1J0HA

Crystal structure of bacillus stearothermophilus neopullulanase
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
588
structure length
588
Chain Sequence
MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLYSGEEKLVYTEKGFYFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPSISPEGSRPWGSEDPTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGESSKYKDWFHIHEFPLQTEPRPNYDTFAFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRSLRRGEISFLHADDEMNYLIYKKTDGDETVLVIINRSDQKADIPIPLDARGTWLVNLLTGERFAAEAETLCTSLPPYGFVLYAIEHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords neopullulanase
total genus 194
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.2.1.135: Neopullulanase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j0hA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1j0hA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1j0hA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1j0hA03
3L3JB 1WGOA 4XP4L 3FB7B 1ZLSL 2CCRA 1F42A 4NO3B 3AIQA 4O5LH 3L5JA 4MNMA 2ITDA 3MRJB 3GO1H 5C0AD 4G9DA 4LCWA 3QI9A 1T21A 2A9MH 3B5HA 3NFPA 1OY3B 3NFNA 4MA7H 3SE4A 1FGVL 5IGXL 3K3QA 1WZ1L 1KENL 4N8VA 2Y4SA 1VGKB 4V1DD 4QF1A 4TSCH 4EAMA 4FZ8L 2P4AB 3IJHB 3WNNA 1I7ZA 4HFWB 3HZKA 4OQ1A 1A9EA 4ZFOL 4H04A 4DQOL 1CT8A 4JPIA 2PR4L 2AEWA 3E6HB 1NUNB 4GXVL 1CU4L 4U3AA 4Q9RH 3BPNC 1A64A 1I7UB 4LCWE 4YZFF 5ECJE 2BRQA 1LO2L 1T1WA 2YSSA 5L9DH 5DVKA 1FL6A 1HH9A 4IRSB 2OL3B 4AYFA 1GHSA 3QHFH 3AS0A 4Z0BL 3ESVF 3L3GA 5B8CC 4JFTA 4LX4A 2ZUWA 1MCWM 1KIUA 1NOUA 1UCBL 3KPSA 3AXHA 1E6QM 3MUAA 1D9KC 4PGJA 2UWEE 1U3HD 1QRNE 2EXYC 3MRMA 4W6XB 5FKAA 3VFPB 4CKVX 3IVKB 1WISA 2YDQA 1ZT1B 3D85A 2X4NB 3ULVL 1EUTA 4O00A 3AUVA 2BDNL 4JFZL 3H9ZA 4WWKB 3SURA 4QXGL 1N59B 4HUWA 2YWYA 4I2XB 3BVWA 1QLFA 4D94A 3WDIA 1M6OB 3ROLA 4EIZC 3MKKA 2E9WA 5DC9B 2ADJA 4XV0A 2OLDA 2CKBA 2WIMA 1C8PA 4XP9L 4PJDE 3LH2H 4Q9RL 2BNUA 1IEBA 3C2AL 4JVWA 3T0EC 3GSWA 3RZCA 1HI6B 1ZSDA 3WKMH 4F7CA 3BPCA 4K07A 1OSPH 1U3ZA 4S1SH 5FO9A 4YXLL 1RAMA 4C7FA 3GSOA 2RBLA 2P8MB 2BVPA 