1J0HA

Crystal structure of bacillus stearothermophilus neopullulanase
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
588
structure length
588
Chain Sequence
b'MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLYSGEEKLVYTEKGFYFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPSISPEGSRPWGSEDPTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGESSKYKDWFHIHEFPLQTEPRPNYDTFAFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRSLRRGEISFLHADDEMNYLIYKKTDGDETVLVIINRSDQKADIPIPLDARGTWLVNLLTGERFAAEAETLCTSLPPYGFVLYAIEHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords neopullulanase
publication title Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 194
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.2.1.135: Neopullulanase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j0hA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1j0hA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1j0hA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1j0hA03
2ZWYA 1UM4L 5D1ZA 1H4PA 3LKRB 3N1QC 5IHUH 3JV5A 3QFDA 3B2VL 2FGWL 4YDKH 5B39G 1AD9B 4JKLA 5C2BH 2Z92B 1UB6B 4JDZA 1UKOA 5TQ0L 5CWSA 4D0BB 1TTGA 1FFPA 4PGBA 1RZJL 3ZTJH 2X05A 1E40A 3Q6FB 3ROLA 1DR9A 2QQLH 1G9MH 2OR7A 1AMYA 3LKNB 1JGDA 1O7AA 2DMKA 3CCHA 2DBLH 1D6EB 5BWFA 2I07A 1K8IA 1U8HA 1JUFA 4JFXB 1NMAH 4JREB 3VCLB 4GI6A 1H11A 5ANMA 2XKUA 2F5BH 1K5NB 3V7AE 2P5WD 2L4OA 3HPJA 5CP7B 3DUHA 4JZJB 2BVEA 2ZSWB 5A8MA 4RAHA 3TH3T 3TBYB 3HUJB 3QIWA 2Q8AH 1XH3A 5CSGA 1LEGA 4HUXA 4F3FA 3V8OA 1PIFA 3CPLB 3TCLA 1TZHB 3KAAA 3HNTL 3BSHA 4HKJA 5H35B 5F6HJ 3QOKA 2F53E 1SJHB 1EUUA 1XSIA 2B0SH 2XFYA 3MR9B 3U5UA 5GZND 4ZFMA 2YSSB 3K81A 1EDTA 1MY5A 1BF8A 1NC2A 1JFXA 3MLUL 3C5ZD 3A5VA 3G5VA 2Z8RA 1HZHH 4UIMA 4HQQH 3TN0D 1MCSA 4X6CA 4JRXB 2WUCL 2XZCH 2EXYC 1NUGA 5D9SB 4W8LA 3O6ML 1KPRB 3MCKA 5EU5B 4MA7H 4C56E 3BZEA 4L3CB 3IFLH 5HGGS 3UTQB 1JGUL 4E4PA 2VXTH 4QXGH 4WW2A 3H9HA 5JW5B 3ALFA 1B88A 3F7VA 2HTKC 4QTIH 5DWUL 1NFDF 5JOFA 4HZAA 1LWRA 2H9GA 3HS0B 3PZGA 1I1AA 4A2MA 1F3JA 3QDHA 2GUOB 2H45A 3OKEA 5C9JA 4R96A 5M95B 5ALBH 3OLGA 2WZHA 3INUL 3T0DA 5CPQA 3LEXB 4PR5A 3CFKB 4QRPB 4JB9L 3U9PH 4PMOA 5E5UB 1H3PH 3ABZA 5C6TL 3EOAB 4GAGL 2YA0A 4UNTA 3BGAA 3HFMH 4M6OL 2RQ8A 3GI8L 3RIFK 1ULVA 3T4YB 5HHVH 4JO1L 3RWJA 2DIEA 2ZSVA 3ARYA 3DI2B 2YLAA 1BZ7A 3VXTB 1CZ8L 3AICA 2A9MH 1J86A 4FTVD 5J6GB 2XWBB 1CWYA 1NDGA 4PBGA 3MBEA 2Q7YA 32C2A 5FGCB 4FQXB 1ZSDA 1U3JA 1MIEL 4M43L 3ECBB 4LCCB 3T2NH 4ERSH 5F7UA 4LCWA 3BPNC 2V3DA 1NGPL 1CGSH 3JTSB 2XRAH 2XOTA 1CFTA 4FQQB 4HS6A 2DYPA 4JPKH 4UBDC 3TVMA 5IV2A 3KPQB 1P4LA 4L4PA 1C93A 3ZJKA 1N59B 3MLYL 4WCYL 3CUPB 4GQ9L 2ERJB 4OCSH 2G75B 4GS7C 4TUOA 4WGVB 5C8JA 3QHTC 2IH1A 1E9LA 4GBXC 1K9FA 1NPUA 3WQ6A 5E9DD 4Y16C 1DDHA 2P47B 1P1ZA 1NEZA 4R90L 3MLRH 2G3NA 4HPOL 4IJ3C 4OLXL 2LVCA 4LEOB 2BMKB 1RUPH 5IQ7L 2Y72A 4JFHD 5KAQF 4PN2A 3UR8A 3FHQA 1QHPA 4ZXBB 3MV8D 4ZQKB 4JY4B 3MV7D 4LOUD 5LWYL 4I18C 5SX4I 1KGCE 4JGMA 2IANE 5J1AA 3IU4L 2ADIB 3FTGB 4QHLB 2ITDB 4G6JH 5FYLH 3ZKXB 1V6UA 2MPAH 5C7XL 3BLKA 5EN2A 4DUWA 3S36L 4H88H 3MC0A 5E6IA 4PJCA 2ZX9A 3UG4A 4NQDB 5CJOH 1R6VA 4W87A 4YJZL 1A0QH 3EDDA 1EEUA 3DYOA 1PQZB 2WHKA 1XGQB 3PWVB 4PJEB 3BKYH 4HXAL 1YEGL 4PS4L 4MQSB 3EFDH 2OTPA 3EYOA 3L3HB 4Z0XA 4JQIH 3HZ3A 1UD6A 2D24A 3ARFA 2E6PA 1H3WM 3RWFB 3WMSA 5ICYA 5I1KL 3D1MC 4NO3B 1LEIA 3JV4A 1ED3A 3LH2L 2P5EE 2MSPA 3DX8B 1ZA3A 4PGCA 4AT6B 5FYKE 4U0RB 5F9OH 4XVUC 3G6MA 1FVEB 2P8LA 5MERB 2OX5A 5ALCL 1UADC 5HYJE 4C55A 3QEQA 3TO4D 2C8NA 1G7PA 2X2YA 3WD2A 3LKRA 4NO0D 3QH3B 1AD9A 1UKTA 1B0WA 1KEGH 3TO2A 1KXTB 1AHWB 1AXIB 4NHUA 5I9QC 4Y4FC 5FYKL 1UB6A 3VIOA 5TPWL 2D03L 4OGAD 4D2NA 3SCVA 2MCPH 3NACL 3X12B 3MZGB 4HT1L 2W0FA 2WCGA 4V2BA 4DAGH 5CUSL 1TITA 3MRKA 3G5YB 2FR4B 2CK0L 1BD2D 1NQBA 3GRWA 3GZKA 1Q9OB 4PRWA 2FB4L 3TH2T 3HI6L 1BFOB 3CJJA 4MB1A 4NQCE 1U8LB 3WDJA 5MEQB 3VCLA 5ADPH 5BV7H 3FO2A 4HXBL 4RGOL 3V0WL 2AW2A 1K5NA 3ZIZA 1S7WA 1C1EH 4ONGH 4RRPG 5CEZD 4B9YA 1SBSH 2P5WB 5CSZB 4Z0BL 1GPOL 4WWID 3QUYC 5KVEL 2ZSWA 5L8LB 5FKYA 3BEVB 3TBYA 3HUJA 3NFNA 1YNKH 4W70A 3AFLA 5F9JA 2C3XA 1LL4A 4HCRL 1I7UB 5DJ8A 2R1YA 4YHYC 4H26B 3BQUA 1AFVH 2DLEA 1D3CA 3NA9L 4GSDH 4Z7OE 5H35A 5I66B 2ZUMA 1E4XI 4NKDA 2NW2A 4CVZB 2COQA 3MR9A 4G8GD 1AXSB 2ESVE 5CQ1A 2BC4A 3C2AL 4G6KL 3GJFH 5KSAD 2G2RB 2YSSA 1JV5B 3L5HA 4AIEA 3IJYB 2ICWI 1XF5B 4PP1D 3H55A 1NDMA 2VLJE 4J8RA 1S8DB 3JUYA 2Q86B 3TA9A 1MFAH 5DK0B 3C5ZB 1JMXA 4JRXA 4Q97A 1QPPA 3MXWL 2GFBB 4KKBD 2CR6A 3I6KB 3TN0B 1JWMB 4N90D 4YNYB 3U0WH 4Z2IA 4MAYD 5EU5A 2V5RA 2X1XR 5D1XD 1EERB 4PB0L 2QHAA 1BPVA 1MQPA 1TVNA 1RJYB 1K9DA 3VGBA 2AOSA 5I1CL 4QOKE 5B38G 2PF0A 4JGJA 3C8KB 3L4XA 3OR7B 1JPSL 4DGVL 1ZT7A 1BAGA 2EDJA 1MCJA 4P5TD 3GI9L 3OAYK 1DQDL 1MF2L 3FZUC 3A24A 4MAVA 3LEXA 3CFKA 4QRPA 1N6UA 1I7RB 2HFEA 5DQDL 5IBUB 2FWOB 3VMNA 1T0MB 2W91A 4NZTH 3WL0A 1T89C 2EO9A 5A94A 1CDHA 5LGHL 3LS4L 3ULUF 3RIKA 1KACB 3BH8A 1O7SA 1Q38A 3T4YA 2ED7A 5DI8A 3F5WA 1NCCH 3OKMB 2EDDA 1SBBA 4IBLT 5F1OB 1R0AH 4Z7NF 3D39E 1IQDB 1QHZA 4BH8A 3ZR6A 3TFKD 1BFSA 5MEPA 4S1DD 3HB3D 1FYTD 2YBUA 4FTVB 4U7SA 4M6ML 5LQBH 2LQRA 3D4YA 5GGQL 4ZNEE 