1J0FA

Solution structure of the sh3 domain binding glutamic acid-rich protein like 3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
100
structure length
100
Chain Sequence
GSEGAATMSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKATPPQIVNGNHYCGDYELFVEAVEQDTLQEFLKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 domain-binding glutamic acid-rich-like protein 3
publication title Solution Structure of the SH3 Domain Binding Glutamic Acid-rich Protein Like 3
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 25
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04908 SH3BGR SH3-binding, glutamic acid-rich protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1j0fA00
5LD0A 2VAFA 2WFCA 1Q98A 3GIXA 3HYPA 1S3DA 3L78A 4IJ3A 3ZZXA 4PXOA 3F6FA 1XWCA 3NIVA 1EOHA 3GMFA 1EWXA 1M7TA 4KE3A 4OFTA 2LJAA 1T1VA 3GKNA 4G2EA 3W6GA 1ERUA 3D5JA 1F9MA 1KTEA 5IMDA 4KSOA 2VLTA 2CZ3A 5IIZA 5JCWA 5B8AA 1G6YA 4KH7A 4BWSA 3GA4A 2KP2A 5ECQB 1V2AA 2H1BA 4PNGA 3HVXA 3ERGA 5D9XA 3BD2A 5HQPA 3LWAA 3ZFLA 4KW6A 1XWGA 3MNGA 2VOCA 1A0RP 1OC3A 2L4QA 2RM5A 2E0QA 3QAGA 4JE1A 3VLNA 3KZQA 3DVXA 4NAXA 3RHBA 2QKEA 3I9V2 1AW9A 3KP8A 3TJBA 4WETA 2H70A 4I6XA 3TJFA 1EOGA 2GQKA 1LU4A 3ZL5A 2WZ9A 4EL1A 2X8CA 3AY8A 1NM3A 3GX8A 2FWHA 5GZZB 12GSA 4IP1A 4POKA 4TW5A 5D8IA 1JZDA 4HOJA 5HR3A 4F2IA 1AQXA 2FWFA 2GGTA 1FHEA 1Z5YE 3L9SA 3VK9A 3DGQA 4IP6A 1GUKA 4XS4A 4ML1A 1TJDA 2BTOT 2F9SA 4DSSB 1PKWA 2F8FA 4K7OA 2VLVA 3HXSA 3WYWA 3F3QA 2C80A 2IJYA 1V40A 1MD4A 1F2EA 2CA8A 2OBIA 4JR6A 5G5FA 2X8GA 4KDUA 1IYIA 3IV4A 4XS6A 3FK8A 5JWOB 4BPYA 1OC8A 2V41A 2XBIA 4JBBA 4OCEA 3QMXA 2GSQA 2XHFA 3RPNA 3C73A 3F9UA 4YQUA 1R5AA 3APOA 4GSNA 2VCXA 2YV7A 3IHQA 2YN1A 2WDUA 3KEBA 1QK8A 5F07A 4KNDA 1SD9A 1GLPA 1H75A 5L71A 2YZUA 1NW2A 2OE0A 1SU9A 3K8NA 4MA9A 3VPTA 1BEDA 2YCDA 3GYKA 2P5RA 1WJKA 1Q4JA 4V2MA 5D9VA 2AV4A 5DALA 4I5QA 2C3QA 2VM1A 3IPZA 1DE2A 1SYXA 3Q6OA 1O81A 5ECNB 5ABRA 3VWUA 1A2JA 5F0GA 3EU4A 5DCHA 4EC0A 4ISDA 3ZVJD 3NZNA 4RQXA 2JZSA 1TRVA 1TOFA 1XVQA 1PN9A 4YAVA 4KGIA 2H76A 2GSRA 3CSIA 4EF0A 5LNKe 4JZQA 1TK0B 1U3AA 2R5GA 2VD1A 3HJMA 4AF2A 4XCSA 2MZCA 1QGVA 1KBNA 2ZNMA 1B4QA 5E59A 2YV9A 1K3LA 3WT2A 4KCAA 4POLA 3IAS2 3P2AA 3D21A 1SYRA 2M72A 2PERA 1A2MA 4MJCA 1UC7A 4O92A 2BJXA 3UVHA 6GSXA 1QXHA 2MMAA 4K2DA 4GSSA 3HA9A 1EV9A 2TIRA 2QC7A 3DYRA 2YNXA 4V2NA 5CRGA 2HLSA 5A5KA 5DVBA 2YWMA 4WF5A 1VF3A 2VCVA 6GSUA 2B5YA 2IL3A 3VWVA 4MF6A 3Q74A 3TGZA 1PD21 2KP1A 2YPMA 5A4UA 2DJ0A 2GT6A 2PU9C 1THOA 16GSA 1GSEA 5AIVA 5A4VA 1VF1A 3BCIA 1EGOA 3KH9A 3APSA 4FYCA 1OKDA 5AIXA 2PN8A 2H75A 2DBCA 4Z7XA 4WXTA 4EDYA 3IRAA 1T8EB 4ZIJA 1XOBA 2GSTA 1AAZA 1VRSD 4MCUA 2P0GA 2B1LA 2C1YA 4I2TA 1FO5A 3C8EA 4HQZA 5IMCA 3ZYWA 1AC1A 1GTUA 2L57A 3PH9A 5KEJA 1V58A 3JCML 2IPAA 3IXRA 5ID2B 3UIWA 1SKSB 3UMAA 4ECIA 3IR4A 3G7IA 2EC4A 1ZYQB 1CQHA 3LYPA 5KN0A 2GQLA 1N8JA 2H0IA 1TXXA 3MWHA 1Z6NA 3N9JA 2GVPA 3G7JA 4O32A 4PQHA 1GTBA 5CRHA 3IK9A 4GQFA 1BYEA 4OO5A 3H4KA 5IMZA 2K18A 2YOIA 4GQCA 4F0BA 4OFMA 2L6CA 4PURA 3RBTA 3FY7A 4TN8A 3L9UA 3BJ5A 1S3AA 1XPVA 4GLTA 1USBA 4TOPA 1PMTA 1WP0A 3OR5A 2ON5A 1MDKA 2HT9A 5IOXA 5G2ZA 2YP6A 5H5SA 4WEYA 2YANA 4HZ4A 2DJJA 3VPQA 4ZBAA 5DCGA 2JU5A 2HXKA 3PR8A 3KGKA 1RW1A 1LBKA 2NPBA 3E9JB 3FZAA 1TRSA 2LS5A 3GH9A 1X0RA 4XS4B 2K9FA 1HNBA 2ON7A 4IW9A 1WPIA 1ZYEA 3ZVJA 4I8BA 3KP9A 4IHUA 4K7IA 2WB9A 3US3A 2ZUPA 1MDIA 3DKSA 4IVFA 3FR6A 2C3NA 1K3OA 1WE0A 2CVDA 3E0UA 3D22A 4TRXA 5ECOB 3VURA 4EUYA 1KNGA 2CAQA 3F0IA 4MJEA 3BOAA 2RM6A 2G0FA 3QCPA 2I9HA 2FGXA 3GTUB 2H6ZA 1G7OA 1GULA 2GDRA 2L5OA 3VI5A 1ZL9A 3LGCA 3QOUA 3F6DA 4F03A 2M80A 1A23A 4Q5QA 1B48A 1ON4A 1M9BA 1ERWA 4HU7A 3KCMA 3A2WA 1XVWA 1XOAA 5HR2A 1X5DA 1PQNA 5IM9A 4EXJA 4ZB6A 4WBRD 2HFDA 4ULXA 2IMDA 3EC3A 1QMVA 2FUG2 1ILOA 2HRNA 2V6OA 4FYUA 3H8QA 1FVJA 3ZLPA 3G7YA 2L5LA 3WGDA 1VF4A 1EP8A 1GTAA 2HNLA 3O3TA 3H1NA 3CYNA 4X0XA 1GL8A 2LQQA 5J9BA 1UVZA 2HSHA 3ME7A 1GSDA 4PUAA 4TR1B 4PQIA 1K0MA 4L0UA 4TXVA 3A2VA 2IMKA 3G9BA 4QL7A 3TKSC 1T3BA 1X9MB 1F3AA 6GSYA 3TRPA 5FHIA 1FVKA 1AQVA 1PKZA 1GTIA 1ST9A 3HVVA 3O6TA 3TUEA 4PGTA 1RK4A 1SJ6A 2YJ7A 4NPBA 2I4AA 5ECKB 4F82A 1PL2A 5ECPB 1FW1A 4CW9A 1G7EA 2VL2C 2FD3A 2CX3A 4YAPA 3LEFA 4ECJA 4DSQA 5ID2A 4F0CA 2FA8A 4TR0A 4BL7A 2VL3A 2H1DA 1ML6A 4J57E 5DJMA 2HZEB 4JU5A 1ACVA 4K0NA 1Z7RA 3TJJA 4AGSA 1M2DA 4L5OA 3UAPA 1HQOA 2ES7A 4J2FA 4GF0A 2H6YA 1A2LA 3DWVA 5IPHA 2IMEA 3C1SA 4HJ2A 2DJKA 1S3CA 5C00A 2IFQB 4GSTA 2M46A 2V2GA 3P7XA 4MPFA 4N0VA 3ME8A 2LRCA 2GQMA 1ERVA 3CSHA 5KN2A 4AJ7A 3A5WA 2Z9SA 5ECHB 2OJLA 4ECCA 4V1Ap 1T4YA 5G31A 1XZOA 4HZ2A 1SK0A 4MF7A 4IQ1A 1EEJA 3FW2A 4HDEA 2NDOA 2H19A 4MH3A 1A8YA 4WR5A 4NWYA 1B9XC 4TR3A 3D4MA 2H6XA 1PRXA 4MJAA 3KD0A 4POMA 3KJYA 4DSRA 1V9WA 4E8HA 5JWQB 3DMLA 2NBSA 1Z3EA 2PMTA 2R6KA 4JR4A 4K0GA 2B5EA 5A4WA 4LL4B 1I9DA 5JCGA 13GSA 3EWLA 1SL2B 3F4TA 2DJ2A 1R5PA 2J9HA 3WD6A 1BX9A 2N5BA 5IO2A 3GTUA 2P5QA 3CXGA 2REMA 2A2SA 4L8EA 1JHBA 2B5XA 3TKRA 1PGTA 4BWQA 3GHAA 4GWRA 4MMMA 2E7PA 1SJZA 5CRDA 3ZMKA 1DSBA 4IKHA 3QPMA 4G19A 1CQGA 2LEGA 4KAEA 3F4RA 4ZL9A 3ERWA 2GSSA 4ZL7A 4YQMA 3TDGA 4LLRA 1X9WB 3GFKA 5DBQA 1G6WA 1GNEA 1U88A 5CNWA 1SL0B 1TDIA 4NXIA 1EP7A 4HUAA 4TR1A 1THXA 3LSZA 1GH2A 1E6BA 4L0WA 4OCFA 1R4WA 5CAXA 4XRDA 1NHOA 1AQWA 2VM2A 2CVKA 3MSZA 4RUVA 3GKMA 2O87A 3IC4A 3IOSA 2P31A 5F06A 1H4OA 2X8HA 2IMFA 1XCCA 5COHA 2H1GA 3IA1A 3VFIA 1JLWA 1EGRA 2YZHA 3UEMA 2LQOA 3H79A 5HR1A 18GSA 3UBKA 7GSSA 1O8WA 3KH7A 1JLVA 2L6DA 3EMPA 4OD7A 2FWEA 2O8VB 1IYHA 2V32A 3CRTA 4MH2A 1EV4A 2E2GA 1ZOFA 1HD2A 1C72A 3HKRA 1A24A 3GX0A 2EIRA 4LMWA 1YF0A 3D4TA 1K0DA 4K1FA 3EINA 5AGYA 2AHEA 1T00A 1O6JA 2GS3A 2HZEA 3EURA 3LYKA 4ZB9A 5HR0A 1QQ2A 2O7KA 3TRXA 1YEXA 4XRAA 4Q5FA 1BG5A 4ZL8A 1F6MC 1WIKA 4RQRA 5D73A 5GAND 4QQ7A 4P3YB 5CO3A 3GSTA 4TVEA 22GSA 3GKXA 4NV2A 2XC2A 2IFQA 1B4PA 2MMOA 2I3YA 2JZTA 1M2AA 2FA4A 1K0BA 2AB6A 3EU3A 1WRYA 1GSQA 3P8WA 4Q5RA 1U6TA 1TRWA 4NMUA 1BJXA 3L4NA 4K8MA 4KDYA 1HNCA 2H01A 4N30A 2H8LA 3KIJA 2VCWA 3KTLA 1XW6A 1GSFA 1TRUA 2VCZA 4G9HA 2K8VA 1X9SB 4KA0A 8GSSA 4MPGA 3V1WA 2EIOA 1A0FA 4LMVA 1EEMA 3BCKA 1U87A 2OA7A 2VCTA 4BVXA 4PX1A 2GTUA 1Y6EA 3HHVA 2FCHA 4HQSA 2LNSA 2BMXA 3FR3A 3GV1A 3KMOA 1GSUA 1XWKA 2LJKA 4RI6A 2OKAA 11GSA 2AYTA 3F8UA 5J4UA 4FH8A 1W89A 3HY2A 3TKQA 4OWYA 3U5RE 1YY7A 4MABA 4EO3A 4FIWA 3LFLA 1PL1A 5CREA 5JCUA 3DD3A 3WT1A 3ZREA 1UA5A 5DAKB 2CT6A 2V6KA 4RI7A 5FT3A 3W8JA 3GUSA 3I69A 2HZFA 3ZFBA 2AAWA 2B7JA 1OE8A 1ZCPA 1O8XA 1YDKA 3GH6A 3F63A 4GRFA 2H73A 2G2QA 4HU9A 6GSTA 4ECBA 3P90A 3VWWA 4IGJA 5F05A 3FYGA 2B3SA 3EYTA 4KDXA 1XWBA 4O5RA 5G30A 1K0OA 3LXZA 20GSA 4QL9A 2C0DA 5G1KA 2E2MA 1WMJA 1ABAA 2NVLA 4EVMA 1SK1A 4MZCA 2B1KA 4IN0A 3KXOA 1U3IA 6GSWA 4L5LA 4D73A 1O85A 1K0NA 2H30A 3GURA 3LG6A 2WS2A 2XPDA 3WGXA 4HJMA 1XW5A 2HYXA 2I1UA 3UVTA 1YZXA 1R26A 5F8BA 1J0FA 3ED3A 10GSA 1Z7PA 3TJKA 2PWJA 3HCZA 3DXBA 3IBHA 4CDOA 1XXUA 3C7MA 3LORA 4TXOA 4KSMA 1NHYA 1PSQA 2LSTA 3SWLA 3GL3A 2AJQB 4DEJA 1X5EA 1TP9A 4KUNA 2C3TA 2L59A 3HZ4A 3TCOA 2C8UA 1K0AA 1EZKA 6GSVA 2RIIA 3NOFA 1XBSA 2ZCTA 4H86A 5ENUA 4EE0A 3CTFA 5ECLB 5IMVA 1XFLA 2CAIA 2JL4A 4YQVA 1J9BA 3RDWA 2HRFA 1RQMA 1T4ZA 1JZWA 5LCZA 3DEXA 1BQ7A 1GUHA 4Q5NA 3TKSA 1M99A 2LJRA 3RHCA 4XS1A 3D6IA 1FB6A 5AN1A 2F8AA 3FZ9A 4ZBDA 3CRUA 4KCEA 4MZBA 5J41A 3FZ4A 3HD5A 1F3BA 4V2LA 2OE1A 3QFBC 4HI7A 4HS1A 5FWGA 2O89A 3QAVA 1O73A 2VL2A 1GUMA 3C71A 2A2RA 1SKWB 1F37A 3F4SA 2DLXA 2OE3A 3ZITA 1GLQA 5HFIA 5KN1A 2NTOA 4ID0A 3A2XA 3Q18A 3E3EA 1PX7A 3M1GA 1NSWA 2C0EA 4WKWA 2LNTA 2IN3A 2HE3A 2N5AA 2HI7A 4KX4A 4I97A 1TU8A 2KOKA 1N2AA 4AJ8A 2WJUA 3VWXA 5ELGA 1QFNA 2LTKA 4FYBA 5J9CA 3EE2A 5DDLA 3ZIVA 5ECIB 3RAZA 4ZXGA 2OADA 2H0HA 5DAKA 3LQ7A 5B6NA 1XWAA 3GRXA 3I6AA 2LRNA 5E4WA 1QUWA 2K8SA 3TKPA 3CTGA 2H0GA 1Z6MA 3QDNA 2JSZA 2KLXA 2WULA 1TKDB 4OMVA 1I5GA 1JFUA 3HJOA 2DMMA 4EKZA 2QGVA 5HFKA 3MDKA 1DBYA 4JRRA 1OVNA 4MLYA 4IELA 3TRQA 2RLIA 5GSTA 4LA1A 2GZPA 3R2QA 5CRWA 5ECMB 1OKTA 4WBJA 2B7KA 2DSAA 3M9JA 4ILFA 4ZB8A 3IE3A 3TJGA 3GN3A 1MTCA 3M3MA 2TRCP 2H71A 3QR6A 5G5EA 1LJRA 3TOTA 3O76A 2MBTA 1G0TA 2C0FA 3M8NA 2PPTA 9GSSA 1ZGNA 3RPPA 2HSYA 4LL1B 5IO0A 2PVOC 5IPGA 1DE1A 4MK3A 2X64A 2O85A 3FRCA 3GSSA 4AJ6A 2XPEA 3ZRDA 2C0GA 2F3MA 3QAWA 1VF2A 2R2JA 2OBKA 3ISOA 1T7PB 2YJHA 1M2BA 1GSYA 2YWIA 4MJBA 5GSSA 3D0ZA 2CZ2A 1XW9A 4XHMA 4PQ1A 1MEKA 5IMAA 3S9FA 2DIYA 3GKKA 4WR4A 1JZRA 5D93A 4PNFA 4MP4A 5D9WA 3QFAC 5IOWA 1TK8B 3KM6A 2JACA 1AUCA 1R7HA 1M9AA 4D73B 1AXDA 4F9ZA 1GRXA 3U6VA 2VD0A 2MMZA 17GSA 5H5RA 1TI3A 3UOMA 2JSYA 3DVWA 2C4JA 4OFNA 4TXOB 1OC9A 4MZWA 3H93A 3C1RA 5D96A 3FR9A 5ELAA 4CHSA 5B8BA 4V1Ag 2IIYA 1ERTA 4PUFC 1PA3A 3ZIJA 2LKUA 2FY6A 1MDJA 3CSJA 2EIQA 1YQ1A 3ZTLA 3EVIA 5H5QA 3IAM2 14GSA 1SD8A 3Q19A 1V98A 4K7NA 4JEDA 2A4VA 3I43A 2PGTA 4ACSA 19GSA 1HYUA 2CQ9A 4N10A 4NHZA 2F51A 4ZBBA 1URMA 5J5NA 1MD3A 2CV4A 2XBQA 1YKAA 2R37A 4YH2A 3FZ5A 5AISA 3SBCA 1SJIA 1Y25A 4N0ZA 1OYJA 5DJLA 2GLRA 1YKCA 2FWGA 2V1MA 1V57A 5CYYA 2YWNA 2H72A 5B7CA 2GZYA 4NV5A 3FKFA 3CMIA 2PBJA 2IMIA 3ZMLA 2JADA 5D9TA 2GT5A 2MYGA 1K3YA 5IMFA 4MDCA 3EMXA 5EL8A 5DQSA 2CX4A 3BBYA 2DJ3A 2VCQA 1O7UA 4TKYA 2WCIA 3HJPA 1AIUA 1PX6A 3UL3A 4XIHA 1OAZA 1Z9HA 4BVYA 3DIEA 1E2YA 4K6XA 4IQAA 1ZZYA 3QD9A 1TI1A 3TOUA 4IBPA 1W4VA 1FB0A 1DUGA 1M0UA 3CBUA 3F3RA 3MAKA 2D2ZA 2I81A 3GL5A 4J56E 1SENA 2RUEA 4DSSA 2LV3A 3TB2A 2VUPA 4WF4A 3HVSA 5EY6A 5ECRB 3IDVA 3TKSE 3KTBA 4MF5A 1UN2A 3J7Yb 3DRNA 1BAYA 1FAAA 2J23A 1GNWA 1YEPA 1WWJA 1XIYA 2DC5A 2WGRA 3FEUA 1TK5B 2KUCA 1SL1B 3PINA 3N5OA 5EPFA 4TR4A 5KN3A 1VGLA 1A8LA 3M9KA 1TU7A 2K6VA 2OACA 5EVOA 5IQYA 6GSSA 1B8XA 4POBA 1K0CA 3FHKA 3J7Yk 3LXTA 2R3XA 2CVBA 2AUVA 2QSIA 2L4CA 2RUFA 2DIZA 4HEA2 4KB3A 3M0FA 4IJIA 3L0HA 4I2UA 5JWRB 1GWCA 3UBLA 2LUSA 4EDZA 1GP1A 4ZILA 2IWTA 2KHPA 3LJRA 1OE7A 4DVCA 3HZ8A 1WOUA 3KMNA 5HFGA 3ERFA 2DMLA 2YWOA 2GZZA 5J3RA 1B9YC 3IK7A 4XTSA 4GXZA 1SK2A 2JZRA 2VIMA 1JZOA 1FG4A 5GAPD 2B6MA 1X5CA 1YF1A 2PVQA 2H1AA 2VO4A 1SKRB 5DALB 2R4VA 1J08A 3A3TA 5DQYA 5CP1A 3APQA 4ML6A 2DJ1A 4N11A 2FHEA 2LRTA 4BA7A 3W8SA 2MBSA 4GCIA 1KEBA 1TW9A 2X99A 2TRXA 5C04A 4O7HA 4G10A 2H74A 2FNOA 3HDCA 3WGEA 4FO5A 5INYA 1ZMAA 3PGTA 1TTZA 4IS0A 1YJ6A 4X43A 4GTUA 5B6MA 4K9ZA 4E8EA 1GSSA 1HNAA 3L9VA 2H66A 2FLSA 2ALBA 3VI7A 4NHWA 2VLUA 3UJ1A 2MMNA 3GNJA 2VL9A 1FOVA 2WRTA 2N5FA 5G1LA 1OC9B 2PUKC 4X1UA 3UARA 5ECSA 4OO4A