2X4OA 2DI7A 1SJEB 4JFDE 5JZ7C 1MIEL 1BOGB 1VGEL 2HG5B 4R7NA 4WHCA 5J1TC 3I75B 3MRHA 5I1IL 1U6AL 4JR9L 3EYPA 3WN5C 4OIFA 3QDJA 4KTYA 4NXKA 1FZKB 4U3XA 2H26A 2P5WA 1VFOA 2A9NL 3CSPA 1U95A 4GQ9L 5I0ZA 1KLGA 2BSED 3ECBB 4ETQB 3VDBA 3VFNA 5EB8A 4HX1B 1GPFA 4W81A 4B50A 4I3RH 3SUUA 1S9KC 3ULSB 2HJFB 2VDML 4F7TA 5D7LB 1N7ML 2DD8H 2DT1A 5JA8B 3LS5L 4LF3B 5IFAL 4HG4K 1I1AD 2ZXAA 1UM5L 3VA2C 2X4OB 2NY1C 3DVIA 1BVKB 4Z5RB 3IGUA 1ZVSB 4AM0B 1V0MA 3T0AA 4HWNA 4TOQA 5FHAH 2YZ1A 3WH6A 2I26N 2NW3B 1TENA 3A4AA 2FYVA 1VCAA 35C8H 3O3BA 4D6DA 1YEKH 2XG4A 3G5VB 4OLYL 4C7DA 4XPGL 5E8EB 4JL2A 4ZD3L 2C3WA 2VZOA 2PYEB 4J4PD 4EI5D 1KTLB 2Y9RT 1BM3H 1W2PA 5EOCH 5A8NA 3O11B 2XUCA 4ACZA 3BP6A 1QRND 4GAGL 3CFDB 3HE7A 3JV6A 4NJAH 1K6AA 3F7PC 5C0FA 5ADOL 1ZA3A 2YXFA 5D9MA 5JUVA 1U8PB 3LIZH 5BRZA 3RDKA 3RI5F 1G7PB 2DBLH 4Y7EA 1EGJH 3MROA 4MJIB 5C7XH 4L4VA 5KS9B 3ZT5A 1UKPA 2XI9A 1CFTA 1XGUA 3QO1A 2W63A 3LB6C 4NO2B 2P46B 2OSWA 2UYLB 3PABA 5B3JE 1PG7X 4ESKA 2R2EB 5FUCC 1X7QA 4YK4C 4WHYG 1GOIA 4ZPVA 2HT4D 3X3GL 5HDOA 1BBDH 5B38A 2ED8A 3NPSB 2E0PA 2V9QA 1FRGH 2H9GB 2ADIB 4PY8J 4W8BA 1GZPA 3GMNA 3LQMA 4I3RL 4X4YB 1NQBA 5LQBL 1CXKA 4LSRL 4N0RA 5D7JD 1ISWA 2X44D 1FNSH 3EKCA 2H3NA 5LA2A 1XCWA 4WHYH 3T4AB 3HR5B 1LO4H 1ODZA 2Z31B 3LKSA 2EH8L 2W61A 3NYDA 1QO3A 4KKBD 4RGMC 3ZR6A 5E2JA 1JGEB 4KJPD 3X14A 1N5AA 2FHCA 1W0WA 3O81A 3S97C 2D9CA 4KJYA 1MFVA 2XNAA 3DUHA 5H2BA 1CBVL 1B3YA 2IPTH 3AMCA 2B20A 3UBXG 2FGLA 1U3YA 3MSGA 4IOFC 3HE6C 1OAYH 5E4EC 3S35H 1A21A 4GKNB 1QFHA 4LCUB 4MQXD 2E4TA 3E0GA 4Y4FA 3LSOA 3MNVA 4P4KB 3X11B 1FIGH 1RUPL 3CDYA 2E27H 5GRZA 4K94L 2TAAA 1NCBH 1N82A 2VC9A 4JY4B 2VAAA 4RGOL 3H0TA 3K81A 1FP9A 4XVSL 1H5BC 3DMMA 4HULB 3T8XA 4MJ6A 5D1XA 3M17A 1YNKH 1F58L 3AS3A 3BUQA 5DEZA 3VGAC 3TFKC 2J5LB 1DJSA 2B2XH 4LLMA 4X4XA 5ERWA 1TUXA 4Y88A 4CDHA 1L0QA 1FE8L 1G7LA 4LGPB 1JWUA 1O7AA 3GBLA 1UQZA 1EO5A 4YBQD 3EOBA 1F5WA 1ZT7B 3V6FB 2R0LL 5LWYL 2C26A 3BAJA 4ODXB 5A43C 1TJIH 4PJ5E 1GQJA 2B2XL 1OIFA 5GXBB 1BQLL 4ZFFB 1MCFA 4QY8A 1IT9L 5E6IB 2PW1A 3WO4B 4LVNB 