3GKWH 4KU1A 4XC1H 5D9MA 3EJJX 4TNVK 1DWFM 4FQQA 4ZE4A 2X4RA 3GSVB 2B1AL 4J4PA 2PWHA 5JW4M 1A14H 4IRJD 4JFDE 3AIQA 4FQLL 1K6AA 3KPQA 1VFBA 2FX9L 4MTVA 5HNNA 3RVXC 2XPGA 1AJ7H 1TZIB 1FFNB 1G6RA 3HRPA 5E2VH 1PG7W 2QQNL 2O9OA 1QEWA 1JNJA 5E9DB 1XGTB 4DVRL 4LEOA 2BMKA 1CXHA 5CLTA 3VPLA 5A6AA 5C92A 1YEFL 3WFCL 4X6CF 4MA8L 4WV1C 4ZQKA 4JY4A 4EK7A 4PRDB 4C57C 3ZDXE 5HGDB 2D7QA 3MV8B 5T5NF 5D5MF 3MV7B 3DX4A 1LQ0A 3FO0H 3WBDA 1YPZE 4Z95L 3FTGA 2G60L 1AGFA 1IGYB 4O9HL 4WW2F 4EQ3A 2C4FU 4JVUA 2FATH 2HT4D 1SJEB 1WICA 3ARDB 4N8CH 4DW2H 2W66A 4JPWL 3T4AA 3A47A 2AQ1A 1H3VA 4H8WL 3SDAA 1BEYL 4XB8A 4V27A 2XWDA 4N9GA 5JW4R 3WLBB 5DVMA 3PWVA 5CS7A 3OL2A 2H26A 1Q9KA 1P5UA 3ULSB 5F9WB 1H0DB 3LPGA 1S7UB 3Q5OA 4XPHH 3L3HA 1PYWB 1WBZB 1CLYL 3ARSA 1HHJA 3RWFA 3ET9F 3OAUL 4X9FA 12E8L 4NZJA 1NQ6A 4NO3A 2YC1A 1MCIA 2ICEB 4NQXB 1OP9A 3V7AG 3SCMA 2JK5B 4H5SB 1BVLB 3RM9A 4D9RE 1F11A 2FIRT 1FVEA 2I25N 2V38A 5JR1H 1NC4D 4OUUA 5GRUL 2G5RA 3BZDA 4JZOA 3I6GB 1LO4H 2CQVA 1RIVH 1DBML 5HDQH 5IGXH 1P84K 4PRHD 2E27H 4D6HA 4IS6B 3FFDB 3TO4B 5F1NB 4PJ7B 2GCYB 2EEAA 4NO0B 3CU7A 4UR9A 3BX7C 4UTBL 5GGRY 3PTKA 4ODSH 3WV0A 2AJYH 2WWCA 4AZHA 4XNZB 3TJEH 4U1HB 4GAJH 1CIUA 2A0LC 4WUUE 2J47A 5FCUL 4JPIB 4FXKB 4LYRA 1VCAA 4NOBA 3G5YA 4YHZH 5DUMH 3ZYZA 3ZDZF 2F61A 1MFDH 3GBLA 35C8L 4HX1B 1UWGH 1BD2B 5GHWH 3RY6A 1GOGA 1BFOA 4CMHB 1ZLUH 4FG6C 1H0GA 1CGYA 1HH6B 5E8DH 1PZ5A 3OJDB 3T3MF 2VKWA 4UDTB 5KG9A 4E41D 3QRGL 5C0CD 3F6LA 3JWNC 1RFDL 2ZG1A 2P5WA 5I15H 5C9KA 4YGAB 2GVYA 1EMTH 4HBQA 2XN9D 3BEVA 1E1EA 5ISZD 3IJSA 4LLMB 1R5WB 2VDRH 4OD2A 1LL6A 3ZHKA 4WTZA 5GGRB 4IRSD 1T5XB 5DS8B 2XIBA 5I66A 3ULVC 4GXUN 3EUUA 4PJCF 4PJFE 1YQ2A 1CENA 5HYFA 2MKLC 5F1IB 3CX5J 4IHOB 3UAJD 4CVZA 2EZ0C 2WVUA 5DFAA 2XT1B 1JYXA 3FQWB 1HWHB 2VERN 1JIBA 2CXKA 5D4YA 2G2RA 2WUBH 4G8GB 3TBWA 5KTEL 3S8WA 5KSAB 1GRWA 5H2BB 2D0GA 3CHEA 4X6FB 2UUDK 5DTFA 5GS3A 4EI5A 4K68A 3GDBA 1BFNA 1P6FA 5E2UH 1JWMA 2W59A 3W39B 3WYRA 4DFHA 4MAYB 1CFSB 1DANT 2Q76B 4B5EA 2VDPL 1OW0C 2HMID 3RNQA 4OSUL 4XNMB 5D1XB 4S3JA 2L0DA 4UI2A 3BAYA 4K94H 1A7QL 1A4KB 2Y7QA 3DVGB 5HI4C 3VIGA 1MPAH 5E4IA 3VG9B 1CLXA 2JB6A 3C8KA 3CVIL 3OR7A 3L95A 1ISYA 1RUQH 4PLJD 2MQ0A 4H0GA 1C08A 4HP5A 3WH8A 3KPTA 1WFUA 1U8JA 2WHLA 2H6PA 1YMME 4P5TB 1JTTA 4Y4KC 5C08E 3KPOA 2C4XA 3D48R 4LSQL 5GGVY 2HT3D 3PG2A 3GMMB 4OGXL 5EBWB 4NC0B 4ZAKD 5E8NA 1FAIL 2XTJD 2X4QB 2W62A 1KLFA 2E9JA 2EDOA 4HC1A 5KW9L 2IPUG 5I78A 2LU7A 1V3JA 4HWBL 1Y6NR 3N13A 2ATKB 1HDMA 4J6RH 5CHNB 1HSAA 2PO6D 5DVNA 2G9HB 3L5JA 3DX9B 4JDTH 3BVTA 2OK0L 4AEIL 3HE7D 4Y5VC 1UCTA 1WKYA 5HOSA 3CZJA 4YUEH 4KRPD 3OR6B 3FKUS 2J62A 1ZXQA 4Y5XC 2BY2A 4FTVA 3WSQH 2V17L 4XP1H 4MS8C 1FYTB 1HJUA 4ZDHA 3ECQA 3UBXG 2Y5TB 4XVTL 3WMBA 1P69B 1UWXK 3L7FB 1JNDA 3I6LE 1HILB 4JQVC 4XPBH 3DXAA 4IRJB 2ZJSL 3M8OL 1FFNA 4EQ2A 5E0FA 1YY8A 5JBDA 1FNFA 1FVCB 4OOZA 3QNXB 3IKCB 4FNLL 2JJTC 4TSBH 1KCSH 2BSRB 2NY4C 1INEL 2J8FA 2C9AA 5E9DA 4UINH 4PJGB 4LGSB 4TTUA 2VDLL 4RMUA 3UTTE 4FQIL 1I85A 3RPIB 4E42B 2XG4A 1IBGH 4PRDA 5FA3B 1MIML 5HGDA 1B4JH 4I0PC 1HK6A 1TTUA 5I6XC 1TQTA 3DO7A 2WCSA 1UWTA 2XG9A 4WSJA 3R06A 5GJTL 4QTHB 5ICZB 3Q1SH 3K8MA 4YK4B 2UWFA 1SJEA 3ARDA 3FQRB 3TC9A 4D0DA 4QRTB 5L88H 3RRQA 3PF2A 4P2QA 3BN9C 2J25A 3KPPB 2X1IA 5A8PA 3LPFA 3OTTA 3CSGA 5IKCB 2FEDC 4XMLL 1W3JA 2JJUA 4FNQA 2AJ3A 2HRPL 4OFKA 4PY8J 4I3GA 1YNTB 4XXCA 1H0DA 1K2DB 1G9EA 1U2CA 5DRZB 5C0FA 2A6IB 1S5IH 1WBZA 3KPNB 3WHXB 2IPTL 3N9KA 1CQKA 4XP5H 4KHTL 4PP2B 4XNYH 2PETA 4NQXA 3VE0B 4KKCC 1QFWL 1CD1B 3IGAA 1T22A 3FO1B 3VU2A 3EGSB 3TPUB 4MSWB 3NCJL 3UC0H 2XYCA 5LYRA 3U5YA 2Z8WC 1ZVYA 1XD1A 1M71A 5L0QC 3FT3B 2X44D 3ILQC 3DV4B 1D9KC 1OVZA 1YEDB 3SO3B 1K6QL 5SX4H 3A4XA 3RI5F 4BQ5A 4LARH 3TO4A 4R7DB 2GCYA 3GBEA 5K9OB 4H1LH 1AGCB 3I2CH 1AGEB 2QMJA 3OG4B 3L9RB 5AYUH 1WBXA 4HIIB 4U1HA 3GXNA 5AYBA 3NSNA 5DD6B 3ZKMD 4K7PY 5GGVH 3TZVC 3WIIH 2DOCA 1C91A 3VRIB 1B0RB 4YDJB 3REWB 3GBDA 1G0DA 5K9JH 4GZIA 5IHUL 4OD1H 4OV5B 1ETZB 1BD2A 3RDTD 4FP8H 3BWAB 1HJWA 5ESAB 5BVJB 5C2BL 1FZOA 2ICWB 5JBFA 3EZ8A 1GCFA 3DMMA 1C5DA 2VL5B 4MCZB 2AKRB 4UDTA 3PZQA 5H94B 4K71C 4X6DE 5D7LB 1E3ZA 4WGWB 2IUZA 4E41B 1TMQA 1UFUA 4LKXA 5C0CB 1B4RA 1FE8H 8A3HA 3FT2B 2QQLL 1F90H 3FHAA 2J7GA 1G9ML 4QF1A 2XN9B 5J3HC 4Z7WB 5ISZB 3DARA 2DBLL 1UA7A 3GFUA 3BH9A 2GY5A 2XIDA 1NMAL 4V1DA 3A21A 5F1IA 3QQ9C 4IRSB 4FFWD 4JJ5B 4IHOA 1FDLH 3VH8B 3FQWA 3FT4A 4JFFE 4EUPA 2Q3ZA 4I2XB 5I8EB 1BYBA 2HG5B 3W28A 3P4MB 4NF7A 5H2BA 2D7TH 5D7IE 2QSCH 3CSPA 3QUXD 4PJBE 1KOAA 2Q8AL 3OMZA 3FOMB 1UJTA 3VFWA 3RY5A 3HRZB 2GAZB 1HF6A 4BZ1L 1MCRA 4U1MA 5HD8C 3EYUH 3BVUA 1FFRA 1JHKH 1UM6H 3ARBC 2Q76A 2B0SL 3VA2C 3MANA 4WK9A 2IPUK 1BIHA 2H2PC 3ILPB 4ZUSA 5D1XA 2F1AA 2ZOKB 3GSUB 3P0GB 4FQPA 5DHYA 5DRWA 1A4KA 3RA7H 1KUMA 5HVHC 1FN4A 3DIFB 3P30H 1YEJH 3U7WL 1LQSR 4HQQL 4I4WA 1HXJA 1MCWW 2XZCL 2OW7A 1I8IB 1IM3A 4MA7L 3DPBA 2X4TB 3IFLL 2X2HA 4QXGL 2VYRE 4ONOA 1FG9C 2X4QA 4QTIL 1HHIB 4P3DB 1ZBKA 3LS5H 4WTWA 4MMZC 4ZAKB 4H8HA 2XTJB 2KQNA 5CG0A 1H3TA 2HA1A 4ETQB 5KN5B 1X5AA 4FA8A 3DX9A 4OLZL 2PO6B 5ID0B 2GY7B 5FDWA 2D9QB 1D5XB 3T2QA 1JBJA 2CETA 1NWRA 4LP5A 3KR3L 3VXNA 1WITA 3U9PL 1H0IA 1FL6B 