1J0HA

Crystal structure of bacillus stearothermophilus neopullulanase
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
588
structure length
588
Chain Sequence
MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLYSGEEKLVYTEKGFYFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPSISPEGSRPWGSEDPTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGESSKYKDWFHIHEFPLQTEPRPNYDTFAFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRSLRRGEISFLHADDEMNYLIYKKTDGDETVLVIINRSDQKADIPIPLDARGTWLVNLLTGERFAAEAETLCTSLPPYGFVLYAIEHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords neopullulanase
publication title Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 194
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.2.1.135: Neopullulanase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j0hA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1j0hA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1j0hA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1j0hA03
4KZEL 1RJZB 2EPKX 3ALXA 1MXGA 1O7DC 2ZXBA 4PTWA 1YNTA 3OR6A 3SCNA 1H15B 3QDJA 2GT9A 4PJXA 5ESAB 3HNVH 4JKKA 4GKNB 1MWAA 4GFTB 4MMXC 4LSRL 3VCLA 1ZBKA 1M53A 4R97B 3TBVB 5KANI 4XB8A 4HEPG 4QXGH 1MRDL 2E9IA 1C5BH 2VDKH 2OK0H 2E7LA 4MNGB 3VG0H 4L8DB 5I1CL 4J8RB 3KLAA 1WB0A 4U1JA 4XBPA 2NR6D 4LPCA 3O2VL 5MEPA 4M1CC 1CG9A 4YWGL 3VWKD 2VH5L 5CILL 3GXTA 3D85D 4K7PX 5FHBL 3FQXB 4G9FB 4H20H 3OKDA 5HD8C 3ARDA 2FE0A 5DR5H 1P4BH 1CGYA 4LCYB 5DDHA 4CAGA 4GRWH 1Q9WB 1C91A 1T03L 3ZJ7A 1AJ7L 3LQZA 1HHKB 2NX5A 3U82B 5J9PA 3CAFA 3CLFH 4HJJL 4JZOA 5DJ2A 2BNQE 1A3QA 1XH1A 4YUEL 1OAUH 3UEZA 5HDQL 2ZG2A 4I18A 1QTYT 1UEMA 4PP2A 4KJPD 3AS2A 1DANU 2F1AA 4QTIL 3UP1A 4FFWD 2R2CA 1MCOL 1YQVL 4UUJB 3NYDA 3A4AA 3EHBC 4EDWL 5HGBA 1XGYH 4KC3B 3LKRA 5K9QI 2HT4D 1BZ7A 2VXSL 4YBLC 4JFDB 5CGTA 3VXMB 1G01A 1MFUA 4XHQA 2X09A 3CTTA 2AJXL 2WLZA 3KPNA 4OZOA 3KXFD 1FO0H 4FP8H 1A6UH 4X7EC 1NM9A 4P4KB 5D71H 3V5KB 2X4RB 1RJLA 5KSAA 2F15A 4LSVH 1ZWIB 1CPUA 3VDAA 2VQ1A 4KJWD 4UAOB 5IR1B 4L5FL 3CU7A 2Y23A 3WY4A 3HI5H 2CUHA 1GOIA 1LO4L 4HP5A 2QQLL 1R3JB 4KVNH 1FJ1A 3UBXI 5FA3B 1AQDB 2PB1A 4D1IA 2VYRE 1WNOA 2DAVA 4N8VA 5EOCL 3JTTA 4AMKL 1C5CL 5A3HA 4UFKA 3S6CA 3CSGA 1TJHH 1JUFA 1A6WH 3DC0A 4NOFA 4XZUB 3EYOA 4HIJB 3DHMA 5MEOA 4PGCB 3QQ3B 4GRLB 1FFOA 4MAYB 3KE0A 4H1LB 1AXTL 3PDOB 4JPIB 5EZOH 3RL1A 5IUSA 5IROC 4RWYL 5DMYA 4Q9QL 3IS0X 1SJHB 4P5MA 1WCBA 3L3HB 5FYJU 2DTSA 2HTLD 3UEQA 1J05B 1HDMB 4U3XA 4PJEF 1GZJA 2CKRA 1K8DB 4FQ2L 1MHHA 3MUGA 4OCRL 3DX0A 5C08D 2FL5A 1MOEA 2VX6A 4KMTL 2CIKB 4OZGF 4JFXA 3KL5A 1E40A 4KTEL 3VXTA 1U8LB 4GBXB 5DD0L 1PS3A 3BGAA 1QVOA 3D9AL 3LRSB 1Z2KA 5ABHA 4PGBB 2G41A 3X3GH 2A9ML 4PRBB 1K5NA 3W53A 1KV3A 4P59H 2NY1C 5BW7A 3PV7A 1X5HA 1YJDC 3REVB 5IB1B 2RCSH 1Q0XH 3V2AR 4LSPL 4MSWA 3MV9B 4XXCA 1G9EA 5HHPB 1NWUA 3EOTH 5DMGC 5GRUL 4JFTA 1P4IH 3PWLB 4XPTL 5HHMB 4L8SB 2UY7A 4HF5H 1S46A 3FB6A 4D6HA 1CVRA 2X0YA 1OF2B 4JJ5B 1W9DM 4RGOL 1F4XH 2MHAB 3S34L 5L8KB 4GT7A 1UM5H 5GRJH 3WMSA 1JGUH 1KTCA 3BZ4A 1LVEA 4AH2B 1JTPA 2MQ3A 5E4IA 4YX2L 4Y2DD 3RAJL 4UU9A 3SCSA 1I85C 1JWUB 4RISH 5DQ9B 5CSBA 2P8MB 4NUJB 3SCMA 5T3XH 1RH9A 2ICWA 2RGSA 5EU6D 4P8UA 3BVXA 1ZKAA 1OBAA 5JORA 3HG1E 1BQHB 3CXDH 3EFFA 5EOQL 2J7EA 1F13A 3A24A 4PBGA 3RDTC 2CKSA 1L7IH 2QV4A 4F3FA 4K9EL 2WV3A 5J0BA 1FNGA 2WNWA 4P23C 3ILPB 5DMIH 2O5ZH 2E3VA 4JANA 3QCVH 1ORQA 1E6OH 3MPCA 3QXAB 3O0RH 2LQRA 1KLGA 5D7LB 5GJSH 5EBMA 1JDDA 2AAAA 5BVJB 3QCUL 1IL1B 4FQXD 5FKAA 1KQYA 2LU4A 1KR0A 1M7XA 3S2CA 4X6EA 1XCWA 4OLVH 3MRIA 1KPRB 4QT5A 5J4MA 2P49B 3EAKA 1V6YA 3AVEA 4U0QB 4FLQA 3PZ9A 4G8FB 5BQ7B 1V7ML 3UTQB 4H26B 2H8PB 3J8F7 3MGTA 3CDFA 2D7NA 1MCQA 4KI5C 1VA9A 3V6ZB 1FNHA 4OZHA 4Z7UF 2QPSA 3SKUD 4QXUL 1U8MA 4Z95L 1DQQB 1P7QA 5CD5D 3N0PB 4M8QB 4N9GA 1Z9LA 5E2WL 2P46B 5TPWL 2IH1B 4KU1A 4Y4HC 5DTFA 2CKNA 2DLTA 3AMCA 3MLZH 5TF0A 4LEXL 3LS4H 5M3WA 3C9NA 1HH9B 3UYRL 1T3FB 1LEKA 3II1A 1X7QA 4FF5A 3DRQB 1V0NA 4HK0A 1J0HA 2PTTA 1YN6A 4AC1X 1R5IB 5E9DB 1T5XA 1KLUA 4OSUL 2XICA 1ZA6A 4BKLB 1NAKH 1CDCA 1EH9A 3D2UB 4FN0A 4M00A 1A6VH 3U0PA 4HG4K 5D70L 2J8UB 4WFEE 4WFGD 2OYPA 4UIKL 3QIWD 1A9EA 1PY4A 1OHQA 3HC4L 5FGSA 2OL3B 3U1SH 4JKLA 1V02E 2BERA 2W65A 4MLIA 4XVJH 5DURD 3QUKB 1TQVA 4MDIB 3V0VA 3QT2A 1CICD 1KNOB 1U8IA 4Z7QE 3FRUA 3EO9H 1DBJL 5C2BL 5D1ZB 1KN4H 3AMGA 3VXSA 3ARWA 2BXZA 4PLKC 3LX9A 3PZOA 2NY7H 4D6DA 1AY1L 1KYOK 5JPMB 2A38A 5DJXA 4QF1B 1R34A 4PLJC 3IVKA 2BCKA 5IF0B 4HWBA 7FABH 4PFEA 3TWCL 2X7LB 3UDWA 5GGVY 1JD9A 4NQCB 3W5MA 5DSCB 1UQYA 5EC1B 4XTRD 1W9XA 3X14A 3SDAA 1IM3A 4UDTA 1V0LA 2BX5A 4GMSL 4EBQL 3TTQA 5C0IB 1QFWH 4OOUA 1QSED 3PV6A 3PHAA 4V1DA 2CETA 1RUPL 3U7YH 5F97E 3NFNB 3PZUA 5DI8A 1QA9A 1RJYB 1OB0A 4PTVA 4ZAKD 5A6KA 5I2IB 1CK0H 5HVHB 3NDZA 2E40A 1QLEL 3W29A 5IHRA 1Y18B 3O45B 3PL6D 4OUOA 5KOMC 2C0HA 2Z31D 4O4YH 3QFJE 5BV7C 2WVSA 4LLWA 1MFNA 4X9BA 4NNYA 3IJHA 3V79C 3W38A 2V17L 1UCTA 4NWTL 4BZYA 4ZOBA 3P3YA 5GS1B 3GZAA 1OTSC 3SDCD 1RZGB 2XNAA 3E0GA 4IMKC 6FABL 1EO8H 4PJHB 1TVBA 3D0LB 1LF1A 4CCDA 4F2MB 3OGVA 4HAGA 1F97A 4ZFOL 2IAMA 1E28A 4WU7B 1VF8A 1IAIH 3LV3B 5DRWB 2DLFH 2BS9A 4Z8FH 1R3HA 1F4YL 