4PRHB 3OL2A 5MEOB 4LDOB 2MCPH 3DX0A 5GGUB 3QUKB 5GJTL 1MI5D 1RJZB 5FUCE 4JGMA 4ELKB 1BFOB 5F3HA 4GO9A 5EORH 1X9QA 3II1A 5JHDE 4MAZA 4XNUL 5D2LB 3C6LB 1IBGL 5C08D 5ITFA 2W5FA 2A6IB 4XVTH 4FHBD 4OF0A 2VXSL 1HHHB 2Z31A 1EHAA 1YDPA 5EZOL 3HR5A 3T4AA 2NXZC 2R1XB 2J8HA 1UWTA 1I4FA 5CSZB 5F9JB 2NYYD 4XNUH 2WHJA 4QT5B 2YD4A 5EB9A 1YHTA 1VFMA 5DUBB 2A9ML 4NO5B 3APGA 1QR4A 4XBEH 3AQUA 3RWHA 3CU7A 3ULUL 3Q2CA 4GI9A 5E2UH 5EOTA 4PSRA 5DDHA 3U0PB 4MXQC 4LEOB 2VITB 4U3HA 4GSDH 5FA4A 2MCPL 3FRUA 4ONHA 4K8RH 4GRMA 2BVYA 3PHOB 2UYLA 3B5GA 3PABB 1TMQA 1IC1A 1OOAA 1R5VB 4UB0L 5ID1A 5I79A 5JO5B 3C09C 2BRRH 4JZNB 4M9OA 5TJWK 3CC1A 5FOOA 2EIDA 1CFSB 4YPJA 3BZ4A 4TUOB 3KR3L 3VFUA 3ZYJA 5GGSA 4MB1A 3ZLQC 3MRPB 3O8XD 5AYQA 1NEZB 4GAJL 2AXHA 3O11A 4UOJA 1G6RH 1KIPB 1RPKA 2OL3H 1UYQA 4PMZA 2CIKB 2X0YA 1FHGA 1AC0A 3N9GH 4FS0A 2P7TB 3GMLA 1X5ZA 3UTTA 3KLAB 2NY3B 2H32B 5HVHC 1RUAL 4NBXB 4M62H 1J8HE 1QI0A 4YHML 1H8SA 4HIHA 2BNRE 5GS0C 4R8WH 2ZWZA 2GUYA 1WNOA 1JGVL 4JRYE 3VGGA 1B0RB 4EANA 1TQBC 2G4FA 3MRDA 3GJEB 3DX7A 1AH1A 4U1HA 3ARGC 4LF3A 2O5YH 3WKZA 3WFHA 2YJQA 3ULSA 2VL5A 3QIBD 3VFWB 2I24N 4HX1A 3RGVC 3X12A 3PWJA 3GKWL 2QMKA 1ZMYA 4XNYH 3MRDB 3WDPP 4FABH 5CBAA 2JIEA 4LQFL 1PKQE 1S3KL 3QISA 4PYGA 3ULVC 5D8JL 3O9WC 3BIKA 4OZFG 1HZHL 4DZ8A 3F65A 3LS5H 1N4XL 2D22A 3WBAA 5LYRA 3GMPB 5GRUH 4XAKD 1XGRA 3W0WE 5JZ7D 1HINH 4NKIL 3LRMA 3C8KB 3RVWC 2Y6SC 3KPTA 5E95B 2DIAA 5IVOA 2HG5A 2DQDH 4BZ2H 5CZVL 1FC1A 4S2SB 3VXNA 2FGWL 2VDOL 2XKSA 5I0DA 3WEZA 2EXWC 2G3MA 4JJHA 2J78A 3VFWA 2AQ1A 1MRDH 1U92A 1ZAGA 4KQ3H 1ZSDB 2OS7A 3CSBA 2ZX8A 2BNUB 1I8MB 2DT0A 2W59A 4HXAH 2D2OA 1G9MC 4FTVE 3VXSE 2V6HA 1T03L 4QLRA 1A2YB 4WGVB 4WI6A 4JZNA 4AMCA 1EIBA 1UWEH 3WHE0 3A3HA 4AD3A 3V4UL 4PBGA 3HC3L 3U4BL 4ML4A 3WYRA 4M43H 1GGYA 2VCAA 4I0PC 3L5IA 4GW5B 2YC1A 1VKXA 2DQGH 3LEVH 3RUGB 3RVTC 3S35X 4Z76A 3LS4L 3MI6A 4OD3L 4WWKD 3NVQA 1LVEA 1CTOA 1AE6L 2V3FA 4P8WA 1JNNL 3JWOC 3KLHC 3G6DL 4ZOBA 1RK1B 3LH2L 3ARDC 1TDQA 2APFA 2PTVA 4M00A 5I15L 3QXWA 3RDTD 3I85A 2FO4A 5FYKD 1S46A 3KPSB 4N9OB 