3HE7B 5EZLA 5BRZA 2J8OA 4R97C 2PW2B 3NFPA 1JFQL 3HFML 1FYTA 1PX3A 3EYQD 2BSSB 4HJGB 4Z77B 1W72H 2Y5TA 5EOQH 5DFTA 1QI0A 3BDYH 5FYJE 5HHVL 3QCVL 4WTXA 3K3QA 1HILA 1WZLA 3FQTA 1KB9J 4Y5YC 4F58L 4IRJA 4JFPA 1EGJH 2UY6A 4J3XA 1XGUB 4IIQB 2A9ML 3GUTB 4M7LT 1UZ4A 4ODTH 1FVCA 4PMQA 1X4XA 3QNXA 5TD4A 2VDMH 3T2NL 2BSRA 4ERSL 1WTLA 2XV6B 1CGSL 2XRAL 5DD1H 1ISVA 5FYJL 4PJGA 1I9RH 3SGJA 4WKAA 2J12B 4P2RE 4AJ0A 4KRUA 1UD2A 4JPKL 5L2KD 4NJ9H 3TYFB 2EXWD 5CGYD 2A3BA 1J0JA 4OT1H 1RULH 3HZYB 3SBWA 4UUJB 1MHPH 3NIGF 2B4CH 3MJ9A 5FYLE 3S35H 7FABL 3UCQA 5ICZA 1ORQB 1S9YA 5T33L 4G6AD 2YN5A 1RUKL 1TTFA 3MLRL 2VVNA 4OOUA 1R3LA 4ZFFA 2PXYB 1RUPL 3T0EC 4M29A 1OD7A 5KZ6A 2RB8A 4FQCH 2FX7H 4HUWA 4LQFH 1FHLA 1Q0XL 3KL3A 1QNSA 3FCTB 2ZUSA 4RFNC 3BAKA 3BD5A 1CICD 5FFLA 2BFGA 4F9PA 2G5BA 1YNTA 4GO8A 3E3QE 1S7RB 1ERNA 3R0MA 1DLHB 5DRZA 1FZJA 1S7QB 4G6JL 5FYLL 2MPAL 3KPNA 3CX5K 4H88L 5F88B 2ARJA 2EIDA 4WEBH 4PP2A 5CJOL 1VPOL 1CD1A 5T3XD 1GONA 1A0QL 3S9DB 4N0UB 3FO1A 4ONFL 1OGTA 1T3FA 3EGSA 3TPUA 3AGVA 5IW3A 4KK5C 4NKQB 5F6IC 2PKDA 7TAAA 3POCA 3EFDL 4HUUB 1YEDA 2BERA 1DQMH 2X1WL 4ZPTB 1Y7VA 3AM8C 3OBAA 5ESVA 4YEEA 3VD9A 4R7DA 4WFED 4YBLC 3VM5A 5F7NC 2YS4A 5IVNA 1AGCA 4DCQB 1MW2A 5I76B 1GOOA 5KS9B 5F9OL 1FC1A 3KLKA 2EO7A 2OCFD 2GITB 3KXFA 3MRJB 5I74C 4XNQB 4YHNB 4U3HA 3VRIA 1B0RA 1CFBA 4YDJA 5DFVD 3IRPX 5CSYA 4YAQB 3J8F7 3JV6B 4OV5A 3KYNB 1KEGL 3GNPA 4Y2DC 3U9UA 5A3ID 4I48B 1U8OA 1UXSB 3RDTB 1A6ZB 4J3SA 2AKRA 2FRGP 2FO4B 4CVXB 4GW4B 5H94A 2MCPL 5D7LA 5ETUB 1ZOXA 5IW1B 2FDMA 1B2WH 2CO7B 2YBTA 3MRGB 2R0WH 4HH9A 4YDIH 2IQ9H 1INQA 3C08H 5JW4N 5IEKA 3KJ4C 4JFED 1B2YA 5SWZA 1JTPA 4Z7WA 3B43A 4HLZH 4G3YH 3FOLB 4OF7A 4N1CA 4OLEA 4M61A 4DOHB 4BFGA 2FBOJ 4KMLB 4OD3H 5ADPL 5BV7L 5F7KC 4IRSA 1E5NA 1EOMA 3KL5A 1VFAB 5F3HB 3ULUH 3EYVB 4KK9D 4JCLA 2HH0H 1HOCA 4QHMB 4F7EA 1U58B 2P8PB 5A2CA 4PJEE 1YC8A 5TE7H 3RVWD 1AIFA 1U0QA 1US3A 3UYOD 3W5MA 2JJWA 5CZXC 1YNKL 1FOBA 1W0VA 3QUXB 1SYSB 3FOMA 4OI9A 2GAZA 2R8SH 2NR6C 3L6FB 2HJKA 4PRBB 1AFVL 1IILE 3AXLA 4IMKC 2JB5H 4GSDL 2D4DA 2VIRB 3CFDB 4JKMA 3MV11 1A02N 1DP0A 3ILPA 2H2SD 3CDGB 3O41B 2BVYA 1UH4A 3GSUA 4ZG1A 1UR8A 4P7RA 5FXCH 4PTUB 1HHKA 3BUYB 4YE4H 4HKZB 4NFDA 1H15B 2FLRT 5F7DB 2F8OA 2DQGL 3HAEG 4PRNA 2CR3A 2M8XA 4NIKB 3SHSA 1F2QA 1EK3A 1LO5A 1E6SM 2WWKT 4NRXB 1I8IA 3U0WL 1ODUA 3BXWA 4PLKC 4X7TA 3GIZH 5TDNB 4L8BA 3IK2A 3IDGA 2GFTA 1QSFE 4RMTA 2F74A 5C71A 4P4RA 1TQBC 4UQCA 4L3AA 1LDSA 4P3DA 2PNDA 1GGBH 1B90A 4ZAKA 2VLRD 1H2JA 4Y19D 2NY1C 3EO0A 4XCEB 5KN5A 5B4MD 3VWJC 5HDBE 1I7TB 4EN3C 2PO6A 4HG4J 5C07A 4QRQA 1D5XA 2DIAA 4HSQA 4DWSC 1N0LA 2QHLA 3L5WB 1OBAA 4F9LC 3BPNB 4L4JA 4XPGH 1FL6A 4L4OA 3OF6A 2V7NB 1E4LA 3LRHA 4K55A 4G43B 4NZTL 2FIKA 4EDWH 5JHDA 4TYUA 2BSSA 4X98B 3SE4A 2XWJA 2OI9C 3TESA 4KMQA 2EPNA 1NCCL 2ADFH 1HHHB 4EZMA 2P44B 1YEEH 4WHDA 4WU7A 3ZTNH 4JANB 1R0AL 5E1AA 4KI5C 5KVGH 3CZFA 4IIQA 1BYDA 3K4DA 1H8NA 3QO1A 4U5IA 1F4XH 5B3JF 2XZAL 4BZ2L 5GGUB 1RZJC 3FQUB 5LQBL 3W11D 2O5XH 3GKWL 4GG6B 4FLRA 2A74B 4LFHG 3RUGE 1LNUA 3IDUA 4URTB 1FH9A 1ZHBA 1FNEA 5E8PB 5L2KB 3PJSA 4HA4A 1TR1A 4DK6A 1CXKA 3HZYA 1OOAA 1MAKA 1MCCA 2AK1H 3F58H 4ZS6C 5E2VL 1X7QA 2YA2A 4K9EH 1R86A 3T3PF 4DEPC 1EHXA 4U6XB 2PXYA 5J9PB 4LKCB 1U3HA 3M46A 4QLKA 2MQ3A 4Z7VE 2XM1A 5EBGA 1VBRA 3MREB 2R39A 3MMEB 4I3RH 3RY4A 2Y8KA 2OWCA 4JZNB 3AVEA 3ZTJG 2PI6A 5CJQH 4MQXD 3TT1H 1F6AA 3UYRH 3FO0L 1CICB 1S7QA 5KVFH 3T0XA 3NCBB 1YYLL 1YEHL 2XFXA 4J3WA 1MYRA 4MHHG 5J0BA 4DW2L 4LHUD 3LRSB 1G9NH 5HYQB 1V6YA 3NPSC 1FP5A 3V6OA 4ZOBA 3VXUD 5FD0A 3TONA 5IK3B 3I02A 1OARH 1EJ6A 2OZ4A 2HVMA 1UKQA 5JOEA 1T80A 1BSIA 4HUUA 4Y4FB 2Y8VA 4HWNA 4XPHL 3DWTA 1NFIB 4NQEB 5JBEA 1A6WH 2C1PB 3SDXE 3SPVB 3UG3A 2CH8A 1B31A 2QADC 4HOXA 4DCQA 4K7PX 3MRRA 4AZ6A 5KS9A 1BFTA 2XA3A 3G6DL 4Z7UB 3E2HB 2X4OB 3G5ZB 5DD3H 2GJPA 1TZ7A 3MRJA 2QLVB 5JR1L 2E9WA 4YHNA 1W3HA 2UVEA 4KKAC 4N1HB 1V3KA 1LO4L 3H7BB 4LCYB 1RIVL 4AENA 5HDQL 1X5GA 5IGXL 2WC3A 2CDEB 5CD5C 4L8CA 3VXPB 3D50A 4P8UA 3KYNA 5AYIA 1AO7E 3L3GA 5EBLA 2XJ7A 3RDTA 2AEPH 1A6ZA 4ODSL 2F7OA 4PJGF 4CVXA 3MLPA 4GW4A 3S35X 2AJYL 5ETUA 3RVUD 3VFPA 3TJEL 4MAZA 1MCLA 4AM0B 2DQXA 4GAJL 2P7TB 3WEZA 3MRGA 1UD8A 2X42A 4YHZL 1LK2A 1MFDL 3N04A 1ADQH 4I13B 2A9NL 3FOLA 1UWGL 4JFEB 4WFGD 2WW5A 4NN6C 5DJ6B 2OJZH 5GHWL 2VXVH 5A2JH 1L8NA 4Y89A 2WMJA 5E8DL 4Q9RH 5ABHA 4APQC 1DWAM 3MRCA 1IGFH 2UWEE 1VFAA 5EU4A 5FO7B 1IV8A 2J6EH 4QHMA 3ZO0A 1DBJL 4QLRA 3V6FB 2P8PA 4ZSOE 5I15L 2EDQA 1EMTL 3G08B 5F7EH 1DVFC 2NT0A 1KB9K 3L4WA 2VDRL 2IF7A 3QUXA 5JHLH 1SYSA 1GJWA 3BEWA 2XQBH 3WUWA 2D23A 3L6FA 4HWUA 2ITCA 4OGYH 8CGTA 4TULH 3W38A 3H42H 2VIRA 4FNTA 1A64A 1C8PA 3O41A 5D1QD 1F4YH 2WUBL 2E7MA 3MRHB 1MREH 3CFJA 4PJDA 4PTUA 4HKZA 3ALWA 4XTRC 1V02A 3GSRB 3BVNB 5F7DA 3MKKA 2CMRH 3MGOB 4YHPB 1FH5H 3AAZB 4PJ7E 5E2UL 3QUZC 4NRXA 1KGXA 4G9FD 5TDNA 1T7ZA 3M07A 4YR6B 1NGXB 3LQAH 2DH3A 4U1NB 3BVXA 4X9BA 4JHBA 1MLCB 3MRFB 3QIUC 1NMBH 3WD5H 4U6TA 4XCEA 2VLRB 3NFSH 4Y19B 3V4PL 1AQDB 1RUQL 1I7TA 5ENWB 1IAIM 1DJSA 1YUHB 3TA3C 1T0PB 5GRVL 2NYYC 1MCWM 5I19H 4KKLD 2PF6A 2V7NA 1FZKA 3CXHK 2HFGH 3OKOB 1P2CB 2GJJA 4G43A 4CD6A 3IXTA 4HZ6A 3GSNB 1VGEL 3KPSD 