1U58B 3OJDB 3SDDA 1I8MB 3KYMA 4W4OA 3IK2A 3VIPA 3OPZH 1QRKA 3VWKB 3NIYA 4LRNH 3NACH 2EXYC 3D85B 4LSQL 4PJDF 2MWCA 5I75C 4JRXB 4HPOH 4M7KH 4DFIA 3IRPX 3B9KA 2WC3A 5CSZA 2NNAB 3WFLA 2VN7A 2H32H 1ZHLB 4F66A 5DF0A 5CWSA 4TSCH 1XIWA 4GW4B 5IW1A 1W9BM 4ORGB 1BLNA 4D0BA 1U8PA 2W66A 4NGHL 1NBZB 5FYJD 4NQVA 5E94A 2L7JA 3WH7A 1FHGA 5GGSA 5KVEL 2EEBA 1Z9SA 1WDQA 2GK0A 2QQKL 3BYTA 1NKRA 4XNQB 2YXMA 3RY6A 1QBAA 5JW4N 1CZ1A 2D31A 2VLLB 3BZFB 4UQCA 4LCIL 3H9SA 4JHWH 4YH6A 1R3LB 3DSFH 3DURB 4BQ3A 3MKKA 4GKZB 4FABH 5A69A 1CBVH 4LPVA 3KXFB 1J1XH 1B2YA 3FAXA 4QHNA 3MRPA 1P4LA 4QRSA 3RRQA 4HX1A 3MLXH 1FN4A 4PRNA 2VDOH 3L9RA 5I19L 1JHTA 2EBNA 2E8YA 1KGCE 4OF7A 3U0TA 4XCFH 4MVBC 4YBQC 3QXTA 5IMOB 1CDYA 1KN2L 3PNWB 1V6WA 4QLLA 2E7LC 1E6RA 2W67A 5C9JA 3KYOA 3L5WA 1UD5A 4QTHA 1MJUH 1C1EH 5EO0B 1BF8A 3AIRA 4Z2KA 2GIYA 4YJZL 3GMOB 3D4YA 4OFDA 5DC9B 4BFIB 2FBJH 3ARDC 4CDHA 3T1FB 4KKBD 3BGMB 3C09B 3L3KB 4TVPE 3W81A 1KGUA 1H0IA 1PKQA 4HKBA 5F7EL 3PDGA 4PP1C 3UPRA 2YL8A 1EEZB 4JFDE 4CVWA 3VXME 5EBAA 1RU9H 5MP6L 1PIGA 5FKYA 1ES0A 1GAFL 2DJ4A 1N5YH 3MRCB 4BQ4A 4I18C 4XPBH 1GQJA 2R69L 5E9AA 1A1NB 4UV7L 2M1KA 4WENB 1INQB 1MH5B 4HS8H 1ZGLB 4Q6IA 4DAGL 1DCLA 5D9NA 1CLOH 5J6GA 1FO0A 4CD4A 3TT3H 1ORSB 4NHCL 3L4VA 4GAGH 1XCTA 2DBLL 3QNYB 3CUHA 1A6TB 2WUBH 1SZNA 2CBUA 3LIZH 5I73C 2V5CA 1JWMA 4JKMA 5GS2D 4CVZB 4HKZA 3WUGA 3MLUL 4RE3A 4OIFA 3JTSA 3O3EA 4JFYB 5TF1H 2ZG1A 1A21A 4WSKA 3U5UA 5I16A 4ZO8A 3BP6B 4Z7NE 1R5WB 35C8H 3NVQA 5GRVK 3T0AA 5JOEA 2X4PB 1DQML 4Y1AD 4OCMC 3RNQA 2OI9C 2ZX7A 4NOBA 1MCJA 1FVCB 5H2BA 3GYCA 4LFHD 3KLDA 3PZMA 3SGKA 4W7VA 4HHAA 5J11B 3MNZA 4KJYB 4OCLC 2AXGB 4MNQA 5TJWK 3WELA 3FOMB 3CFEA 1LLOA 2VVNA 1FDLH 4WUUA 2LV4A 4HOZA 1HXYB 3N85L 3IFOB 2XGBA 4PGEB 4ZD3H 5DLMH 4OZIB 4Y2DB 5ENWB 1A7PH 3G9AB 5L2KB 4FZ8L 4IPNB 1AR2A 3LN9A 4BZ1L 1JPFB 2ITCB 3CMGA 1U41A 1VFOA 2PYFA 1W2KT 3HLAA 3WL1A 3GSQB 2R1YA 1QOXA 5D5MF 4Q2ZB 3EYVB 4K94C 1Z3GH 3ZTJG 3LEXA 1R87A 5CD3B 3TNNA 2XZQH 2W59A 1XFPA 3DIFA 2BVPA 1UG6A 5BW7C 1OB1B 1PQZB 4KZDH 3P77A 2TAAA 2J8OA 1JPTL 1YEDB 2WUCL 1NLDH 3RPIB 4NCDA 4XP9H 1IFHH 1JYWA 3ZDZF 2R4SH 3IXAA 3OKNB 3K81A 4L3EA 3LD8C 4XXCC 1XZ0B 4CN6A 1MWAL 3Q6GH 2XXMB 1QP1A 1UH4A 5TH2A 5F70A 2C5DC 2HT3C 1IARB 1JNHB 2FEEI 3VRLF 2LE9A 3GI8H 2O9OA 4U1LA 4M4RA 4ONGL 1CFVL 5I18L 3QG7H 2P5ED 4FQJH 4H0HB 2H26B 5HPMA 1E1FA 5HHNB 2V2XA 1A6AB 5FHAL 4TRPH 3WLBB 5EZLA 1G9MC 1RUQH 4MD4B 2VZSA 4DVRH 2J75A 2APBA 3RU8L 2J4GA 2R0ZH 4XI5D 5KEZA 1KCLA 4ZTOL 1HXMA 4EI5A 4M6AA 3DX8A 4N1CA 3RWEB 2G8ZA 4K3GA 3SCMC 1VADB 5D7LE 1WBYB 4ZPTB 2NY1B 1OWWA 6CGTA 5KSAD 1PG7X 1KTDA 2MPAL 2A6JA 2A3AA 3HI6H 2EQDA 2DT3A 1EA9C 4HUXB 2WYSA 5DVNA 2VXTH 2Q8BH 3O9WD 2JIXD 5CHNB 3O2LA 4FFVC 2XVKA 4Z5RB 5M94B 3CDYA 4CD7A 5JPNA 3ULUD 2MSPA 3QIWB 3AISA 2QHRH 4XH2B 2DF3A 1RPKA 5DMJB 1BYBA 1JFXA 4H7VA 1M7IA 4PV9A 2DYPA 2PYEB 4YQXH 3V0WH 1GOWA 4H41A 2YPVH 4S1DC 1CT8A 1G7IA 4N5EC 4WFHE 4XBEL 5DURB 4GG6A 5SWSD 2KKQA 3H6JA 1WFOA 3EMCA 1OPGH 4PB0L 3BKML 1FZKA 3N9GL 4L3CB 4KRUA 3SE4A 3VRIB 4ZXBD 2PF6A 1LEIA 1MAMH 1NQBA 3MV7D 2Z8WC 3NCYS 1QLRB 3LAFA 1WV7T 3NCJH 3CZGA 1ISVA 5IVZA 3WNPA 4TNWF 1AQ0A 5EPMA 5E9DE 1L4IA 4PMNA 4P3DA 1JGEB 3FO1A 3RDTB 3WEOA 1A6ZA 3NH7H 3ULUL 4RGNE 1MNUL 2VR4A 4GXUM 2J8UE 1GVYA 1N8ZB 4OIIL 3QIBA 1K3ZA 1I9JL 4CJ0A 1W72H 5LGHL 1B2WH 1R47A 3OJ2C 1CE6A 4I48A 4JAWA 4ZFOB 2R9HC 5CP3H 5EORL 2EYRB 2VXUL 4OGAC 5GRXG 3VIMA 3RILA 2IBZY 4ZAKB 5GS0C 3PIQB 4JPWH 4ODSH 1TG7A 2ZKHH 3B9AA 3F58L 5CGYC 1J0IA 1J88A 1I8IB 1FC1A 2R1WA 1TJIH 3TPUA 3PL6B 3MSDA 4HWZA 3TPKA 3F5JA 3BW9B 4NO5A 4S1QH 4PG9A 5KSUA 1MW1A 3MR9B 5E8PB 5HGGS 1CU4L 4LNRA 3WKML 4I9WE 6TAAA 5EOTA 2RR3A 2BRQA 3GMLB 4DO5A 4NQCE 4ZS7L 5DJCB 3C87A 4O2FA 1UASA 1XF5A 1ZJAA 3BI9X 2F5BL 5L6YL 1E6NA 1E4LA 4C58B 1V6VA 2NMSA 1SYVB 1BGXH 2R1XA 3Q1SH 1ZLWH 5B3JF 5CJ8A 3LRLA 4QRUB 5KSBB 4M82A 4IOSD 4M93B 1H49A 3OLGA 5EO1B 5ACZB 4Y89A 4NRYB 3D39E 2R8SL 5F7HA 1PX4A 2D7TL 2YD8A 4I3RL 2YEZB 5CZXC 2AJYL 1NDMA 3H3PH 4PJIA 4QHUB 3UDWC 5J3HD 3MMWA 3GBML 2WLYA 3GKWL 5ESVA 1UWXH 3CC5A 1T21B 4XBGB 3SDAC 5I0ZA 2F61A 4Y4KA 4HFUH 3K4AA 1WZKA 4P9HC 1V0MA 5HHOD 2OTWB 4OT1H 1UWGH 3MRJA 3CDCA 2PBGA 2WK2A 1KENL 2IMNA 1JN6B 5AZEH 4YNYA 4F7CA 5K59E 3AJ7A 1E1EA 3G9VA 4NDMB 3MV01 2P8LA 4WDIB 3PP4L 1BBJA 4Y4FD 4U49A 3RIAF 3IDYC 1HK6A 4KK8C 3F6LA 5E8NA 4JFWA 4C54A 5E2TH 5EA0L 2ATPB 3G6JE 4L1DA 5J7CC 1T5WA 5HDBE 2WXDM 1HCVA 4XC3L 5J6HA 5IV2B 4HDIB 2D3LA 3TH3T 2GJPA 4JFSA 4JRXE 5IEKB 1YYLL 1P7QD 1LK2B 2IBBA 2M26A 3ULVH 2UY3A 2JJUA 4JHBA 4BF7A 1SFSA 2R2EA 4XCYB 1U8NB 4WWKD 5DD6B 3W39B 3MCLL 4Y19D 3VTRA 3WXWH 2OZ4H 3C08L 4UI2A 3ESVF 4U1NA 4M43L 3SDDC 1NFIA 1MHCB 3LQAH 3I6GB 4PJ7B 3AQUA 2MQ0A 1OQXA 4R2GC 2H32A 3L2MA 4XHJC 2H1PL 3PQYD 4ONFH 1X4YA 2NY6C 5EFIB 4HPYH 3B9KC 4LGPB 1IE5A 2P7TB 5A6BD 1CGUA 2AVGA 1FL6A 2YK1H 4M5YL 4PN2A 5C6TH 1AP2B 1XIWC 4JM4L 2ZWZA 2FHCA 1MFAL 3HCVA 3HAEB 3BKCH 4NM8L 5EBGA 2AJ3A 4DKEL 4TVSa 2BSRA 1V8HA 3BJ91 5BZDB 2IPTL 1ZLSL 5FKPA 4NKOB 2HA1A 4NF7A 4OF5A 4IRSD 1X5ZA 5C0FA 3TF7C 1PZ5A 1OP3K 3OF6D 4XWOD 5GS0L 2CK0H 5JLZA 4X4ME 3VFOA 2VLRA 1JNLL 1YY9C 2C3XA 3LSOA 4ODXB 3ZKNC 2WHKA 5M17A 3O2DL 