3RIFK 1HHHA 3U9UA 1B3ZA 4BZYA 1EERB 3BP7A 4GAYA 2A6IA 2BXZA 2EYSB 2GEEA 3TA3C 5JBFA 5IJVB 1JWMB 1P6AB 5I3DA 1F4WL 2XTJD 1XR9B 3JSSA 5JBEA 4G9FD 2EEXA 1FNHA 3MRCB 3RU8H 1U2HA 2BSRA 1BFOA 5EU7E 5JO5A 4LCIL 1KR1A 2Y6SD 3KXFD 1CICC 3FRUB 1E5NA 5MEOA 2PWDA 1EMTL 4M24A 3WY1A 2FH6A 5LA1A 5DDHB 1EFXB 4ZS7L 4QO1A 1KLUA 1DANU 2K1MA 3BT2L 3SUWA 1IM3B 2OQJB 5IQ7H 1FFRA 5BRZD 3LHPL 1G9NC 1IAII 1L7TH 3NFPB 1T21B 2J62A 4G9DB 2DQUH 1HJUA 1R7OA 4LLMB 1PVHA 5ERWB 1EJOH 4BS0A 4HIXL 1UZ8A 1T3FA 1BFNA 3TLRA 3X3FL 2MANA 3SCMB 4XPBL 2DQGL 3LEVL 1UZ6E 5L8JB 4XHJD 1D5XB 2AK4D 3HG1D 3CFEB 2MQ3A 1ZWIB 5L0QB 3UXFA 5KVFL 4JN2A 3U4BH 5I77A 1UR9A 1KIRB 2C1OB 3L5XL 4JGUA 1IC5H 3GMMB 2P5EB 1N8ZA 1QR1A 4J4PC 5GGUA 2IAMD 4EI5C 3NGBB 1VEPA 2YIHA 3MGOA 3OXSB 3O4OB 3NH7H 2ICWJ 1NP0A 1BD2A 4JPVH 5CMAB 3AISA 3AY4C 4GKNA 4IRZH 1P84K 3H9HB 3GSXB 5DTFA 4RE2A 4ZUSA 5FGSA 3WNPA 4A3HA 2F58H 3GK8H 1T80A 4HHAB 2VE6B 1SBSH 3O45A 4WU5B 2W4XA 3VXRA 3BZEA 4PJAA 1FSKC 3VRIB 3MO1B 3IETB 4JFFD 2D73A 4ZSOB 1IT0A 4EKJA 5F6IC 1MEXL 1XEDA 1CEOA 3EMCA 2P5ED 2ADGA 4RFOL 2JIWA 2IFFL 4EXPX 1ZLWK 1MLBA 1CN4A 3UTOA 5J1SC 3SKOB 3LKSB 1KUMA 3KL0A 3RRQA 5CHNA 4CGTA 4EI6B 2CUMA 2W66A 1LO0L 1XMWA 1D5MA 3DHPA 5EFIB 5HHQA 1LO2H 1BREA 1FIEA 1DTUA 2J8OA 4V2CB 5DQDH 1EMTH 3QDAA 4Y4FB 1TTUA 1KJ2L 5M7QA 1XIWC 3V79C 4GKSA 1AFVH 4Y4FC 5T1MB 3C08L 2R2EA 1BFVL 4V1DA 5KOVC 2Q6WB 1OSPL 3W4RA 4OLXL 3UX9B 3GTNA 3MLRH 4KQ4H 3VSVA 1AKJD 1IAOB 2F5BH 3FQTB 4TXEA 3HMXL 1KJ2H 5CG0A 5F9WB 2PO6B 4FQJL 2WHKA 2X0HA 4N0FB 3DSFH 2OX5A 2EDEA 4AENB 4BFIB 1KFWA 4P9HC 1NAML 4L8SC 5KTEL 4G9FB 4K23L 3IRZA 4CRPA 4ACZB 5A6MA 4L4OA 1H2JA 1MNUL 4NN5C 4TVPL 2UWFA 2HTLC 1X5AA 5I1JL 4Z0XB 1T83C 5CD5D 5JHLH 4PJ9D 2G3JA 5E09A 5DJ6A 4WRLA 3T0VA 2DSWA 1K8IA 4ISVA 5SX5H 4X9HA 1Q9LB 1B3VA 3N85L 4XX6A 5D7SH 4EUPA 4OZHF 1SY6L 2VIRA 1AHWC 3AAZB 1DP0A 1KB5B 3NZ8B 3EJQA 4AWEA 5E9DE 3SJVD 1SY6A 1XGUB 3MFGB 3NDYA 1P7KA 1C12B 2A0LC 3LQAH 2F74A 1QI2A 1RZJH 4M4PA 1ZLVK 2HJFA 4J6RH 3MUHL 2ZUSA 3BPOB 4H20L 2OWWA 3PXJA 3SOBL 3C6SA 4PY7A 1A6PA 