4O2FA 4HLJA 1KR1A 4HUKB 4U1LB 2LTQB 4J6RL 5HHOA 1I8MB 2NQCA 5CJXC 5I18H 5BQ7B 4JDTL 4Z7WF 3O8XC 1U36A 4GBXA 4GRWB 4JANA 4UQ3B 4UQ2B 3O6KH 4Y16A 3QDMD 4LLDB 4U6YA 5SV4A 3HG5A 4V28A 1WNOA 1WPCA 3FB7A 2JIWA 4KZDH 1W1YA 3CLEH 1EXPA 4GKOA 3QQ3B 3WSQL 5CJ8A 1XFPA 4M7ZC 5GGUA 5M7QA 3FQUA 5I6SA 5AWNH 2VT0A 3SCWA 4I18A 3G5XB 4RAUB 2BNQE 2A74A 3U79A 3VIFA 5IMLA 1IAKA 1BVKB 4EI6B 4BH7B 4MNMA 4XPBL 1EH9A 1X4ZA 4XBGB 2YR3A 4N5ED 4D0CB 3SQOH 4N9OB 4S1QH 5FHBH 1ZS2A 4G8EA 4V2XA 1KNOB 1BLIA 3WDPP 3OXSA 2YLLA 4KAQH 4J1UB 1LG1A 1UZ6E 4TSBL 1KCSL 1UA6H 5J13C 4MXQD 3NN8B 4U6XA 4UINL 4S1SH 4LKCA 3MLTB 3MRNB 3RVVC 1PZ2A 4AZBA 1PVHA 5EPMA 4R0LC 1FRGH 3B5HA 3MREA 5EFIB 3AYRA 1C16A 1IBGL 2YKLH 3ME0A 4K3GA 4QY8B 4CBPA 4QNPF 3QA3A 1RZKL 5GIRB 3Q1SL 3OGOE 3VO0A 5L88L 5D2NE 4R3SA 2XVGA 1UJ3C 4JDVB 4XCNB 5HYQA 1LDPH 3JVGC 1WTGT 2D0FA 4GQPH 1CXLA 5CILL 3IFPB 5DRXB 2PBOA 5BVPH 3N12A 1V08A 1WB0A 4Q2ZA 3AHZA 3VXUB 4LNVA 2Y2WA 5IOPB 3IDIB 4DO6A 1OSZB 1ZLSL 1G7IA 3ZR5A 4Y4FA 4YIQB 4DQOH 3AXXA 1S5IL 4NQEA 4PGEB 5EZIL 2C1PA 1RHFA 4C7GA 2EE2A 4XP5L 4XNYL 1M1SA 5FO9A 3HMXA 2X4OA 1S7TB 3FFCA 1J1XH 1TPXB 2Y5EA 4JFWA 1YDPA 3RWIA 4NO2B 1P7QD 3LN5A 5HY9A 4LCYA 3F65A 2XKNB 2M26A 2CDEA 3LB6D 4MJIA 3QULA 4LARL 3QQ4B 3BPLC 1FJ1A 3BIKB 1SM3H 3I2CL 4KJWD 1OLZA 3PWPE 3QUYA 4L29A 1ND0B 4J3UA 1BQSA 1I8LA 4P46D 5AYUL 3P9LB 1CQYA 5IVZB 5GGVL 2CIKA 3WIIL 4FRWA 3IDXH 3FONA 2CERA 5K9JL 3GK8H 3SY0B 4OD1L 4NX0A 4FP8L 5DJ6A 1F3RB 8FABB 4G9DB 3RWGB 1NAKH 3C6LC 1BOGB 4Y4HC 4I8DA 1GSMA 3R0NA 3VFOA 2WBKA 2H32H 5CBAA 4BUGA 4LK4A 3O0RH 4LSRH 3VXSD 2N56A 3FB5B 1FV1B 4GUPB 3V6FA 1BFVL 1IGMH 3VDCA 2CUIA 5IB4B 3G08A 1FE8L 1U2YA 2GSGB 5FCZA 1F90L 2EJ1A 4OZHB 3PZ9A 1U8IB 1J8HB 3NGBB 4KRLB 1UB5A 1ECEA 1REIA 3VI4F 5IHBA 4XWOD 1FO0H 4ZO7A 3PNWB 2I60L 2VLMD 1K8DA 1FDLL 4PUEA 4LF3A 1DE4B 4HGMA 1QSED 1AC6A 4AIOA 1H41A 4GINA 5D1QB 4AL8H 1FZMA 2D7TL 4F79A 3O45B 1PKQE 1CXFA 3GSRA 4ZUVB 4KK6D 4TVSa 3MRMB 3MV9E 3A4WA 3MGOA 1C92A 3U83A 3AAZA 4PRHE 1T89A 3RTQD 1RK1B 5E7FA 4ML4A 3VUPA 5AC5A 3VXQA 3EYUL 1IAOB 4H8WC 4ISVB 1HVQA 3PV6B 1JHKL 3IFOB 4G9FB 4U2ZA 1ORSB 4YR6A 1NGXA 5KS9F 3C2SA 1OGAD 1JYWA 3KPMB 2VXUH 1NKRA 4XRCA 3QAZB 1N82A 4AZ8A 4U1NA 3TF7C 3RQ3A 3U48A 3P30L 1H3GA 5SWSD 1YEJL 5GS0C 4QRRE 3CUFA 2VLRA 4GRLC 1AQDA 1OAUH 3BHBB 5FAAA 4WUKH 3RJXA 2GJ6B 2JE8A 1ISWA 4W8BA 3QDJD 1T7VA 2EPMX 4OIIH 4FMKA 4F2MB 1U30A 1KCRH 1XYFA 4ELME 4ZUUA 4WNQA 4NN5B 4LX4A 3TPKA 1JK8A 3LS5L 4DGIH 1RAMA 5E09A 3BAWA 1E4XL 4U1LA 4KRNA 5IMKB 5BS0A 2FZ3B 2AXFB 5BQ7A 2DM3A 4YN5A 1ZT4B 3CSYB 3WEXA 4HZLB 4UQ2A 1H5BC 5EOTB 1HJSA 3WE6B 2FNBA 1DL7H 1VB9A 4OJFH 1U3YA 1NWUA 3QDMB 1ZBWA 1B1YA 1RZGB 1KLGB 4P9MH 5DMJB 5DK2B 2V7HB 4WV1A 4HK0B 1OB0A 1M05B 1W72L 3G5XA 5EOQL 3HU7A 1TVPA 3BDYL 4AWEA 3QJHB 3O9WD 4HKBB 3SIMA 2E0PA 1EGJL 4I0KA 1HKLH 2UYLA 4YBQC 1W32A 2DKSA 5T1KD 1LE5B 4ODTL 2JALA 4J1UA 1QR4A 5J11C 2VDML 3SGDI 5IMMB 1T21B 3NN8A 4PJDF 4W81A 1I9RL 2PTTA 2EKSB 3ZM8A 3SGKC 1GGTA 4QHKJ 3NIDF 1MJ8L 4S10A 4FK9A 2EDRA 5EFIA 4KROC 1UZ8B 4HS3B 4R2GC 4OT1L 2W9LA 1RULL 4IOFD 3U6RA 5E00B 4U3AA 4NGHH 1I1RA 4M03A 3D0LA 3DYPA 4XHJD 1HL8A 2B4CL 3S35L 4NFBA 2VJXA 4YH6A 5B39B 1GOFA 4RGNC 4XPAH 1TJGH 5GSRB 3GJFK 4XCNA 4JDVA 3WH7A 2E3ZA 1Z9OA 3RHWK 1FLTX 2XM2A 2FX7L 2YPKB 2FGLA 3IFPA 3WN6A 1GNXA 3S6CA 4LQFL 4WO4D 1I4FB 3S88H 1BBDH 3PZOA 1XGRA 3RKDD 4LLQA 1Z5LB 3ES6B 2CRYA 5IOPA 4OLUH 3IDIA 4JRYD 4Z2KA 1SY6H 3KS0H 2VXQH 1TQUA 3LD8B 4YIQA 2A6DB 3WXVH 3D85D 4BKLB 1BX2B 1I75A 1VFMA 4RAVA 1NUNB 2B20A 1FVDA 4I1NB 4L9LC 5GS2D 2AJZA 15C8H 4XNUH 4UT6L 1S7TA 1M03A 4M7KH 3KLLA 1IE5A 3SCSA 4TUJA 2J7LA 3KNBB 4JAMB 4OBRA 3MROB 4J7RA 4PMDA 5DC0A 3EJYC 1BQCA 1WWCA 1IGCH 3HR6A 4NO2A 1QP1A 3CZGA 1AP2B 1RU9L 5HHMD 3IRZA 4KTYA 1P7QB 1Q1JH 3WFEH 1FNSH 5KJRH 2ZUWA 3QQ4A 2NW3B 5D1ZC 1RPKA 2ZUVA 3WFHA 3LPPA 1ZT1B 1UEYA 4LIQH 1VJZA 1JDAA 3TBTB 3VXRA 3CBWA 4WDIB 1A6PA 3P9LA 2BNRD 2BSED 2MOVA 2VITA 1N8ZB 1PPIA 5KVMC 1ZANH 3ELAT 4P46B 1N2RB 1OHQA 9CGTA 2EACA 3GZAA 3U36B 3IDYC 4DZ8A 3WQWA 3NIFF 3C60D 2ILLA 3QXDA 3TH4T 4AMXA 1FFOA 4TNWK 3RJQB 4RBPH 8FABA 4G9DA 3RWGA 2A6KB 2WSKA 3IYLW 1GQLA 3EJQA 5FOOA 4KJYB 2F7QA 1HEZB 1QNZH 3AHVA 4X0KB 3ULUE 3P11H 1FV1A 1KPVB 1B2WL 3BW9B 4YDIL 1UVQB 5IB4A 2IQ9L 5HBBA 1EJOH 3C08L 3DETC 4PJ5A 4Z7NE 3UZEA 3UPCA 2DWDB 3ARBB 1EFXD 1U8IA 4Y1AD 1J8HA 4G3YL 1Z0MA 1VRXA 2HTLC 1A7RH 4L9DA 3BCFA 2ADJA 3QIWC 4OZFB 3ROOA 4OD3L 5I5RA 1F4WH 2VTFA 1IEAB 5ITBH 3ULUL 5I2UA 4UFHA 4C83B 3IU3A 3PP4H 1TQCB 5I23A 4OM0H 4D3CH 4ODVL 1KJVB 1OP3H 4K8RC 1XGPB 5DMGC 5TE7L 5D1QA 2VR4A 2XPKA 1QSEB 1G7HA 2W63A 1CS6A 1G6VK 3GMLB 3MRMA 2DF3A 2HAZA 5J89A 3W6MA 1FAKT 3SUTA 2R8SL 1NEUA 2F54B 3P9MA 4XXDA 2JB5L 4LVNC 4ISVA 4M24A 3RTQB 5I1LB 4J23A 3IFOA 2NX5D 1ORSA 5DT7A 3KPMA 4PYSA 1QLFB 4AD5A 1OGAB 3RGVD 4MGXA 4W93A 4X6CE 3UJJH 4YE4L 1XCQB 5HHPB 4Y5VA 1W3LA 2IFFH 5D5ME 1QFWM 5SWSB 2QKIA 4X8JA 3QNYB 2ICWJ 2I24N 1S3KL 4EBQH 2GJ6A 3TNMA 1VF8A 4R97B 4Y5XA 1ZL1A 3GIZL 3IDNB 3RBSA 4F2MA 4GIAA 4PTXA 3QDJB 1YHTA 4U1IA 3ARVA 3IKKA 1AKJD 1C7TA 1JNNL 1DWIM 1G0YR 3S5ZA 3I75B 1GGBL 2I5YH 5H37H 4MQ7A 4JQVA 5CIPB 3N50A 5GZOD 1MHEA 5ABFA 1O5DT 1S7VB 