chains in the Genus database with same CATH superfamily
5LD0A 2VAFA 2WFCA 1Q98A 3GIXA 3HYPA 1S3DA 3L78A 4IJ3A 3ZZXA 4PXOA 3F6FA 1XWCA 1M3JA 3NIVA 1EOHA 3GMFA 1EWXA 4USSA 1M7TA 4KE3A 4OFTA 2LJAA 1T1VA 3GKNA 4G2EA 3W6GA 1ERUA 3D5JA 1F9MA 1KTEA 5IMDA 4KSOA 2VLTA 2CZ3A 5IIZA 5JCWA 5B8AA 2X49A 1G6YA 4KH7A 4BWSA 3GA4A 2KP2A 5ECQB 1V2AA 2H1BA 4PNGA 3HVXA 3ERGA 5D9XA 3BD2A 5HQPA 3LWAA 3ZFLA 4KW6A 1XWGA 3MNGA 2VOCA 1A0RP 1OC3A 2L4QA 4MNNA 2RM5A 2E0QA 3QAGA 4JE1A 3VLNA 3KZQA 3DVXA 4NAXA 3RHBA 2QKEA 4G0KA 3I9V2 1AW9A 3KP8A 3TJBA 4WETA 2H70A 4I6XA 3TJFA 1EOGA 2GQKA 1LU4A 3ZL5A 2WZ9A 4EL1A 2X8CA 3AY8A 1NM3A 3GX8A 2FWHA 5GZZB 12GSA 4IP1A 4POKA 4TW5A 5D8IA 1JZDA 4HOJA 5HR3A 4F2IA 1AQXA 2FWFA 2GGTA 1FHEA 1Z5YE 3L9SA 3VK9A 2A2PA 3DGQA 4IP6A 1GUKA 4XS4A 4ML1A 1TJDA 2BTOT 2F9SA 4DSSB 1PKWA 2F8FA 4K7OA 2VLVA 3HXSA 3WYWA 3F3QA 2C80A 2IJYA 1V40A 1MD4A 1F2EA 2CA8A 2OBIA 4JR6A 5G5FA 2X8GA 4KDUA 1IYIA 3IV4A 2QA2A 4XS6A 3FK8A 5JWOB 4BPYA 1OC8A 2V41A 2XBIA 4JBBA 4OCEA 3QMXA 2GSQA 3CQFA 2XHFA 3RPNA 3C73A 3F9UA 4YQUA 1R5AA 3APOA 4GSNA 2VCXA 2YV7A 3IHQA 2YN1A 2WDUA 3KEBA 1QK8A 5F07A 4KNDA 1SD9A 1GLPA 1H75A 5L71A 2YZUA 1NW2A 2OE0A 1SU9A 3K8NA 4MA9A 3VPTA 1BEDA 2YCDA 3GYKA 2P5RA 1WJKA 1Q4JA 4V2MA 5D9VA 2AV4A 5DALA 4I5QA 2C3QA 2VM1A 3IPZA 1DE2A 1SYXA 3Q6OA 1O81A 5ECNB 5ABRA 3VWUA 1A2JA 5F0GA 3EU4A 5DCHA 4EC0A 4ISDA 3ZVJD 3NZNA 4RQXA 2JZSA 1TRVA 1TOFA 1XVQA 1PN9A 4YAVA 4KGIA 2H76A 2GSRA 3CSIA 4EF0A 5LNKe 4JZQA 1TK0B 1U3AA 2R5GA 2VD1A 3HJMA 4AF2A 4XCSA 2MZCA 1QGVA 1KBNA 2ZNMA 1B4QA 5E59A 2YV9A 1K3LA 3WT2A 4KCAA 4POLA 3IAS2 3P2AA 3D21A 1SYRA 2M72A 2PERA 1A2MA 4MJCA 1UC7A 4O92A 2BJXA 3UVHA 6GSXA 1QXHA 2MMAA 4K2DA 4GSSA 3HA9A 1EV9A 2TIRA 2QC7A 3DYRA 2YNXA 4V2NA 5CRGA 2HLSA 5A5KA 5DVBA 2YWMA 4WF5A 1VF3A 2VCVA 6GSUA 2B5YA 2IL3A 3VWVA 4MF6A 4K5SA 3Q74A 3TGZA 1PD21 2KP1A 2YPMA 5A4UA 2DJ0A 2GT6A 2PU9C 1THOA 16GSA 1GSEA 5AIVA 5A4VA 1VF1A 3BCIA 1EGOA 3KH9A 3APSA 4FYCA 1OKDA 5AIXA 2PN8A 2H75A 2DBCA 4Z7XA 4WXTA 4EDYA 3IRAA 1T8EB 4ZIJA 1XOBA 2GSTA 1AAZA 1VRSD 4MCUA 2P0GA 2B1LA 5BMUA 2C1YA 4I2TA 1FO5A 3C8EA 4HQZA 5IMCA 3ZYWA 1AC1A 1GTUA 2L57A 3PH9A 5KEJA 1V58A 3JCML 2IPAA 3IXRA 5ID2B 3UIWA 1SKSB 4BL7B 3UMAA 4ECIA 3IR4A 3G7IA 2EC4A 1ZYQB 1CQHA 3LYPA 5KN0A 2GQLA 1N8JA 2H0IA 1TXXA 3MWHA 1Z6NA 3N9JA 2GVPA 3G7JA 4O32A 4PQHA 1GTBA 5CRHA 3IK9A 4GQFA 1BYEA 4OO5A 3H4KA 5IMZA 2K18A 2YOIA 4GQCA 4F0BA 4OFMA 2L6CA 4PURA 3RBTA 3FY7A 4TN8A 3L9UA 3BJ5A 1S3AA 1XPVA 3FMWA 4GLTA 1USBA 2R0GA 4TOPA 1PMTA 1WP0A 3OR5A 2ON5A 1MDKA 2HT9A 5IOXA 5G2ZA 4FQUA 2YP6A 5H5SA 4WEYA 2YANA 4HZ4A 2DJJA 3VPQA 4ZBAA 5DCGA 2JU5A 2HXKA 3PR8A 3KGKA 1RW1A 1LBKA 2NPBA 3E9JB 3FZAA 1TRSA 2LS5A 3PPUA 3GH9A 1X0RA 4XS4B 2K9FA 1HNBA 2ON7A 4IW9A 1WPIA 1ZYEA 3ZVJA 4I8BA 3KP9A 4IHUA 4K7IA 2WB9A 3US3A 2ZUPA 1MDIA 3DKSA 4IVFA 3FR6A 2C3NA 1K3OA 1WE0A 2CVDA 3E0UA 3D22A 4TRXA 5ECOB 3VURA 3A5IA 4EUYA 1KNGA 2CAQA 3F0IA 4MJEA 3BOAA 2RM6A 2G0FA 3QCPA 2I9HA 2FGXA 3GTUB 2H6ZA 1G7OA 1GULA 2GDRA 2L5OA 3VI5A 1ZL9A 3LGCA 3QOUA 3F6DA 4F03A 2M80A 1A23A 4Q5QA 1B48A 1ON4A 1M9BA 1ERWA 4HU7A 3KCMA 3A2WA 1XVWA 1XOAA 5HR2A 1X5DA 1PQNA 5IM9A 4EXJA 4ZB6A 4WBRD 2HFDA 4ULXA 2IMDA 3EC3A 1QMVA 2FUG2 1ILOA 2HRNA 2V6OA 4FYUA 4EIQA 3H8QA 1FVJA 3ZLPA 3G7YA 2L5LA 3WGDA 1VF4A 1EP8A 1GTAA 2HNLA 3O3TA 3H1NA 3CYNA 4X0XA 1GL8A 2LQQA 5J9BA 1UVZA 2HSHA 3ME7A 1GSDA 4PUAA 4TR1B 4PQIA 1K0MA 4L0UA 4TXVA 5KOWA 3A2VA 2IMKA 3G9BA 4QL7A 3TKSC 1T3BA 1X9MB 1F3AA 6GSYA 3TRPA 1PN0A 5FHIA 1FVKA 1AQVA 1PKZA 1GTIA 1ST9A 3HVVA 3O6TA 3TUEA 4PGTA 1RK4A 1SJ6A 2YJ7A 4NPBA 2I4AA 5ECKB 4F82A 1PL2A 5ECPB 1FW1A 3MYDA 4CW9A 1G7EA 2VL2C 2FD3A 2CX3A 4YAPA 3LEFA 4ECJA 4DSQA 5ID2A 4F0CA 2FA8A 4TR0A 3MIXA 4BL7A 2VL3A 2H1DA 1ML6A 4J57E 5DJMA 2HZEB 4JU5A 1ACVA 4K0NA 1Z7RA 3TJJA 4AGSA 1M2DA 4L5OA 3UAPA 1HQOA 2ES7A 4J2FA 4GF0A 2H6YA 1A2LA 3DWVA 5IPHA 2IMEA 3C1SA 4HJ2A 2DJKA 1S3CA 5BRTA 5C00A 2IFQB 3R3EA 4GSTA 2M46A 4Z2TA 2V2GA 3P7XA 4MPFA 4N0VA 3ME8A 2LRCA 4PTSA 2GQMA 1ERVA 3CSHA 5KN2A 4AJ7A 4YKFA 3A5WA 2Z9SA 5ECHB 2OJLA 4ECCA 4V1Ap 1T4YA 5G31A 1XZOA 4HZ2A 1SK0A 4MF7A 4IQ1A 1EEJA 3FW2A 4HDEA 2NDOA 2H19A 4MH3A 1A8YA 4WR5A 4NWYA 1B9XC 4TR3A 4BVXB 4K5RA 3D4MA 2H6XA 1PRXA 4MJAA 3KD0A 4POMA 3KJYA 4DSRA 1V9WA 4E8HA 5JWQB 3DMLA 2NBSA 1Z3EA 2PMTA 2R6KA 4JR4A 4K0GA 2B5EA 5A4WA 4LL4B 1I9DA 5JCGA 13GSA 3EWLA 1SL2B 3F4TA 2DJ2A 1R5PA 2J9HA 3WD6A 1BX9A 2N5BA 5IO2A 3GTUA 2P5QA 3CXGA 2REMA 2A2SA 4L8EA 1JHBA 2B5XA 3TKRA 1PGTA 4BWQA 3GHAA 4GWRA 4MMMA 2E7PA 1SJZA 5CRDA 3ZMKA 1DSBA 4IKHA 3QPMA 3IC8A 4G19A 1CQGA 2LEGA 4KAEA 3F4RA 4ZL9A 3ERWA 2GSSA 4ZL7A 4YQMA 3TDGA 4LLRA 1X9WB 3GFKA 5DBQA 1G6WA 1GNEA 1FOHA 1U88A 5CNWA 1SL0B 1TDIA 4NXIA 1EP7A 4HUAA 4TR1A 1THXA 3LSZA 1GH2A 1E6BA 4L0WA 4OCFA 1R4WA 5CAXA 4XRDA 1NHOA 1PFOA 1AQWA 2VM2A 2CVKA 3EPTA 3MSZA 4RUVA 3GKMA 2O87A 3IC4A 3IOSA 2P31A 5F06A 1H4OA 2X8HA 2IMFA 1XCCA 4G0LA 5COHA 4CY6A 2H1GA 3IA1A 3VFIA 1JLWA 1EGRA 2YZHA 3UEMA 2LQOA 3H79A 5HR1A 18GSA 3UBKA 7GSSA 1O8WA 3KH7A 1JLVA 2L6DA 3EMPA 4OD7A 2X4AA 2FWEA 2O8VB 1IYHA 2V32A 3CRTA 4MH2A 1EV4A 2E2GA 1ZOFA 1HD2A 1C72A 3HKRA 1A24A 3GX0A 2EIRA 4LMWA 1YF0A 3D4TA 1K0DA 4K1FA 3EINA 5AGYA 2AHEA 1T00A 1O6JA 2GS3A 2HZEA 3EURA 3LYKA 4ZB9A 5HR0A 1QQ2A 2O7KA 3TRXA 1YEXA 4XRAA 4Q5FA 1BG5A 4ZL8A 1F6MC 1WIKA 4RQRA 5D73A 5GAND 4QQ7A 4P3YB 5CO3A 3GSTA 4TVEA 22GSA 3GKXA 4NV2A 2XC2A 2IFQA 1B4PA 2MMOA 2I3YA 2JZTA 1M2AA 2FA4A 1K0BA 2AB6A 3EU3A 1WRYA 1GSQA 3P8WA 4Q5RA 4K2XA 1U6TA 1TRWA 3IHGA 4NMUA 1BJXA 3L4NA 4K8MA 4KDYA 1HNCA 2H01A 4N30A 2H8LA 3KIJA 2VCWA 3KTLA 1XW6A 1GSFA 1TRUA 2VCZA 4G9HA 2K8VA 1X9SB 4KA0A 8GSSA 4O5UA 4MPGA 3V1WA 2EIOA 1A0FA 4LMVA 1EEMA 3BCKA 1U87A 2OA7A 1M3IA 2VCTA 4BVXA 4PX1A 2GTUA 1Y6EA 3HHVA 2FCHA 4HQSA 2LNSA 2BMXA 3FR3A 3GV1A 3KMOA 1GSUA 1XWKA 2LJKA 4RI6A 2OKAA 11GSA 1ZYPA 2AYTA 3F8UA 5J4UA 4FH8A 1W89A 3HY2A 3TKQA 4OWYA 3U5RE 1YY7A 4MABA 4Z2RA 1S3RA 4EO3A 4FIWA 3LFLA 1PL1A 5CREA 5JCUA 3DD3A 3WT1A 3ZREA 1UA5A 5DAKB 2CT6A 2V6KA 4RI7A 5FT3A 3W8JA 3GUSA 3I69A 2HZFA 3ZFBA 2AAWA 2B7JA 1OE8A 1ZCPA 1O8XA 1YDKA 3GH6A 3F63A 4GRFA 2H73A 2G2QA 4HU9A 6GSTA 4ECBA 3P90A 3VWWA 2A4HA 4IGJA 5F05A 3FYGA 2B3SA 3EYTA 4KDXA 4Z2UA 1XWBA 4O5RA 5G30A 1K0OA 3LXZA 20GSA 4QL9A 2C0DA 5G1KA 4BIKA 2E2MA 1WMJA 1ABAA 2NVLA 4EVMA 1SK1A 4MZCA 2B1KA 4IN0A 3KXOA 1U3IA 6GSWA 4L5LA 4D73A 1O85A 1K0NA 2H30A 3GURA 3LG6A 2WS2A 2XPDA 3WGXA 4HJMA 1XW5A 2HYXA 2I1UA 3UVTA 1YZXA 1R26A 5F8BA 1J0FA 3ED3A 10GSA 1Z7PA 3TJKA 2PWJA 3HCZA 3DXBA 3IBHA 4CDOA 1XXUA 3C7MA 3LORA 4TXOA 4KSMA 1NHYA 1PSQA 3HVNA 2LSTA 3SWLA 3GL3A 2AJQB 4DEJA 1X5EA 1TP9A 4KUNA 2C3TA 2L59A 2UZ8A 3HZ4A 3TCOA 2C8UA 1K0AA 1EZKA 6GSVA 2RIIA 3NOFA 1XBSA 2ZCTA 4H86A 5ENUA 4EE0A 3CTFA 5ECLB 5IMVA 1XFLA 2CAIA 2JL4A 4YQVA 1J9BA 3RDWA 2HRFA 1RQMA 1T4ZA 1JZWA 5LCZA 3DEXA 1BQ7A 1GUHA 4Q5NA 3TKSA 1M99A 2LJRA 3RHCA 4XS1A 3D6IA 1FB6A 5AN1A 2F8AA 3FZ9A 4ZBDA 2R0CA 3CRUA 4KCEA 4MZBA 5J41A 3FZ4A 3HD5A 1F3BA 4V2LA 2OE1A 3QFBC 4HI7A 4HS1A 5FWGA 2O89A 3QAVA 1O73A 2VL2A 1GUMA 3C71A 2A2RA 1SKWB 1F37A 3F4SA 2DLXA 2OE3A 3ZITA 1GLQA 5HFIA 5KN1A 2NTOA 4ID0A 3A2XA 3Q18A 3E3EA 1PX7A 3M1GA 1NSWA 2C0EA 4WKWA 2LNTA 2IN3A 2HE3A 2N5AA 2HI7A 4KX4A 4I97A 1TU8A 2KOKA 1N2AA 4AJ8A 2WJUA 3VWXA 5ELGA 1QFNA 2LTKA 4FYBA 5J9CA 3EE2A 5DDLA 3ZIVA 5ECIB 3RAZA 4ZXGA 2OADA 2H0HA 5DAKA 3LQ7A 5B6NA 1XWAA 3GRXA 4BVYB 3I6AA 2LRNA 5E4WA 1QUWA 2K8SA 3TKPA 3CTGA 2H0GA 1Z6MA 3QDNA 2JSZA 2KLXA 2WULA 1TKDB 4OMVA 1I5GA 4G0IA 1JFUA 3HJOA 2DMMA 4EKZA 2QGVA 5HFKA 3MDKA 1DBYA 4JRRA 1OVNA 4MLYA 4IELA 3TRQA 2RLIA 5GSTA 4LA1A 2GZPA 3R2QA 5CRWA 5ECMB 1OKTA 4WBJA 2B7KA 2DSAA 3M9JA 4ILFA 4ZB8A 2HRAA 3IE3A 3TJGA 3GN3A 5KOXA 1MTCA 3M3MA 2TRCP 2H71A 3QR6A 5G5EA 1LJRA 3TOTA 3O76A 2MBTA 1G0TA 2C0FA 3M8NA 2PPTA 9GSSA 1ZGNA 3RPPA 2HSYA 4LL1B 5IO0A 2PVOC 5IPGA 1DE1A 4MK3A 2X64A 2O85A 3FRCA 3GSSA 4AJ6A 2XPEA 3ZRDA 2C0GA 2F3MA 3QAWA 1VF2A 2HRKA 2R2JA 2OBKA 3ISOA 1T7PB 2YJHA 1M2BA 1GSYA 2YWIA 4MJBA 5GSSA 3D0ZA 2CZ2A 1XW9A 4XHMA 4PQ1A 1MEKA 5IMAA 3S9FA 2DIYA 3GKKA 4WR4A 1JZRA 4EIPA 5D93A 4PNFA 4MP4A 5D9WA 3QFAC 5IOWA 1TK8B 3KM6A 2JACA 1AUCA 1R7HA 1M9AA 4D73B 1AXDA 4F9ZA 1GRXA 3U6VA 2VD0A 2MMZA 17GSA 5H5RA 2QA1A 1TI3A 3UOMA 2JSYA 3DVWA 2C4JA 4OFNA 4TXOB 1OC9A 4MZWA 3H93A 3C1RA 5D96A 3FR9A 5ELAA 4CHSA 4KF9A 5B8BA 4V1Ag 2IIYA 2HSMA 1ERTA 4PUFC 1PA3A 3ZIJA 2LKUA 2FY6A 1MDJA 4CY8A 3CSJA 2EIQA 1YQ1A 3ZTLA 3EVIA 5H5QA 3IAM2 14GSA 1SD8A 3Q19A 1V98A 4K7NA 4JEDA 2A4VA 3I43A 2PGTA 