1C5CH 4X8JA 2XWTB 2AXJA 4B16A 1QA9A 3TZVB 3VXQB 1A7NH 3E2HB 4AEHL 1OTUD 1S7WB 4Q7NA 2YN3A 4LP4A 5F7LB 5E94B 5EOQL 5IB2A 5IJKC 2VTFA 2C5DC 1JMXA 3OKNB 5CGYD 4FQCH 5FCUH 3UZQA 2OLHA 4QDMA 4JQXC 3PGCA 3D4ZA 1Q94B 3TNNA 1MJ7L 3V0WH 2DJSA 5FO8B 2BHZA 1HHGB 4MA1B 3QWQB 3MBXH 4Z2KA 4CNIA 3LMYA 1JAKA 1Q9KB 1RZKC 1RZGA 2MCG1 2YMXH 1OWRM 1VPOH 3T0EE 3DIFB 4KHTL 2Z8WC 1WITA 5FYKU 5EU6E 3WL0A 4PN2A 3JV4A 1BEYL 4UUJB 1HHKB 4BZ1L 4H8WH 4PJAE 1OD0A 4IMLB 4R4BA 3ET9F 1AQMA 4CD4A 1DN2A 3S36L 1SJHA 3LN4A 4M8VA 1P6FA 1FLRL 2ZNWA 2P5WB 4HXAL 4L8BB 4WK9A 1D6VH 4OFKA 1HNFA 1UJ3C 1CR9H 4S1QH 1MYRA 4MVBD 4OFYD 2QSQA 4OLZL 3VU2A 4XCNA 4U1JB 4U05A 5C8BB 2VWEC 1BOGA 4X5LA 1AR2A 1U2YA 4UOZA 4OOUA 1BZ9A 4MZ3A 5IOPA 1NFIB 2WVVB 4PJXE 3RHWF 5F1SA 1MCBA 2Y36H 4NRXA 4EUPB 4E9LA 4JM2F 2OWXA 4ONFH 3U7VA 2D24A 2BZDA 1ZS8B 4M3KB 3OLEA 4ZOEA 4X98B 4DFIA 3BKYH 4OLVL 1AGBA 1ODUA 5H37H 4QRQB 3PL6C 5D7IB 1XF4B 4DO5A 2D7NA 3H53A 2WVUA 1HHIB 1CFBA 4A2MA 4U1IA 3IJYA 1PZUB 1CFNB 3Q6GL 3LN5A 5I17A 2GW5A 3VIHA 4NKQB 3IVKA 4HU0A 4UBDD 4FQIH 1CZ8H 2WIIB 4KKAC 3SPVB 4JDTH 3WENA 3DV6B 1KXQA 1UJTA 3PDGA 4F9PA 4NC1C 3MLPA 2NY4B 3D0LB 4RIRB 4H1LG 5E9AA 3OZOA 3VJ6B 2Z92B 1IM9D 3GHEL 5F1NA 1B0IA 4DAGH 1IC4L 4YR6A 3V5DB 2IQ9L 4R7DA 3UTPE 5JW3L 4YX2H 2BK8A 1CDUA 3DXAE 4PRBB 4GKSB 1UKTA 3GBEA 1KEMH 3WXVL 1JNLH 1FP5A 1YNLH 4ZTPL 4AZ7A 3NSMA 3L9RA 5TDPA 5J89A 1I7UA 1MY7A 4LIQH 1OF2B 3T77B 5DD5H 4Y5XA 4A6YB 5IMMB 4JFEA 5I8EA 2EE3A 3A6OA 1J01A 4KAQL 4POUB 4YDJA 2DKSA 4NNXA 1LO5B 4KK5C 5GZNC 4L1HA 5DQ9A 5I73C 3BH8A 1T4KA 4B53A 4BQ9A 1VACB 3MV7E 4QRPB 1MPAL 2C3VB 5JDSA 5FGRA 3W82A 4WSJA 4JKWA 5DJDB 2D9QB 1XF1A 4XCCL 3K2UH 3TBWA 2FH8A 4LCWB 1BGAA 1YEKL 3FMGL 5CP7A 2EEBA 1NC2B 5D8WA 1R5WB 1GJWA 2F58L 5DK0B 3SDAC 3OZ9L 1MCHA 1X3DA 1UT9A 3QEHB 4HKXB 1IKNA 1AKJB 2DF3A 2OR7A 1OM3L 4YEEA 5INCB 4PJDF 4NBZB 1BD2B 4A6YL 3QDGB 3ULUD 5DJ0B 3OXRA 1BQHA 5D1XD 5HHOE 3AYRA 3OKMB 4JKPL 8CGTA 1DQQB 3DDGA 1JMZA 2VXTH 5KVGH 3ARTA 4OCLC 3BVTA 1NCTA 1INDH 2VZ1A 3W0WA 3CFEA 3I3BA 1BYAA 4F7EB 3DURB 4X99B 3T3PE 