4X5WA 1GZQA 4FQ1H 4P2QA 1A7OL 4J6RL 3L5XL 4LPUA 3IANA 3BH9B 4FNRA 2H2PD 5I75B 1TZHB 3CDGA 2J25A 2CPCA 3HNSH 1MIMH 4G7VL 3TCLB 4QRQA 4WO4C 3B2VH 4NHUA 3TV8A 4M4PA 1JV5B 1W0VA 2VCAA 1RHHA 4XP1H 1XYFA 1B0RB 3D51A 4D9LL 5I8CA 1FIGH 3LPFA 3V6OA 5DXWA 3EYSH 5D8ZA 3EZ8A 4WHDA 4MDPA 2F53A 2OTUA 3BPNC 3B6SB 5C09B 3WD4A 2K3TA 3BO8A 4DK3A 4RA3A 4AM0B 1I7RA 4OCSL 1L6ZA 1I8LA 2QTEA 2NXYC 3AAZA 3OR6B 2H2SC 1JGVL 3OAYH 1GCFA 1ZS2A 3O6ML 4HLZH 3VFMB 5D93C 3MRQB 3VD4A 4M6NH 2GT9B 4PJXB 5DVOA 1MWAB 1GIGH 4Q6IC 3OKOA 3O3AA 3ZT6A 2CKBH 3S88H 1BD2D 1JNDA 4LYPA 2B1HL 3CK0L 4LXFA 2J5LB 5ANMA 4F7MB 5HHVH 3SUTA 5K9JH 4YE4H 4UB0H 5MEPB 3MQIA 1MRFL 3IJYB 3GBDA 1JMZA 1EOKA 1Y6KR 2K7PA 3LS5L 4OLYH 3ARDB 4D3CH 5DDHB 1GC1H 1I8KA 3RPMA 4KK9D 2A6KA 3EJPA 1FH8A 2UVFA 3LQZB 5J9PB 4OZIE 2R56H 3RTQA 5L2KE 3MBXL 5FV2A 3OZOA 3UTSA 2W60A 5AWNH 4HPHA 4WHTA 1DFBH 3P40A 1A4KB 1FNAA 5CEZL 1QYGL 3SGKC 5T5FL 4PP2B 4MA3A 1LDPL 5HHXL 1CXLA 2XWBA 4ZUWA 2IQAB 2YA2A 2KPNA 2WWKO 3CC1A 1L9MA 4QLRA 5FA4B 4XPFL 3RHWF 5DJDA 3O6FD 3U9PL 4GXPA 3S3PA 1BZQK 1UXSA 2JJTA 1BZ7B 1X5LA 5IEHB 1R86A 4FK9A 3BP7A 3DDGA 2PC8A 2C3GA 4KY1L 4EEEA 5EB8A 3WQ8A 2VB5A 1F42A 2B7DT 4KKLD 4YDKH 1BP3B 5I71B 3N11A 1F6AA 1RJLB 4L4TA 5I1KH 5KSAB 1LL4A 1AR1C 1G9NL 1BAFH 4XAKD 1I1AD 4U31A 2VQ1B 1KTLB 5DO2D 1KXTA 1MJ7L 2G3NA 5M5DA 4I3GA 3HZYA 4BUHA 1RUMH 2WVVA 2JIXB 1FJ1B 3S4SA 4RRPG 3OG4B 3TVMA 1CD1B 2OI9B 3SE8H 3Q48A 4N8VB 4ODWA 5EU3B 3JTTB 3OX8A 3HNVL 1E4XH 4JM2D 5B39G 2CNCA 5JIPA 2X4QA 3LN4A 4G6JH 4Y5XA 3EYOB 2W07A 4OIAA 2ESVD 5MEOB 1JXJA 4DZ8A 2B4CH 4KK6D 1C5BL 4M48H 3KPSD 1JYNA 3VG0L 3RL1B 4XNMA 5L2JB 2ATKB 1ZT1A 2C4FU 4KQ3H 4P5MB 3G08B 4ZSOB 2EO1A 1R24B 3WFDL 1OAXL 4QXTA 5D72H 4PTXA 2AJSL 4W89A 1S7RB 3MUGB 4U2ZA 5C0EB 5DR5L 3UTTD 1P4BL 2VLJA 4PIRF 2D4FA 3L3OA 1JWSA 2GCYA 2FL5B 3EGSB 1SBSH 1VSCA 3GHEH 3OZ9H 4JGUA 1VESA 4JFXB 5FF6A 5GQBA 1G7LA 4EN3D 2DLGA 4MXQC 3BAJA 4PMDA 4WFGE 4Z7VB 4YHOH 4EI5C 1OAKL 2GKIA 5I30H 3KYKH 2Y6SC 5MEND 1OAUL 1K5NB 5GRVL 3HE6D 4GINA 4JFQB 1C8PA 3VFGH 1QFOA 3RVWD 2PYEE 4Z7QF 4BZ2L 1EERB 2ICEA 1NANI 4XVSL 4XPGH 3V4PL 2QV2A 4MSWB 3W28A 1XGYL 3MROB 2J7GA 4F8XA 1HILA 1G1CA 4JB9H 2YWYA 1NMCC 4I2XA 1X1NA 4JO3H 3VFRA 1FO0L 3THML 2OW6A 4LQ1A 1ZSDA 4FP8L 1A6UL 3X13B 2IWGA 1OARH 3D25A 3SO3C 3V5HB 1D5IH 2EDRA 4LSVL 3FT2A 1U91A 4LDLB 3RI5K 3SQBA 1YYMH 4PJFB 1S7VA 5I15L 3BZ4B 4GAJH 3FXYA 3HI5L 2GJJA 3W26A 1UA3A 2WC7A 3T2OA 3INUL 5T1MA 4UU9B 4KVNL 5CUSH 1DSFL 1DBAL 3SGDI 3F7YA 1CNVA 4OLZL 1A64A 3S5ZA 1O7AA 4LHJB 4WU5A 2ICWB 2EDHA 3GSRA 4B9YA 5JORB 1LMKA 1TJHL 3POCA 4XUYA 3EFFB 1FAKT 4NO0A 1W72A 2GVYA 5JZ7D 4F3FB 5CP3A 2BC4A 4ZO9A 1FNGB 3QIBC 4QOKD 4AEIH 1A7BA 4TTUA 3EYUH 1X4ZA 4IIQB 4JANB 4KI5E 3HAEG 1ORQB 1A4JA 4RX4A 1RUAH 1VFAA 4HBCH 2WIIB 4YLQT 1KLGB 3WFHA 3F7RA 1P53A 5EBMB 2J8FA 1MLCB 1H2JA 2XA8H 1BX2B 1AGCA 4F58H 2ZPKH 3TO4A 3CGTA 4HIXL 1FCCA 3BDYH 3DVFA 1NEZA 3MRIB 4QT5B 5KVDH 2XFFA 5KSBE 1E3ZA 1N2RA 3BVTA 4XP4H 1W3HA 3N18A 3X3GL 1XF2B 5BVPL 1FE8H 5EZIL 2R39A 3ZKMD 4TSAH 5HI4C 5JTWA 2UZXB 3OLDA 1Q0XL 3D6GA 2XFXB 4OZHB 5CBEA 1MJJB 2OLDA 3DXAA 4ETQA 3MV8E 4UQDA 2Y07H 1P7QB 2R4RL 1WWAX 4B41A 2N1KA 3HFML 1OAQL 5IT2H 1VACA 4ODBD 1HHHA 3EOTL 4WWKB 1H3XA 4X6CF 1P4IL 4I5BA 4HF5L 4Y19B 1DQDH 3GDBA 4NZUH 5IFJA 2DMCA 3C9NB 4OCXH 5A2CA 1I1WA 2AK4D 1F4XL 1YMHB 3EOBA 3S36X 4HK0B 3NUKA 3OG6B 5GIRA 3T0WA 1LG2A 1YN6B 4YHYB 1EDGA 1T5XB 3STZB 1KLUB 4C57C 1JGUL 1ZA6B 2J6EL 5M95B 3ARVA 1J7VR 5TDPB 2GJ6A 5HBFA 2NY3D 1UB5B 5T3XL 3BUPA 1ODUA 5IFTA 1NSNL 5E00A 4P5KA 3C6SA 3QA3B 4K7FA 2W65B 1NDGA 3GJEA 1GXEA 1L7IL 2XY1A 4YEFA 5FOBA 2ENSA 3V0VB 1XSKA 2JEQA 2M2DA 3U4AA 4G43B 1N5AB 1T66C 4OKDA 4IRSB 1ISYA 3SUVA 2HFTA 3VDBA 4X4ZA 5DMIL 2O5ZL 5DS8A 2HTKC 3MJ6A 3RZCC 4IRZH 3BISA 4PJ8D 4M9PA 5J56B 4RAUA 3IVKB 1UWXK 2BCKB 2VISB 2UVEA 5DFVC 1F6FB 3B9EA 1DDHB 1CDJA 2OZ4A 4CDGC 1KEGH 2VMFA 5E5MB 3MBED 1BAGA 3FO0L 4NSKA 3SDAB 2AGJL 1IM3B 4LK4A 3QUYA 2XJ7A 4HK3N 1H9VA 1DQLL 4JFEA 4EK7A 2CITA 4K3EH 4G6AD 2EIDA 1QA9B 3QHTC 2H9GB 5T33L 4H8UA 3MUJA 1KPUA 2ALWA 2XYLA 1MELA 3OL2A 5CP7A 3MRHA 2V3FA 4UNIA 3E6FA 2QBWA 1H3TA 3BXNA 4F37F 4HA4A 1CGWA 3MRRA 4LU5H 5CEYA 4LLWB 5L9DH 2YDRA 3LS4L 4MQ7A 2XKUA 4OF8A 3VMNA 5E70A 4JFZH 4JHAL 3SGJA 1R3KB 1NCBL 4MJIA 1FNEA 4ONHA 2JB6A 3BAYA 1TTUA 1TVBB 4OUEA 4Z7NF 5IQ7H 4IISA 2IAMB 1E28B 1ZHBB 1A7NL 3L3JA 1KBGL 3W11D 1A3RH 3KPRD 1NBYB 4Y5VB 2CLZA 4I0PA 4JFHE 1IAKA 4PV8B 1TQCB 2CGRH 1IILE 1DANT 1MSPA 4N8VG 5A2LH 3SDDB 4GLRI 3WN5A 3R8BB 3HJEA 3MANA 1F11A 4E8DA 4ZNEE 5FYKH 4R2GB 4H5SA 2YHGA 3WFCH 2HFGH 2A0LC 3TCXA 5C09E 1XCXA 1T04B 4Y4KD 5I17A 2VABB 2QMJA 4GPNA 4LCWD 1MVUA 3BPOC 4BH7B 5CSZB 1A5FH 2EE3A 5CWSB 3U5YA 2ZOXA 2Y5EA 1XIWB 3QDJE 3DVGA 3QEUA 4PJXE 4D0BB 1U8PB 7FABL 1WVZA 4NQVB 4YZFF 1RJCA 5E94B 3TESA 2XIDA 2JIEA 1G7JA 3ZR6A 5GGSB 4N90E 5F3BA 4TNVF 2P43B 2Y36H 3WE6A 3O11B 4P7OA 2D31B 4JVPA 3HMWH 1QFWL 3MRKA 1NUFA 4NQXA 4MNMA 3PWVB 1I8LC 1LK3H 3U7YL 4L4VD 2K1MA 4IRJC 3H9SB 3BRGC 2CKBA 1GRWA 5DZOA 1CK0L 3H0TA 1QQDA 3QUMH 1N64H 3D3VD 4ELMB 3FO2B 4QHNB 3MRPB 4QRSB 3C8KB 2GK2A 4ZNCD 4QRPA 2DM3A 4U7SA 5GGRY 2NW3A 5BO1H 3T0EA 1FN4B 3GO1H 4DUWA 4GI8A 