4A5PA 4O5QA 4ACSA 19GSA 1HYUA 2CQ9A 4N10A 4NHZA 2F51A 4ZBBA 1URMA 5J5NA 1MD3A 2CV4A 2DKIA 2XBQA 1YKAA 2R37A 4YH2A 3FZ5A 5AISA 3SBCA 1SJIA 1Y25A 4N0ZA 1OYJA 5DJLA 2DKHA 2GLRA 1YKCA 2FWGA 2V1MA 1V57A 5CYYA 2YWNA 2H72A 5B7CA 2GZYA 4NV5A 3FKFA 3CMIA 2PBJA 2IMIA 3ZMLA 2JADA 5D9TA 2GT5A 2MYGA 1K3YA 5IMFA 4MDCA 3EMXA 5EL8A 5DQSA 2CX4A 3BBYA 2DJ3A 2VCQA 1O7UA 4TKYA 2WCIA 3HJPA 1AIUA 1PX6A 3UL3A 4XIHA 1OAZA 1Z9HA 1ZYNA 4BVYA 3DIEA 1E2YA 4K6XA 4IQAA 1ZZYA 3QD9A 1TI1A 3TOUA 4IBPA 1W4VA 1FB0A 1DUGA 1M0UA 3CBUA 3F3RA 3MAKA 2D2ZA 2I81A 3GL5A 4J56E 1SENA 1XG8A 2RUEA 4DSSA 2LV3A 3TB2A 2VUPA 4WF4A 3HVSA 4YKGA 5EY6A 5ECRB 3IDVA 3TKSE 3KTBA 4MF5A 1UN2A 3J7Yb 3DRNA 1BAYA 1FAAA 2J23A 1GNWA 1YEPA 1WWJA 1XIYA 2DC5A 2WGRA 3FEUA 1TK5B 2KUCA 1SL1B 3PINA 3N5OA 5EPFA 4TR4A 5KN3A 1VGLA 1A8LA 3M9KA 1TU7A 2K6VA 2OACA 5EVOA 5IQYA 3LW9A 6GSSA 1B8XA 4POBA 1K0CA 3FHKA 3J7Yk 3LXTA 2R3XA 2CVBA 2AUVA 2QSIA 2L4CA 2RUFA 2DIZA 4HEA2 4KB3A 3M0FA 4IJIA 3L0HA 4I2UA 5JWRB 2R0PA 4HSCX 1GWCA 3UBLA 2LUSA 4EDZA 1GP1A 4ZILA 2IWTA 2KHPA 3LJRA 1OE7A 4DVCA 3HZ8A 1WOUA 3KMNA 5HFGA 3ERFA 2DMLA 2YWOA 2GZZA 5J3RA 1B9YC 3IK7A 4XTSA 4GXZA 1SK2A 2JZRA 2VIMA 1JZOA 1FG4A 5GAPD 2B6MA 1X5CA 1YF1A 2PVQA 2H1AA 2VO4A 4ICYA 1SKRB 2R4VA 5DALB 1J08A 3A3TA 5DQYA 5CP1A 3APQA 4ML6A 2DJ1A 4N11A 2FHEA 2LRTA 4BA7A 3W8SA 2MBSA 4GCIA 1KEBA 1TW9A 2X99A 2TRXA 5C04A 4O7HA 4G10A 2H74A 2FNOA 3HDCA 3WGEA 4FO5A 5INYA 1ZMAA 3PGTA 1TTZA 4X4JA 4IS0A 1YJ6A 4X43A 4GTUA 5B6MA 4K9ZA 4E8EA 1GSSA 1HNAA 3L9VA 2H66A 2FLSA 2ALBA 3VI7A 4NHWA 2VLUA 3UJ1A 2MMNA 3GNJA 2VL9A 1FOVA 2WRTA 2N5FA 5G1LA 1OC9B 2PUKC 4X1UA 3UARA 5ECSA 4OO4A
chains in the Genus database with same CATH topology
5LD0A 2VAFA 2WFCA 1Q98A 3GIXA 3HYPA 1S3DA 3L78A 4IJ3A 3ZZXA 4PXOA 3F6FA 1XWCA 3NIVA 1EOHA 3GMFA 1EWXA 4USSA 1M7TA 4KE3A 4OFTA 2LJAA 1T1VA 3GKNA 4G2EA 3W6GA 1ERUA 3D5JA 1F9MA 1KTEA 5IMDA 4KSOA 2VLTA 2CZ3A 5IIZA 5JCWA 5B8AA 2X49A 1G6YA 4KH7A 4BWSA 3GA4A 2KP2A 5ECQB 1V2AA 2H1BA 4PNGA 3HVXA 3ERGA 5D9XA 3BD2A 5HQPA 3LWAA 3ZFLA 4KW6A 1XWGA 3MNGA 2VOCA 1A0RP 1OC3A 2L4QA 4MNNA 2RM5A 2E0QA 3QAGA 4JE1A 3VLNA 3KZQA 3DVXA 4NAXA 3RHBA 2QKEA 4G0KA 3I9V2 1AW9A 3KP8A 3TJBA 4WETA 2H70A 4I6XA 3TJFA 1EOGA 2GQKA 1LU4A 3ZL5A 2WZ9A 4EL1A 2X8CA 3AY8A 1NM3A 3GX8A 2FWHA 5GZZB 12GSA 4IP1A 4POKA 4TW5A 5D8IA 1JZDA 4HOJA 5HR3A 4F2IA 1AQXA 2FWFA 2GGTA 1FHEA 1Z5YE 3L9SA 3VK9A 2A2PA 3DGQA 4IP6A 1GUKA 4XS4A 4ML1A 1TJDA 2BTOT 2F9SA 4DSSB 1PKWA 2F8FA 4K7OA 2VLVA 3HXSA 3WYWA 3F3QA 2C80A 2IJYA 1V40A 1MD4A 1F2EA 2CA8A 2OBIA 4JR6A 5G5FA 2X8GA 4KDUA 1IYIA 3IV4A 2QA2A 4XS6A 3FK8A 5JWOB 4BPYA 1OC8A 2V41A 2XBIA 4JBBA 4OCEA 3QMXA 2GSQA 2XHFA 3RPNA 3C73A 3F9UA 4YQUA 1R5AA 3APOA 4GSNA 2VCXA 2YV7A 3IHQA 2YN1A 2WDUA 3KEBA 1QK8A 5F07A 4KNDA 1SD9A 1GLPA 1H75A 5L71A 2YZUA 1NW2A 2OE0A 1SU9A 3K8NA 4MA9A 3VPTA 1BEDA 2YCDA 3GYKA 2P5RA 1WJKA 1Q4JA 4V2MA 5D9VA 2AV4A 5DALA 4I5QA 2C3QA 2VM1A 3IPZA 1DE2A 1SYXA 3Q6OA 1O81A 5ECNB 5ABRA 3VWUA 1A2JA 5F0GA 3EU4A 5DCHA 4EC0A 4ISDA 3ZVJD 3NZNA 4RQXA 2JZSA 1TRVA 1TOFA 1XVQA 1PN9A 4YAVA 4KGIA 2H76A 2GSRA 3CSIA 4EF0A 5LNKe 4JZQA 1TK0B 1U3AA 2R5GA 2VD1A 3HJMA 4AF2A 4XCSA 2MZCA 1QGVA 1KBNA 2ZNMA 1B4QA 5E59A 2YV9A 1K3LA 3WT2A 4KCAA 4POLA 3IAS2 3P2AA 3D21A 1SYRA 2M72A 2PERA 1A2MA 4MJCA 1UC7A 4O92A 2BJXA 3UVHA 6GSXA 1QXHA 2MMAA 4K2DA 4GSSA 3HA9A 1EV9A 2TIRA 2QC7A 3DYRA 2YNXA 4V2NA 5CRGA 2HLSA 5A5KA 5DVBA 2YWMA 4WF5A 1VF3A 2VCVA 6GSUA 2B5YA 2IL3A 3VWVA 4MF6A 4K5SA 3Q74A 3TGZA 1PD21 2KP1A 2YPMA 5A4UA 2DJ0A 2GT6A 2PU9C 1THOA 16GSA 1GSEA 5AIVA 5A4VA 1VF1A 3BCIA 1EGOA 3KH9A 3APSA 4FYCA 1OKDA 5AIXA 2PN8A 2H75A 2DBCA 4Z7XA 4WXTA 4EDYA 3IRAA 1T8EB 4ZIJA 1XOBA 2GSTA 1AAZA 1VRSD 4MCUA 2P0GA 2B1LA 5BMUA 2C1YA 4I2TA 1FO5A 3C8EA 4HQZA 5IMCA 3ZYWA 1AC1A 1GTUA 2L57A 3PH9A 5KEJA 1V58A 3JCML 2IPAA 3IXRA 5ID2B 3UIWA 1SKSB 4BL7B 3UMAA 4ECIA 3IR4A 3G7IA 2EC4A 1ZYQB 1CQHA 3LYPA 5KN0A 2GQLA 1N8JA 2H0IA 1TXXA 3MWHA 1Z6NA 3N9JA 2GVPA 3G7JA 4O32A 4PQHA 1GTBA 5CRHA 3IK9A 4GQFA 1BYEA 4OO5A 3H4KA 5IMZA 2K18A 2YOIA 4GQCA 4F0BA 4OFMA 2L6CA 4PURA 3RBTA 3FY7A 4TN8A 3L9UA 3BJ5A 1S3AA 1XPVA 3FMWA 4GLTA 1USBA 2R0GA 4TOPA 1PMTA 1WP0A 3OR5A 2ON5A 1MDKA 2HT9A 5IOXA 5G2ZA 4FQUA 2YP6A 5H5SA 4WEYA 2YANA 4HZ4A 2DJJA 3VPQA 4ZBAA 5DCGA 2JU5A 2HXKA 3PR8A 3KGKA 1RW1A 1LBKA 2NPBA 3E9JB 3FZAA 1TRSA 2LS5A 3PPUA 3GH9A 1X0RA 4XS4B 2K9FA 1HNBA 2ON7A 4IW9A 1WPIA 1ZYEA 3ZVJA 4I8BA 3KP9A 4IHUA 4K7IA 2WB9A 3US3A 2ZUPA 1MDIA 3DKSA 4IVFA 3FR6A 2C3NA 1K3OA 1WE0A 2CVDA 3E0UA 3D22A 4TRXA 5ECOB 3VURA 3A5IA 4EUYA 1KNGA 2CAQA 3F0IA 4MJEA 3BOAA 2RM6A 2G0FA 3QCPA 2I9HA 2FGXA 3GTUB 2H6ZA 1G7OA 1GULA 2GDRA 2L5OA 3VI5A 1ZL9A 3LGCA 3QOUA 3F6DA 4F03A 2M80A 1A23A 4Q5QA 1B48A 1ON4A 1M9BA 1ERWA 4HU7A 3KCMA 3A2WA 1XVWA 1XOAA 5HR2A 1X5DA 1PQNA 5IM9A 4EXJA 4ZB6A 4WBRD 2HFDA 4ULXA 2IMDA 3EC3A 1QMVA 2FUG2 1ILOA 2HRNA 2V6OA 4FYUA 4EIQA 3H8QA 1FVJA 3ZLPA 3G7YA 2L5LA 3WGDA 1VF4A 1EP8A 1GTAA 2HNLA 3O3TA 3H1NA 3CYNA 4X0XA 1GL8A 2LQQA 5J9BA 1UVZA 2HSHA 3ME7A 1GSDA 4PUAA 4TR1B 4PQIA 1K0MA 4L0UA 4TXVA 5KOWA 3A2VA 2IMKA 3G9BA 4QL7A 3TKSC 1T3BA 1X9MB 1F3AA 6GSYA 3TRPA 1PN0A 5FHIA 1FVKA 1AQVA 1PKZA 1GTIA 1ST9A 3HVVA 3O6TA 3TUEA 4PGTA 1RK4A 1SJ6A 2YJ7A 4NPBA 2I4AA 5ECKB 4F82A 1PL2A 5ECPB 1FW1A 3MYDA 4CW9A 1G7EA 2VL2C 2FD3A 2CX3A 4YAPA 3LEFA 4ECJA 4DSQA 5ID2A 4F0CA 2FA8A 4TR0A 3MIXA 4BL7A 2VL3A 2H1DA 1ML6A 4J57E 5DJMA 2HZEB 4JU5A 1ACVA 4K0NA 1Z7RA 3TJJA 4AGSA 1M2DA 4L5OA 3UAPA 1HQOA 2ES7A 4J2FA 4GF0A 2H6YA 1A2LA 3DWVA 5IPHA 2IMEA 3C1SA 4HJ2A 2DJKA 1S3CA 5BRTA 5C00A 2IFQB 3R3EA 4GSTA 2M46A 4Z2TA 2V2GA 3P7XA 4MPFA 4N0VA 3ME8A 2LRCA 4PTSA 2GQMA 1ERVA 3CSHA 5KN2A 4AJ7A 4YKFA 3A5WA 2Z9SA 5ECHB 2OJLA 4ECCA 4V1Ap 1T4YA 5G31A 1XZOA 4HZ2A 1SK0A 4MF7A 4IQ1A 1EEJA 3FW2A 4HDEA 2NDOA 2H19A 4MH3A 1A8YA 4WR5A 4NWYA 1B9XC 4TR3A 4BVXB 4K5RA 3D4MA 2H6XA 1PRXA 4MJAA 3KD0A 4POMA 3KJYA 4DSRA 1V9WA 4E8HA 5JWQB 3DMLA 2NBSA 1Z3EA 2PMTA 2R6KA 4JR4A 4K0GA 2B5EA 5A4WA 4LL4B 1I9DA 5JCGA 13GSA 3EWLA 1SL2B 3F4TA 2DJ2A 1R5PA 2J9HA 3WD6A 1BX9A 2N5BA 5IO2A 3GTUA 2P5QA 3CXGA 2REMA 2A2SA 4L8EA 1JHBA 2B5XA 3TKRA 1PGTA 4BWQA 3GHAA 4GWRA 4MMMA 2E7PA 1SJZA 5CRDA 3ZMKA 1DSBA 4IKHA 3QPMA 3IC8A 4G19A 1CQGA 2LEGA 4KAEA 3F4RA 4ZL9A 3ERWA 2GSSA 4ZL7A 4YQMA 3TDGA 4LLRA 1X9WB 3GFKA 5DBQA 1G6WA 1GNEA 1FOHA 1U88A 5CNWA 1SL0B 1TDIA 4NXIA 1EP7A 4HUAA 4TR1A 1THXA 3LSZA 1GH2A 1E6BA 4L0WA 4OCFA 1R4WA 5CAXA 4XRDA 1NHOA 1AQWA 2VM2A 2CVKA 3EPTA 3MSZA 4RUVA 3GKMA 2O87A 3IC4A 3IOSA 2P31A 5F06A 1H4OA 2X8HA 2IMFA 1XCCA 4G0LA 5COHA 4CY6A 2H1GA 3IA1A 3VFIA 1JLWA 1EGRA 2YZHA 3UEMA 2LQOA 3H79A 5HR1A 18GSA 3UBKA 7GSSA 1O8WA 3KH7A 1JLVA 2L6DA 3EMPA 4OD7A 2X4AA 2FWEA 2O8VB 1IYHA 2V32A 3CRTA 4MH2A 1EV4A 2E2GA 1ZOFA 1HD2A 1C72A 3HKRA 1A24A 3GX0A 2EIRA 4LMWA 1YF0A 3D4TA 1K0DA 4K1FA 3EINA 5AGYA 2AHEA 1T00A 1O6JA 2GS3A 2HZEA 3EURA 3LYKA 4ZB9A 5HR0A 1QQ2A 2O7KA 3TRXA 1YEXA 4XRAA 4Q5FA 1BG5A 4ZL8A 1F6MC 1WIKA 4RQRA 5D73A 5GAND 4QQ7A 4P3YB 5CO3A 3GSTA 4TVEA 22GSA 3GKXA 4NV2A 2XC2A 2IFQA 1B4PA 2MMOA 2I3YA 2JZTA 1M2AA 2FA4A 1K0BA 2AB6A 3EU3A 1WRYA 1GSQA 3P8WA 4Q5RA 4K2XA 1U6TA 1TRWA 3IHGA 4NMUA 1BJXA 3L4NA 4K8MA 4KDYA 1HNCA 2H01A 4N30A 2H8LA 3KIJA 2VCWA 3KTLA 1XW6A 1GSFA 1TRUA 2VCZA 4G9HA 2K8VA 1X9SB 4KA0A 8GSSA 4O5UA 4MPGA 3V1WA 2EIOA 1A0FA 4LMVA 1EEMA 3BCKA 1U87A 2OA7A 2VCTA 4BVXA 4PX1A 2GTUA 1Y6EA 3HHVA 2FCHA 4HQSA 2LNSA 2BMXA 3FR3A 3GV1A 3KMOA 1GSUA 1XWKA 2LJKA 4RI6A 2OKAA 11GSA 1ZYPA 2AYTA 3F8UA 5J4UA 4FH8A 1W89A 3HY2A 3TKQA 4OWYA 3U5RE 1YY7A 4MABA 4Z2RA 4EO3A 4FIWA 3LFLA 1PL1A 5CREA 5JCUA 3DD3A 3WT1A 3ZREA 1UA5A 5DAKB 2CT6A 2V6KA 4RI7A 5FT3A 3W8JA 3GUSA 3I69A 2HZFA 3ZFBA 2AAWA 2B7JA 1OE8A 1ZCPA 1O8XA 1YDKA 3GH6A 3F63A 4GRFA 2H73A 2G2QA 4HU9A 6GSTA 4ECBA 3P90A 3VWWA 2A4HA 4IGJA 5F05A 3FYGA 2B3SA 3EYTA 4KDXA 4Z2UA 1XWBA 4O5RA 5G30A 1K0OA 3LXZA 20GSA 4QL9A 2C0DA 5G1KA 2E2MA 1WMJA 1ABAA 2NVLA 4EVMA 1SK1A 4MZCA 2B1KA 4IN0A 3KXOA 1U3IA 6GSWA 4L5LA 4D73A 1O85A 1K0NA 2H30A 3GURA 3LG6A 2WS2A 2XPDA 3WGXA 4HJMA 1XW5A 2HYXA 2I1UA 3UVTA 1YZXA 1R26A 5F8BA 1J0FA 3ED3A 10GSA 1Z7PA 3TJKA 2PWJA 3HCZA 3DXBA 3IBHA 4CDOA 1XXUA 3C7MA 3LORA 4TXOA 4KSMA 1NHYA 1PSQA 2LSTA 3SWLA 3GL3A 2AJQB 4DEJA 1X5EA 1TP9A 4KUNA 2C3TA 2L59A 2UZ8A 3HZ4A 3TCOA 2C8UA 1K0AA 1EZKA 6GSVA 2RIIA 3NOFA 1XBSA 2ZCTA 4H86A 5ENUA 4EE0A 3CTFA 5ECLB 5IMVA 1XFLA 2CAIA 2JL4A 4YQVA 1J9BA 3RDWA 2HRFA 1RQMA 1T4ZA 1JZWA 5LCZA 3DEXA 1BQ7A 1GUHA 4Q5NA 3TKSA 1M99A 2LJRA 3RHCA 4XS1A 3D6IA 1FB6A 5AN1A 2F8AA 3FZ9A 4ZBDA 2R0CA 3CRUA 4KCEA 4MZBA 5J41A 3FZ4A 3HD5A 1F3BA 4V2LA 2OE1A 3QFBC 4HI7A 4HS1A 5FWGA 2O89A 3QAVA 1O73A 2VL2A 1GUMA 3C71A 2A2RA 1SKWB 1F37A 3F4SA 2DLXA 2OE3A 3ZITA 1GLQA 5HFIA 5KN1A 2NTOA 4ID0A 3A2XA 3Q18A 3E3EA 1PX7A 3M1GA 1NSWA 2C0EA 4WKWA 2LNTA 2IN3A 2HE3A 2N5AA 2HI7A 4KX4A 4I97A 1TU8A 2KOKA 1N2AA 4AJ8A 2WJUA 3VWXA 5ELGA 1QFNA 2LTKA 4FYBA 5J9CA 3EE2A 5DDLA 3ZIVA 5ECIB 3RAZA 4ZXGA 2OADA 2H0HA 5DAKA 3LQ7A 5B6NA 1XWAA 3GRXA 4BVYB 3I6AA 2LRNA 5E4WA 1QUWA 2K8SA 3TKPA 3CTGA 2H0GA 1Z6MA 3QDNA 2JSZA 2KLXA 2WULA 1TKDB 4OMVA 1I5GA 4G0IA 1JFUA 3HJOA 2DMMA 4EKZA 2QGVA 5HFKA 3MDKA 1DBYA 4JRRA 1OVNA 4MLYA 4IELA 3TRQA 2RLIA 5GSTA 4LA1A 2GZPA 3R2QA 5CRWA 5ECMB 1OKTA 4WBJA 2B7KA 2DSAA 3M9JA 4ILFA 4ZB8A 2HRAA 3IE3A 3TJGA 3GN3A 5KOXA 1MTCA 3M3MA 2TRCP 2H71A 3QR6A 5G5EA 1LJRA 3TOTA 3O76A 2MBTA 1G0TA 2C0FA 3M8NA 2PPTA 9GSSA 1ZGNA 3RPPA 2HSYA 4LL1B 5IO0A 2PVOC 