1UD4A 4Z2GA 4CN4A 3SGEI 1DQDH 4P2RE 5CKGA 4N1EA 1UD2A 4GI8A 1MREH 1U8JA 4YE4H 4K8RL 3ZYIA 2NTFB 4PJFB 3O6MH 3LRKA 3MRBB 2WZHA 4YHLH 3F7VA 4OIAA 2YPLB 3A47A 4U1LB 3A22A 4DWSB 1PKOA 4TNVF 2NCMA 2D7TL 3DJ9A 3QCUL 3DUSA 4JQXA 4ZS7H 3JBG7 3Q1SL 4JR9H 5HDBF 4HA3A 2ATKB 1ES0A 4F7PA 1OAKH 3K74B 2AOSA 2NW2A 3QA3A 2VXQL 4Q0XL 1E4MM 3OX8B 3B6SA 1R3IH 1AGFA 1WBYA 3BP4A 4NO0B 3MMWA 1L4IA 5C08A 5D2LF 4R90L 2ADFL 2FYYA 4PJCF 3ZKMC 4E4PA 1YMMD 5L2KB 1DHKA 3MGAA 4LKXA 2EO9A 1RZ8B 3G5XB 2DI9A 4FQHB 1IGJA 3EHBC 5A2IH 5MEPB 3DDFA 3MCKA 1I75A 2FEEL 4GZJA 5K9JL 3BD5A 2QADD 4FXGA 5EZLB 3TVMB 3W11C 1S9VB 1QQDA 4MXVE 4M1DL 3CZSA 3VOCA 5ID0A 5D7KE 5ISZB 3GJFK 4WTWA 4BKLA 3L3KB 5DRWA 1U3HA 1IM9B 2ZCKH 1NAKH 4HBCL 2B1AH 1QSFE 1RUML 4X0KB 5HSFA 3HN3A 4OQTL 4RDQG 3VXSD 3CFCH 3OTTA 1WFTA 1PZ5A 3WDHA 3PZVA 4WKFA 4ZNCD 1UR2A 3BIBX 4YGVA 3U36B 4X7TB 2ZUYA 4OUEA 4MNHA 4I9WD 1Y6KR 1YQ2A 3MRGA 4K3EL 4RBPK 3AIEA 3PDOB 1KACB 1UA7A 1I7RB 5BVJA 1WCBA 3GI8H 2YLAA 3PWPD 3W39B 3RZCD 3CC5B 3FT3B 3M8OL 3PZMA 3MZTA 1A8JH 4X6CF 5FOBB 4NSBA 1WEJH 4UQ2B 4UFJA 3GNRA 1ROWA 1NGPH 1ED3B 2XVNA 2EDBA 3L5WB 3QNXA 3L3DB 1JFHA 3SDDA 1Y0LA 3NIFF 3U46B 1FO0H 5GRUL 2JEQA 4PMVA 4PJXA 2VDQL 1X5HA 3LRHA 1MJJA 3THMH 3OPZL 3RZWA 3HAEA 4P3DA 3V9FA 2BJMH 5AEAA 4GSDL 1KPRB 1HKLH 4UFIA 2Q8BH 4J3OC 1T1ZB 1OIMA 3IGAB 3QUYC 2CQVA 5J1AB 1EFXD 1KXTB 4I8DA 5GGRB 2EH8H 3MOBL 1ULVA 2X4RB 1LE9A 2XYCA 4OZGA 5CILH 4LSQH 2I27N 3FB5B 3ALWA 4YK4B 3WFHB 4JHAL 5D71L 5BZDA 4HZLB 3EOYG 2VDPL 3LKOB 4QRPD 1GL4B 3NPZB 3RNKA 2EE6A 1AJ7H 3OGSA 4A3YA 1SEQH 3WKML 3MLTB 1HP5A 2NY4C 5FEBA 2X6MA 5C0EA 1VFBA 2AAAA 5LGJA 12E8L 2IANA 2O5XL 3TBYA 5IHBA 2GDUA 5IBTL 4JCMA 5DD1H 1E4WL 3MSPA 2ORBH 1BLNB 4RQQA 2IC2A 1AI1L 2JEPA 1IQDA 1ETZB 1KNOA 3TIEA 2IBGA 3P73A 1EAPB 4HGKC 3UCRA 3EOTH 3B2UC 2VKWA 5BZWB 3SIMA 3DX8A 5KZ6A 3U57A 3D2UD 4IS6B 1KIPA 1A3HA 1INEH 4HWBA 2VQ1B 1I3VA 2UZIH 2R2CA 1NEZA 4MQXC 1CG9A 1GORA 2CITA 4UZSA 4ETYA 3SDDC 1NAMA 3KS0J 1G5AA 1KXVA 4WV1A 4OJFL 4NC2B 2OTPA 2VX6A 5CIPB 4UNUA 5EOCL 2X1OA 4LVHC 1C5DA 3B9DA 