4GQ9H 1BF2A 2NX5E 2BY3A 5A6AA 1VEPA 3U0TB 1OCQA 2WCAA 1OSPL 4DWSA 4E5XB 2D24A 5C9JB 3L5WB 4JL1A 1R7AA 1BQUA 1IZJA 3EJYD 3KWXA 4XZBA 1QWNA 4RA0C 3A6CH 4GRWB 1GHSA 4M6OL 3M1BB 1WWCA 4WTXA 4M1DH 2ICCA 3BLPX 1MQPA 1RV6X 1ONQA 3QUZD 1UWUA 4WHYG 1HOCA 3S96A 3QHOA 1PKQB 3BPNB 4HKBB 2DLFL 3UPRB 2EDWA 2ESVB 4EI6A 3EO0A 3DHJA 3OAYK 3VXUD 3RTQC 2AV1A 3IFNH 1GNXA 1A9BA 1FFPB 4LPYA 4IJ3C 3O6LH 3QEQA 2A6DA 4HFWA 1I1CA 1KJ3L 1Q94A 1OTUC 4M7KL 3UTTB 1AO7A 4Q6IB 4W93A 1FO0B 4PRDA 4NJAH 4F7PA 2B0SH 3VFNB 2JJTC 4G6KL 5FAAA 1XCTB 4TSCL 4AYFA 3L3IA 4D9QE 4OZFB 1ZVSA 4CD8A 1BFTA 4FQIH 1QI4A 3VNZA 5JR1H 2FLRT 3L95B 5MENB 4L8BA 4AISA 4HU8A 3HE6B 4AL8H 2X70A 1JYXA 2O61A 4P3WA 3O6AA 5GNZA 3IXTB 3JTSB 3OGOE 1EAJA 2G2RA 4NP4H 5HGDA 1B3WA 3FQRA 3PZGA 2OR7A 1BBDH 1CE1H 4JY5H 3BIKB 2D1ZA 2CJUL 5INDB 3TVMC 3RNQB 4JHWL 4ODHH 3DSFL 3TN0A 4BSWA 4FABL 1OT2A 2FJHA 3CVHL 5H2BB 1KIUA 3OSKA 4MHHG 3REWA 2ZOKA 4HHAB 3MLXL 3CZFB 4PJBA 4Y5XC 1NOFA 2VDOL 4MNQB 1HKFA 2J8UF 1E5NA 4UNUA 1E4KA 3A6BL 3W4RA 1YEFH 3C5ZA 3P30L 5H37G 4CJ1A 1HZHH 5I1DA 2IBZX 1MJUL 1C1EL 5EBWA 3VXOA 3FFCA 4PY8I 2VI0A 2X10A 1NC4D 2HYMA 4XP6H 4DZBA 5FCUH 3MRMB 2I27N 3IDIA 2OR9H 4Y5YC 3HLAB 2PYFB 1L7TH 4G5ZL 1E9LA 2PBOA 3CPLA 4NZTL 3M46A 4HGWA 3MOAH 2HISA 2DQCL 1EOMA 4KAQH 4IOIB 2NY2D 2PWDA 4M7LT 4B53A 4LARH 3TZVA 4JDZB 3DIFB 4GAFB 2BVPB 4NQSA 3ROOA 3BVWA 3RIFK 2DWDA 5DD3H 5BXFA 1PBGA 4C55A 3P77B 3GBNH 3NABL 5KVMC 4HS8L 4JCLA 2NYYD 4R90H 3IFPB 3AB0C 4MWFB 2UY2A 1CLOL 1CTNA 1TFHA 3AUVA 3IXAB 1MFDH 4PBWD 1OW0A 4L3EB 3MRBA 3BMWA 2WUBL 1ZOXA 5TH2B 1VHPA 3M8OH 4U6VH 4TVCA 4KTYA 1KTRL 3X3FL 4PMVA 2HLAB 1KCSH 3ZOAA 4ZDHA 4R26L 1H8OA 4L9LC 1UXWB 1UC6A 5HPMB 4KHXL 5IB3A 5A40E 4RZCA 2PN5A 2XQBH 3EJZC 5F89A 1GJUA 3GSVA 5C6PB 5D2LF 3BSHA 2PF0A 3PABB 2Q86B 5ID0A 1HSAB 4J28A 1E6SM 1HXMB 4LCUA 4EI5B 3DX8B 4ORZC 5K59F 3B2UD 5I0DA 1QO3A 3ALGA 4GAYA 1QD0A 1G7HA 3FQTA 1N59A 4KJQC 4KGJA 3MLYH 4L4TD 4P2RA 4N0RA 1JL8A 2PW1A 2AK4B 1JZ6A 1KTDB 5BYWA 4HIHB 3GGWA 1EGJH 5GZOC 4QNPF 3O41A 5JQ6L 1OGSA 3TTOA 4XNYL 3WN6A 3G6JF 5F21B 4ZD3L 2IADB 1N26A 1TIUA 3QEGL 4O9HH 5DLML 3SE9H 4F7TB 2DDQL 3WEZA 5KG9A 2VLMD 5JPNB 2NY3B 3MREB 4OZHE 1VFBA 1JHLH 1I1YA 1PEZA 5FDYA 3UBXA 5IHZA 1DE4A 1M7IB 1RZKH 2QJDA 2DYPB 3QHMA 1RMFH 3CMOH 4WW2F 1CT8B 1G7IB 3JWOH 3B9DA 4LF3B 1WPCA 4V2BA 3GNML 5I1AA 4BFGA 1Q38A 2FATH 2JCCB 2XZQL 1JHKH 1CZ8H 4MJ6B 4KUCD 4UQBA 2CUIA 4DCQA 2FH8A 1LEIB 4G80A 4NCC1 2D7OA 1KB9K 3FT4B 4AG4H 4PJ8B 4KZDL 1KJ2L 5IB4A 5EPMB 2YN3A 1NLDL 1NGYA 4J23A 4P3DB 1S9XA 3DHUA 1FH5H 4P3CL 3F8UB 3N04A 3Q6GL 3HR5A 3X17A 5I5RA 3QIBB 2DKMA 4WGWB 1Q8MA 3NCFB 5I1JH 3GI8L 3CSBA 1CE6B 4I48B 4WEUD 1MY5A 3SCWA 4FQJL 5D1QD 3VI3E 1KIQB 2IAND 2Z92A 3FFDA 3P9MA 3WF4A 1ZA3A 2KL6A 2WWMC 1NCDH 3WDIA 1CLXA 4PJ5D 1U3HC 5E2UL 3OLEA 1HINL 2R1WB 1UFUA 3ARBA 3OZPA 2XT1B 4UTAL 3MA9L 4F9LA 1U8KA 3VXSE 3C5JA 3ARRA 4HWZB 5E5RB 3ARFA 3RBGA 4NO5B 4HJ0C 3RVUD 4APQD 4YDLB 5KSUB 1FOBA 5JIHA 1OSZA 4OIBA 3BH8A 1IGJA 3QJFB 4LNRB 2V3DA 3D87B 4PREB 1Q6DA 3DX7A 4AD0A 5EOTB 5LQBH 3VGEA 3TIDA 1VENA 3T09A 1NMAL 1QPKA 1U36A 1JZ4A 2PW2A 1NLBH 2NCMA 3HI6L 1N6QL 4O2FB 1XF5B 1KTKE 3ARGA 2MJWA 3CFDA 3GRWL 2Q8BL 3BKJH 3LDBC 4P7RA 1F3DJ 2EDJA 4ZFGH 4NZFA 1BFOA 2R1XB 2WP3T 3CFJB 4V1DE 3P4MA 4MHHI 1BPLB 2XTJC 2ZG3A 4ZQKA 3RL2B 2DL2A 3UC0L 3ULVC 3BWAB 1S9VA 1ZANH 3AGVA 4H1LH 1QPPA 1E27A 4MLSA 3DMMD 3MTRA 2DQDH 2PKDA 5E99L 1NDMB 3I6LD 4PJIB 3MRFB 2PO6A 3HE7D 1OIMA 4QEGA 1NC2A 1W0WA 3LQAC 3CC5B 4GKLA 4Y4KB 5DHYA 4GW1B 3QUYC 4E41A 4DTGH 3KLLA 2VJXA 3EDFA 4PUBH 3NA9H 3RM9A 2DI8A 3MRJB 1MAML 1OGAA 4KKAC 2LVCA 1GVIA 3MZTA 3LHPH 2XY2A 4YNYB 5LWYL 1WBZA 2RB8A 2P8LB 3TO4D 4RQQA 5F9WC 4TSBL 3NH7L 3QNXA 3MRLB 1CECA 2OWWA 5CEZE 3CIQA 2CEQA 1HX0A 3T4YB 5E8EB 5E8NB 4J3UA 3VIFA 1VGKB 2HG5A 4ZXOA 2GEEA 2WVUA 1BFSA 1T5WB 2FSEB 4XWGL 2WB5A 3UJIH 3SGJC 1Q1JL 1XH3A 4NO2A 3UO1L 1J87A 3DJ9A 4JPWL 5D7KE 5I8OL 2ZKHL 1IQDA 4ENEC 1IM9D 4HSQA 1AFVH 5A8PA 5AD0A 4WRLA 3PE9A 1EXPA 4J3OC 4M7ZC 5BOPA 2FWOA 2QR0A 4XXDA 2XM1A 2R2EB 3HC0B 4I0PC 3LKQA 1CS6A 2XVGA 3DVNA 1BJ8A 3BFOA 1U8QB 1N7MH 1O6IA 1MY7A 4PTUA 5J06A 1NFIB 3WN5C 2V2TB 4PRPD 3G5YA 5DRZA 4Y7EA 2DSVA 2BJML 4QRTA 2H32B 3QUZB 2WBWB 4Q9BA 1YC8A 1BEYH 1KJMA 4NQDA 2X1PA 5FCZA 5AYUL 3Q1SL 2VCBA 2GJ6D 1PLGL 5CKGA 2AOSA 3H9SE 1Z32X 5A2BA 4OQTH 1UZ8A 5JBFA 1WGOA 2P4AB 3H8NA 4LPWA 3TV3H 4FMKA 2J7DA 2BSRB 2N4IA 1NL0H 3OKEB 5FKPB 1KWGA 4RE2A 1GONA 1CDUA 3RBSA 5ABFA 5GZNC 2DMBA 1HKMA 2R2BA 2YDQA 2VRAA 3QUMA 1GOHA 4G7YH 2C7UA 1UADC 4GRWE 5JLZB 2VLRB 1Z0MA 5EUKA 5C0AA 3CCHB 3GB7B 4MJ2A 4X5WB 4OLUL 2F54D 2ERJB 4UDUA 2NXZC 1GZQB 4C59B 2VURA 2V38A 3P0GB 4P2QB 4PPTA 3C8DA 2GAZA 4FFYL 1NMBL 1KXHA 3NGBC 5J57B 3EJSA 3NDYA 2BVOA 1PKQE 3T0EC 3LMYA 4P5TD 1NCAL 2W91A 3FN9A 1OCWH 3C6LD 3PGDB 4DWSC 1GGYA 4FA8A 4UQ3A 4U7KA 3NFPB 3QJHB 4DW2H 4F7EA 3WCYA 4L4PA 1GC1C 1W0VB 2Y06L 1RHHB 1HH6A 1MREH 3LPOA 1MEXL 3UXFA 3BUIA 1IGIL 4NFDA 5CLTA 1P6AB 3OKLA 3TJEL 3CV5A 4HCRH 3ULVL 1ZVYA 4PLNC 2F53B 2ED8A 1YUHA 2NTFA 2NZ9C 1XF3A 2VSCA 4X8JA 4YFLI 1J1PH 1QHZA 3BO8B 4NXKA 5F1KC 4OGYH 4OD2B 3WXWL 5I24A 3EMZA 1I7RB 4NKIH 4W86A 4AEHL 3LQAL 3AAZB 1Q72L 1NP2A 