1JF1B 2FZ3A 3TV3H 1RJZB 1XHGA 3CSYA 4TSAL 4LLUA 4HZLA 3AROA 2XI9A 1JL8A 3WE6A 4XPGL 3G6LA 1IAII 1KIPA 3RAJL 1DQJB 1DANU 4EDWL 1OL0A 5DK2A 3WIHH 2DH2A 3MBEC 5EU6A 1CN4A 4H20L 4I0PA 4F9JA 4M1GH 4P57B 1MCEA 4IOIB 4W4OA 3O4LB 4U2YA 2WMGA 4CCCA 4AK1A 2ADFL 1EXUB 3QDGD 3QJHA 4GW5B 4ACPA 1JF6A 3M45A 4HKBA 4OZFH 3TYGH 3MUY1 3ZTNL 4P2OC 4AH2A 1BQLL 3O9WB 4FZ8L 5KVGL 5T1DL 4PREB 5FKAB 4O2EB 3TVMC 2V3FA 1ZLUK 1JGVH 4LCWE 2I9TB 5A2IH 1F4XL 1LE5A 3LX9A 4OQTA 4PJIB 2VZ3A 4M4RA 2NTSP 2O5XL 4H1LG 4TQEH 4LLWB 1W1TA 2EH8H 2Z31C 4JO4L 1G9MC 3TIDB 3K2MC 3ZOAA 3W53A 2Z35A 3KLAB 2GSJA 4QHUA 2EKSA 5L6YH 3U7YH 4M80A 2CD0A 3OKNB 4F37F 2W07A 3ZDZE 4XI5C 1UZ8A 1HQ4A 4HS3A 1JWUB 3MO4A 4DN4H 3BGFC 1D5ZB 2AK1L 3F58L 2YD7A 4K9EL 5SWQB 2Z1SA 2F53D 4MNGE 5B39A 4POZC 1T5WB 4HH8A 1S78D 3LEVH 3OKYA 4KUZH 2F5AH 1D9KA 4NBZB 3L3IB 2VCBA 1NGYB 1CT8A 1ZBVA 2HLFD 4YQXH 4WO4B 4X8XA 5JXED 5CJQL 4JFOB 3OKKA 3OKLB 3UYRL 5DSCB 1Q6GA 4YHIA 3D0VB 4PJCE 2ZUNA 2DDXA 1JN6B 1E6XM 1U93B 1GZQB 5KVFL 1UKPA 4C56D 2A6DA 4JRYB 4BKLA 3SCPA 1BX2A 2LE9A 1HI6A 5C09A 2WQ8A 4HIEA 3D85B 4ZMAT 1EVUA 1G9NL 3TZVA 4DKDC 5I74B 4AIUA 5DEFB 3MSGA 3ARFC 3N15A 1NL0L 3FQNB 2AV7A 2M1KA 1LEKB 3CVHB 4GRWF 3MROA 4QAWA 5A69A 4MZ3A 5IJKC 2IBZY 3D2UD 1AP2A 3W81A 3MODH 2BY3A 2E5EA 1IGJB 2VDQH 3N1GC 5HHMB 3BCDA 4JFYA 1NBZB 2I27N 4FFVC 5HDLA 2NXZD 3UERA 1C90A 3WNLA 3TBTA 1E0WA 3RPMA 5BO1L 5DD3L 4DFIA 4YDVA 1MVUA 5IFAH 5A6SA 2DS4A 3BH4A 3QEQE 2BNRB 5IB5B 1DWHM 5D7KE 1WZ1H 1FNGB 3AU1B 5BRPA 3WH6A 2HWZL 3C60B 2FYVA 5LA2A 4WWKD 3FB8B 4OZGB 2BHZA 5FV2A 4IPLA 1FORH 4GO9A 2DI9A 1PG7H 5FCSH 1EUTA 1PBGA 4H8VA 3WDRA 4HOWA 2AEPL 1HEZA 3RU8H 2DTSA 4D6IA 4X0KA 3VG0H 2NY6D 1TXKA 4JREC 4L8SB 2E6JA 1UVQA 2NY3D 4M7JL 4PRPD 2ZP0T 1QI5A 3K7UA 4WFHE 3QUMH 5B22A 4JZJC 2J8UA 4LASH 3ARBA 2FJHB 4DUXA 1OGGA 2OJZL 2VXVL 4Y1AB 1EFXB 4B3KA 4Q9RL 1B3VA 1IGFL 5JPMB 2J6EL 2E6QA 2FBJH 4G6FD 4QXUH 4JJHA 2DSVA 5BXFB 5F7EL 1KGCD 2IAND 5JHLL 1ZGLP 1K4CB 2XQBL 1QBLL 2F54A 4E5XB 3DTXB 4OGYL 1E6RA 3GXTA 3H42L 5JDSB 3VH8G 5LCVH 4WFEE 2EE9A 4MD0B 5F70A 5GS2H 1T66C 5I1LA 1FG2B 2R2EA 3AIVA 3VM7A 5J6HB 3C9NB 1X5LA 1A1OB 2NX5B 1F4YL 4P4KC 5BZWB 2OSXA 1JYVA 1MFUA 5A95A 1OGAA 2OTUB 2W61A 4HFUL 2DTMH 4NBXB 4NRZB 5E99H 1NLBH 2D7PA 1A6VH 3RGVB 5HHPA 4NPYB 4Q6IB 4PJAA 2DGAA 5DZNA 4YX2H 5E24E 1NGWA 1Q94B 5DR5H 2CMRL 4PJHE 5SWSA 2Y07H 1FH5L 2MWCA 3MLXH 3QNYA 3X13B 3U7BA 1V8HA 4O02H 1FLRH 1TFVA 1XSJA 1MW3A 3QDJA 4JY6A 1F42A 1ZTXH 1UC6A 3KYKH 3LQAL 4NQTA 4MB3A 1AKJB 2P5ED 5FYKD 3U7VA 1TIUA 3UTSA 5CIPA 1NMBL 3WD5L 4UOZA 3Q5YA 4Y5YA 3HG3A 4YHKH 3KE0A 2VABA 3ULVF 2NTFA 1ES0B 4DO5A 1S7VA 1JF1A 2V3EA 3OG6B 3NFSL 4B7LA 5IMOB 5E4EC 2YL5A 1MRDH 4K7FB 1VKXB 1MAMH 4RX4D 3GMQA 3RWDA 2J7HA 3RKPA 2IG2H 3UO1H 5I19L 4AYSA 1HWWA 2FX8H 2HFGL 4NOFA 4UNIA 3LMJH 1DQJA 2DKMA 1I9JH 4LRNL 4FQJH 3QRFM 3HHRB 1UR9A 1CXEA 4FQXC 4NQSA 1M01A 4DM2A 2YBRA 2QLYA 4P57A 1G0CA 3O4LA 4KDTA 4LCCC 5I18L 1T1XB 4B15A 1I1YB 4GW5A 2OLDA 3SJVD 1QVBA 3QHOA 3OV6A 2MHAB 3GGWB 3QDGB 2DB8A 1CGVA 3EBAA 3QEHA 4PREA 1HSBB 3LKOA 4KZDL 4M8UA 1P4IH 3PDGA 2B2XH 4UFJA 3T0EA 1GC1H 2ZX5A 2Y23A 1E27A 4NQCD 2PCPB 4U1SA 1W9PA 3H9SA 5AWNL 1A9EB 4LLWA 4MJ6A 5I24A 1JWSB 1UH2A 3STLB 2E4TA 5JIHA 2ORBH 1NCNA 3NDYA 1SR0A 2BVTA 3GBMH 3ZYOA 1JWUA 3S5LB 1ZHKA 1KV3A 1WQVT 3CMJA 1F2XK 4ZXBC 3E6FB 3P77B 1WP6A 2E7HA 1O0VA 1SEBA 4P5KA 3SQOL 3GH5A 4S1QL 5FHBL 2HN7B 4KAQL 4RNRB 5SWQA 4IM8A 2IXVA 4MNJA 1UA6L 3ZKXC 1G94A 2ESVD 1T5WA 1Q6EA 2F53B 2WXDM 1W8OA 2J75A 2YOCA 2A2QT 2VLJD 3EFFB 3L3IA 1G6RL 4JGUA 3VFMA 1MWAA 3AM8A 4MJ5B 1WFOA 2YKLL 3AZTA 4JFOA 3IAQA 4UQBA 3OKLA 1UM4H 5DSCA 2QADB 3WUBA 1JN6A 2EBNA 3OGSA 1RIUH 1TVHB 2EDXA 4P9HH 1T03H 4ODUA 4C56B 5C0AA 4G80B 2AEWA 3F7QA 1LDPL 1FYHB 4QHNB 3H3PH 4QOKD 1FCGA 5BVPL 5CFHA 4GXPA 2XTKA 2CUHA 2DT1A 1H3XA 2RCSH 3OJ2C 3CVHA 3SGDH 4H41A 1KB3A 1AGBA 4U0RC 5D2LA 1OINA 3STBA 4Y2DA 5JLZA 1M7IB 4DQOL 2WNWA 3PQYD 3QXAA 3D2UB 4S11A 1IGJA 4M00A 1EZVY 3LDBC 1ZV5A 1NBZA 1V0KA 3X11A 4AC1X 1JDDA 1YN6A 1ZA6A 3BP5B 4L4VA 2ZUXA 1AHWC 2R1WB 3Q3GA 1J1XL 5IEHB 1BIIB 4WLCA 2D7MA 2ZKHH 1FNGA 2ZCHH 3D25B 5A40E 3OAZH 4G8FB 5CP3H 3LCYA 3L2MA 3D39D 4NWTH 4NRYB 4OZGA 3C6SA 5CEYB 3VD7A 1E73M 3SQBA 3SCRA 1JPGA 4WWKB 3NCYP 1A8JH 5JIIA 1SM3L 3HKFA 3MRIA 3ARRA 3QHZH 2A6JB 3VFNB 1DVFB 1U2HA 2NY6B 5FUCC 3DVNA 1AE6H 3IDXL 1RZ7H 2OLHA 3VRJB 5F7WC 5AG8A 1WCBB 1MH5A 4IMKA 5B38A 4HA3A 2CKBA 2NY3B 3BZFB 3HR5B 3Q2CA 4I77L 2AVGA 2OM5A 3GK8L 4M8QB 4F7TB 1WDPA 2A3AA 3F7YB 5DJYB 4F57H 2VUYA 3MLVH 4NUJB 1X5IA 2GDVA 5J06A 4R26H 1EFXA 1NAKL 1MCBA 4HJJH 3DV6B 2DSWA 1JGUH 5JPMA 1OSPH 3O0RL 5IBTH 4AMKL 2NNAB 2X89D 4LSRL 4ORGB 6TAAA 1IGML 5GRWA 4G6FB 4NT6A 2VQ1B 3AS0A 3C5JA 3C5SA 4W88A 3QUZB 4QRSB 3BJ91 2N4IA 2R9HD 1L6ZA 4KKNA 5GZNC 2V2WA 3SOBL 2IANB 3FY1A 3EDKA 4E5XA 1TVDA 1DLFL 3BISA 2QL1A 3C5ZC 1RH9A 4LAJH 1FO0L 3BDXA 4MD0A 1HP5A 2AABH 3A6BH 3TN0C 3C9NA 1KQZA 2NX5A 2NZ9D 3QIBD 3VWJA 1JZ6A 4XV0A 4M6OH 1OTSD 4AL8L 4PMNA 3TA3B 1V6WA 4DWSA 1Q94A 4JHWL 4JAWA 4WI6A 3NIGE 3X13A 1H8SA 2ZNXA 4CNIA 1PY9A 2X5PA 1H5VA 5AC4A 1HKFA 1XR8B 3TP4A 1EO8H 2VXUL 2APTA 3KDMB 3PV7A 3TTSA 3U0TB 1YA5A 1PG7X 3NYDA 1NGPH 