5IPGA 1DE1A 4MK3A 2X64A 2O85A 3FRCA 3GSSA 4AJ6A 2XPEA 3ZRDA 2C0GA 2F3MA 3QAWA 1VF2A 2HRKA 2R2JA 2OBKA 3ISOA 1T7PB 2YJHA 1M2BA 1GSYA 2YWIA 4MJBA 5GSSA 3D0ZA 2CZ2A 1XW9A 4XHMA 4PQ1A 1MEKA 5IMAA 3S9FA 2DIYA 3GKKA 4WR4A 1JZRA 4EIPA 5D93A 4PNFA 4MP4A 5D9WA 3QFAC 5IOWA 1TK8B 3KM6A 2JACA 1AUCA 1R7HA 1M9AA 4D73B 1AXDA 4F9ZA 1GRXA 3U6VA 2VD0A 2MMZA 17GSA 5H5RA 2QA1A 1TI3A 3UOMA 2JSYA 3DVWA 2C4JA 4OFNA 4TXOB 1OC9A 4MZWA 3H93A 3C1RA 5D96A 3FR9A 5ELAA 4CHSA 4KF9A 5B8BA 4V1Ag 2IIYA 2HSMA 1ERTA 4PUFC 1PA3A 3ZIJA 2LKUA 2FY6A 1MDJA 4CY8A 3CSJA 2EIQA 1YQ1A 3ZTLA 3EVIA 5H5QA 3IAM2 14GSA 1SD8A 3Q19A 1V98A 4K7NA 4JEDA 2A4VA 3I43A 2PGTA 4A5PA 4O5QA 4ACSA 19GSA 1HYUA 2CQ9A 4N10A 4NHZA 2F51A 4ZBBA 1URMA 5J5NA 1MD3A 2CV4A 2DKIA 2XBQA 1YKAA 2R37A 4YH2A 3FZ5A 5AISA 3SBCA 1SJIA 1Y25A 4N0ZA 1OYJA 5DJLA 2DKHA 2GLRA 1YKCA 2FWGA 2V1MA 1V57A 5CYYA 2YWNA 2H72A 5B7CA 2GZYA 4NV5A 3FKFA 3CMIA 2PBJA 2IMIA 3ZMLA 2JADA 5D9TA 2GT5A 2MYGA 1K3YA 5IMFA 4MDCA 3EMXA 5EL8A 5DQSA 2CX4A 3BBYA 2DJ3A 2VCQA 1O7UA 4TKYA 2WCIA 3HJPA 1AIUA 1PX6A 3UL3A 4XIHA 1OAZA 1Z9HA 1ZYNA 4BVYA 3DIEA 1E2YA 4K6XA 4IQAA 1ZZYA 3QD9A 1TI1A 3TOUA 4IBPA 1W4VA 1FB0A 1DUGA 1M0UA 3CBUA 3F3RA 3MAKA 2D2ZA 2I81A 3GL5A 4J56E 1SENA 2RUEA 4DSSA 2LV3A 3TB2A 2VUPA 4WF4A 3HVSA 4YKGA 5EY6A 5ECRB 3IDVA 3TKSE 3KTBA 4MF5A 1UN2A 3J7Yb 3DRNA 1BAYA 1FAAA 2J23A 1GNWA 1YEPA 1WWJA 1XIYA 2DC5A 2WGRA 3FEUA 1TK5B 2KUCA 1SL1B 3PINA 3N5OA 5EPFA 4TR4A 5KN3A 1VGLA 1A8LA 3M9KA 1TU7A 2K6VA 2OACA 5EVOA 5IQYA 3LW9A 6GSSA 1B8XA 4POBA 1K0CA 3FHKA 3J7Yk 3LXTA 2R3XA 2CVBA 2AUVA 2QSIA 2L4CA 2RUFA 2DIZA 4HEA2 4KB3A 3M0FA 4IJIA 3L0HA 4I2UA 5JWRB 2R0PA 1GWCA 3UBLA 2LUSA 4EDZA 1GP1A 4ZILA 2IWTA 2KHPA 3LJRA 1OE7A 4DVCA 3HZ8A 1WOUA 3KMNA 5HFGA 3ERFA 2DMLA 2YWOA 2GZZA 5J3RA 1B9YC 3IK7A 4XTSA 4GXZA 1SK2A 2JZRA 2VIMA 1JZOA 1FG4A 5GAPD 2B6MA 1X5CA 1YF1A 2PVQA 2H1AA 2VO4A 4ICYA 1SKRB 2R4VA 5DALB 1J08A 3A3TA 5DQYA 5CP1A 3APQA 4ML6A 2DJ1A 4N11A 2FHEA 2LRTA 4BA7A 3W8SA 2MBSA 4GCIA 1KEBA 1TW9A 2X99A 2TRXA 5C04A 4O7HA 4G10A 2H74A 2FNOA 3HDCA 3WGEA 4FO5A 5INYA 1ZMAA 3PGTA 1TTZA 4X4JA 4IS0A 1YJ6A 4X43A 4GTUA 5B6MA 4K9ZA 4E8EA 1GSSA 1HNAA 3L9VA 2H66A 2FLSA 2ALBA 3VI7A 4NHWA 2VLUA 3UJ1A 2MMNA 3GNJA 2VL9A 1FOVA 2WRTA 2N5FA 5G1LA 1OC9B 2PUKC 4X1UA 3UARA 5ECSA 4OO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LD0 A;  2VAF A;  2WFC A;  1Q98 A;  3GIX A;  3HYP A;  1S3D A;  3L78 A;  4IJ3 A;  3ZZX A;  4PXO A;  3F6F A;  1XWC A;  3NIV A;  1EOH A;  3GMF A;  1EWX A;  1M7T A;  4KE3 A;  4OFT A;  2LJA A;  1T1V A;  3GKN A;  4G2E A;  3W6G A;  1ERU A;  3D5J A;  1F9M A;  1KTE A;  5IMD A;  4KSO A;  2VLT A;  2CZ3 A;  5IIZ A;  5JCW A;  5B8A A;  1G6Y A;  4KH7 A;  4BWS A;  3GA4 A;  2KP2 A;  5ECQ B;  1V2A A;  2H1B A;  4PNG A;  3HVX A;  3ERG A;  5D9X A;  3BD2 A;  5HQP A;  3LWA A;  3ZFL A;  4KW6 A;  1XWG A;  3MNG A;  2VOC A;  1A0R P;  1OC3 A;  2L4Q A;  2RM5 A;  2E0Q A;  3QAG A;  4JE1 A;  3VLN A;  3KZQ A;  3DVX A;  4NAX A;  3RHB A;  2QKE A;  3I9V 2;  1AW9 A;  3KP8 A;  3TJB A;  4WET A;  2H70 A;  4I6X A;  3TJF A;  1EOG A;  2GQK A;  1LU4 A;  3ZL5 A;  2WZ9 A;  4EL1 A;  2X8C A;  3AY8 A;  1NM3 A;  3GX8 A;  2FWH A;  5GZZ B;  12GS A;  4IP1 A;  4POK A;  4TW5 A;  5D8I A;  1JZD A;  4HOJ A;  5HR3 A;  4F2I A;  1AQX A;  2FWF A;  2GGT A;  1FHE A;  1Z5Y E;  3L9S A;  3VK9 A;  3DGQ A;  4IP6 A;  1GUK A;  4XS4 A;  4ML1 A;  1TJD A;  2BTO T;  2F9S A;  4DSS B;  1PKW A;  2F8F A;  4K7O A;  2VLV A;  3HXS A;  3WYW A;  3F3Q A;  2C80 A;  2IJY A;  1V40 A;  1MD4 A;  1F2E A;  2CA8 A;  2OBI A;  4JR6 A;  5G5F A;  2X8G A;  4KDU A;  1IYI A;  3IV4 A;  4XS6 A;  3FK8 A;  5JWO B;  4BPY A;  1OC8 A;  2V41 A;  2XBI A;  4JBB A;  4OCE A;  3QMX A;  2GSQ A;  2XHF A;  3RPN A;  3C73 A;  3F9U A;  4YQU A;  1R5A A;  3APO A;  4GSN A;  2VCX A;  2YV7 A;  3IHQ A;  2YN1 A;  2WDU A;  3KEB A;  1QK8 A;  5F07 A;  4KND A;  1SD9 A;  1GLP A;  1H75 A;  5L71 A;  2YZU A;  1NW2 A;  2OE0 A;  1SU9 A;  3K8N A;  4MA9 A;  3VPT A;  1BED A;  2YCD A;  3GYK A;  2P5R A;  1WJK A;  1Q4J A;  4V2M A;  5D9V A;  2AV4 A;  5DAL A;  4I5Q A;  2C3Q A;  2VM1 A;  3IPZ A;  1DE2 A;  1SYX A;  3Q6O A;  1O81 A;  5ECN B;  5ABR A;  3VWU A;  1A2J A;  5F0G A;  3EU4 A;  5DCH A;  4EC0 A;  4ISD A;  3ZVJ D;  3NZN A;  4RQX A;  2JZS A;  1TRV A;  1TOF A;  1XVQ A;  1PN9 A;  4YAV A;  4KGI A;  2H76 A;  2GSR A;  3CSI A;  4EF0 A;  5LNK e;  4JZQ A;  1TK0 B;  1U3A A;  2R5G A;  2VD1 A;  3HJM A;  4AF2 A;  4XCS A;  2MZC A;  1QGV A;  1KBN A;  2ZNM A;  1B4Q A;  5E59 A;  2YV9 A;  1K3L A;  3WT2 A;  4KCA A;  4POL A;  3IAS 2;  3P2A A;  3D21 A;  1SYR A;  2M72 A;  2PER A;  1A2M A;  4MJC A;  1UC7 A;  4O92 A;  2BJX A;  3UVH A;  6GSX A;  1QXH A;  2MMA A;  4K2D A;  4GSS A;  3HA9 A;  1EV9 A;  2TIR A;  2QC7 A;  3DYR A;  2YNX A;  4V2N A;  5CRG A;  2HLS A;  5A5K A;  5DVB A;  2YWM A;  4WF5 A;  1VF3 A;  2VCV A;  6GSU A;  2B5Y A;  2IL3 A;  3VWV A;  4MF6 A;  3Q74 A;  3TGZ A;  1PD2 1;  2KP1 A;  2YPM A;  5A4U A;  2DJ0 A;  2GT6 A;  2PU9 C;  1THO A;  16GS A;  1GSE A;  5AIV A;  5A4V A;  1VF1 A;  3BCI A;  1EGO A;  3KH9 A;  3APS A;  4FYC A;  1OKD A;  5AIX A;  2PN8 A;  2H75 A;  2DBC A;  4Z7X A;  4WXT A;  4EDY A;  3IRA A;  1T8E B;  4ZIJ A;  1XOB A;  2GST A;  1AAZ A;  1VRS D;  4MCU A;  2P0G A;  2B1L A;  2C1Y A;  4I2T A;  1FO5 A;  3C8E A;  4HQZ A;  5IMC A;  3ZYW A;  1AC1 A;  1GTU A;  2L57 A;  3PH9 A;  5KEJ A;  1V58 A;  3JCM L;  2IPA A;  3IXR A;  5ID2 B;  3UIW A;  1SKS B;  3UMA A;  4ECI A;  3IR4 A;  3G7I A;  2EC4 A;  1ZYQ B;  1CQH A;  3LYP A;  5KN0 A;  2GQL A;  1N8J A;  2H0I A;  1TXX A;  3MWH A;  1Z6N A;  3N9J A;  2GVP A;  3G7J A;  4O32 A;  4PQH A;  1GTB A;  5CRH A;  3IK9 A;  4GQF A;  1BYE A;  4OO5 A;  3H4K A;  5IMZ A;  2K18 A;  2YOI A;  4GQC A;  4F0B A;  4OFM A;  2L6C A;  4PUR A;  3RBT A;  3FY7 A;  4TN8 A;  3L9U A;  3BJ5 A;  1S3A A;  1XPV A;  4GLT A;  1USB A;  4TOP A;  1PMT A;  1WP0 A;  3OR5 A;  2ON5 A;  1MDK A;  2HT9 A;  5IOX A;  5G2Z A;  2YP6 A;  5H5S A;  4WEY A;  2YAN A;  4HZ4 A;  2DJJ A;  3VPQ A;  4ZBA A;  5DCG A;  2JU5 A;  2HXK A;  3PR8 A;  3KGK A;  1RW1 A;  1LBK A;  2NPB A;  3E9J B;  3FZA A;  1TRS A;  2LS5 A;  3GH9 A;  1X0R A;  4XS4 B;  2K9F A;  1HNB A;  2ON7 A;  4IW9 A;  1WPI A;  1ZYE A;  3ZVJ A;  4I8B A;  3KP9 A;  4IHU A;  4K7I A;  2WB9 A;  3US3 A;  2ZUP A;  1MDI A;  3DKS A;  4IVF A;  3FR6 A;  2C3N A;  1K3O A;  1WE0 A;  2CVD A;  3E0U A;  3D22 A;  4TRX A;  5ECO B;  3VUR A;  4EUY A;  1KNG A;  2CAQ A;  3F0I A;  4MJE A;  3BOA A;  2RM6 A;  2G0F A;  3QCP A;  2I9H A;  2FGX A;  3GTU B;  2H6Z A;  1G7O A;  1GUL A;  2GDR A;  2L5O A;  3VI5 A;  1ZL9 A;  3LGC A;  3QOU A;  3F6D A;  4F03 A;  2M80 A;  1A23 A;  4Q5Q A;  1B48 A;  1ON4 A;  1M9B A;  1ERW A;  4HU7 A;  3KCM A;  3A2W A;  1XVW A;  1XOA A;  5HR2 A;  1X5D A;  1PQN A;  5IM9 A;  4EXJ A;  4ZB6 A;  4WBR D;  2HFD A;  4ULX A;  2IMD A;  3EC3 A;  1QMV A;  2FUG 2;  1ILO A;  2HRN A;  2V6O A;  4FYU A;  3H8Q A;  1FVJ A;  3ZLP A;  3G7Y A;  2L5L A;  3WGD A;  1VF4 A;  1EP8 A;  1GTA A;  2HNL A;  3O3T A;  3H1N A;  3CYN A;  4X0X A;  1GL8 A;  2LQQ A;  5J9B A;  1UVZ A;  2HSH A;  3ME7 A;  1GSD A;  4PUA A;  4TR1 B;  4PQI A;  1K0M A;  4L0U A;  4TXV A;  3A2V A;  2IMK A;  3G9B A;  4QL7 A;  3TKS C;  1T3B A;  1X9M B;  1F3A A;  6GSY A;  3TRP A;  5FHI A;  1FVK A;  1AQV A;  1PKZ A;  1GTI A;  1ST9 A;  3HVV A;  3O6T A;  3TUE A;  4PGT A;  1RK4 A;  1SJ6 A;  2YJ7 A;  4NPB A;  2I4A A;  5ECK B;  4F82 A;  1PL2 A;  5ECP B;  1FW1 A;  4CW9 A;  1G7E A;  2VL2 C;  2FD3 A;  2CX3 A;  4YAP A;  3LEF A;  4ECJ A;  4DSQ A;  5ID2 A;  4F0C A;  2FA8 A;  4TR0 A;  4BL7 A;  2VL3 A;  2H1D A;  1ML6 A;  4J57 E;  5DJM A;  2HZE B;  4JU5 A;  1ACV A;  4K0N A;  1Z7R A;  3TJJ A;  4AGS A;  1M2D A;  4L5O A;  3UAP A;  1HQO A;  2ES7 A;  4J2F A;  4GF0 A;  2H6Y A;  1A2L A;  3DWV A;  5IPH A;  2IME A;  3C1S A;  4HJ2 A;  2DJK A;  1S3C A;  5C00 A;  2IFQ B;  4GST A;  2M46 A;  2V2G A;  3P7X A;  4MPF A;  4N0V A;  3ME8 A;  2LRC A;  2GQM A;  1ERV A;  3CSH A;  5KN2 A;  4AJ7 A;  3A5W A;  2Z9S A;  5ECH B;  2OJL A;  4ECC A;  4V1A p;  1T4Y A;  5G31 A;  1XZO A;  4HZ2 A;  1SK0 A;  4MF7 A;  4IQ1 A;  1EEJ A;  3FW2 A;  4HDE A;  2NDO A;  2H19 A;  4MH3 A;  1A8Y A;  4WR5 A;  4NWY A;  1B9X C;  4TR3 A;  3D4M A;  2H6X A;  1PRX A;  4MJA A;  3KD0 A;  4POM A;  3KJY A;  4DSR A;  1V9W A;  4E8H A;  5JWQ B;  3DML A;  2NBS A;  1Z3E A;  2PMT A;  2R6K A;  4JR4 A;  4K0G A;  2B5E A;  5A4W A;  4LL4 B;  1I9D A;  5JCG A;  13GS A;  3EWL A;  1SL2 B;  3F4T A;  2DJ2 A;  1R5P A;  2J9H A;  3WD6 A;  1BX9 A;  2N5B A;  5IO2 A;  3GTU A;  2P5Q A;  3CXG A;  2REM A;  2A2S A;  4L8E A;  1JHB A;  2B5X A;  3TKR A;  1PGT A;  4BWQ A;  3GHA A;  4GWR A;  4MMM A;  2E7P A;  1SJZ A;  5CRD A;  3ZMK A;  1DSB A;  4IKH A;  3QPM A;  4G19 A;  1CQG A;  2LEG A;  4KAE A;  3F4R A;  4ZL9 A;  3ERW A;  2GSS A;  4ZL7 A;  4YQM A;  3TDG A;  4LLR A;  1X9W B;  3GFK A;  5DBQ A;  1G6W A;  1GNE A;  1U88 A;  5CNW A;  1SL0 B;  1TDI A;  4NXI A;  1EP7 A;  4HUA A;  4TR1 A;  1THX A;  3LSZ A;  1GH2 A;  1E6B A;  4L0W A;  4OCF A;  1R4W A;  5CAX A;  4XRD A;  1NHO A;  1AQW A;  2VM2 A;  2CVK A;  3MSZ A;  4RUV A;  3GKM A;  2O87 A;  3IC4 A;  3IOS A;  2P31 A;  5F06 A;  1H4O A;  2X8H A;  2IMF A;  1XCC A;  5COH A;  2H1G A;  3IA1 A;  3VFI A;  1JLW A;  1EGR A;  2YZH A;  3UEM A;  2LQO A;  3H79 A;  5HR1 A;  18GS