5LGKA 4EOWH 1JHTB 1F8TH 4HC1L 1OGAB 4HUUB 4CW1A 5K33A 2EO7A 3CDGA 2ESVD 5FIPA 4AEEA 4U1MA 5GIRB 1N0XL 3TT3L 1IAIL 2X1QA 1FZMA 4GMSL 4LEOA 2X4SA 3C5SB 2ZG3A 4RFNC 3E6FA 4ZXBB 1CE1L 3UETA 3TIEB 5DEFB 3QBTB 4ZUTB 1DUYB 3U30B 4M7LL 1VGEH 5IB4A 5EUOE 5D7JA 3KYNA 1AGCA 4RMVA 2PWEA 4D6GA 2VLJA 3LS4H 4Z7UF 4GFTB 4U5KA 4GRLB 3A6CH 3WS6A 4HIEB 4RL3A 1XYZA 3VI4E 3CPLA 5AG9A 3BDXA 4M7LH 5DFVD 3WXWL 3DX9A 2K3TA 5AYUH 3CCHB 4PJIB 2AEIT 2NY6D 3N18A 5HDQL 1C7TA 1MJUH 2E5EA 1G94A 1M01A 3CX5J 3CX2A 2OZ4L 4PTTA 4I0CC 4UQAA 1I1FA 5J3HD 4ENED 2YBRB 1EEZB 4KRLB 4Y4HB 3UEZA 1QBML 3O6FA 2GY7B 5BV7B 4CD8A 5SWSA 5DD3L 5T3ZE 1NEUA 5H35A 4QY8B 4XXCC 1WTGT 5E2VH 4AD2A 2J7LA 3TWCH 4F8XA 4QRTA 1MWOA 3FQRB 4Z78B 4MXQD 1CL7H 1L9MA 3R0MA 5J4MA 1GGIL 3CU1A 1MVUA 1FPTL 2IPKB 5IV2B 3L95A 1NC4D 3SDDB 1OT2A 2AK4A 2JB5L 2X41A 3SDYH 4WI2A 5EO9B 2NY3D 5DRZB 4NZTH 2D7QA 4Y0GA 43C9B 2VKXA 4ZAKB 3S5YA 4R6UA 2G5BB 4YIQA 3VD4A 1QHPA 3WIFB 1N3NB 3DMMB 1QACA 1BD2D 4Q6IA 3FZUC 3S88H 4DN4H 2KKQA 3DVNA 5DJCB 2FEEI 1HL9A 4JM2A 4N5UA 2Y7QB 2AV1B 3SGDH 3UZVB 1A6TB 3R06B 3RX8A 5TE4L 3S4SG 3RY6A 4BQ5A 2CKBH 4XH2B 1JGUH 3MNZA 3P11H 1B0GB 2FJGA 1G1CA 3ZSTA 4O02L 4LYRA 2BOCB 2JCCB 3S8WA 5HGBB 1QNQA 4RFEB 1J0JA 2AKRA 3MV9A 5MHSD 4G80B 1UM4L 2H45A 4OSUH 1E28A 4QGYA 1U93A 3MRRB 2CDGB 3QUYB 4U3CA 1QQDB 3DNKA 1HDMB 1A7RL 3SDYL 1V6YA 3MRNB 3QQ3B 1AGEB 5JXED 4X7FC 3HG1B 1A1NB 4WW2C 4XVUD 4ZFZA 1AXIB 1QEWA 1DE4A 4HKZA 5EN2B 3AM8A 3RAJH 4X4YA 3VMNA 1VADB 2CBIA 2EDQA 5EOCJ 1P7QD 1F90L 1JRHL 4B7LA 5DWUH 4JDTL 2YL5A 5TE6H 3B2VH 4HUVB 4NNYB 4CCCA 3BP5B 1GHRA 3TBSA 5FFLA 3DUSB 2FBOJ 4ELMA 1Z3GL 4XHJC 5TPWL 4OM1H 2CNCA 5HDQH 4MJ2A 5I24A 2MTPA 3D48R 3QIWC 5I74C 3T0WA 1HKMA 5KS9A 3MRLB 2HKFL 3STZB 1W72B 4WUKH 3I2CL 2XQYK 3LN9A 5HGDA 3H7LA 1FFPB 5EZOH 3V2AR 2CHNA 2NX5A 2W0KA 1U58A 1C16B 4GJTB 5DMKB 4PRAA 4PLJD 3V4VL 3WIHA 2H2PD 1CZ1A 2XRAL 4G8GB 2XTLA 3RIAF 1CFQA 3RP1A 3WE6B 2EPMX 4M29A 1MHHA 5KOMC 2VLKA 5J8OA 1GAFH 3U7WL 5D2LE 3SDCC 1YC7A 3F5WA 1PKQA 5FYJD 1OBAA 2ZKHH 4TUKH 2WMJA 1AXSB 5LGHL 