3O8XB 4NNYA 1E70M 3DUUB 2P5EB 1UGNA 1ES0A 3PDOB 4HWZB 2AV1B 1OAUL 4YZFF 4WUKL 1UKSA 5CSBA 3MLYH 4WCYH 2NT1A 4OIIL 4OI7A 1MHHB 4YHMH 3MYJB 3QDAA 1KCRL 1YYMH 4CDGC 1QFWI 5HI5D 5CBEB 3O2LA 2MKWA 3O3AB 1RUMH 3T77B 5JDJA 4DGIL 2GTZB 2YL8A 3UMTA 3AB0B 1E28A 3W2DH 2QV2A 4P59H 4WUUD 4X0NA 1TA3B 3UZVB 2J8UF 3B83A 1C5CH 1EDGA 5T1LD 3VSVA 3OLDA 1VBUA 1TZGH 5ITFB 1CFQB 1A7BA 4HC1L 3AIRA 3SJVB 3VD4A 1DL7L 2OYKA 4OJFL 3W0WD 3V0VA 3EO9H 1CGUA 2FH8A 5HGAB 4NO5B 4P9ML 3S36H 4R6UA 3AISA 4GLRI 3QPXH 4R0LB 4NQCB 3G9AB 1A9EA 3N9GH 1JWSA 3NCFB 1RVFH 3DXAE 3H6JA 2KZWA 4P99A 3OXRB 4PJ9D 3KYOA 3W4RA 3E6FA 3P77A 4XAKE 5TH2B 1QO3B 4LOUC 5JA8B 5I0ZA 1GJUA 4F15B 2FD6H 3LH2H 3WJLC 2XIIA 3L4YA 4PJAF 1IAIH 2ESVB 1DEDA 5F3BA 5JPNA 2RHEA 5F7LB 4WJ5B 5DMYA 4UIKH 2VLJB 4XP6H 3W9EA 4NGHL 5DMKB 1JGLL 2OQJB 5F21B 1LP9A 4PJ8D 5AZ2H 1I3GH 2OS7A 1G7LB 4OCMC 1MI5E 4P2QE 5F9WC 3WJJC 5EULV 1GUVA 4ZFOA 3N11A 4XPAL 1TJGL 5FYKH 3KPSE 5D9PA 3HPLA 2IXUA 3PHOB 4KTEL 1PLGH 4QHNA 2WVVA 4FQ2H 2X4NA 5IB2A 5JUEH 2IBZX 3S88L 4NWUH 3PWUB 4GOSA 4TNVF 5CMAA 4F7MA 4QOKB 4LPWA 1G7JB 4UZUA 4OLUL 3BPLB 2OSYA 1SY6L 2VXQL 4Y8AA 1YMMD 3HI6H 4K94C 3D2UA 5DQ9A 3WXVL 3VNYA 2NPLX 3PQYB 4UQEA 1LD9A 3IDJB 1S9VB 4AW7A 3L3DB 2O26U 5C0DB 4OUEA 15C8L 3O6FD 4JHOA 1PEZA 3KLSA 4AQOA 4D71A 3TO4C 4KZEL 2C26A 4LIQE 2JF1A 4NM4H 5KVEH 1BIIA 2ICES 3KLDA 1ZHLB 4UTAH 1IGCL 1OM3L 3D25A 5DEGA 4XNZC 3MTRA 2C1OB 4G8FA 4OGAC 4Y0GA 2PUQT 3VFGL 1IAMA 3IFNH 1Q1JL 3WFEL 3C8HA 4UFIA 1SMDA 1FNSL 5KJRL 2VVSA 3O3DB 2W38A 3PHQA 3D39B 2F58H 3KEHA 1R34A 2O5YH 3AYSA 4LIQL 4CMHC 2WNGA 3VFNA 1JNEA 3BLPX 3QCTH 1DVFA 2RJMA 5E0QA 4ATLA 1M7DB 1R3HA 1HHGB 4KRMB 4F7CB 3I6LD 3NZHH 4F7TA 4JFDB 4M8QA 3F7YA 1JXKA 5DJYA 2Z8SA 4Q9CA 2BVQA 1LVEA 3DV6A 1HYSD 5DDHB 4ZTOH 1QNZL 5JA9A 2CJUH 4UCFA 3DRQB 1L9MA 4GKLA 4Z6AT 2QBWA 2IALA 3P11L 2J1KA 3UTTD 1US2A 1EJOL 3QUZA 4FNSA 4L4TA 1J88A 2GI7A 1J7VR 4O51A 4U1GB 1WWBX 3MUZ1 5KSAC 2RAMA 4FXGB 4P23D 1EDQA 1A7RL 4PP1C 1U91A 5B3JE 2W5FA 2L7JA 1YPZB 4NZUH 3QIUA 1RZ8B 5ITBL 4JY5H 1HKMA 3PP4L 4N0CD 4OM0L 5E6ZA 4D3CL 1A6UH 2D3LA 4KKBC 2X4PB 3NJ3A 4MAYC 5LGHH 1WDSA 5GNYA 2ATPA 3X3FH 5D2LF 3QIBB 4W7UA 5D1XC 3UBXA 3TA3A 3WNMA 1ITCA 4XH2B 3VX1A 2Q87A 2ZUUA 3VG9C 3S96B 2OJEA 2FEDD 2GTWB 3T3PE 1XR8A 4Z5RA 3QR3A 3L3OA 3KDMA 4X4XB 4GO6B 4P5TC 1E72M 5CJXA 1QFOA 3B4NA 3O8XA 3T2OA 3BIBX 3UJJL 4Z18A 2P5EA 1NARA 4LRIC 2NY0D 3NABL 1Z3GH 3PDOA 4C4KT 2IFFL 4M1RA 4QCEA 2FX9H 5D2NC 4NC1C 4OZGF 4EBQL 2PBGA 4U6HA 2FYYB 1CD8A 3LKQB 4DKAA 3BPOC 4GQQA 4LBEB 1OAZL 5HYJA 3MYJA 1QNQA 5CBEA 2GJRA 3VTRA 1GGUA 3V9FA 3O3AA 1T6VN 2YXFA 1CK0H 3UDWC 1OIFA 1I3VA 3VXSE 2I5YL 4JO3H 3TFKC 4S1DC 3HB3C 1QWNA 1CTOA 1HH9B 4WUUB 5E2TH 1GORA 3ORJA 3MOQA 5BRZE 1CFQA 3MBXH 1BJ1H 1L0YA 4XP9H 2YA1A 1QRND 1SQ2N 4A6YA 4TX6A 1OCWL 4GAFB 4IRJC 2VLME 1G7MA 4HCRA 4CU8A 3DGCR 5IB3B 3CFCH 4R0LA 3WIHL 2KH2B 2ICCA 4NQCA 4JPWH 4KROB 1T1YB 5F7MC 5C6PB 1AC0A 3VW3H 3A23A 4M02A 2X0HA 1NCWH 3B3IA 4WIQA 7A3HA 4M1GL 3CHDA 4G8IA 4XT1C 5FUZH 3MO1B 2R23A 2EDEA 3OXRA 3TYGL 3T65B 4YDLB 4PJ9B 2QF8A 5TH2A 1JRHI 1QO3A 1JGVL 3L3JB 1CLYH 3JVGA 1E6NA 1QZ1A 5JQHC 3SBWC 2AJSH 4PJFB 3E6HA 4TQEL 5HPOA 4FN0A 3WXWH 2EH8L 1KTDA 4JFFD 4DN3H 1FQ9C 4YK4C 2ESVA 5L6YL 3WS3A 1QI3A 4W89A 3K46A 2HT4C 4KVNH 5TDOA 5GISL 5GRUH 1EBAA 2P1YA 4HKXB 2EYSA 3CTTA 1HP4A 4DN4L 2BVOB 3KS0J 5DMKA 2FEEI 4EKJA 5M17A 1U6AH 4JM2D 2EDWA 4PJ8B 3AFBA 3BGMA 2ZXDA 5GGTH 3Q5TA 3WEOA 1BBJB 3LEVL 5CJBA 4KI5F 4KUZL 2F7PA 4XBPB 2F5AL 1D5MA 1K9TA 5CGTA 3V5KB 1ZGLA 4YQXL 3GMPB 4D9LH 4GKNA 1EZVX 4EXKA 5EBMB 3MFFB 3O11B 5IQ9A 2QSQA 3TT3L 3IJ8A 3SN6N 5JNYA 1R3IH 3UTPE 1YMMB 1MHCA 3SO3C 3IDJA 1S9VA 2X40A 4LHUG 5C08B 2WP3T 5C0DA 3TBSB 1A6TB 3U46B 3A22A 4UU9A 4C54A 1XIWD 2VLKA 3O6FB 3S36X 2LABA 4CMMB 2MJWA 1CTNA 4X6BB 4RFEA 3O3EA 1FNLA 1W2VA 1YEKH 2WWKO 2C1OA 3C6LA 4Y4HA 1CVRA 4U1KB 5C0EB 1KLUA 3NSMA 2QR0A 5FIPA 1T1ZA 3DYMA 4WENB 3SKMB 4J27A 2VDQL 4PJIE 2W9DH 3QUKA 1W8NA 1IM9D 3B9EA 6FABH 5EOCJ 3D39A 5F1KC 3MSDA 1HYRC 1ESWA 3EJTA 3KXFE 1A6AA 4P3CH 3FNDA 2J8GA 1CDIA 2FJFB 4ZNEA 5FYJD 3QISA 1WZ1L 2PYFB 2GHWB 5IROC 3NCEB 4PRIE 4JFDA 1T0OA 3ALGA 1S9KC 3WF2A 1FORL 4K07A 3WHE1 3IF1A 3EOTH 4MD4A 1BREA 2R2BB 3RU8L 1CDCA 4XP4H 4OSUH 1KCLA 3ULVH 2DD8H 2X70B 3MGAA 1A7QH 4IRSC 5SWZE 1B6UA 1FL3B 4P2RD 2CRZA 2EECA 3RIAF 4UV7H 3U4EB 3UAJC 3UTTB 4WF7A 1LP9F 5AY7A 3QUML 3RI5K 4AD0A 3TOPA 3ZKQD 2W65B 3MNZA 3BUBA 2OXHA 4AZCA 5AYQA 1MXGA 2UZIH 4MPKA 5FYLD 4P23B 1J12A 4CCDA 1RZ8A 1FAIH 3DOSA 4MXVF 4RCAA 2FBJL 4OB5L 4QXUL 1QR1B 3NZ8B 1HTYA 1JE6A 1NJ9A 4PMYA 3G6AB 1QBML 3WIFB 5AAMA 3WSUA 1U8KB 4XZUA 5DYOA 2D73A 2HMIC 3CUGA 3HG1A 3HCVB 1C8QA 4LPCA 4XBEH 4G7VH 3DRTB 2AXHA 2OK0H 3QI9D 3V4VL 2YUXA 3K1DA 5HBFA 2WW8A 5LCVL 4PLJC 3VMPA 4X4XA 1KN4H 2J88L 1KBKA 2DTML 2DLIA 5E99L 3V8CA 5F89B 5GGSY 4CUCA 1A6VL 4ZXOA 3RM8A 1H5BA 5AZEH 2HT3C 4YX2L 1XC6A 3BO8B 1CBVH 4ZAKC 2XTJC 5IM7A 2Y07L 2NY0B 3MLXL 4Z78B 4O02L 2EXOA 3HG4A 1FLRL 5CGMA 3PWJB 3GMNB 2ZJSH 1GZPB 4HV8B 2PO6C 4W68A 1ZTXL 2WM0A 4IMLA 3KYKL 4P0DA 2YDSA 2V2XA 1WC7B 3UX9B 2GK2A 3HE7C 4YHKL 4KRPC 5C07E 2X9XA 1NGZB 4HPGA 2OL3A 1QVOB 1HH9A 1MFEH 3OX8B 4WUUA 