A;  3UBK A;  7GSS A;  1O8W A;  3KH7 A;  1JLV A;  2L6D A;  3EMP A;  4OD7 A;  2FWE A;  2O8V B;  1IYH A;  2V32 A;  3CRT A;  4MH2 A;  1EV4 A;  2E2G A;  1ZOF A;  1HD2 A;  1C72 A;  3HKR A;  1A24 A;  3GX0 A;  2EIR A;  4LMW A;  1YF0 A;  3D4T A;  1K0D A;  4K1F A;  3EIN A;  5AGY A;  2AHE A;  1T00 A;  1O6J A;  2GS3 A;  2HZE A;  3EUR A;  3LYK A;  4ZB9 A;  5HR0 A;  1QQ2 A;  2O7K A;  3TRX A;  1YEX A;  4XRA A;  4Q5F A;  1BG5 A;  4ZL8 A;  1F6M C;  1WIK A;  4RQR A;  5D73 A;  5GAN D;  4QQ7 A;  4P3Y B;  5CO3 A;  3GST A;  4TVE A;  22GS A;  3GKX A;  4NV2 A;  2XC2 A;  2IFQ A;  1B4P A;  2MMO A;  2I3Y A;  2JZT A;  1M2A A;  2FA4 A;  1K0B A;  2AB6 A;  3EU3 A;  1WRY A;  1GSQ A;  3P8W A;  4Q5R A;  1U6T A;  1TRW A;  4NMU A;  1BJX A;  3L4N A;  4K8M A;  4KDY A;  1HNC A;  2H01 A;  4N30 A;  2H8L A;  3KIJ A;  2VCW A;  3KTL A;  1XW6 A;  1GSF A;  1TRU A;  2VCZ A;  4G9H A;  2K8V A;  1X9S B;  4KA0 A;  8GSS A;  4MPG A;  3V1W A;  2EIO A;  1A0F A;  4LMV A;  1EEM A;  3BCK A;  1U87 A;  2OA7 A;  2VCT A;  4BVX A;  4PX1 A;  2GTU A;  1Y6E A;  3HHV A;  2FCH A;  4HQS A;  2LNS A;  2BMX A;  3FR3 A;  3GV1 A;  3KMO A;  1GSU A;  1XWK A;  2LJK A;  4RI6 A;  2OKA A;  11GS A;  2AYT A;  3F8U A;  5J4U A;  4FH8 A;  1W89 A;  3HY2 A;  3TKQ A;  4OWY A;  3U5R E;  1YY7 A;  4MAB A;  4EO3 A;  4FIW A;  3LFL A;  1PL1 A;  5CRE A;  5JCU A;  3DD3 A;  3WT1 A;  3ZRE A;  1UA5 A;  5DAK B;  2CT6 A;  2V6K A;  4RI7 A;  5FT3 A;  3W8J A;  3GUS A;  3I69 A;  2HZF A;  3ZFB A;  2AAW A;  2B7J A;  1OE8 A;  1ZCP A;  1O8X A;  1YDK A;  3GH6 A;  3F63 A;  4GRF A;  2H73 A;  2G2Q A;  4HU9 A;  6GST A;  4ECB A;  3P90 A;  3VWW A;  4IGJ A;  5F05 A;  3FYG A;  2B3S A;  3EYT A;  4KDX A;  1XWB A;  4O5R A;  5G30 A;  1K0O A;  3LXZ A;  20GS A;  4QL9 A;  2C0D A;  5G1K A;  2E2M A;  1WMJ A;  1ABA A;  2NVL A;  4EVM A;  1SK1 A;  4MZC A;  2B1K A;  4IN0 A;  3KXO A;  1U3I A;  6GSW A;  4L5L A;  4D73 A;  1O85 A;  1K0N A;  2H30 A;  3GUR A;  3LG6 A;  2WS2 A;  2XPD A;  3WGX A;  4HJM A;  1XW5 A;  2HYX A;  2I1U A;  3UVT A;  1YZX A;  1R26 A;  5F8B A;  1J0F A;  3ED3 A;  10GS A;  1Z7P A;  3TJK A;  2PWJ A;  3HCZ A;  3DXB A;  3IBH A;  4CDO A;  1XXU A;  3C7M A;  3LOR A;  4TXO A;  4KSM A;  1NHY A;  1PSQ A;  2LST A;  3SWL A;  3GL3 A;  2AJQ B;  4DEJ A;  1X5E A;  1TP9 A;  4KUN A;  2C3T A;  2L59 A;  3HZ4 A;  3TCO A;  2C8U A;  1K0A A;  1EZK A;  6GSV A;  2RII A;  3NOF A;  1XBS A;  2ZCT A;  4H86 A;  5ENU A;  4EE0 A;  3CTF A;  5ECL B;  5IMV A;  1XFL A;  2CAI A;  2JL4 A;  4YQV A;  1J9B A;  3RDW A;  2HRF A;  1RQM A;  1T4Z A;  1JZW A;  5LCZ A;  3DEX A;  1BQ7 A;  1GUH A;  4Q5N A;  3TKS A;  1M99 A;  2LJR A;  3RHC A;  4XS1 A;  3D6I A;  1FB6 A;  5AN1 A;  2F8A A;  3FZ9 A;  4ZBD A;  3CRU A;  4KCE A;  4MZB A;  5J41 A;  3FZ4 A;  3HD5 A;  1F3B A;  4V2L A;  2OE1 A;  3QFB C;  4HI7 A;  4HS1 A;  5FWG A;  2O89 A;  3QAV A;  1O73 A;  2VL2 A;  1GUM A;  3C71 A;  2A2R A;  1SKW B;  1F37 A;  3F4S A;  2DLX A;  2OE3 A;  3ZIT A;  1GLQ A;  5HFI A;  5KN1 A;  2NTO A;  4ID0 A;  3A2X A;  3Q18 A;  3E3E A;  1PX7 A;  3M1G A;  1NSW A;  2C0E A;  4WKW A;  2LNT A;  2IN3 A;  2HE3 A;  2N5A A;  2HI7 A;  4KX4 A;  4I97 A;  1TU8 A;  2KOK A;  1N2A A;  4AJ8 A;  2WJU A;  3VWX A;  5ELG A;  1QFN A;  2LTK A;  4FYB A;  5J9C A;  3EE2 A;  5DDL A;  3ZIV A;  5ECI B;  3RAZ A;  4ZXG A;  2OAD A;  2H0H A;  5DAK A;  3LQ7 A;  5B6N A;  1XWA A;  3GRX A;  3I6A A;  2LRN A;  5E4W A;  1QUW A;  2K8S A;  3TKP A;  3CTG A;  2H0G A;  1Z6M A;  3QDN A;  2JSZ A;  2KLX A;  2WUL A;  1TKD B;  4OMV A;  1I5G A;  1JFU A;  3HJO A;  2DMM A;  4EKZ A;  2QGV A;  5HFK A;  3MDK A;  1DBY A;  4JRR A;  1OVN A;  4MLY A;  4IEL A;  3TRQ A;  2RLI A;  5GST A;  4LA1 A;  2GZP A;  3R2Q A;  5CRW A;  5ECM B;  1OKT A;  4WBJ A;  2B7K A;  2DSA A;  3M9J A;  4ILF A;  4ZB8 A;  3IE3 A;  3TJG A;  3GN3 A;  1MTC A;  3M3M A;  2TRC P;  2H71 A;  3QR6 A;  5G5E A;  1LJR A;  3TOT A;  3O76 A;  2MBT A;  1G0T A;  2C0F A;  3M8N A;  2PPT A;  9GSS A;  1ZGN A;  3RPP A;  2HSY A;  4LL1 B;  5IO0 A;  2PVO C;  5IPG A;  1DE1 A;  4MK3 A;  2X64 A;  2O85 A;  3FRC A;  3GSS A;  4AJ6 A;  2XPE A;  3ZRD A;  2C0G A;  2F3M A;  3QAW A;  1VF2 A;  2R2J A;  2OBK A;  3ISO A;  1T7P B;  2YJH A;  1M2B A;  1GSY A;  2YWI A;  4MJB A;  5GSS A;  3D0Z A;  2CZ2 A;  1XW9 A;  4XHM A;  4PQ1 A;  1MEK A;  5IMA A;  3S9F A;  2DIY A;  3GKK A;  4WR4 A;  1JZR A;  5D93 A;  4PNF A;  4MP4 A;  5D9W A;  3QFA C;  5IOW A;  1TK8 B;  3KM6 A;  2JAC A;  1AUC A;  1R7H A;  1M9A A;  4D73 B;  1AXD A;  4F9Z A;  1GRX A;  3U6V A;  2VD0 A;  2MMZ A;  17GS A;  5H5R A;  1TI3 A;  3UOM A;  2JSY A;  3DVW A;  2C4J A;  4OFN A;  4TXO B;  1OC9 A;  4MZW A;  3H93 A;  3C1R A;  5D96 A;  3FR9 A;  5ELA A;  4CHS A;  5B8B A;  4V1A g;  2IIY A;  1ERT A;  4PUF C;  1PA3 A;  3ZIJ A;  2LKU A;  2FY6 A;  1MDJ A;  3CSJ A;  2EIQ A;  1YQ1 A;  3ZTL A;  3EVI A;  5H5Q A;  3IAM 2;  14GS A;  1SD8 A;  3Q19 A;  1V98 A;  4K7N A;  4JED A;  2A4V A;  3I43 A;  2PGT A;  4ACS A;  19GS A;  1HYU A;  2CQ9 A;  4N10 A;  4NHZ A;  2F51 A;  4ZBB A;  1URM A;  5J5N A;  1MD3 A;  2CV4 A;  2XBQ A;  1YKA A;  2R37 A;  4YH2 A;  3FZ5 A;  5AIS A;  3SBC A;  1SJI A;  1Y25 A;  4N0Z A;  1OYJ A;  5DJL A;  2GLR A;  1YKC A;  2FWG A;  2V1M A;  1V57 A;  5CYY A;  2YWN A;  2H72 A;  5B7C A;  2GZY A;  4NV5 A;  3FKF A;  3CMI A;  2PBJ A;  2IMI A;  3ZML A;  2JAD A;  5D9T A;  2GT5 A;  2MYG A;  1K3Y A;  5IMF A;  4MDC A;  3EMX A;  5EL8 A;  5DQS A;  2CX4 A;  3BBY A;  2DJ3 A;  2VCQ A;  1O7U A;  4TKY A;  2WCI A;  3HJP A;  1AIU A;  1PX6 A;  3UL3 A;  4XIH A;  1OAZ A;  1Z9H A;  4BVY A;  3DIE A;  1E2Y A;  4K6X A;  4IQA A;  1ZZY A;  3QD9 A;  1TI1 A;  3TOU A;  4IBP A;  1W4V A;  1FB0 A;  1DUG A;  1M0U A;  3CBU A;  3F3R A;  3MAK A;  2D2Z A;  2I81 A;  3GL5 A;  4J56 E;  1SEN A;  2RUE A;  4DSS A;  2LV3 A;  3TB2 A;  2VUP A;  4WF4 A;  3HVS A;  5EY6 A;  5ECR B;  3IDV A;  3TKS E;  3KTB A;  4MF5 A;  1UN2 A;  3J7Y b;  3DRN A;  1BAY A;  1FAA A;  2J23 A;  1GNW A;  1YEP A;  1WWJ A;  1XIY A;  2DC5 A;  2WGR A;  3FEU A;  1TK5 B;  2KUC A;  1SL1 B;  3PIN A;  3N5O A;  5EPF A;  4TR4 A;  5KN3 A;  1VGL A;  1A8L A;  3M9K A;  1TU7 A;  2K6V A;  2OAC A;  5EVO A;  5IQY A;  6GSS A;  1B8X A;  4POB A;  1K0C A;  3FHK A;  3J7Y k;  3LXT A;  2R3X A;  2CVB A;  2AUV A;  2QSI A;  2L4C A;  2RUF A;  2DIZ A;  4HEA 2;  4KB3 A;  3M0F A;  4IJI A;  3L0H A;  4I2U A;  5JWR B;  1GWC A;  3UBL A;  2LUS A;  4EDZ A;  1GP1 A;  4ZIL A;  2IWT A;  2KHP A;  3LJR A;  1OE7 A;  4DVC A;  3HZ8 A;  1WOU A;  3KMN A;  5HFG A;  3ERF A;  2DML A;  2YWO A;  2GZZ A;  5J3R A;  1B9Y C;  3IK7 A;  4XTS A;  4GXZ A;  1SK2 A;  2JZR A;  2VIM A;  1JZO A;  1FG4 A;  5GAP D;  2B6M A;  1X5C A;  1YF1 A;  2PVQ A;  2H1A A;  2VO4 A;  1SKR B;  5DAL B;  2R4V A;  1J08 A;  3A3T A;  5DQY A;  5CP1 A;  3APQ A;  4ML6 A;  2DJ1 A;  4N11 A;  2FHE A;  2LRT A;  4BA7 A;  3W8S A;  2MBS A;  4GCI A;  1KEB A;  1TW9 A;  2X99 A;  2TRX A;  5C04 A;  4O7H A;  4G10 A;  2H74 A;  2FNO A;  3HDC A;  3WGE A;  4FO5 A;  5INY A;  1ZMA A;  3PGT A;  1TTZ A;  4IS0 A;  1YJ6 A;  4X43 A;  4GTU A;  5B6M A;  4K9Z A;  4E8E A;  1GSS A;  1HNA A;  3L9V A;  2H66 A;  2FLS A;  2ALB A;  3VI7 A;  4NHW A;  2VLU A;  3UJ1 A;  2MMN A;  3GNJ A;  2VL9 A;  1FOV A;  2WRT A;  2N5F A;  5G1L A;  1OC9 B;  2PUK C;  4X1U A;  3UAR A;  5ECS A;  4OO4 A; 
#chains in the Genus database with same CATH topology
 5LD0 A;  2VAF A;  2WFC A;  1Q98 A;  3GIX A;  3HYP A;  1S3D A;  3L78 A;  4IJ3 A;  3ZZX A;  4PXO A;  3F6F A;  1XWC A;  1M3J A;  3NIV A;  1EOH A;  3GMF A;  1EWX A;  4USS A;  1M7T A;  4KE3 A;  4OFT A;  2LJA A;  1T1V A;  3GKN A;  4G2E A;  3W6G A;  1ERU A;  3D5J A;  1F9M A;  1KTE A;  5IMD A;  4KSO A;  2VLT A;  2CZ3 A;  5IIZ A;  5JCW A;  5B8A A;  2X49 A;  1G6Y A;  4KH7 A;  4BWS A;  3GA4 A;  2KP2 A;  5ECQ B;  1V2A A;  2H1B A;  4PNG A;  3HVX A;  3ERG A;  5D9X A;  3BD2 A;  5HQP A;  3LWA A;  3ZFL A;  4KW6 A;  1XWG A;  3MNG A;  2VOC A;  1A0R P;  1OC3 A;  2L4Q A;  4MNN A;  2RM5 A;  2E0Q A;  3QAG A;  4JE1 A;  3VLN A;  3KZQ A;  3DVX A;  4NAX A;  3RHB A;  2QKE A;  4G0K A;  3I9V 2;  1AW9 A;  3KP8 A;  3TJB A;  4WET A;  2H70 A;  4I6X A;  3TJF A;  1EOG A;  2GQK A;  1LU4 A;  3ZL5 A;  2WZ9 A;  4EL1 A;  2X8C A;  3AY8 A;  1NM3 A;  3GX8 A;  2FWH A;  5GZZ B;  12GS A;  4IP1 A;  4POK A;  4TW5 A;  5D8I A;  1JZD A;  4HOJ A;  5HR3 A;  4F2I A;  1AQX A;  2FWF A;  2GGT A;  1FHE A;  1Z5Y E;  3L9S A;  3VK9 A;  2A2P A;  3DGQ A;  4IP6 A;  1GUK A;  4XS4 A;  4ML1 A;  1TJD A;  2BTO T;  2F9S A;  4DSS B;  1PKW A;  2F8F A;  4K7O A;  2VLV A;  3HXS A;  3WYW A;  3F3Q A;  2C80 A;  2IJY A;  1V40 A;  1MD4 A;  1F2E A;  2CA8 A;  2OBI A;  4JR6 A;  5G5F A;  2X8G A;  4KDU A;  1IYI A;  3IV4 A;  2QA2 A;  4XS6 A;  3FK8 A;  5JWO B;  4BPY A;  1OC8 A;  2V41 A;  2XBI A;  4JBB A;  4OCE A;  3QMX A;  2GSQ A;  3CQF A;  2XHF A;  3RPN A;  3C73 A;  3F9U A;  4YQU A;  1R5A A;  3APO A;  4GSN A;  2VCX A;  2YV7 A;  3IHQ A;  2YN1 A;  2WDU A;  3KEB A;  1QK8 A;  5F07 A;  4KND A;  1SD9 A;  1GLP A;  1H75 A;  5L71 A;  2YZU A;  1NW2 A;  2OE0 A;  1SU9 A;  3K8N A;  4MA9 A;  3VPT A;  1BED A;  2YCD A;  3GYK A;  2P5R A;  1WJK A;  1Q4J A;  4V2M A;  5D9V A;  2AV4 A;  5DAL A;  4I5Q A;  2C3Q A;  2VM1 A;  3IPZ A;  1DE2 A;  1SYX A;  3Q6O A;  1O81 A;  5ECN B;  5ABR A;  3VWU A;  1A2J A;  5F0G A;  3EU4 A;  5DCH A;  4EC0 A;  