4NC0B 3ZQ9A 1F58L 3OR7A 1GOFA 4S10A 2EDKA 4U6HA 4G8EB 5F1IA 3O3AB 1G0XA 1KIRA 3QNZA 4JN1L 1CENA 2YD2A 3VH8A 5D8JH 2YK1L 2DB8A 5DHVB 1B0GA 2XQYK 1KT2B 2YC1A 2VXVL 3GXFA 5C6TL 4CBPA 3Q2CA 3HZ3A 5ANMB 3JWDH 5GGUB 3V52L 3LRKA 5FM4A 2X6MA 1KQZA 1A1OB 1FIEA 4K3JL 4MNQE 1XF1A 5JIKA 4JRYA 2Q76B 5GGTH 4TVUA 3SOBL 4PJAA 1JPSH 4WUUE 3T0VA 2WMIA 3DVIA 1K4CA 5B22A 1KJVB 1MF2L 3GJFK 3S36L 5AYQA 2AI0H 5GS3A 3RTQB 4JKPL 3UTSB 4M61A 1QLFA 2V5YA 3EOYG 3TN0C 2B4CC 1CCZA 4IJ3B 4FQ1L 3K74B 3FN3A 2DT1A 3V8CA 1JBJA 2GFTA 2ZNWA 2PXYA 4JQXA 4POZD 2XWBB 4Q7NA 5IGXH 4ACZA 3M6DA 2WZPD 1E4IA 1A7RL 1MIML 1MRDH 3LKNA 1E4KC 5D7IA 5JOPE 1JI2A 3N17A 2EH8L 3C5ZC 4KI5F 1FA2A 4ZS6D 4BS0A 4IBLT 1LILA 5F7UA 4LQFH 4K07A 3BP7B 1OTTC 1TDQA 2QADD 4XP1L 3O2VH 5CXPA 4YWGH 5JBDA 5CILH 3H7BA 5DJ0A 4AT6A 5DRNA 5LJYH 3RWIB 5IJVA 1XGRA 5FHBH 3CUFA 1G7MA 4LLDB 5IW6B 1I3RA 4L4TB 3EYSL 1QI5A 4UMGA 4FLSA 4NQEA 1US2A 1Z0NA 5FYLD 5KSBF 4L3EE 4FLRA 1KXTB 1T1XB 2APWA 3SJVD 1T03H 2EDLA 3O3DA 3S6TA 5IBUG 1JTOA 5AUMB 2L7UA 1KJ2B 3ZKSD 1FP9A 3UR7A 4B7IA 2FGWL 4G42A 4HJJH 1IEAA 4OM1H 4YC2C 3TZVC 2XVPA 1LP9A 1S7XB 4NO3A 1EGZA 1MCIA 2DQJL 2YPLD 3BPLB 3S4SB 4M6ML 1UG9A 4LVHC 4YUEH 2NT0A 4M6NL 4ODWB 3B83A 1M4KA 4EDXB 2X4QB 3GMMB 5IFAH 3NIFE 5HI5C 2YPKB 3KHOA 2XZAH 2DQIL 3LN4B 3QQ9C 4QTIH 5L88L 4YDJB 5ERWB 5T3XE 3KPOA 4Y5XB 1MCOH 2FYYB 1HJSA 5IVOA 2CKBL 1YQVH 3V6FA 4W4NA 2CBIA 4DZ8B 5ITBL 4CD5A 1RK1A 1OW0C 4H0GA 5HYFA 5GSRB 1VB9A 43CAB 4LYQA 4I3SL 3VO0A 3BN9D 4G3YH 3DUSA 1FLRH 4XNMB 4DO4A 3CBWA 1IGFH 1T0PB 5HHVL 2IXVA 4YE4L 1T4KA 2AJXH 4UB0L 4NN6B 5FYLL 3WFBL 2EC9T 4QXTB 2DIAA 4GMTL 1EEUA 4JKWA 2VIRA 5KAQG 2VLJB 3DGGB 2Q3ZA 4WSJA 2GCYB 1ZLVK 4L5FH 1HI6A 5JXEA 5FF6B 4AYSA 2WKLA 1KFAL 2R56L 4CNIB 3TA9A 4P2OA 2JB5L 4CADB 3ZSTA 4XNUL 3ZL4L 1EGJA 5BWFA 2Z93A 1J12A 1DFBL 3ZKQD 5A1AA 1H15A 1MCCA 5EOCH 3SUSA 4AMKH 2BFGA 1NJ9B 4GKNA 3PWJA 2UV3A 2XSAA 3PN8A 2VOTA 2F9BT 4GG6E 2IANB 1CLZL 1QBML 1WCQA 5DYOA 4QLJA 1K9EA 3AB0B 4LRIA 4PJ5B 3GH4A 2R0LL 1AXTH 1HILB 4LKCB 4MNGA 4L8DA 1EEQA 4TXEA 4X9GA 4Q9QH 3CPUA 4URIA 1UHVA 4I2XB 4B16A 4P9ML 1KCUL 3IDNA 4HMCA 2J7LA 3VFRB 3W9EA 1ZSDB 3MFGB 5MEQB 1I1RA 3FQXA 4G9FA 4LPXA 3D25B 4NM4L 2HVMA 1BAFL 1H3UA 1U91B 3N1GC 5F96L 4WI9A 4PMZA 5DD0H 3D9AH 4PS4L 4Z7OE 4UFLA 4C56A 5T1MB 2AJVH 3F7YB 2A9MH 3T2QA 3PHSA 3SE8L 2QL1A 3U46B 3KLHD 1H8NA 1KCRL 3UAJC 4WU5B 1E4XL 1XSJA 4XMLH 2HRPL 2GTZA 2P24B 1ZHNB 2BMKA 4G6JL 3P9WB 1UR2A 4NO0B 5FGBA 3GH5A 4PRID 1BECA 4UUJA 3HE7B 2B4CL 3TTSA 1XSIA 2BVYA 1J11A 1VEOA 4LEOA 5DFWH 4M48L 5EIVA 4MA8L 3EOAB 2BC4B 3N9KA 5GRUH 5EC2B 1ITBB 4KK8D 4OB5L 4ZXLA 4FS0A 4KQ3L 2WSKA 2OMBA 5D72L 5E0QA 5HYQA 1A4JB 3FQWB 2VLKA 2WZHA 4O2CB 5JQHC 2PR4L 4PSPA 3S34H 3EO1A 3FNDA 2ZUXA 3WL9A 1AGCB 3ARBC 3RVTC 3TO4B 4H04A 5CPTA 4PJEA 1JNNH 1NEZB 3CIVA 3UTOA 3KS0J 4NCC2 4YX2H 1N2RB 4YHOL 3RAJH 3WHXA 3ARFC 4G6ML 1AQDA 3OLIA 2HMID 3W0KA 2DD8H 1I4FA 2FX7L 4JDTL 5EU4B 4ACYA 4PJIE 1DLHB 1D2KA 1JMXA 4Z9KB 4ETQB 4PGCA 3QQ3A 4GRLA 3ARGC 2HN7A 4FQQA 1IM9B 2OP4H 2WMPA 4H1LA 4JPIA 3PDOA 4K9EH 3MJGX 5HYSB 4MS8D 1HHHB 4KMQA 1SJHA 1IZKA 4PJXF 4I5BB 1J05A 1HDMA 1WDSA 3OGRA 2NY4C 2AK1L 1OARL 5CKAA 3WIIH 5IFJB 4RWHA 4KROD 1T7WA 1QSVA 1D5IL 4HGMA 4PRPB 3GXNA 5DEFA 1QNRA 3EOBB 2O26U 3QCUH 2PO6C 1XV8A 2CIKA 3QHFL 5B3NA 2DQEL 4GBXA 2VAJA 3LRSA 1GGUA 4XVTL 3IETB 4PGBA 4TTDD 5CUSL 1UQSA 1YHTA 3WL0A 3AC0A 2GJ6B 5I66B 2VWEC 2VE6A 5E00B 4P5KB 3REVA 5IB1A 5FECB 12E8H 4YEEA 2OSYA 1NDGB 2W9LA 4QXUH 2CSPA 4Z95H 5H8DA 3P73A 1C90A 1SVCP 4HKJB 4MAVA 3RVVD 2C1PB 2WINB 3ARED 3QR2A 3MV9A 3PWPD 5DUPH 4OF6A 5HHPA 1QFPA 5TPWH 4NQTA 3DV6B 3PWLA 5DS8B 1LD9B 2VR5A 4L8SA 2R29H 4LEXH 3RDKA 4NKMA 1RUAL 4JJ5A 1FAIH 4YHNA 3UYRH 1RFDL 4FQPA 4HXAL 4R4ND 4LVEA 4RAUB 5MHSE 3HB3C 5I76B 2F54B 4HKXB 4AY1A 5DHXB 3U9UB 1FRGH 1H09A 3AS0A 2XA8L 3ALPA 2WBJA 3MLSH 4OSUH 3TYGH 4R96B 1C08A 4NSKB 2ENYA 5HOSA 5D9PA 4DUVA 3QUYB 4BM7A 3C6LB 5DQ9A 5KS9A 1QFWI 3WO3B 3QDGD 4JFEB 2CESA 2CBJA 2P8MA 4UTFA 2HT2D 2EDOA 4UIKH 4W6WB 3VXRD 3E6HA 3LPWA 1BQHA 5EU7C 3T08A 4MQXC 3AHZA 1KPUB 3TA3D 4MQTB 5FUOL 4P8VA 2LU7A 3EDDA 4OQTA 4IOFC 5CP7B 3MRHB 5F9WB 3BEWB 1DBJH 4MYWB 3ILPA 3BXNB 4P46D 2VLRE 3UESA 7TAAA 3PZNA 1CD8A 3QXDA 5CEYB 4ZOEA 2YLAA 1A47A 1ACZA 3FONA 3NIDE 1AY1H 4NZUL 1KBBA 4OCXL 4YFEA 2YSSB 4P2QE 5BVJA 4MJIB 1FNEB 4ONHB 2XG5A 2JB6B 3GSXB 3W0WD 1AC0A 4OFYD 1OM3L 1OM0A 1KPRA 2VRJA 5F1NB 3VFVB 3UTQA 4I0PB 3OJMB 1IAKB 1ROWA 1HYRC 3S4SG 1QWUA 5DJZB 3JWNC 2Z0BA 5GGRA 3IDMA 3WN5B 2IH3A 1F11B 1IAOA 4MA7L 3V6OE 4H5SB 3MV11 2NZIA 4UQ2A 2F53E 4M8QA 3AXLB 3GMQA 3Q6FB 4C83A 5I17B 4ZO6A 4E41D 2IH1A 1E72M 3WDPP 3PTKA 3RNKB 4PMUA 2EO7A 2CRYA 1KLFA 3QWRA 4M81A 2O9PA 4HCRA 4YGVA 2Q8AH 2EXOA 4NWTH 1T3FA 1Y6NR 5A2FA 3DVGB 3QEUB 3DRQA 1ISXA 2XIBA 3R0MA 6FABH 2A74B 4CVXB 1R5IA 1G7JB 1TQSA 4BKLA 2J7FA 4M8UA 2YJQA 3TBYB 3F5LA 4OLEA 4DGVL 3WE6B 4X6FA 2GW5A 1J18A 2AJZA 3AU1A 3MZGB 2MANA 5ANME 1F4YH 1ZV5A 5CIPB 3SBWA 1HJVA 2GSGA 4K3EL 5FO7A 4BK4A 1VERA 2CRZA 2QADB 2CKBB 2XG9A 5IKCB 1INDH 2VZOA 4J27A 3WF2A 1M01A 4MA1C 5KJRH 1J10A 4FQHB 4QRPB 3I50H 3ZKXC 1KNOA 4M29A 3T0EB 4CMMB 1IVLA 2JELH 1CD9B 3ETBF 3SJVB 