A;  3VYW A;  4ZLD A;  2G3K A;  2BE5 F;  4O6M A;  1NU9 C;  2CNW A;  3QZC A;  1VYI A;  5E3C A;  2DGJ A;  3AG4 C;  2WZG A;  2XXA B;  3B0V C;  3ZG1 A;  2J7P A;  3I5P A;  1ZHW A;  3AQC A;  3NYJ A;  5HSW A;  1RJ9 B;  3WG7 C;  1M2V B;  2Q9A A;  1TWH A;  4WJ0 A;  3EPV A;  2C04 A;  4BJ5 C;  1J8M F;  3PHF 2;  4K0D A;  2EIM C;  3JRT A;  1M57 C;  2A1D D;  1TR2 A;  4BEJ A;  2FGY A;  1FMV A;  2Q3T A;  2W9Y A;  4U5G A;  4DBR A;  4U5H A;  2C03 A;  2HV6 A;  4AE4 B;  5F5H A;  4C3B A;  1KU2 A;  2YHS A;  1OKK D;  2Y39 A;  2R7T A;  3NG1 A;  4BG0 A;  4C7O B;  1D1B A;  3AQB A;  5DS6 A;  5E2Q A;  3EFO B;  4ZLC A;  3L34 A;  5D92 A;  4M63 A;  5DQZ A;  4W8K A;  2Y3G A;  4LLE A;  2Y69 C;  4GYT A;  3WOD F;  4B6I A;  4EWC A;  4CS8 A;  4RBN A;  1ST6 A;  2LSE A;  4E7Z A;  1JPN A;  2J0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...