4ISD A;  3ZVJ D;  3NZN A;  4RQX A;  2JZS A;  1TRV A;  1TOF A;  1XVQ A;  1PN9 A;  4YAV A;  4KGI A;  2H76 A;  2GSR A;  3CSI A;  4EF0 A;  5LNK e;  4JZQ A;  1TK0 B;  1U3A A;  2R5G A;  2VD1 A;  3HJM A;  4AF2 A;  4XCS A;  2MZC A;  1QGV A;  1KBN A;  2ZNM A;  1B4Q A;  5E59 A;  2YV9 A;  1K3L A;  3WT2 A;  4KCA A;  4POL A;  3IAS 2;  3P2A A;  3D21 A;  1SYR A;  2M72 A;  2PER A;  1A2M A;  4MJC A;  1UC7 A;  4O92 A;  2BJX A;  3UVH A;  6GSX A;  1QXH A;  2MMA A;  4K2D A;  4GSS A;  3HA9 A;  1EV9 A;  2TIR A;  2QC7 A;  3DYR A;  2YNX A;  4V2N A;  5CRG A;  2HLS A;  5A5K A;  5DVB A;  2YWM A;  4WF5 A;  1VF3 A;  2VCV A;  6GSU A;  2B5Y A;  2IL3 A;  3VWV A;  4MF6 A;  4K5S A;  3Q74 A;  3TGZ A;  1PD2 1;  2KP1 A;  2YPM A;  5A4U A;  2DJ0 A;  2GT6 A;  2PU9 C;  1THO A;  16GS A;  1GSE A;  5AIV A;  5A4V A;  1VF1 A;  3BCI A;  1EGO A;  3KH9 A;  3APS A;  4FYC A;  1OKD A;  5AIX A;  2PN8 A;  2H75 A;  2DBC A;  4Z7X A;  4WXT A;  4EDY A;  3IRA A;  1T8E B;  4ZIJ A;  1XOB A;  2GST A;  1AAZ A;  1VRS D;  4MCU A;  2P0G A;  2B1L A;  5BMU A;  2C1Y A;  4I2T A;  1FO5 A;  3C8E A;  4HQZ A;  5IMC A;  3ZYW A;  1AC1 A;  1GTU A;  2L57 A;  3PH9 A;  5KEJ A;  1V58 A;  3JCM L;  2IPA A;  3IXR A;  5ID2 B;  3UIW A;  1SKS B;  4BL7 B;  3UMA A;  4ECI A;  3IR4 A;  3G7I A;  2EC4 A;  1ZYQ B;  1CQH A;  3LYP A;  5KN0 A;  2GQL A;  1N8J A;  2H0I A;  1TXX A;  3MWH A;  1Z6N A;  3N9J A;  2GVP A;  3G7J A;  4O32 A;  4PQH A;  1GTB A;  5CRH A;  3IK9 A;  4GQF A;  1BYE A;  4OO5 A;  3H4K A;  5IMZ A;  2K18 A;  2YOI A;  4GQC A;  4F0B A;  4OFM A;  2L6C A;  4PUR A;  3RBT A;  3FY7 A;  4TN8 A;  3L9U A;  3BJ5 A;  1S3A A;  1XPV A;  3FMW A;  4GLT A;  1USB A;  2R0G A;  4TOP A;  1PMT A;  1WP0 A;  3OR5 A;  2ON5 A;  1MDK A;  2HT9 A;  5IOX A;  5G2Z A;  4FQU A;  2YP6 A;  5H5S A;  4WEY A;  2YAN A;  4HZ4 A;  2DJJ A;  3VPQ A;  4ZBA A;  5DCG A;  2JU5 A;  2HXK A;  3PR8 A;  3KGK A;  1RW1 A;  1LBK A;  2NPB A;  3E9J B;  3FZA A;  1TRS A;  2LS5 A;  3PPU A;  3GH9 A;  1X0R A;  4XS4 B;  2K9F A;  1HNB A;  2ON7 A;  4IW9 A;  1WPI A;  1ZYE A;  3ZVJ A;  4I8B A;  3KP9 A;  4IHU A;  4K7I A;  2WB9 A;  3US3 A;  2ZUP A;  1MDI A;  3DKS A;  4IVF A;  3FR6 A;  2C3N A;  1K3O A;  1WE0 A;  2CVD A;  3E0U A;  3D22 A;  4TRX A;  5ECO B;  3VUR A;  3A5I A;  4EUY A;  1KNG A;  2CAQ A;  3F0I A;  4MJE A;  3BOA A;  2RM6 A;  2G0F A;  3QCP A;  2I9H A;  2FGX A;  3GTU B;  2H6Z A;  1G7O A;  1GUL A;  2GDR A;  2L5O A;  3VI5 A;  1ZL9 A;  3LGC A;  3QOU A;  3F6D A;  4F03 A;  2M80 A;  1A23 A;  4Q5Q A;  1B48 A;  1ON4 A;  1M9B A;  1ERW A;  4HU7 A;  3KCM A;  3A2W A;  1XVW A;  1XOA A;  5HR2 A;  1X5D A;  1PQN A;  5IM9 A;  4EXJ A;  4ZB6 A;  4WBR D;  2HFD A;  4ULX A;  2IMD A;  3EC3 A;  1QMV A;  2FUG 2;  1ILO A;  2HRN A;  2V6O A;  4FYU A;  4EIQ A;  3H8Q A;  1FVJ A;  3ZLP A;  3G7Y A;  2L5L A;  3WGD A;  1VF4 A;  1EP8 A;  1GTA A;  2HNL A;  3O3T A;  3H1N A;  3CYN A;  4X0X A;  1GL8 A;  2LQQ A;  5J9B A;  1UVZ A;  2HSH A;  3ME7 A;  1GSD A;  4PUA A;  4TR1 B;  4PQI A;  1K0M A;  4L0U A;  4TXV A;  5KOW A;  3A2V A;  2IMK A;  3G9B A;  4QL7 A;  3TKS C;  1T3B A;  1X9M B;  1F3A A;  6GSY A;  3TRP A;  1PN0 A;  5FHI A;  1FVK A;  1AQV A;  1PKZ A;  1GTI A;  1ST9 A;  3HVV A;  3O6T A;  3TUE A;  4PGT A;  1RK4 A;  1SJ6 A;  2YJ7 A;  4NPB A;  2I4A A;  5ECK B;  4F82 A;  1PL2 A;  5ECP B;  1FW1 A;  3MYD A;  4CW9 A;  1G7E A;  2VL2 C;  2FD3 A;  2CX3 A;  4YAP A;  3LEF A;  4ECJ A;  4DSQ A;  5ID2 A;  4F0C A;  2FA8 A;  4TR0 A;  3MIX A;  4BL7 A;  2VL3 A;  2H1D A;  1ML6 A;  4J57 E;  5DJM A;  2HZE B;  4JU5 A;  1ACV A;  4K0N A;  1Z7R A;  3TJJ A;  4AGS A;  1M2D A;  4L5O A;  3UAP A;  1HQO A;  2ES7 A;  4J2F A;  4GF0 A;  2H6Y A;  1A2L A;  3DWV A;  5IPH A;  2IME A;  3C1S A;  4HJ2 A;  2DJK A;  1S3C A;  5BRT A;  5C00 A;  2IFQ B;  3R3E A;  4GST A;  2M46 A;  4Z2T A;  2V2G A;  3P7X A;  4MPF A;  4N0V A;  3ME8 A;  2LRC A;  4PTS A;  2GQM A;  1ERV A;  3CSH A;  5KN2 A;  4AJ7 A;  4YKF A;  3A5W A;  2Z9S A;  5ECH B;  2OJL A;  4ECC A;  4V1A p;  1T4Y A;  5G31 A;  1XZO A;  4HZ2 A;  1SK0 A;  4MF7 A;  4IQ1 A;  1EEJ A;  3FW2 A;  4HDE A;  2NDO A;  2H19 A;  4MH3 A;  1A8Y A;  4WR5 A;  4NWY A;  1B9X C;  4TR3 A;  4BVX B;  4K5R A;  3D4M A;  2H6X A;  1PRX A;  4MJA A;  3KD0 A;  4POM A;  3KJY A;  4DSR A;  1V9W A;  4E8H A;  5JWQ B;  3DML A;  2NBS A;  1Z3E A;  2PMT A;  2R6K A;  4JR4 A;  4K0G A;  2B5E A;  5A4W A;  4LL4 B;  1I9D A;  5JCG A;  13GS A;  3EWL A;  1SL2 B;  3F4T A;  2DJ2 A;  1R5P A;  2J9H A;  3WD6 A;  1BX9 A;  2N5B A;  5IO2 A;  3GTU A;  2P5Q A;  3CXG A;  2REM A;  2A2S A;  4L8E A;  1JHB A;  2B5X A;  3TKR A;  1PGT A;  4BWQ A;  3GHA A;  4GWR A;  4MMM A;  2E7P A;  1SJZ A;  5CRD A;  3ZMK A;  1DSB A;  4IKH A;  3QPM A;  3IC8 A;  4G19 A;  1CQG A;  2LEG A;  4KAE A;  3F4R A;  4ZL9 A;  3ERW A;  2GSS A;  4ZL7 A;  4YQM A;  3TDG A;  4LLR A;  1X9W B;  3GFK A;  5DBQ A;  1G6W A;  1GNE A;  1FOH A;  1U88 A;  5CNW A;  1SL0 B;  1TDI A;  4NXI A;  1EP7 A;  4HUA A;  4TR1 A;  1THX A;  3LSZ A;  1GH2 A;  1E6B A;  4L0W A;  4OCF A;  1R4W A;  5CAX A;  4XRD A;  1NHO A;  1PFO A;  1AQW A;  2VM2 A;  2CVK A;  3EPT A;  3MSZ A;  4RUV A;  3GKM A;  2O87 A;  3IC4 A;  3IOS A;  2P31 A;  5F06 A;  1H4O A;  2X8H A;  2IMF A;  1XCC A;  4G0L A;  5COH A;  4CY6 A;  2H1G A;  3IA1 A;  3VFI A;  1JLW A;  1EGR A;  2YZH A;  3UEM A;  2LQO A;  3H79 A;  5HR1 A;  18GS A;  3UBK A;  7GSS A;  1O8W A;  3KH7 A;  1JLV A;  2L6D A;  3EMP A;  4OD7 A;  2X4A A;  2FWE A;  2O8V B;  1IYH A;  2V32 A;  3CRT A;  4MH2 A;  1EV4 A;  2E2G A;  1ZOF A;  1HD2 A;  1C72 A;  3HKR A;  1A24 A;  3GX0 A;  2EIR A;  4LMW A;  1YF0 A;  3D4T A;  1K0D A;  4K1F A;  3EIN A;  5AGY A;  2AHE A;  1T00 A;  1O6J A;  2GS3 A;  2HZE A;  3EUR A;  3LYK A;  4ZB9 A;  5HR0 A;  1QQ2 A;  2O7K A;  3TRX A;  1YEX A;  4XRA A;  4Q5F A;  1BG5 A;  4ZL8 A;  1F6M C;  1WIK A;  4RQR A;  5D73 A;  5GAN D;  4QQ7 A;  4P3Y B;  5CO3 A;  3GST A;  4TVE A;  22GS A;  3GKX A;  4NV2 A;  2XC2 A;  2IFQ A;  1B4P A;  2MMO A;  2I3Y A;  2JZT A;  1M2A A;  2FA4 A;  1K0B A;  2AB6 A;  3EU3 A;  1WRY A;  1GSQ A;  3P8W A;  4Q5R A;  4K2X A;  1U6T A;  1TRW A;  3IHG A;  4NMU A;  1BJX A;  3L4N A;  4K8M A;  4KDY A;  1HNC A;  2H01 A;  4N30 A;  2H8L A;  3KIJ A;  2VCW A;  3KTL A;  1XW6 A;  1GSF A;  1TRU A;  2VCZ A;  4G9H A;  2K8V A;  1X9S B;  4KA0 A;  8GSS A;  4O5U A;  4MPG A;  3V1W A;  2EIO A;  1A0F A;  4LMV A;  1EEM A;  3BCK A;  1U87 A;  2OA7 A;  1M3I A;  2VCT A;  4BVX A;  4PX1 A;  2GTU A;  1Y6E A;  3HHV A;  2FCH A;  4HQS A;  2LNS A;  2BMX A;  3FR3 A;  3GV1 A;  3KMO A;  1GSU A;  1XWK A;  2LJK A;  4RI6 A;  2OKA A;  11GS A;  1ZYP A;  2AYT A;  3F8U A;  5J4U A;  4FH8 A;  1W89 A;  3HY2 A;  3TKQ A;  4OWY A;  3U5R E;  1YY7 A;  4MAB A;  4Z2R A;  1S3R A;  4EO3 A;  4FIW A;  3LFL A;  1PL1 A;  5CRE A;  5JCU A;  3DD3 A;  3WT1 A;  3ZRE A;  1UA5 A;  5DAK B;  2CT6 A;  2V6K A;  4RI7 A;  5FT3 A;  3W8J A;  3GUS A;  3I69 A;  2HZF A;  3ZFB A;  2AAW A;  2B7J A;  1OE8 A;  1ZCP A;  1O8X A;  1YDK A;  3GH6 A;  3F63 A;  4GRF A;  2H73 A;  2G2Q A;  4HU9 A;  6GST A;  4ECB A;  3P90 A;  3VWW A;  2A4H A;  4IGJ A;  5F05 A;  3FYG A;  2B3S A;  3EYT A;  4KDX A;  4Z2U A;  1XWB A;  4O5R A;  5G30 A;  1K0O A;  3LXZ A;  20GS A;  4QL9 A;  2C0D A;  5G1K A;  4BIK A;  2E2M A;  1WMJ A;  1ABA A;  2NVL A;  4EVM A;  1SK1 A;  4MZC A;  2B1K A;  4IN0 A;  3KXO A;  1U3I A;  6GSW A;  4L5L A;  4D73 A;  1O85 A;  1K0N A;  2H30 A;  3GUR A;  3LG6 A;  2WS2 A;  2XPD A;  3WGX A;  4HJM A;  1XW5 A;  2HYX A;  2I1U A;  3UVT A;  1YZX A;  1R26 A;  5F8B A;  1J0F A;  3ED3 A;  10GS A;  1Z7P A;  3TJK A;  2PWJ A;  3HCZ A;  3DXB A;  3IBH A;  4CDO A;  1XXU A;  3C7M A;  3LOR A;  4TXO A;  4KSM A;  1NHY A;  1PSQ A;  3HVN A;  2LST A;  3SWL A;  3GL3 A;  2AJQ B;  4DEJ A;  1X5E A;  1TP9 A;  4KUN A;  2C3T A;  2L59 A;  2UZ8 A;  3HZ4 A;  3TCO A;  2C8U A;  1K0A A;  1EZK A;  6GSV A;  2RII A;  3NOF A;  1XBS A;  2ZCT A;  4H86 A;  5ENU A;  4EE0 A;  3CTF A;  5ECL B;  5IMV A;  1XFL A;  2CAI A;  2JL4 A;  4YQV A;  1J9B A;  3RDW A;  2HRF A;  1RQM A;  1T4Z A;  1JZW A;  5LCZ A;  3DEX A;  1BQ7 A;  1GUH A;  4Q5N A;  3TKS A;  1M99 A;  2LJR A;  3RHC A;  4XS1 A;  3D6I A;  1FB6 A;  5AN1 A;  2F8A A;  3FZ9 A;  4ZBD A;  2R0C A;  3CRU A;  4KCE A;  4MZB A;  5J41 A;  3FZ4 A;  3HD5 A;  1F3B A;  4V2L A;  2OE1 A;  3QFB C;  4HI7 A;  4HS1 A;  5FWG A;  2O89 A;  3QAV A;  1O73 A;  2VL2 A;  1GUM A;  3C71 A;  2A2R A;  1SKW B;  1F37 A;  3F4S A;  2DLX A;  2OE3 A;  3ZIT A;  1GLQ A;  5HFI A;  5KN1 A;  2NTO A;  4ID0 A;  3A2X A;  3Q18 A;  3E3E A;  1PX7 A;  3M1G A;  1NSW A;  2C0E A;  4WKW A;  2LNT A;  2IN3 A;  2HE3 A;  2N5A A;  2HI7 A;  4KX4 A;  4I97 A;  1TU8 A;  2KOK A;  1N2A A;  4AJ8 A;  2WJU A;  3VWX A;  5ELG A;  1QFN A;  2LTK A;  4FYB A;  5J9C A;  3EE2 A;  5DDL A;  3ZIV A;  5ECI B;  3RAZ A;  4ZXG A;  2OAD A;  2H0H A;  5DAK A;  3LQ7 A;  5B6N A;  1XWA A;  3GRX A;  4BVY B;  3I6A A;  2LRN A;  5E4W A;  1QUW A;  2K8S A;  3TKP A;  3CTG A;  2H0G A;  1Z6M A;  3QDN A;  2JSZ A;  2KLX A;  2WUL A;  1TKD B;  4OMV A;  1I5G A;  4G0I A;  1JFU A;  3HJO A;  2DMM A;  4EKZ A;  2QGV A;  5HFK A;  3MDK A;  1DBY A;  4JRR A;  1OVN A;  4MLY A;  4IEL A;  3TRQ A;  2RLI A;  5GST A;  4LA1 A;  2GZP A;  3R2Q A;  5CRW A;  5ECM B;  1OKT A;  4WBJ A;  2B7K A;  2DSA A;  3M9J A;  4ILF A;  4ZB8 A;  2HRA A;  3IE3 A;  3TJG A;  