1DJSA 2W61A 2EIEA 1NUGA 3UTSE 2E5EA 1RSFA 1WAAA 5L9DL 4DO6A 5FEBA 5GGTA 1U3YA 4QF1A 2DM7A 3NZ8A 1UACH 1QRNA 2J77A 5IK3B 1ONQB 5GXBB 2G3MA 1SJXA 1FSKB 5F7WC 5IQ7L 1HOCB 2FO4A 3S96B 2QQKH 3VFPB 1A3RL 1FL5B 2HJFA 4O51A 4EI6B 5IW3A 4U33A 3EO0B 4PRWA 4GI9A 2ICWJ 1I7TB 2AV1B 3NFNA 5A2JH 4M56A 1E73M 4LCIH 3SDXB 1CFNB 4X4XB 5I2IA 1KELH 5FYKL 2FEDC 4L4TE 3WFCL 3BDXA 1AHWC 2PXYC 4JQXC 2VDPL 1HHJA 2A6DB 2P47B 1S9YB 4HFWB 1GJIA 1Q94B 3DRTA 5J13C 1AO7B 1TITA 2QQNL 5DK0B 1TE1A 5F6IC 4Z2JA 5BS0D 4PRDB 5FYJH 4F7PB 3GXMA 1KN2H 3D3AA 3S5YA 1A5FL 1G0DA 4XX6A 5C0AD 5I1GL 1RQ5A 2VUYA 3FZUD 3PZVA 1KCVL 2GSIA 2VDML 3LN5B 1C93A 1MFBH 1ZVSB 1RZGA 2BDNH 4UBDC 1BREA 4L8BB 5JXAH 4PJHA 3I3EA 2X70B 1N6UA 4WU7A 4QYOA 2YA1A 1EFXD 4XVUC 4OV5B 2G2RB 5F7EH 4J3VA 2D23A 2Y36L 1NEZG 3RJDA 4LBEB 4OLXL 1WSST 3HMWL 4NN5B 4LNVA 4UT6L 4AZ8A 3BVVA 1QNQA 1PKOA 1YPZA 2ZX8A 1GAFH 2VAAB 4GLRH 3TN0B 4BSWB 3VWKA 2ZP0T 1N64L 2R69H 3D85A 3ILQD 2VLJE 4HUVA 3REWB 2ZOKB 3LPPA 3ET9F 2F7PA 4DAGH 4UNVA 2Y24A 4OBRA 3V7AE 4NHCH 4GG8B 2NNAA 3MO4A 1HF6A 4YDIL 1GGCL 2X89D 3C5ZB 5I1DB 2OJEA 4ORGA 3VXOB 2XIIA 1E0WA 3QQNA 3VI3F 2C8NA 1IT0A 4DZBB 4AIOA 5I9QB 3IDIB 3N15A 3CPLB 4EQ2A 4Z76B 1ZJBA 4XNQA 2BHZA 5JXEC 3WHE1 4PRIB 3WH8A 3FL7A 1WZAA 2PWGA 3CZNA 4ATWA 5E8DL 1DQMH 4P2OC 4I2XE 3BZFA 1OP5K 1AQKH 4OJFL 3TZVB 3ZHLA 1R3LA 1DTUA 5BRZA 3KXFA 3O6LL 3B5HA 5BXFB 3QGVA 2VZTA 2J4WL 4M7JL 4R97C 5HI4D 4K71C 4L3AA 3GHBL 2HRLA 5C71A 4NJAL 3SKMA 5LXGH 1QACA 5GS2H 5ILTL 3N85H 2BOBA 3NSMA 2YL9A 3MRBB 1G9HA 5AG8A 2XTLA 2F1BA 1RZKC 3AXIA 2GK1A 1RUKL 2YBUA 5DK3A 2C7FA 3JWOC 4ZDHB 3L3KA 3UTPD 1T0MA 5IB3B 2FBOJ 4NP4L 4Y88A 3WH9A 3MUAA 5F89B 3GSVB 3TBTB 1K2DB 1EEZA 1WIPA 5T1LD 1BBDL 4A2MA 1JPGA 5ID0B 4M7LH 3JZ7A 4LCUB 3QUXD 2EEAA 5E03A 1HYSD 3MRCA 5IQ9B 1KFWA 1NARA 2D73A 5I77A 1N59B 3FQTB 3T04D 1D6VL 1Q9KB 1D5ZA 1JPTH 4P2RB 1QI0A 3VU2A 5FGBC 3MXWL 1ZGLA 5C08A 1B90A 4ELKA 2C26A 1X5YA 1G6RL 3O41B 3TBWB 4DM2A 2VDRL 2VDQL 1FZJB 1VEMA 3QNYA 5E1AB 2YLLA 3OGSA 4MXVE 2NT1A 2XVLA 5D6DA 3SUUA 1XT5A 4OKVB 2EZ0D 5KG9B 4KPHH 5C3TA 3FMGL 2WSPA 4XP6L 3WDQA 1CFVH 2HH0L 3BAEH 1VFBB 5I18H 3QQ4A 3DXAE 3WD2A 3H9HA 1L7TL 2EH7H 3UBXB 2I5YL 4JFYA 1DE4B 1XMWA 5IHZB 3BH4A 5FHAH 2EKJA 3MOAL 3C2AH 4M24A 1F4WL 2Q8XA 3RU8H 5IB2B 1ITCA 1URLA 3AREB 4Z78B 3K2UL 3PWPB 3O4LD 5TE4H 5TQ2H 4ZTOH 1UWTA 5HYJD 5CLWA 2Z91A 1Q0YL 5D5MA 2VQTA 4DCQB 2YMXL 3CSYB 2GHWB 4G80B 4W87A 2BNUB 4ZFZA 1AMYA 1YECH 5DD3L 1CGTA 3DGCR 2ZCLH 4KJYA 1XGUA 3GBNL 5JOFB 4R90L 4GRLC 1JRHH 2OSWA 1NGYB 4MAYC 1WK0A 4PG2A 3VDHA 2QEJA 1S9XB 1J8HD 3L4UA 4XGZB 3DETD 4MMZC 2GJ6E 3HR5B 4Y2DA 4U6VL 2RAMA 2DJUA 1DUYB 5C0BD 2W0LA 4GZIA 3B8SA 5C07D 2F74A 4JFVA 4M5ZH 3OG2A 5IG7A 4NFCA 5EU6A 1CFBA 4P8XA 4TUKH 3GSQA 2Z92B 2PWFA 4XBEH 1ZA3B 2XQBL 1PDKA 4ALAL 4GBXC 4HLZG 4UNTA 4PB0H 3BKMH 3N9GH 4GRWF 3U2SA 3C5JB 2XTJE 4XB7A 4AZ6A 4XCEA 3N12A 1B3VA 3ULVE 3TIEA 3G6DL 3U4BL 2XACC 4ACPA 1V03A 2FGLA 2OJZL 3BH8B 3DUUB 1PQZA 3RX7A 4BELD 3WQWA 3MLYL 3TIDB 1S9WA 1YEDA 3RPIA 4WNQB 2PW2B 1PX8A 2FHBA 2VR9A 3NIGE 2YD9A 4FQXA 4RMSA 2X40A 1KOAA 3ARGB 3ZLQC 3CFDB 1UJ3B 1E15A 2RJMA 3NPZB 3ULUH 1C8XA 1MNUH 4O58H 4NBZB 4C56D 4JFEE 5AAMA 1BFOB 2QSQA 1I9JH 1LQ0A 3JV4A 4L8SC 2YUWA 5LGHH 1UA6L 3SIMA 2Z1KA 3UZEA 1UR1A 2XFYA 5ECUA 1E27B 3I6KA 4N0YH 1OGBA 3NOIA 2UUDH 3STLB 5KVGL 3FB5A 1A6AA 3CMOL 3WLBA 3PHOA 2WBJC 4MD4A 4U7MA 1NC2B 2ZX6A 1W0WB 1AE6L 2GUOA 4R3SB 3FO9B 5DHYB 4K7PH 1DWJM 4E41B 1DWHM 1JHKL 1XGQA 4KFZC 1VADA 5KOVC 1OGAB 4ZPTA 2V3EA 3WKMH 4UOZA 4MJIE 3MJ9H 5J1AB 4O00A 5DVKA 3MJ7A 4IRJD 2EXWD 4ZS7H 3RPKA 5CGMA 1A7QH 5I1HL 5IHUL 4IMLB 4QO1A 4R7DA 5ECJE 4HUXA 5L6YH 1T1ZB 5A95A 3QIUD 1E5JA 5CHNA 3KR3H 4G8GA 3UG5A 1K3IA 3DV4B 5GSVB 2ZUUA 2B31A 3QIWA 4CVUA 3UZVB 2R8SH 2RGLA 1O7SA 3RM8A 2G4FA 2D7TH 3EJTA 1XH3B 1RZJL 4I3RH 4NO2B 3SDYL 4QKXB 3F5KA 2R0KL 5CG0A 4O02H 2AJYH 1YMMD 3GBMH 1NCDL 1IQDB 1MI5D 1BG4A 1YDPA 5AD0B 4YPJA 3ZO9A 1CICA 1YNLH 3AS1A 2D0HA 2FWOB 1GPFA 3VRIA 5LG1A 3LKQB 3DVNB 2VL4A 1CLYL 1OT1A 1K9DA 4Q22A 2G5BA 1JZ7A 1KENH 5DRZB 1U8JA 4LOUC 1NLBL 1HHIA 4QRTB 1YEIH 1JGEA 2LAAA 3VMOA 3QDMD 4FTVD 3PP4H 1ISZA 4GH7B 3ECQA 4NQDB 1E6JH 1EX0A 4N8CL 4DN3L 4K8RD 4KI1A 3BD4A 3I75A 4TNWK 4P2CG 2HKHL 5EA0H 1TJGL 1QSEA 3QWOB 1ZANL 4ZFOA 5JNYA 4DVBA 4PR5A 1AGFA 5F8RC 5JW5B 4WVRA 4XC3H 5C8BB 4WKAA 1J8KA 1EAPA 4QRPE 4HV8A 3T0EE 1EEYB 4YPGB 1H5VA 2FDBP 4UOW1 3U7BA 3PL6A 2R2BB 2BNJA 4WI7A 2Z31A 5BS0B 3MCLH 2FB4L 3VPLA 4PUBL 3MR9A 4YHZL 3IF1B 3QFDB 1HQ4A 3SBWC 4AXNA 3MLRL 3C08H 1RZFL 5EUKB 5C0AB 3BE1L 4N0FA 2Y1VA 1H5BA 1NGPL 3LHPL 3SDCA 3NIFF 3N13A 4UDUB 4K8RL 5CPSA 2H1PH 3HMXL 3RJQB 2P48B 3JWDC 4DFHA 1JXKA 2WMKA 1GYAA 2WHMA 3ZE1E 1SYVA 2WIMA 5HSFA 4OF0A 4QRUA 2ZCHL 4QY8A 4WUKL 2IFFL 2HLFC 3V6BR 5ACZA 4UR9A 3VRJB 1DN2A 1MFAH 4NM8H 3RKDC 4J3SA 4DKEH 1NGQH 2YEZA 3QEQE 3RWDA 2UWEF 4OGXH 2IPTH 3JXAA 1ZLSH 1A02N 4GO6B 2FJGA 1AO7E 2GFBA 3OKLB 2X4UA 2ESCA 4X8JB 2NTFB 1XF3B 2QQQA 3B5TA 3GJFB 1VGEH 1IGCL 4RFOL 2PTVA 1N7ML 5AEAA 3UJTL 3O2DH 2NY0D 1JN6A 4JO1L 3CJJA 5K9QG 4ZUTA 5HVHC 4ATDA 4GG6F 3OR7B 1A7OH 4WKHA 1NFDA 4J6RH 4MA1B 4AZCA 3L5XH 2FO1A 5F1IB 4ONOA 4IUGA 1KIRB 4HBQA 2XWJA 