1MIMH 1GL4B 1MRDL 3DUSB 3QXVA 1MAML 3GB7B 4ACZB 4DVBB 4EE9A 3E8UH 4XX1G 2IG2L 5JHDE 3UO1L 1XEDA 3PZVA 2FX8L 4XX6A 3LMJL 2YL6A 3SGKA 4IIQC 5GGSB 1W2PA 4FQJL 4WY7H 3QFJD 3ZE1E 1T1YA 2PR4H 3X14A 5T1MA 4LU5H 1I3RA 4PY7A 4X6DB 3V5HB 3PIQA 4KVCH 5D6DC 2HRPH 2HVKA 1VENA 5I1HL 2A3CA 3T65A 1UEMA 4X80H 4WI3A 1M6OA 3O2DH 5EC1B 2ZOLB 5K59F 3MRDB 5CSUA 1P4IL 1LO2L 2B2XL 4BQ9A 1GC1L 5E7BA 1PY4A 4KHTH 3RX7A 2WB5A 5HTSA 1DBAH 2VX5A 1A3LH 1QFWH 4B16A 1J0YA 2ORBL 5K93A 3HNVH 4JFFB 3GBML 4WEUD 2SEBB 4WW1B 3KHOA 3UESA 2XACC 4HKXA 3BD4A 4PJBB 1OD0A 2BVOA 2XKSA 4PMVA 1CE6A 1KYOK 1XR9A 2XGBA 4ZNCD 3RWCB 4JM2B 3BPCB 3UPAA 1UQSA 4JRWA 5CD3A 1FNHA 3SE9H 4GLRH 3V5KA 1KWGA 4OTXH 3V6OC 4HWBA 2P8MB 4NQVA 4KQ4H 5EBMA 3VI4E 4BM7A 1DUYB 1RIUL 2K1MA 4HS8H 4OLWH 1GOMA 1GZJA 2JCCB 4MA1B 4P9HL 1QSFD 5IW6B 1T03L 3QG7H 4TTDD 3KWWB 3WBEA 5IVXE 4H25A 4RQQB 3PGCB 5DQJB 3EHBD 5C08A 1E4KA 3TBSA 5DLML 3U46A 4LXFA 5IHZA 4FNPA 3VNZA 2YZ1A 3H3PL 3O6FA 3KYMB 3WFDH 2DI8A 2VWEE 2RCSL 1ZLVH 1B0GB 1XIWB 2W0PA 4NXKA 3THMH 1CLZH 1WIUA 3QDGE 5B8CC 4X6BA 3BRDA 5C0EA 4N8PA 1IGTA 3V5DA 2V5CA 3D3VD 3P0VL 3SKMA 4B41A 3ZKMC 5F96L 3QWRD 2VNCA 4R4FH 3A67H 5HI3D 4Y2OA 3HG2A 3U4BL 1IM9B 4TN9A 4BELD 1ODZA 5HJ3B 4PB9H 3G6JA 3RDTC 2FJFA 5LXGH 5AUMA 1YJDC 1XSKA 2ZKHL 5IB1B 2D31A 2ZCHL 3IS0X 4MWFA 2LU4A 1H1NA 4L3EE 2WBWB 4JE4B 1OWRM 3SE8L 4NWTL 3HAEA 4GT7A 4M9PA 5MENA 4BZ1H 5EO1B 2J74A 2XN0A 3O6AA 4AXNA 4K2UH 1MY7A 1BVNP 4AZIA 3QHZL 2YRLA 2X2JA 4ZD3H 1NCAH 3EYFA 3KPLB 1NAMH 5D72L 2UVFA 2CHOA 5H37G 4PMZA 4X99B 5JMOC 1AE6L 4ZPVA 1RZ7L 3JTTB 4LAQH 4FFWC 3SE3C 3U7WH 4P2RB 1L4IA 4WFFE 4MCYB 3OJVC 1MCKA 3UBXI 3TIEB 4F57L 2W65A 3MLVL 3WD3A 1P84J 4R26L 4P4KB 4W5ZA 4HJJL 4QKXB 5DJDA 3QUXC 1EVTC 43CAA 4ZUTA 2CLRB 1OSPL 1A7PH 2B1HH 5IBTL 1T4KB 3PL6D 3K4ZA 4WI5A 4KUCD 3BUIA 3MLSH 3G6AA 3WIFA 4PSPA 3FRUB 1QLRB 3W9DA 4HHAA 1KJMB 2BX5A 3HCVA 4OLZH 3ARGD 5MI0B 4UQ9A 3SCOA 4ZYKA 4OZFG 2YPLA 1CDGA 1R85A 3KR3H 4PLNC 4PCTA 2VH5H 3B9KD 3QI9B 3EO1B 3RWEA 2AK4A 2AABL 3A6BL 5F97E 5BZDA 5C0BA 1JFQH 1KG0A 3P4OB 3HZVB 4BZYA 1V02E 3KJ6H 1G1YA 5E4EB 3VJ6B 3VD5A 1I1WA 2EIZB 4BFIB 1OF2B 4UT7H 1RI8A 3FXYA 3QCVH 4AY1A 4M48H 4NZFA 3CX2A 1ZLWH 3O6LH 2DQDH 4F58H 1UWUA 1INDH 3VDBA 1TCMA 3PWJA 1G9NC 5FGSA 3S5YA 4BSWB 1W9UA 2XWEA 1N4XH 2EE3A 2O61A 1X5YA 1EO8L 1KTLB 3S97C 3PZMA 1Y18B 4NDMB 5FYJH 2R0KH 5F1SA 1VJSA 4P2OA 4PRAB 4PRPE 3M1BB 2KL6A 5LGKA 3QNZB 1EEZB 2IQAA 5IESH 4HK3N 3RFZC 1L7IH 3CAFA 3PTMA 3N06B 3EYQC 1X5XA 4DVBA 4YHML 1TUXA 3X3GH 4MYWB 3CZKA 3LSOA 3AMKA 1YYML 5INDB 2Z31A 1CLCA 7FABH 1AO7D 2GT9A 4DKEH 5T33H 1WCQA 1RUML 5HHOE 1KBGL 3NDZA 1RUKH 3GXDA 4F33B 4BSVA 1TCRB 5BV7B 3W2DL 5F71A 3QFJB 4P59L 4ZUWA 1J05A 3GH4A 4X6DA 1Q0XH 3PZUA 5GJSL 1C5CL 2XY2A 1TZGL 1S7XB 5ICXB 4QCIB 1R5IB 1N3NB 5C0GA 5EC1A 2QPUA 5IR1A 2ZOLA 4RBPK 3UTZA 1KJ2H 1PJ9A 4JG1H 4PGDB 2TAAA 2PWFA 3EO9L 1KCKA 3BXNA 2EXWC 2DQHH 1QFPA 5CGYC 2PC8A 2IADA 4PD4J 3SGEI 3QPXL 1HKIA 1ZMYA 4K3JH 3N9GL 5T3ZH 1VPOH 5EU3B 4EVNB 1Z6JT 1RVFL 5A16B 4ONFH 2FHFA 3NIFE 3GJFB 4S0TD 4G6AC 1K4DA 1DEEB 5A2FA 5CKAA 5D7IA 4HIHA 4H0HB 1RP9A 3BIAX 4PJBA 2ZX8A 1IVLA 1T20B 4RIRA 1E55A 2JIEA 5TGBB 1CICC 1QPKA 4JFTA 2FD6L 3BPCA 2CIIA 1FL5B 3S4SB 2EYRA 3DGGA 1OP3K 1X44A 4MDJB 5BJTB 4DK3A 1IAIL 4MJ4A 1SZNA 5IJKA 1NANI 2R2CA 2HKFH 5F7HA 2ID5A 3JWOC 3RL2A 3VIJA 4UIKL 3R8QA 4XP6L 3LDBB 2P8MA 3FRPA 5AZ2L 2XZZA 1V05A 1I3GL 3RWHB 4NUGH 1AXTH 3AY4A 4JFQB 2Z92A 5ID1B 3G04B 1FSKB 4S2SB 3PHAA 4CU7A 3HE6D 2JFEX 3AS2A 4BF7A 1JZ2A 4JKPH 5JO5B 4D0BA 4RQQA 2CDGB 2Y1VA 1JRHH 1QSFB 3MNWB 3PGCA 3OZPA 1PLGL 1YMHB 4MMXC 4FQ2L 4X6EB 4LVHC 3O81A 5BRQA 5JUEL 1SYVB 3KYMA 3MRLB 3B5GA 4NWUL 4F80A 3PZTA 1B0GA 1XIWA 3BVVA 3Q6FA 3E2HC 3SJVE 4FFYH 3VDHA 3LKNA 1CLVA 4GZEA 3SKJH 4X7EC 1D6EA 2G3JA 3U0PB 4JFXA 5CINH 3PZIA 3V95A 3F12B 4F8QA 2LVEA 3FFCE 5J57B 5DFVC 2VX4A 4NM4L 2DLGA 5CP7A 1J0KA 4JPVH 1UG6A 2NYYD 4JZJA 5A3IC 1I8LC 5IB1A 3U2SB 4UTAL 4KGJA 1QLEH 3QG6B 1O6IA 3E0GA 4HFWB 2FGZA 3BDBA 3CPLA 1TZHA 1FIGH 3IFNL 2PN5A 1OAYH 1RMFH 1EHLL 3HMXL 1KCUL 1M53A 2BXYA 3TGXA 1SVZA 2F58L 2HYMA 1SJHA 2O5YL 4FMVA 1OGBA 1MCHA 3QCTL 4MNHB 2BNQD 4GFTB 3MRBB 3DDFA 4M5YH 1UWRA 4M82A 4DWHA 3RUGB 2DQGH 4KK9C 2X1OA 3NZHL 5LA0A 2P49B 5D9SA 4CAGA 3ESVF 1KPRA 3VXOB 2QJDA 2QTEA 2V9TA 1U92B 3LKPB 3RVWC 4P4KA 2V3GA 3POHA 5A6BA 4L3CA 1KC5H 2BVPB 3SDCD 3UTQA 5IFHH 4ZTOL 1OIMA 2CJUL 2CBVA 5JW5A 3EJRA 4PY8I 4GMTL 1T4KA 3BKMH 2NZIA 3WF1A 1C8XA 3HS0A 3PL6B 4FZEH 3FRUA 1J87A 2GUOA 2PW1B 4Z7VB 1KJMA 2H2SC 3ZSSA 5J12B 3CHFA 2Q20A 3PQYE 3MXVL 5JMRA 1UYQA 3ARGB 5FIEA 4LPVA 2APWA 1NP0A 1CD0A 1NOUA 3NCCB 2RBLA 4NZUL 5DGQA 3L4UA 3ARZA 4JY5L 4BK4A 3BYTA 3B9KB 3EOAA 1A6UL 4LMQI 3P4OA 3HZVA 2AJXL 3VJ6A 4I5BB 5FOJA 3X3FL 2XSBA 2Q6WB 3IT8D 3UETA 4IRZH 4EIZC 4ONHB 5C6WH 1KT2B 1NM9A 2J2ZA 1KTCA 2VZTA 3RJYA 2NY7H 5JQ6H 3OGCB 5FF6B 1JPFB 3VXTA 2J78A 4BSWA 4QCFA 5IP4A 5J6GA 2XWBA 1CI5A 1G9HA 5TJWK 1OD8A 5B4MC 5HGHB 2VDNH 4FQXA 2XZAH 3LRMA 4BZ2H 3ECBA 1VESA 3AC0A 3G6JF 3SDXB 1Z9SA 3OKDB 4LCCA 3JTSA 4NDMA 2FSEB 2NLJB 3A3HA 4YXKH 1WK0A 3VGAC 1Z3GL 3NAAH 1MRFL 4ZEPA 3AMCA 4B53A 3M7SA 3OGVA 4MB5A 2LTQC 1IC1A 1N59A 3CUPA 2FJGB 