3GN3 A;  5KOX A;  1MTC A;  3M3M A;  2TRC P;  2H71 A;  3QR6 A;  5G5E A;  1LJR A;  3TOT A;  3O76 A;  2MBT A;  1G0T A;  2C0F A;  3M8N A;  2PPT A;  9GSS A;  1ZGN A;  3RPP A;  2HSY A;  4LL1 B;  5IO0 A;  2PVO C;  5IPG A;  1DE1 A;  4MK3 A;  2X64 A;  2O85 A;  3FRC A;  3GSS A;  4AJ6 A;  2XPE A;  3ZRD A;  2C0G A;  2F3M A;  3QAW A;  1VF2 A;  2HRK A;  2R2J A;  2OBK A;  3ISO A;  1T7P B;  2YJH A;  1M2B A;  1GSY A;  2YWI A;  4MJB A;  5GSS A;  3D0Z A;  2CZ2 A;  1XW9 A;  4XHM A;  4PQ1 A;  1MEK A;  5IMA A;  3S9F A;  2DIY A;  3GKK A;  4WR4 A;  1JZR A;  4EIP A;  5D93 A;  4PNF A;  4MP4 A;  5D9W A;  3QFA C;  5IOW A;  1TK8 B;  3KM6 A;  2JAC A;  1AUC A;  1R7H A;  1M9A A;  4D73 B;  1AXD A;  4F9Z A;  1GRX A;  3U6V A;  2VD0 A;  2MMZ A;  17GS A;  5H5R A;  2QA1 A;  1TI3 A;  3UOM A;  2JSY A;  3DVW A;  2C4J A;  4OFN A;  4TXO B;  1OC9 A;  4MZW A;  3H93 A;  3C1R A;  5D96 A;  3FR9 A;  5ELA A;  4CHS A;  4KF9 A;  5B8B A;  4V1A g;  2IIY A;  2HSM A;  1ERT A;  4PUF C;  1PA3 A;  3ZIJ A;  2LKU A;  2FY6 A;  1MDJ A;  4CY8 A;  3CSJ A;  2EIQ A;  1YQ1 A;  3ZTL A;  3EVI A;  5H5Q A;  3IAM 2;  14GS A;  1SD8 A;  3Q19 A;  1V98 A;  4K7N A;  4JED A;  2A4V A;  3I43 A;  2PGT A;  4A5P A;  4O5Q A;  4ACS A;  19GS A;  1HYU A;  2CQ9 A;  4N10 A;  4NHZ A;  2F51 A;  4ZBB A;  1URM A;  5J5N A;  1MD3 A;  2CV4 A;  2DKI A;  2XBQ A;  1YKA A;  2R37 A;  4YH2 A;  3FZ5 A;  5AIS A;  3SBC A;  1SJI A;  1Y25 A;  4N0Z A;  1OYJ A;  5DJL A;  2DKH A;  2GLR A;  1YKC A;  2FWG A;  2V1M A;  1V57 A;  5CYY A;  2YWN A;  2H72 A;  5B7C A;  2GZY A;  4NV5 A;  3FKF A;  3CMI A;  2PBJ A;  2IMI A;  3ZML A;  2JAD A;  5D9T A;  2GT5 A;  2MYG A;  1K3Y A;  5IMF A;  4MDC A;  3EMX A;  5EL8 A;  5DQS A;  2CX4 A;  3BBY A;  2DJ3 A;  2VCQ A;  1O7U A;  4TKY A;  2WCI A;  3HJP A;  1AIU A;  1PX6 A;  3UL3 A;  4XIH A;  1OAZ A;  1Z9H A;  1ZYN A;  4BVY A;  3DIE A;  1E2Y A;  4K6X A;  4IQA A;  1ZZY A;  3QD9 A;  1TI1 A;  3TOU A;  4IBP A;  1W4V A;  1FB0 A;  1DUG A;  1M0U A;  3CBU A;  3F3R A;  3MAK A;  2D2Z A;  2I81 A;  3GL5 A;  4J56 E;  1SEN A;  1XG8 A;  2RUE A;  4DSS A;  2LV3 A;  3TB2 A;  2VUP A;  4WF4 A;  3HVS A;  4YKG A;  5EY6 A;  5ECR B;  3IDV A;  3TKS E;  3KTB A;  4MF5 A;  1UN2 A;  3J7Y b;  3DRN A;  1BAY A;  1FAA A;  2J23 A;  1GNW A;  1YEP A;  1WWJ A;  1XIY A;  2DC5 A;  2WGR A;  3FEU A;  1TK5 B;  2KUC A;  1SL1 B;  3PIN A;  3N5O A;  5EPF A;  4TR4 A;  5KN3 A;  1VGL A;  1A8L A;  3M9K A;  1TU7 A;  2K6V A;  2OAC A;  5EVO A;  5IQY A;  3LW9 A;  6GSS A;  1B8X A;  4POB A;  1K0C A;  3FHK A;  3J7Y k;  3LXT A;  2R3X A;  2CVB A;  2AUV A;  2QSI A;  2L4C A;  2RUF A;  2DIZ A;  4HEA 2;  4KB3 A;  3M0F A;  4IJI A;  3L0H A;  4I2U A;  5JWR B;  2R0P A;  4HSC X;  1GWC A;  3UBL A;  2LUS A;  4EDZ A;  1GP1 A;  4ZIL A;  2IWT A;  2KHP A;  3LJR A;  1OE7 A;  4DVC A;  3HZ8 A;  1WOU A;  3KMN A;  5HFG A;  3ERF A;  2DML A;  2YWO A;  2GZZ A;  5J3R A;  1B9Y C;  3IK7 A;  4XTS A;  4GXZ A;  1SK2 A;  2JZR A;  2VIM A;  1JZO A;  1FG4 A;  5GAP D;  2B6M A;  1X5C A;  1YF1 A;  2PVQ A;  2H1A A;  2VO4 A;  4ICY A;  1SKR B;  2R4V A;  5DAL B;  1J08 A;  3A3T A;  5DQY A;  5CP1 A;  3APQ A;  4ML6 A;  2DJ1 A;  4N11 A;  2FHE A;  2LRT A;  4BA7 A;  3W8S A;  2MBS A;  4GCI A;  1KEB A;  1TW9 A;  2X99 A;  2TRX A;  5C04 A;  4O7H A;  4G10 A;  2H74 A;  2FNO A;  3HDC A;  3WGE A;  4FO5 A;  5INY A;  1ZMA A;  3PGT A;  1TTZ A;  4X4J A;  4IS0 A;  1YJ6 A;  4X43 A;  4GTU A;  5B6M A;  4K9Z A;  4E8E A;  1GSS A;  1HNA A;  3L9V A;  2H66 A;  2FLS A;  2ALB A;  3VI7 A;  4NHW A;  2VLU A;  3UJ1 A;  2MMN A;  3GNJ A;  2VL9 A;  1FOV A;  2WRT A;  2N5F A;  5G1L A;  1OC9 B;  2PUK C;  4X1U A;  3UAR A;  5ECS A;  4OO4 A; 
#chains in the Genus database with same CATH homology
 5LD0 A;  2VAF A;  2WFC A;  1Q98 A;  3GIX A;  3HYP A;  1S3D A;  3L78 A;  4IJ3 A;  3ZZX A;  4PXO A;  3F6F A;  1XWC A;  3NIV A;  1EOH A;  3GMF A;  1EWX A;  4USS A;  1M7T A;  4KE3 A;  4OFT A;  2LJA A;  1T1V A;  3GKN A;  4G2E A;  3W6G A;  1ERU A;  3D5J A;  1F9M A;  1KTE A;  5IMD A;  4KSO A;  2VLT A;  2CZ3 A;  5IIZ A;  5JCW A;  5B8A A;  2X49 A;  1G6Y A;  4KH7 A;  4BWS A;  3GA4 A;  2KP2 A;  5ECQ B;  1V2A A;  2H1B A;  4PNG A;  3HVX A;  3ERG A;  5D9X A;  3BD2 A;  5HQP A;  3LWA A;  3ZFL A;  4KW6 A;  1XWG A;  3MNG A;  2VOC A;  1A0R P;  1OC3 A;  2L4Q A;  4MNN A;  2RM5 A;  2E0Q A;  3QAG A;  4JE1 A;  3VLN A;  3KZQ A;  3DVX A;  4NAX A;  3RHB A;  2QKE A;  4G0K A;  3I9V 2;  1AW9 A;  3KP8 A;  3TJB A;  4WET A;  2H70 A;  4I6X A;  3TJF A;  1EOG A;  2GQK A;  1LU4 A;  3ZL5 A;  2WZ9 A;  4EL1 A;  2X8C A;  3AY8 A;  1NM3 A;  3GX8 A;  2FWH A;  5GZZ B;  12GS A;  4IP1 A;  4POK A;  4TW5 A;  5D8I A;  1JZD A;  4HOJ A;  5HR3 A;  4F2I A;  1AQX A;  2FWF A;  2GGT A;  1FHE A;  1Z5Y E;  3L9S A;  3VK9 A;  2A2P A;  3DGQ A;  4IP6 A;  1GUK A;  4XS4 A;  4ML1 A;  1TJD A;  2BTO T;  2F9S A;  4DSS B;  1PKW A;  2F8F A;  4K7O A;  2VLV A;  3HXS A;  3WYW A;  3F3Q A;  2C80 A;  2IJY A;  1V40 A;  1MD4 A;  1F2E A;  2CA8 A;  2OBI A;  4JR6 A;  5G5F A;  2X8G A;  4KDU A;  1IYI A;  3IV4 A;  2QA2 A;  4XS6 A;  3FK8 A;  5JWO B;  4BPY A;  1OC8 A;  2V41 A;  2XBI A;  4JBB A;  4OCE A;  3QMX A;  2GSQ A;  2XHF A;  3RPN A;  3C73 A;  3F9U A;  4YQU A;  1R5A A;  3APO A;  4GSN A;  2VCX A;  2YV7 A;  3IHQ A;  2YN1 A;  2WDU A;  3KEB A;  1QK8 A;  5F07 A;  4KND A;  1SD9 A;  1GLP A;  1H75 A;  5L71 A;  2YZU A;  1NW2 A;  2OE0 A;  1SU9 A;  3K8N A;  4MA9 A;  3VPT A;  1BED A;  2YCD A;  3GYK A;  2P5R A;  1WJK A;  1Q4J A;  4V2M A;  5D9V A;  2AV4 A;  5DAL A;  4I5Q A;  2C3Q A;  2VM1 A;  3IPZ A;  1DE2 A;  1SYX A;  3Q6O A;  1O81 A;  5ECN B;  5ABR A;  3VWU A;  1A2J A;  5F0G A;  3EU4 A;  5DCH A;  4EC0 A;  4ISD A;  3ZVJ D;  3NZN A;  4RQX A;  2JZS A;  1TRV A;  1TOF A;  1XVQ A;  1PN9 A;  4YAV A;  4KGI A;  2H76 A;  2GSR A;  3CSI A;  4EF0 A;  5LNK e;  4JZQ A;  1TK0 B;  1U3A A;  2R5G A;  2VD1 A;  3HJM A;  4AF2 A;  4XCS A;  2MZC A;  1QGV A;  1KBN A;  2ZNM A;  1B4Q A;  5E59 A;  2YV9 A;  1K3L A;  3WT2 A;  4KCA A;  4POL A;  3IAS 2;  3P2A A;  3D21 A;  1SYR A;  2M72 A;  2PER A;  1A2M A;  4MJC A;  1UC7 A;  4O92 A;  2BJX A;  3UVH A;  6GSX A;  1QXH A;  2MMA A;  4K2D A;  4GSS A;  3HA9 A;  1EV9 A;  2TIR A;  2QC7 A;  3DYR A;  2YNX A;  4V2N A;  5CRG A;  2HLS A;  5A5K A;  5DVB A;  2YWM A;  4WF5 A;  1VF3 A;  2VCV A;  6GSU A;  2B5Y A;  2IL3 A;  3VWV A;  4MF6 A;  4K5S A;  3Q74 A;  3TGZ A;  1PD2 1;  2KP1 A;  2YPM A;  5A4U A;  2DJ0 A;  2GT6 A;  2PU9 C;  1THO A;  16GS A;  1GSE A;  5AIV A;  5A4V A;  1VF1 A;  3BCI A;  1EGO A;  3KH9 A;  3APS A;  4FYC A;  1OKD A;  5AIX A;  2PN8 A;  2H75 A;  2DBC A;  4Z7X A;  4WXT A;  4EDY A;  3IRA A;  1T8E B;  4ZIJ A;  1XOB A;  2GST A;  1AAZ A;  1VRS D;  4MCU A;  2P0G A;  2B1L A;  5BMU A;  2C1Y A;  4I2T A;  1FO5 A;  3C8E A;  4HQZ A;  5IMC A;  3ZYW A;  1AC1 A;  1GTU A;  2L57 A;  3PH9 A;  5KEJ A;  1V58 A;  3JCM L;  2IPA A;  3IXR A;  5ID2 B;  3UIW A;  1SKS B;  4BL7 B;  3UMA A;  4ECI A;  3IR4 A;  3G7I A;  2EC4 A;  1ZYQ B;  1CQH A;  3LYP A;  5KN0 A;  2GQL A;  1N8J A;  2H0I A;  1TXX A;  3MWH A;  1Z6N A;  3N9J A;  2GVP A;  3G7J A;  4O32 A;  4PQH A;  1GTB A;  5CRH A;  3IK9 A;  4GQF A;  1BYE A;  4OO5 A;  3H4K A;  5IMZ A;  2K18 A;  2YOI A;  4GQC A;  4F0B A;  4OFM A;  2L6C A;  4PUR A;  3RBT A;  3FY7 A;  4TN8 A;  3L9U A;  3BJ5 A;  1S3A A;  1XPV A;  3FMW A;  4GLT A;  1USB A;  2R0G A;  4TOP A;  1PMT A;  1WP0 A;  3OR5 A;  2ON5 A;  1MDK A;  2HT9 A;  5IOX A;  5G2Z A;  4FQU A;  2YP6 A;  5H5S A;  4WEY A;  2YAN A;  4HZ4 A;  2DJJ A;  3VPQ A;  4ZBA A;  5DCG A;  2JU5 A;  2HXK A;  3PR8 A;  3KGK A;  1RW1 A;  1LBK A;  2NPB A;  3E9J B;  3FZA A;  1TRS A;  2LS5 A;  3PPU A;  3GH9 A;  1X0R A;  4XS4 B;  2K9F A;  1HNB A;  2ON7 A;  4IW9 A;  1WPI A;  1ZYE A;  3ZVJ A;  4I8B A;  3KP9 A;  4IHU A;  4K7I A;  2WB9 A;  3US3 A;  2ZUP A;  1MDI A;  3DKS A;  4IVF A;  3FR6 A;  2C3N A;  1K3O A;  1WE0 A;  2CVD A;  3E0U A;  3D22 A;  4TRX A;  5ECO B;  3VUR A;  3A5I A;  4EUY A;  1KNG A;  2CAQ A;  3F0I A;  4MJE A;  3BOA A;  2RM6 A;  2G0F A;  3QCP A;  2I9H A;  2FGX A;  3GTU B;  2H6Z A;  1G7O A;  1GUL A;  2GDR A;  2L5O A;  3VI5 A;  1ZL9 A;  3LGC A;  3QOU A;  3F6D A;  4F03 A;  2M80 A;  1A23 A;  4Q5Q A;  1B48 A;  1ON4 A;  1M9B A;  1ERW A;  4HU7 A;  3KCM A;  3A2W A;  1XVW A;  1XOA A;  5HR2 A;  1X5D A;  1PQN A;  5IM9 A;  4EXJ A;  4ZB6 A;  4WBR D;  2HFD A;  4ULX A;  2IMD A;  3EC3 A;  1QMV A;  2FUG 2;  1ILO A;  2HRN A;  2V6O A;  4FYU A;  4EIQ A;  3H8Q A;  1FVJ A;  3ZLP A;  3G7Y A;  2L5L A;  3WGD A;  1VF4 A;  1EP8 A;  1GTA A;  2HNL A;  3O3T A;  3H1N A;  3CYN A;  4X0X A;  1GL8 A;  2LQQ A;  5J9B A;  1UVZ A;  2HSH A;  3ME7 A;  1GSD A;  4PUA A;  4TR1 B;  4PQI A;  1K0M A;  4L0U A;  4TXV A;  5KOW A;  3A2V A;  2IMK A;  3G9B A;  4QL7 A;  3TKS C;  1T3B A;  1X9M B;  1F3A A;  6GSY A;  3TRP A;  1PN0 A;  5FHI A;  1FVK A;  1AQV A;  1PKZ A;  1GTI A;  1ST9 A;  3HVV A;  3O6T A;  3TUE A;  4PGT A;  1RK4 A;  1SJ6 A;  2YJ7 A;  4NPB A;  2I4A A;  5ECK B;  4F82 A;  1PL2 A;  5ECP B;  1FW1 A;  3MYD A;  4CW9 A;  1G7E A;  2VL2 C;  2FD3 A;  2CX3 A;  4YAP A;  3LEF A;  4ECJ A;  4DSQ A;  5ID2 A;  4F0C A;  2FA8 A;  4TR0 A;  3MIX A;  4BL7 A;  2VL3 A;  2H1D A;  1ML6 A;  4J57 E;  5DJM A;  2HZE B;  4JU5 A;  1ACV A;  4K0N A;  1Z7R A;  3TJJ A;  4AGS A;  1M2D A;  4L5O A;  3UAP A;  1HQO A;  2ES7 A;  4J2F