3EBAA 3SPVA 3VH8B 2SEBA 2YC1B 4D9RE 3V4UH 4OQTL 3RVXD 3S35X 3TV3L 4NC1C 3P4NA 5IV2A 4HC1L 3RIAK 4HDIA 4D9LH 4UZUA 2XKNA 4PJBE 3UBXG 1LK2A 1CDGA 3F4VA 4PJAB 4Z7OF 4UQAA 4XCYA 2WMIB 1K4CB 1U8NA 4YK4B 5DD6A 3W39A 4NI3A 5F7DB 4YHKH 4HU0A 4OCSH 4WFFE 5D4QA 4D2NA 1C3FA 3FFCE 3U7AA 5D96C 2NR6C 1QLFB 2RFXA 4PJ7A 4R7NB 3VWKC 4HPGA 1G6RB 2Z9TA 5I8KH 3GNPA 3GKZA 1ED3B 4ODUB 3ZDXF 2VDNL 1SMDA 5EFIA 2AP2A 5ISZD 4ACZB 1OCWL 3CFCL 5AY7A 2P7TA 3LKNB 4RNRB 1KPVA 1EHLH 2B1HH 4TUJA 3CK0H 4KK5D 1P2CB 4X9YA 1AP2A 3VI4E 1CD0A 2XUCA 3AIEA 4NXSA 2FIKB 3G5XB 5E6ZA 3QUXB 4LKXB 3ZDYF 4EIGB 1MRFH 4AT6B 5IJVB 1XGRB 3CLEL 4JZNB 4KJPC 1G7MB 3M7SA 3LS5H 3LRMA 3RP1A 4LGRB 1I3RB 4HCRL 4LHUD 4FFWC 1CDHA 5I8EA 2O92A 3NMEA 2GQHA 1J1PL 3AYSA 3PHQA 3L7EA 3K1KC 3O3DB 2WZIA 4OGYL 3WKZA 1A2YA 2HT4C 4NKIL 4G42B 3MBXH 1IEAB 2MNUA 3LY6A 4ODXA 3V95A 4PJIF 1UB6B 5TFSL 5KAQF 3GM0A 1RHFA 1QYGH 1E4XI 1LDPH 2XWDA 4Z6AT 1CEOA 4NRXB 4KJWC 1TQBB 4N42A 3KPOB 2X2IA 4KV5E 3V6FB 2CDEB 1EJOL 1B4RA 3O4LB 1NUNB 3DUSB 1JV5A 2DQUH 3JWDL 4FZEL 4KY1H 4Y1AA 3S5LA 3VA2C 1T4KB 1B0RA 4ERSH 5HYJB 3ARSA 3HPJB 1FZMB 4MX7A 4P2RE 3AROA 1VKXA 2GTWA 4F79A 4XNZB 5GGQL 4NRRA 2F8OA 3GM8A 1G9NH 3F5WB 5GGTL 1JPSL 3B6SA 1V3JA 3DBXA 4UTBL 1QX1A 4YXKL 1ADQL 1MJ7H 2W0FA 4N5UA 1U3HD 1UKQA 2D3NA 3A5VA 1GGBL 4AM0A 2AI0L 4UILL 1TENA 3B3IA 4P2OB 3RWFB 2V3GA 2Z93B 2HTLC 3VFMA 1CF8L 3MRQA 1IC1A 3R1GH 1GUVA 3PWJB 2X1IA 4EAMA 1EBPA 2MKLC 2ED7A 2BNRD 4FHBD 4K71B 5IGXL 5DYOB 4QFUA 1FYTD 1WICA 4GO8A 1P7HL 4LQFL 4F7MA 3FCTA 5D6DC 4U5IA 4LDEB 3WFDH 3UERA 1OAXH 5E5UB 1BWWA 3IDNB 3W9EB 3IJYA 2AJSH 3EYFA 4C7FA 1JDCA 3SKOA 4P4RB 2FLBT 4RAVA 2Z8VC 1HKJA 2NSXA 3D52A 1KB3A 2VT0A 3GIZH 5BRQA 1WEJL 1LWRA 4O5LL 5FK9A 1GOKA 2DKUA 2XN9D 4OM1L 2V5SA 4C56B 1CL7L 1OAKH 3QI9D 5LYRA 3T77A 4EUPB 1A4KA 4K9EC 5B4MD 4J4PA 2Y8VA 5J11C 3HUJF 2FD6H 4OD3L 2XGIA 2P5EA 2GTZB 5IFAL 4HUKB 2IQAA 3ME0A 2XZAL 2BMKB 4B50A 4BZ2H 2YZ1A 4XVSH 4PG2C 5FA4A 3V4PH 4OTXH 4LX4A 4HLJA 1MCNA 4LEOB 1KTBA 5LA2A 4G3YL 4Y2DC 1FLRL 3NIDF 5IEHA 3ECBA 1JZ5A 1IGFL 1QBLL 5DEGB 3VDCA 2YBTA 5TE6L 1BMGA 5BRZD 3THMH 1T6WA 5HYQB 1H0DA 1R46A 2VLKB 2WVTA 2BSED 4MDOA 4FFZH 5JW4M 3EO1B 4OZFH 1RULH 1KTLA 1QOKA 1YEJH 3WL9B 5I15H 3LKPA 5HYIA 1S3KL 4PJEB 2QSCH 3A3HA 3CH1A 3WNKA 1T7XA 3INUH 3O9WA 3WHXB 5ALBH 2JIXA 3ZT5A 1DSFH 1DBAH 4CGTA 1CD1A 4OLZH 4OZGB 1I4FB 1OL0A 4QHKJ 1QNZL 5DK2A 5EU3A 1BSIA 4Q0XL 3E8UL 1ZLUK 5HI3D 1Z9OA 4OQ1A 4NBXB 4M02A 1T80A 3WNLA 5I1EH 3AHYA 3G04A 5F72S 2DICA 2X4OA 3K4DA 4FQXC 2GDUA 2HN7B 4FQQB 1MI5B 5SWSA 2HFFA 4E41E 5IIEA 4PYSA 5L2JA 5MI0B 2ATKA 5FUZL 1QSFD 1OGAE 1SMOA 2VWEE 4ZSOA 3G08A 2WKGA 4ZXBA 1R24A 4NFBA 3WF1A 3BT2L 3MV7A 1FLTX 2XN0A 1S7RA 5C0EA 4HQQL 3RKPA 1LE9A 5DEFB 3EGSA 4AZBA 2FX9L 5CD5C 2DEPA 4ZMAT 1W8OA 4HIXH 3QDMB 4UCFA 5E8OB 3MRGB 3MJ9A 3OA5A 4Z7VA 2AJVL 3VFSB 1UQSB 3BPCB 5BVPH 5EZIH 4UQ9A 5DFTA 3QULA 4JFQA 2VE6B 4XMLL 1TXKA 3P73B 3GSWA 4XRCB 4Y2OA 2R4RH 3MROA 2GITA 3W6LA 3HFMH 3MFFA 5FYKE 3VH8G 1OAQH 1SEQL 3SGEH 2PWEA 1G7PA 4ZEPA 2G60L 4X0NA 2UUDK 4NKMB 9CGTA 3TJHD 3QIWC 3V5DB 4OFKA 1H3PH 3X13A 3KLKA 2WPGA 5GISL 4YHNB 3V5HA 5EU7E 3N06B 5IVNA 2HAZA 4NQDE 1JJUA 1II4E 4PJFA 3TT1H 3L2LA 2WBJB 1CICC 3MLWL 4AIUA 2J6EH 1JNNL 1C08B 1F3JB 1T6VN 5FM5O 5CJXA 5KS9B 1NBVL 2DD8L 1BJ1H 1NSNH 5LBSL 3E6HB 1VPOH 3E3QE 5B38B 1FVEA 4ZFFA 4Z2IA 1DLFL 3U7VA 4JR9L 3VA6A 2OP4L 4XTRC 1HJQA 4E8CA 2ZX5A 5BS0E 2FYVA 2BRRH 3QHZL 1HWGB 5JIWA 1H8SA 5DT5A 4JFFD 2DSKA 4IIQA 1JFQL 5C0AE 5HHOA 3QXDB 3W2DL 1NBQA 3FONB 1R3IH 1BVKA 4LAQH 4AEFA 5DO8A 3I2CH 3WIIL 1N4XL 2WIIA 4ZAKC 2NY0B 1MLCA 3IJ9A 1L8NA 4X6CA 1BX2A 2QMKA 2C1OB 5SWZD 4AZHA 3FO0H 3PL6C 4Y4FA 3DPBA 2YBRA 2AGJH 4D72A 2AEPL 2Z31C 1XF2A 1DQLH 1S8DA 2D03H 3HI1B 2DSZA 5DGQA 1TUXA 2EDBA 3SCRA 1I9RH 5HDLA 5GGRB 2ZOLB 3IDMB 1F2XK 5TE7L 3SDCC 5DT7A 2XFXA 1KC5L 2IH3B 4OCNC 5T33H 1MJJA 12E8L 1IAOB 2EYSA 4Z2HA 4UQ2B 1X9QA 3QPQD 3GMQB 5K9OB 5DUPL 4C83B 3RCNA 3DSNA 5EUOF 2JF7A 3VIIA 4WWKA 3SKNA 4M93C 3POHA 2R29L 4HJGB 4Y19A 4KRPB 4YGVB 3F65A 1FAIL 3VFTA 1T2JA 3UG4A 4JHAH 3SHSA 4HWEL 1YMHA 2DBJA 1NCBH 1YY8A 1FRGL 3H54A 3MUZ1 3STZA 3MLSL 1FNSL 3IAPA 2BVTA 3TYGL 1MHPL 3PQYA 3O2DA 1A7NH 5ID1A 1KBGH 1UUQA 3BLBA 2RGMA 4IS6B 1ACYL 4X6FB 3MMUA 1J01A 4G8GD 5A6BA 2AJZB 1L9NA 3AU1B 3MUHL 5TDPA 1Y7VA 8CGTA 4MB1A 3ZJ6A 3QAZB 1UB5A 2GSGB 5TDNA 1WAWA 5FO7B 5J8OA 1F4AA 3QA3A 5D7JD 5SV4A 5A2KH 1J0JA 3VG9B 5F7LB 1UZ1A 4JRYE 2AS5M 3PWUA 4PJAE 5ESQA 1DN0A 1TFVA 4G43A 1N5AA 4IRSA 3WSQL 1AIFA 2D9CA 3HKFA 3IDXL 2AABL 3OF6A 1PG7H 4JE4B 4LVNC 4H2CA 2W62A 3IDGA 4V27A 3GSUA 1FH9A 4O2EA 1CDIA 1S5IH 5D8WA 2VISA 4W68A 3MU7A 2F8QA 3NZ8B 3MUY1 1QRNB 1DDHA 3KJ6L 1LHZA 5E5MA 5D7IE 4MNKA 2FO4B 3HMCA 3FAWA 2HJFB 1FG2B 5LKNA 4O51B 3ES6A 1HVQA 1XCQA 2AXFB 2X1OA 2XYCA 2H9GA 1M04A 4HIIB 3G6LA 3VIKA 5E2VH 3EJJX 1OAZL 3HZKA 4NQEE 4BQ9A 4KKBC 1HHJB 4PJ9D 5D7SL 2EKSA 2D4DA 4M03A 3DRTB 4Y16D 3DX9B 2IGFL 1OSPH 4MXVF 4ZUVB 4U6YB 4JQVA 1LP9E 2BY2A 4PJDB 2Q8AL 2GSIB 2X4TA 3NSNA 4NZRL 1R3KA 4M6OH 4FXGA 5HVGB 4JQIH 3BOVA 4X7CC 3GIVB 1MW2A 4IM4A 5JMRA 2XHYA 3HA0A 4F37K 1ZHBA 4QYOB 1NBYA 4Y5VA 1BD2A 2OSLB 1DBML 5A8OA 4PV8A 2A3BA 