2G75A 5H8DA 2BP3A 3QPQD 2VQTA 2DJ4A 3OLEA 2BVUA 3T2PA 2BSTB 4JEGB 4LSTH 5EC2B 1CK0L 5BS0E 3WUGA 4QXTB 3PWPD 1V5JA 1AO7B 4P49A 4JO3L 1OB1B 1TCRA 5HYSG 3MUGB 1W1VA 4O2CB 4ZXBA 3DSFH 2F15A 5AD0B 4OCYH 2HJLB 4IDJH 4GMSL 5E2TL 1Z32X 3V6ZB 3W11C 1HNYA 4TVCA 5ICXA 1S7XA 3BE1H 3MBXL 1R5IA 2F18A 4XP9L 2ADIA 4QHLA 2ITDA 5CEXB 5EZJB 3RCNA 5MHSD 1YYLH 1YEHH 4IISA 1R3KB 3CFCL 3STZB 4NQDA 5DJ2B 5DJAB 3RILA 3FN9A 5E2JA 3VW3L 2UWEB 1DN0B 4EVNA 3CLWA 4NKOB 2BNUB 1NCWL 4MX7B 2YD8A 3DBXB 3DX6B 2DJSA 1PQZA 5FUZL 1XGQA 4PMRA 3ZT5A 3EJZD 3GJFA 5KSBE 4ZSOB 4PJEA 1F13A 2VX6A 3TM6A 4ELKB 1MFVA 2F9BT 3CFEB 4Y88A 2WLYA 3ZLQC 4BSJA 2BDNH 2AJSL 1YN7B 3W0KA 2CLVB 2FDBP 4MQXC 5DURD 3WXWL 3RNKB 3DX8A 4AT6A 2F7RA 1G1CA 4FF5A 3G6DH 5BJTA 4MDJA 1QQDB 4DN3L 2E9LA 5D6CB 3ZKND 5MERA 3S5LG 2AJVH 4KVNL 3L4ZA 2XSAA 3MV9D 43C9B 5GS1B 2K9UA 1BGGA 5ECJE 1JP5A 1WO2A 1U8QB 1U6AL 1JJUA 4HIJB 3QH3A 5FA4B 3HZMB 3FN3A 1KXTA 1AHWA 5GGTL 4HBCH 2CDGA 3MJ8B 5EWIL 3VGEA 3HE6B 1KPUB 2VR5A 4PJXB 3X12A 4M7LH 2P48B 1SYVA 2APVA 2YDQA 4QRRD 1AY1H 1R8LA 5FOBB 3K0WA 4D9LL 4OCXH 4CJ1A 2FR4A 1UT9A 1TPXC 3S3SA 4CN6A 2A9NH 1Q9OA 3GHEH 3AIWA 1R3IL 3QXUA 3W0WE 4XMKH 4GRLD 1L0XA 1U8LA 5MEQA 1VEOA 1U3ZA 2HLAB 3F12A 1XF3B 3W24A 2EDBA 3ARED 1DBJH 2X9YA 4X6DF 1WAAA 3L3KB 3OZ9H 4AIZB 1OAQH 5CSZA 1RZIB 3WIJA 4DKFH 1OPGH 1YEKL 4G5ZH 1I7UA 3RVUC 4H26A 2W9DL 3VXRE 2CPUA 1P53A 2C7UB 6FABL 1WDQA 2DWEB 3MOBH 1I9IH 1AXSA 4P3CL 2IPKB 4KPHH 4PEEA 1JV5A 4AG4H 3ULVE 3VDAA 3IJYA 1XF5A 5B3NA 4GKZB 4FNRA 5D7IF 4W6WB 2BNQB 1S8DA 1PAMA 2Q86A 4PJBF 5DK0A 3RUGA 2YEZB 3C5ZA 4NZCA 3OA5A 3BJLA 3U82B 2VKXA 2GFBA 2OYPA 3I6KA 3TN0A 5ACZB 4YNYA 3RX5A 3EOTL 2IJ0C 3NGBC 3S3PA 4XP4L 3UEQA 1RJYA 2X1PA 3SDCB 3ULVL 4HPHA 1JAEA 4PJ5E 2DD8L 3FO9B 3DROB 5FK9B 5JUVA 3LRGA 4UV7L 4LHJB 1ZS8B 3V4PH 5JIKA 1UYWH 5D1QC 4YC2C 4JL1A 1B30A 2UZIL 5KANI 1U42A 1I7RA 5ABDE 2FWOA 4PD4K 1T0MA 2YD6A 1KULA 1VGEH 5CLWA 5I1AB 5D2NB 4OKDA 3QAZC 3BPOB 4X4YB 4ONHA 3V7MA 1JGIA 1X6LA 3NVQA 1KT2A 3OKMA 3I3BA 4G7VL 4NSKB 4XBEL 3TWCH 1CU4H 2J5LB 2ZXBA 2EDLA 3FAXA 1IQDA 3OGCA 4OFYD 1M7XA 5FF6A 3TTOA 2ZCKL 3CH1B 4XGZB 3CDFA 1E6JH 3UJIH 2OMNA 3VWKD 1KN4L 2Y9RT 5DJCB 1P6AB 2AEIT 4H1LB 3HUJF 4NN5C 1G7QB 3GSVA 2VLLB 5AZEL 4KKLC 2R0ZL 1S7SB 1CBVL 3ZE2E 3KPRD 1OY3B 2OTWB 1MUJB 5DUPH 1TZIA 1T04B 3VFTB 4OLVH 2ALWA 3PGDB 5IHLB 3P0YH 1AO7A 1DQQB 1XGTA 1QSVA 1SJXA 2C3GA 3PWPB 1FHGA 2W67A 4O2CA 4OZ4B 4OF8A 1QUNA 2OSLB 5AD0A 1MFEL 3OSKA 3H54A 4Z7QE 3OAZK 2YFOA 3V6ZA 3MV8A 3D52A 3OB0H 2IH3B 3MV7A 4W4OC 3E8UL 2GK0B 1IGYA 3WJLA 5CEXA 1RZKH 2A83B 5A2KH 5EU6E 3MQIA 5TDPB 5FGBC 1R3KA 4WY7L 4LSPL 5AEAA 3ULUD 2PR4L 1V3LA 4KGLA 2UWEA 1DN0A 4W6XB 5CILH 4NKOA 4MX7A 4N5EC 4LU5L 2JF7A 3DBXA 3DX6A 5ELIA 4NJAH 3WLBA 2P43B 4KVCL 4A6YH 5J8OA 2G3MA 3ULSA 3OB8A 3WJJA 3FB6B 3K80A 4MXQC 4X80L 4PTTB 4ELKA 3CPUA 5FL1A 1S7UA 5ADOH 1ZLSH 3O2DL 1AD0B 3EZJB 4DO4A 1PYWA 2DKUA 4YFLF 3TNNB 5EZIH 1YN7A 3A6OA 2O9TA 5BYWA 2HISA 2ICEA 2CLVA 5C0IB 4QT5B 1DBAL 2CDFB 1A3LL 4JQXC 2JK5A 4H5SA 1MFCH 1BVLA 5DURB 5C0JB 3HNVL 1ZHNB 5D6CA 3REVB 1QPXA 4E0RB 5E5MB 5E2WH 5D9NA 1BAFH 1J1PL 3I6GA 5GS1A 1NC4B 1PKQB 4K8RD 4QYOB 3BAXA 3MV9B 5D8JL 4IS6A 2J77A 3CD4A 3FFDA 1F4HA 3LKSB 5F1NA 1NBVH 3HZMA 4PJ7A 3VFSB 3I50H 4PRHB 4NO0A 1HXYB 4D6EA 1R24B 2CPCA 3LD8C 1NP2A 3MJ8A 2PTVA 3OHXB 1E5JA 2RFXB 3HE6A 1RURL 3SE9L 2C5DC 3SGEH 3ZZ1A 4GQRA 4JPIA 4FXKA 4OTXL 1NGQL 5TE4H 3BSZH 1O7VA 4QRRB 5C09E 4KQ4L 5C8BB 1E0VA 4OF5A 1HE7A 4HX1A 3VA6A 1QRNE 4HS8L 4OLWL 1HH6A 3QG7L 3OJDA 3JWDC 1I1AD 4ELMB 4Y7EA 4WRLA 1V3HA 4LDEB 1GHFH 2WIIB 3LB6C 3WFDL 1BFVH 3AREB 2IGTA 1RZIA 3NIYA 3THML 1CLZL 4KJWC 2R0LH 1W72B 4LLMA 1R5WA 3ZT7A 1SFSA 4P46C 1NANH 3DX7B 1BLNB 4GXVL 5GGRA 1T5XA 1MNUH 5DS8A 4R4FL 2C7UA 3A67L 5DZLA 1PKOA 2I60H 4XCFL 3NUKA 4GG8B 4KMTH 5HGBB 4MNKA 1MVYA 4GRMB 1F02I 4PB9L 2C7FA 4G8GA 4CL7A 1ACYL 5LXGL 3ZE0E 5KSAA 4GKZA 4PJEF 2QMKA 3RHWF 4YZFE 2VSCA 4X6FA 4E8DA 2J4WH 1OTTD 1JF5A 3MBED 4DZBB 4WHTB 5BW7C 3T0AA 4NZDA 5I8OH 2VZOA 2X7LB 1Y0LB 4LCWD 3W39A 4MAYA 1CFSA 4K2UL 1GGCL 5A43C 1RHHB 2GEEA 1CECA 4XNMA 2DYPD 4ZD3L 1NCAL 3SDCA 3V6BR 1A1NB 1NAML 4JLRB 4Z8FH 1UA3A 3DVGA 5D4QA 5I17B 4BQ6A 3NTCH 1A7NL 1URLA 1JHTB 2J8UE 5FK9A 2YUVA 5IFPA 1JZ4A 4XWOC 1TQCC 4LAQL 3LEYH 2YHGA 1HN1A 5C0ND 4R4BB 1N5YH 2JCCE 4HZ8A 3ARXA 1A2YB 4P5TA 5DO2D 3GMMA 5EBWA 4KK6C 1UQYA 1A7PL 2B1HL 3MYZA 4LRIA 1UH3A 1M04A 1ITBB 3T09A 4MD5B 5F7FA 3RTQC 1D5IH 1E4XH 5KSVB 5I1AA 5D2NA 1UWSA 2PWDA 3MLSL 1JGEB 2ATKA 4KK8D 2BVDA 5CHNA 1KB5H 1WVZA 2G9HA 4TVPE 4X4YA 2Y36H 2HFFB 5GRJH 1Q6DA 4GZJA 1RUAL 2JKXA 1GIGH 2UV3A 2WMPA 1W2KT 5E6ID 3UDWA 3LXCA 1BP3B 2VH5L 4X4MA 2OR9H 3CH1A 3OR6A 4HJ0D 3HNSH 4KRPB 3EW3B 1WAAF 4PJAE 3KJ6L 3T8XB 3VWKB 2DAVA 3GXFA 4H1LA 1Z2KA 4TVPL 3GM0A 4PBXA 4UT7L 1G7QA 1C3FA 3L7FA 1TQVA 4NP4L 1S7SA 4M48L 3O6LL 2DQDL 3P73B 1INDL 4QRUB 2RIKA 4YXHL 3FAWA 3ZJ8A 3KPRB 2Z93B 4NRSA 3AIBA 1YY9D 1Q72H 2YZ8A 1T04A 1N4XL 1J1OL 4JFZH 3UTSE 5IF0B 1D5BB 3PGDA 3IKCA 5ESQB 1DQQA 1MCQA 2A73B 3JBG7 5I73B 2R0KL 3II1A 5JOPE 1V0LA 4OZ4A 3BP7B 2ZUYA 3F5KA 3RPIA 4E42A 3QEQD 1MJ8H 1HJQA 1F5WA 5D7KD 5IESL 4MAUH 5FA3A 4XUYA 1L7IL 4P2CG 2I