A;  4GF0 A;  2H6Y A;  1A2L A;  3DWV A;  5IPH A;  2IME A;  3C1S A;  4HJ2 A;  2DJK A;  1S3C A;  5BRT A;  5C00 A;  2IFQ B;  3R3E A;  4GST A;  2M46 A;  4Z2T A;  2V2G A;  3P7X A;  4MPF A;  4N0V A;  3ME8 A;  2LRC A;  4PTS A;  2GQM A;  1ERV A;  3CSH A;  5KN2 A;  4AJ7 A;  4YKF A;  3A5W A;  2Z9S A;  5ECH B;  2OJL A;  4ECC A;  4V1A p;  1T4Y A;  5G31 A;  1XZO A;  4HZ2 A;  1SK0 A;  4MF7 A;  4IQ1 A;  1EEJ A;  3FW2 A;  4HDE A;  2NDO A;  2H19 A;  4MH3 A;  1A8Y A;  4WR5 A;  4NWY A;  1B9X C;  4TR3 A;  4BVX B;  4K5R A;  3D4M A;  2H6X A;  1PRX A;  4MJA A;  3KD0 A;  4POM A;  3KJY A;  4DSR A;  1V9W A;  4E8H A;  5JWQ B;  3DML A;  2NBS A;  1Z3E A;  2PMT A;  2R6K A;  4JR4 A;  4K0G A;  2B5E A;  5A4W A;  4LL4 B;  1I9D A;  5JCG A;  13GS A;  3EWL A;  1SL2 B;  3F4T A;  2DJ2 A;  1R5P A;  2J9H A;  3WD6 A;  1BX9 A;  2N5B A;  5IO2 A;  3GTU A;  2P5Q A;  3CXG A;  2REM A;  2A2S A;  4L8E A;  1JHB A;  2B5X A;  3TKR A;  1PGT A;  4BWQ A;  3GHA A;  4GWR A;  4MMM A;  2E7P A;  1SJZ A;  5CRD A;  3ZMK A;  1DSB A;  4IKH A;  3QPM A;  3IC8 A;  4G19 A;  1CQG A;  2LEG A;  4KAE A;  3F4R A;  4ZL9 A;  3ERW A;  2GSS A;  4ZL7 A;  4YQM A;  3TDG A;  4LLR A;  1X9W B;  3GFK A;  5DBQ A;  1G6W A;  1GNE A;  1FOH A;  1U88 A;  5CNW A;  1SL0 B;  1TDI A;  4NXI A;  1EP7 A;  4HUA A;  4TR1 A;  1THX A;  3LSZ A;  1GH2 A;  1E6B A;  4L0W A;  4OCF A;  1R4W A;  5CAX A;  4XRD A;  1NHO A;  1AQW A;  2VM2 A;  2CVK A;  3EPT A;  3MSZ A;  4RUV A;  3GKM A;  2O87 A;  3IC4 A;  3IOS A;  2P31 A;  5F06 A;  1H4O A;  2X8H A;  2IMF A;  1XCC A;  4G0L A;  5COH A;  4CY6 A;  2H1G A;  3IA1 A;  3VFI A;  1JLW A;  1EGR A;  2YZH A;  3UEM A;  2LQO A;  3H79 A;  5HR1 A;  18GS A;  3UBK A;  7GSS A;  1O8W A;  3KH7 A;  1JLV A;  2L6D A;  3EMP A;  4OD7 A;  2X4A A;  2FWE A;  2O8V B;  1IYH A;  2V32 A;  3CRT A;  4MH2 A;  1EV4 A;  2E2G A;  1ZOF A;  1HD2 A;  1C72 A;  3HKR A;  1A24 A;  3GX0 A;  2EIR A;  4LMW A;  1YF0 A;  3D4T A;  1K0D A;  4K1F A;  3EIN A;  5AGY A;  2AHE A;  1T00 A;  1O6J A;  2GS3 A;  2HZE A;  3EUR A;  3LYK A;  4ZB9 A;  5HR0 A;  1QQ2 A;  2O7K A;  3TRX A;  1YEX A;  4XRA A;  4Q5F A;  1BG5 A;  4ZL8 A;  1F6M C;  1WIK A;  4RQR A;  5D73 A;  5GAN D;  4QQ7 A;  4P3Y B;  5CO3 A;  3GST A;  4TVE A;  22GS A;  3GKX A;  4NV2 A;  2XC2 A;  2IFQ A;  1B4P A;  2MMO A;  2I3Y A;  2JZT A;  1M2A A;  2FA4 A;  1K0B A;  2AB6 A;  3EU3 A;  1WRY A;  1GSQ A;  3P8W A;  4Q5R A;  4K2X A;  1U6T A;  1TRW A;  3IHG A;  4NMU A;  1BJX A;  3L4N A;  4K8M A;  4KDY A;  1HNC A;  2H01 A;  4N30 A;  2H8L A;  3KIJ A;  2VCW A;  3KTL A;  1XW6 A;  1GSF A;  1TRU A;  2VCZ A;  4G9H A;  2K8V A;  1X9S B;  4KA0 A;  8GSS A;  4O5U A;  4MPG A;  3V1W A;  2EIO A;  1A0F A;  4LMV A;  1EEM A;  3BCK A;  1U87 A;  2OA7 A;  2VCT A;  4BVX A;  4PX1 A;  2GTU A;  1Y6E A;  3HHV A;  2FCH A;  4HQS A;  2LNS A;  2BMX A;  3FR3 A;  3GV1 A;  3KMO A;  1GSU A;  1XWK A;  2LJK A;  4RI6 A;  2OKA A;  11GS A;  1ZYP A;  2AYT A;  3F8U A;  5J4U A;  4FH8 A;  1W89 A;  3HY2 A;  3TKQ A;  4OWY A;  3U5R E;  1YY7 A;  4MAB A;  4Z2R A;  4EO3 A;  4FIW A;  3LFL A;  1PL1 A;  5CRE A;  5JCU A;  3DD3 A;  3WT1 A;  3ZRE A;  1UA5 A;  5DAK B;  2CT6 A;  2V6K A;  4RI7 A;  5FT3 A;  3W8J A;  3GUS A;  3I69 A;  2HZF A;  3ZFB A;  2AAW A;  2B7J A;  1OE8 A;  1ZCP A;  1O8X A;  1YDK A;  3GH6 A;  3F63 A;  4GRF A;  2H73 A;  2G2Q A;  4HU9 A;  6GST A;  4ECB A;  3P90 A;  3VWW A;  2A4H A;  4IGJ A;  5F05 A;  3FYG A;  2B3S A;  3EYT A;  4KDX A;  4Z2U A;  1XWB A;  4O5R A;  5G30 A;  1K0O A;  3LXZ A;  20GS A;  4QL9 A;  2C0D A;  5G1K A;  2E2M A;  1WMJ A;  1ABA A;  2NVL A;  4EVM A;  1SK1 A;  4MZC A;  2B1K A;  4IN0 A;  3KXO A;  1U3I A;  6GSW A;  4L5L A;  4D73 A;  1O85 A;  1K0N A;  2H30 A;  3GUR A;  3LG6 A;  2WS2 A;  2XPD A;  3WGX A;  4HJM A;  1XW5 A;  2HYX A;  2I1U A;  3UVT A;  1YZX A;  1R26 A;  5F8B A;  1J0F A;  3ED3 A;  10GS A;  1Z7P A;  3TJK A;  2PWJ A;  3HCZ A;  3DXB A;  3IBH A;  4CDO A;  1XXU A;  3C7M A;  3LOR A;  4TXO A;  4KSM A;  1NHY A;  1PSQ A;  2LST A;  3SWL A;  3GL3 A;  2AJQ B;  4DEJ A;  1X5E A;  1TP9 A;  4KUN A;  2C3T A;  2L59 A;  2UZ8 A;  3HZ4 A;  3TCO A;  2C8U A;  1K0A A;  1EZK A;  6GSV A;  2RII A;  3NOF A;  1XBS A;  2ZCT A;  4H86 A;  5ENU A;  4EE0 A;  3CTF A;  5ECL B;  5IMV A;  1XFL A;  2CAI A;  2JL4 A;  4YQV A;  1J9B A;  3RDW A;  2HRF A;  1RQM A;  1T4Z A;  1JZW A;  5LCZ A;  3DEX A;  1BQ7 A;  1GUH A;  4Q5N A;  3TKS A;  1M99 A;  2LJR A;  3RHC A;  4XS1 A;  3D6I A;  1FB6 A;  5AN1 A;  2F8A A;  3FZ9 A;  4ZBD A;  2R0C A;  3CRU A;  4KCE A;  4MZB A;  5J41 A;  3FZ4 A;  3HD5 A;  1F3B A;  4V2L A;  2OE1 A;  3QFB C;  4HI7 A;  4HS1 A;  5FWG A;  2O89 A;  3QAV A;  1O73 A;  2VL2 A;  1GUM A;  3C71 A;  2A2R A;  1SKW B;  1F37 A;  3F4S A;  2DLX A;  2OE3 A;  3ZIT A;  1GLQ A;  5HFI A;  5KN1 A;  2NTO A;  4ID0 A;  3A2X A;  3Q18 A;  3E3E A;  1PX7 A;  3M1G A;  1NSW A;  2C0E A;  4WKW A;  2LNT A;  2IN3 A;  2HE3 A;  2N5A A;  2HI7 A;  4KX4 A;  4I97 A;  1TU8 A;  2KOK A;  1N2A A;  4AJ8 A;  2WJU A;  3VWX A;  5ELG A;  1QFN A;  2LTK A;  4FYB A;  5J9C A;  3EE2 A;  5DDL A;  3ZIV A;  5ECI B;  3RAZ A;  4ZXG A;  2OAD A;  2H0H A;  5DAK A;  3LQ7 A;  5B6N A;  1XWA A;  3GRX A;  4BVY B;  3I6A A;  2LRN A;  5E4W A;  1QUW A;  2K8S A;  3TKP A;  3CTG A;  2H0G A;  1Z6M A;  3QDN A;  2JSZ A;  2KLX A;  2WUL A;  1TKD B;  4OMV A;  1I5G A;  4G0I A;  1JFU A;  3HJO A;  2DMM A;  4EKZ A;  2QGV A;  5HFK A;  3MDK A;  1DBY A;  4JRR A;  1OVN A;  4MLY A;  4IEL A;  3TRQ A;  2RLI A;  5GST A;  4LA1 A;  2GZP A;  3R2Q A;  5CRW A;  5ECM B;  1OKT A;  4WBJ A;  2B7K A;  2DSA A;  3M9J A;  4ILF A;  4ZB8 A;  2HRA A;  3IE3 A;  3TJG A;  3GN3 A;  5KOX A;  1MTC A;  3M3M A;  2TRC P;  2H71 A;  3QR6 A;  5G5E A;  1LJR A;  3TOT A;  3O76 A;  2MBT A;  1G0T A;  2C0F A;  3M8N A;  2PPT A;  9GSS A;  1ZGN A;  3RPP A;  2HSY A;  4LL1 B;  5IO0 A;  2PVO C;  5IPG A;  1DE1 A;  4MK3 A;  2X64 A;  2O85 A;  3FRC A;  3GSS A;  4AJ6 A;  2XPE A;  3ZRD A;  2C0G A;  2F3M A;  3QAW A;  1VF2 A;  2HRK A;  2R2J A;  2OBK A;  3ISO A;  1T7P B;  2YJH A;  1M2B A;  1GSY A;  2YWI A;  4MJB A;  5GSS A;  3D0Z A;  2CZ2 A;  1XW9 A;  4XHM A;  4PQ1 A;  1MEK A;  5IMA A;  3S9F A;  2DIY A;  3GKK A;  4WR4 A;  1JZR A;  4EIP A;  5D93 A;  4PNF A;  4MP4 A;  5D9W A;  3QFA C;  5IOW A;  1TK8 B;  3KM6 A;  2JAC A;  1AUC A;  1R7H A;  1M9A A;  4D73 B;  1AXD A;  4F9Z A;  1GRX A;  3U6V A;  2VD0 A;  2MMZ A;  17GS A;  5H5R A;  2QA1 A;  1TI3 A;  3UOM A;  2JSY A;  3DVW A;  2C4J A;  4OFN A;  4TXO B;  1OC9 A;  4MZW A;  3H93 A;  3C1R A;  5D96 A;  3FR9 A;  5ELA A;  4CHS A;  4KF9 A;  5B8B A;  4V1A g;  2IIY A;  2HSM A;  1ERT A;  4PUF C;  1PA3 A;  3ZIJ A;  2LKU A;  2FY6 A;  1MDJ A;  4CY8 A;  3CSJ A;  2EIQ A;  1YQ1 A;  3ZTL A;  3EVI A;  5H5Q A;  3IAM 2;  14GS A;  1SD8 A;  3Q19 A;  1V98 A;  4K7N A;  4JED A;  2A4V A;  3I43 A;  2PGT A;  4A5P A;  4O5Q A;  4ACS A;  19GS A;  1HYU A;  2CQ9 A;  4N10 A;  4NHZ A;  2F51 A;  4ZBB A;  1URM A;  5J5N A;  1MD3 A;  2CV4 A;  2DKI A;  2XBQ A;  1YKA A;  2R37 A;  4YH2 A;  3FZ5 A;  5AIS A;  3SBC A;  1SJI A;  1Y25 A;  4N0Z A;  1OYJ A;  5DJL A;  2DKH A;  2GLR A;  1YKC A;  2FWG A;  2V1M A;  1V57 A;  5CYY A;  2YWN A;  2H72 A;  5B7C A;  2GZY A;  4NV5 A;  3FKF A;  3CMI A;  2PBJ A;  2IMI A;  3ZML A;  2JAD A;  5D9T A;  2GT5 A;  2MYG A;  1K3Y A;  5IMF A;  4MDC A;  3EMX A;  5EL8 A;  5DQS A;  2CX4 A;  3BBY A;  2DJ3 A;  2VCQ A;  1O7U A;  4TKY A;  2WCI A;  3HJP A;  1AIU A;  1PX6 A;  3UL3 A;  4XIH A;  1OAZ A;  1Z9H A;  1ZYN A;  4BVY A;  3DIE A;  1E2Y A;  4K6X A;  4IQA A;  1ZZY A;  3QD9 A;  1TI1 A;  3TOU A;  4IBP A;  1W4V A;  1FB0 A;  1DUG A;  1M0U A;  3CBU A;  3F3R A;  3MAK A;  2D2Z A;  2I81 A;  3GL5 A;  4J56 E;  1SEN A;  2RUE A;  4DSS A;  2LV3 A;  3TB2 A;  2VUP A;  4WF4 A;  3HVS A;  4YKG A;  5EY6 A;  5ECR B;  3IDV A;  3TKS E;  3KTB A;  4MF5 A;  1UN2 A;  3J7Y b;  3DRN A;  1BAY A;  1FAA A;  2J23 A;  1GNW A;  1YEP A;  1WWJ A;  1XIY A;  2DC5 A;  2WGR A;  3FEU A;  1TK5 B;  2KUC A;  1SL1 B;  3PIN A;  3N5O A;  5EPF A;  4TR4 A;  5KN3 A;  1VGL A;  1A8L A;  3M9K A;  1TU7 A;  2K6V A;  2OAC A;  5EVO A;  5IQY A;  3LW9 A;  6GSS A;  1B8X A;  4POB A;  1K0C A;  3FHK A;  3J7Y k;  3LXT A;  2R3X A;  2CVB A;  2AUV A;  2QSI A;  2L4C A;  2RUF A;  2DIZ A;  4HEA 2;  4KB3 A;  3M0F A;  4IJI A;  3L0H A;  4I2U A;  5JWR B;  2R0P A;  1GWC A;  3UBL A;  2LUS A;  4EDZ A;  1GP1 A;  4ZIL A;  2IWT A;  2KHP A;  3LJR A;  1OE7 A;  4DVC A;  3HZ8 A;  1WOU A;  3KMN A;  5HFG A;  3ERF A;  2DML A;  2YWO A;  2GZZ A;  5J3R A;  1B9Y C;  3IK7 A;  4XTS A;  4GXZ A;  1SK2 A;  2JZR A;  2VIM A;  1JZO A;  1FG4 A;  5GAP D;  2B6M A;  1X5C A;  1YF1 A;  2PVQ A;  2H1A A;  2VO4 A;  4ICY A;  1SKR B;  2R4V A;  5DAL B;  1J08 A;  3A3T A;  5DQY A;  5CP1 A;  3APQ A;  4ML6 A;  2DJ1 A;  4N11 A;  2FHE A;  2LRT A;  4BA7 A;  3W8S A;  2MBS A;  4GCI A;  1KEB A;  1TW9 A;  2X99 A;  2TRX A;  5C04 A;  4O7H A;  4G10 A;  2H74 A;  2FNO A;  3HDC A;  3WGE A;  4FO5 A;  5INY A;  1ZMA A;  3PGT A;  1TTZ A;  4X4J A;  4IS0 A;  1YJ6 A;  4X43 A;  4GTU A;  5B6M A;  4K9Z A;  4E8E A;  1GSS A;  1HNA A;  3L9V A;  2H66 A;  2FLS A;  2ALB A;  3VI7 A;  4NHW A;  2VLU A;  3UJ1 A;  2MMN A;  3GNJ A;  2VL9 A;  1FOV A;  2WRT A;  2N5F A;  5G1L A;  1OC9 B;  2PUK C;  4X1U A;  3UAR A;  5ECS A;  4OO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...