5T3ZH 1NAML 2DMKA 2V9TA 5T5NF 5EULV 2F7OA 1YPZB 1EVTC 5D96B 3ALFA 1OP3H 1INDL 5A94A 3FN0H 1YZZA 5KJRL 3EJRA 43C9B 3U0WL 4HUVB 32C2A 3I50L 3A4WA 5D1XD 1KJ3H 1T04A 2R0WH 2VABA 3QYCA 1E4NA 4J3WA 4H1LG 2JELL 4BH7A 4NT6B 2Q6WA 1GJWA 1CXFA 2I9LA 1ERNA 4G6KH 4HUUB 2XN9B 1R85A 5FCSH 2OJEB 5AG9A 1LL6A 2VXQL 1J0ZA 3ZTNL 1UACL 2BNQD 1MJ8H 1PX3A 2ZCKL 1I9EA 5I78A 4U0RB 4X0VA 1KB5L 3ULSA 3O11A 4MNGE 3O6FA 1KF9B 5DQJA 3PWVA 2D0FA 2CJUH 3NBNA 3PG2A 4KKCD 1TETL 3A21A 4G9FE 3CVHH 4H8WL 4TNVK 5C0CA 5BRZB 1QI3A 1KELL 3MOBL 4ELMA 3FO2A 4PYGA 3F62A 1BVNP 3C8KA 3QDHA 1QZ1A 1HSBB 1D3CA 1I1AA 3MYJA 3KPQB 5FYJL 3SKMB 3A6BH 1YA5A 2AEWA 4E5XA 2BOBB 4C56E 2J5LC 1IJ9A 1V05A 4RCAA 2PUQT 3P30H 2GK1B 4S3KA 1MFBL 1DBKH 2BDNL 3L3DB 3OWEA 3M1BA 5JXAL 4JM2A 3KWWA 4JLRB 5I6XC 4G5ZH 2V2WA 3QO0A 1JDAA 4NZTH 1T0MB 1Y0LA 4QHLA 1IEBB 4HWNA 5JO5A 1TVNA 4XMPL 2DQCH 2ESVA 5DQDL 1N82A 3KPSA 1JPGB 1Q6FA 4JRWA 3AHVA 3LXCA 2BHUA 1FFPA 2VLKE 3KPPB 3GZKA 4GUPB 1A3LL 1BQHG 4GW5B 1C7SA 1TTFA 3A4XA 1D5ZB 3NABH 3UTTA 4R9HA 3D5OF 5C08B 4ELKB 1AKJD 4PJEE 3PXJA 3CNKA 5I3DA 3CX5J 3VFNA 4XI5C 1WTGT 4EN3A 3CUIA 1E6PA 4OZFA 1IBGH 2ORBH 5I71C 3L95A 3X3FH 5MENA 1FGVL 3HE6A 5DHVH 4R4BA 4R26H 1WC7B 3QQ4B 5KSAC 4MDJB 3H9HB 3IXTA 4KHXH 4X9FA 2ADIB 3CZ8A 1CBGA 4OAWA 25C8L 1IKNA 3BIKA 2KUTA 3I02A 2YRLA 5INDA 5DA4A 1ESWA 1AQKL 5K9KB 2Z91B 5D5MB 2CBVA 1Z5LB 2I07B 4ZFZB 3ULUC 5FGCB 1UR4A 1RIHL 3CZFA 1XGUB 4JIEA 3HRZB 1VBRA 5JQ6H 4XNYH 5LXGL 5DT1L 3VGAB 1S7QA 4XAWH 4XP5L 4KVCH 3EBVA 2C3VB 3QEGH 5CEXA 3NAAH 1QG3A 2DDQH 4ZXBC 1UGNA 4JREB 4CD6A 4FXLA 2F74B 4P0DA 5IG7B 1WZMA 5EU6B 4Z2GA 3MRMA 1DBBL 2HVJB 2C3WA 3HG1D 1T0NB 1C8QA 3MV9E 1R8LA 1SBBA 2BOCA 3GNMH 4IOIA 1YEGL 3EFDL 3AICA 5HHME 5BRPA 4QOKA 4M7LL 3U2SB 4JDZA 4XCEB 1H0GA 3TIEB 2CRIA 5D2LA 1MAJA 1KJ2H 3LXAA 3AIUA 1S9WB 3MODH 1G0YR 3PP3H 4LSDA 1ODAA 5CCKH 3IFPA 5E09A 4MWFA 3BQUD 2X8RA 4W81A 2CMRH 4FQXB 5SWZB 4P3CH 3RY5A 1TCMA 4W5ZA 5KS9E 5KN5A 3AY4A 3VGBA 2XV6B 3WUBA 4DK6A 3JV4B 3QCTL 4KPHL 5EFFA 5C0JB 2HLAA 4J4PD 2J6EA 5BJTA 3BAEL 1S7WB 3I6KB 3UZQA 1UXWA 2EH7L 3KDMB 1W9UA 2ZUMA 3FB5B 1WBXB 1JF1B 1FZOB 4MCZB 3NPSB 5I1LB 3C2AL 4HZLB 3PHOB 1SR0A 1UD2A 5E2UH 1HINH 1T2QH 2Q86A 3PABA 3WY2A 2GUOB 4UTAH 2CIPA 2DRUA 3MA9H 4KHTH 3NCCB 1HSAA 5TE4L 1HHGB 5TQ2L 3ZSSA 4BSVA 5CJXC 5CSUA 4PGDA 1XGQB 5IXEA 1TCRA 2MMXA 2CQVA 5C92A 1YECL 2ZCLL 1RD6A 1NMAH 3MJ7B 3IRZA 1ZAGA 2AK4A 1W9VA 1CFQB 1JK8A 2QLVB 4HIHA 2ITDA 5J3HC 5DWUL 1JRHL 1N6QH 4R7DB 3GRWH 5L0QB 1DEEB 2IADA 4JGMA 4F7TA 2J7HA 5BOZG 4IIQC 5ADOH 4G8GB 2YN5A 1P1ZA 5D9MA 2ZUWA 3UC0H 3RZWA 3DX1A 4M5ZL 4R8WL 4LDOB 4WFED 3MREA 4Z7WA 4K3DH 4PJBF 1RIVH 4HUWB 3EJQA 5E4EB 4TUKL 2DLEA 3AIQA 5E99H 2CLRB 4D0DB 4W5UA 4LF3A 3TH4T 1YDPB 4DN4H 4Y4FC 1CICB 3RGVD 1NGZB 3KL3A 2JCCA 1UR0A 4MJ6A 3AHXA 1RI8A 4D6IA 1P6WA 1P9MA 4POYA 3FT4A 3CZSA 4LCCA 4PJ8A 1OD0A 2G5BB 1VJZA 2DQHL 2H6PA 1U8JB 5LWYH 1HHIB 1IC7H 1KULA 4TSBH 1MPAH 4OOZA 3MBEA 2GSJA 4O58L 1SHMA 3SQOL 3VI4F 4WWKC 2K9UA 1F8TL 3I75B 5GGSY 1B0IA 5FD0A 1QSEB 1DQTA 2IC2A 3RUGA 4XWGH 5JNYB 4DVBB 4PR5B 1AGFB 2VUOA 1Q1JH 1ZHKA 3GSNH 3U48A 4N0YL 3VGHA 3UO1H 1XGZA 3DYMA 1MYRA 1KIQA 3OXRA 5I8OH 5JA9A 1EAPB 4YHYC 1AD0B 4HV8B 1NAMB 1LEGA 4G9DA 5DJYA 1UH3A 1XH0A 2IPKA 4PJ9B 1NGWA 3VWJD 2KQNA 5FO9B 4K7PL 3MSPA 4XVUD 1E4WL 1WAAE 1R5VB 3LB6D 2DWEB 2Z31B 2JJWA 1B3YA 3O8XD 1IT9L 1JGDB 2WHLA 1HQ4B 1AXIB 1B4JH 3MCKB 3QFJD 3QJFA 1FL3B 1NCNA 3IDUA 4PREA 4KTDL 4N0FB 3MJ9L 1H5BB 1QRNE 3SDCB 5C86A 1WZLA 1CR9H 5E6ID 4PJCF 2BJMH 2YD5A 1A7QL 4X0KB 4KV5F 1AQHA 2DM2A 4IRSC 4JO4L 4C4KT 3BCFA 1X4XA 5AYUH 1GOOA 3KPRA 1B0WA 3CFJA 3KR3L 4XWOC 1PLGH 4QY8B 3RL2A 4FNSA 3WDRA 3BWAA 1JG9A 3QXUA 2AXHA 4LAJH 1B3JA 1I9IL 4XMKL 4DGIH 1DVFD 4O02L 1FHLA 3RWDB 4PMYA 1SY6H 3MRFA 3AMKA 2FJGB 2GFBB 1N0XH 2I26N 2X4UB 2H2PC 5GGVH 1YNLL 5D1XB 1IQWL 4GW1A 2J79A 4LCWA 3KJ4C 4EKJA 3CFKA 2D7MA 3C5SB 1PJ9A 4M1RA 3EMQA 4NC1E 4FOMA 4OLUH 4C7GA 4PJHE 4ZUTB 3EYQD 2ZUYA 4FFYH 3OQ3B 1NMBH 1YEIL 1NFDB 4XX1G 2EIBA 4AZCB 3G5VA 4EOWH 5HTSA 3MRLA 1E6JL 1NCAH 3T4YA 3D5HA 5JMOC 2XWJB 4JQVC 5E8EA 5K33A 3SPVB 4AD4A 1GGTA 3BDBA 1VGKA 1S78D 2SEBB 1RZ7L 1YPZE 3T2NH 2YD3A 3NCOA 3GXPA 2FSEA 4U6TA 2X05A 4LVNB 3WNNA 2HP4A 4L4VA 2Y06H 3ARZA 4NJ9L 3P4NB 1MEXH 1IGIH 1XR8B 2XKNB 3D3VA 1FHDA 2AJUL 3TJEH 2IAMC 3S37X 1W2PA 1EFQA 4MTVA 4AK1A 4Y5VC 3HC0A 3Q5YA 1MCPL 1TQCC 4WTWA 1U8QA 4AW7A 5E7FA 2DIBA 2ZUNA 3DX6A 2LTQC 2NY5L 3WO4B 4JY4B 4AEHH 4W4OC 5IROA 2V2TA 1Q72H 2RFXB 3LEYL 1GPOH 1F58H 4HXBH 1R6VA 3QUZA 4L9DA 1JNEA 4U1HA 3F7PC 3QPXH 2O93L 3WFZA 4XPAL 4F57L 4ZE5A 1LO0H 4JN1H 4KK9C 4TVPD 5DJAB 1BOYA 1KPVB 1B9ZA 1JAEA 4TUJB 5DJ6A 3VXUA 2VXVH 4WKFA 4Y8DC 1G9NC 5SWQA 5D4YA 2X2HA 4JFDD 3VXMD 2FDMA 5BRZE 3KXFE 4KQ4L 5ICZA 1PIFA 3V52H 1NGQL 4RGMC 4OGXL 4YHIA 3JV6A 3WFEH 3OKEA 3RQ3A 4P4KD 4K3JH 2NTSP 3ZE2E 3LCYA 4X7TA 3SOBH 3H42H 5I8EB 3RY6C 3DI2B 4DEPB 3CVHA 1AKJB 3PHQB 3L7EB 1VGEL 5ACLA 4Z2LA 2V5DA 3O6FC 1MF2H 3VMPA 1N3NB 3S36H 1A2YB 1HE7A 3EDEA 4JKPH 3RWHA 5INCB 1CL7I 5A43C 3CCHA 2CR6A 3ESUF 3GB7A 4KKLC 4TVPL 1OOAA 1KGXA 4YHLH 4OUUB 1W32A 5IOPA 1I1AC 4X99A 4BYHA 1JGLL 1I1XA 5DO2C 1A7RH 3PGDA 4MAYD 3NFPA 2EH8H<