1MXGA 1GQIA 1MCNA 1OAXL 2VSDA 3VWKD 2DB8A 1YEIH 3ZMRA 1L7IH 2XTJB 4P8UA 3SKMA 3UCQA 3O3AB 2FATH 2PXYC 2R0WL 1ZBWA 3WNKA 4HMDA 3GB7B 5F88A 4RAHA 3MJ8A 3QEHA 1XCQA 3EBAA 1T0MA 4NKMA 5J12C 1S7XA 2PXYB 3D52A 4LKCB 2QF8A 4P3CH 3DYMA 4N0YL 3KYMB 3N15A 5D6CB 2Z31C 3MLYH 1H3GA 1DLHA 3D50A 4G6JH 3RPMA 5F7MC 3FB6A 3AXLB 4P23C 2CPUA 5F72S 2C3GA 2CYGA 1OTTD 3IFLL 3UPCA 1SYTA 1T4KB 1AD9B 1OGSA 1S7RA 1FVEA 4Q9BA 2A83B 5CJBA 1RK0B 5F89A 4FTVA 3VXSA 4ETQA 1NBZB 3GSQB 2GT9B 3RQ3A 1BFTA 4AEIH 4MA3A 5E7FA 1HIZA 3FN0H 4Y5XB 4A6YA 4WKAA 1KWGA 2WBJC 2XACC 4IUGA 1I9IH 4P2QB 4W7UA 3GNOA 1L0PA 1T7VA 1GW1A 2G60H 3WDJA 4M6AA 4JFDB 3SGKA 5A6SA 4ZXLA 3VIPA 1M53A 3VFGL 3ZSSA 1JTTA 5A3ID 3U48A 4Z77B 2HT2D 2BSTB 4KJQD 1INDL 1NLBH 4UV7L 2XPGA 3QJHB 3G6JF 4Q0XH 1JWSA 3T1WA 1W2VA 4YDVB 1EJOL 5JPNB 1GHFH 3SDDD 5ANME 2R0ZH 2NLJB 2BV9A 3DV6A 1IEBB 5CWSB 3TTSA 1HKFA 2MHAB 5ICZA 1NKRA 1SBBA 1ZLSH 5BOZG 1HOCA 4QXUL 4NM8L 4NQCE 3LMJH 1F4HA 4AIZA 4KMTH 4D9RD 1R7AA 2DLHA 5EU4A 1XGPB 4NCC1 5AWNL 1XF4A 4LHUA 3W6MA 1BQUA 3NA9L 3EUUA 4WWKA 1BQLH 1Q0XL 1MUJB 4MQSB 3B9KC 2CK0H 1PS3A 4JO2L 3QFDB 4X98A 1MCDA 3AZTA 4H8VA 4X9IA 4Z18A 4JRYA 3N50A 5CD3B 1TZHA 3JWNC 3RL1A 3T1FA 3RDTA 1IQWL 4QHMB 2MOVA 4C57C 4Y19A 3QJHA 5T3ZL 1NMCC 4FQ2L 4N90E 1ZVHA 2IAND 5T33L 4U1JA 1FL6B 1YNLL 4ZTPH 5BRQA 1JUFA 2XVKA 4POZC 3MRFA 4LOUD 3FO1B 1WLHA 2ZCLL 4FNUA 3RBGA 3KWXA 3KWWB 1W3LA 1NSNL 2H8PA 1EO8H 2E7LC 1PX3A 3UYRH 2CKBL 2APVA 4RAUB 1MSPA 2V38A 3DYPA 4L29B 1RK0A 3VXSB 4ACPA 4UTAH 4PTXA 1A9EB 1C91A 1M03A 4JHAH 5D71H 2XN9D 4HWBH 3FB6B 4ODUA 1JJUA 1FGVH 2OTWA 1BQHG 3HI1B 4ZFOB 5CUSH 4K8RD 4F58H 5E2TL 1KB3A 4AQ1B 3DO3A 5FUOL 2FD6H 4HH9A 3ILPA 3ZKND 3ALFA 3T0EB 1OLZA 4PYSA 2ICWB 1YNTB 2W1NA 3KNBA 1UOKA 5DURD 3HNSH 3OAUH 4OZGF 2ITDB 3MRJA 5BV7C 2XQBL 2EC9U 3W0KA 2ESVA 3AICA 1CLCA 2CMRH 5HYSG 1NM9A 5ACZB 1CNVA 3WH8A 4W93A 3PZQA 4UV4H 5CZVH 1N2RA 3Q0HA 2MWCA 5I30H 3SCNA 2CUHA 1N7MH 4KC3B 2CETA 4XRCB 1T66D 1S7WA 2VDNL 4JPWH 3D3AA 3SBWC 3RWCA 3FXYA 3LEXB 1MFUA 3IDIB 2VLJD 4UV4L 3VXOA 1U8LA 2DT2A 4E8DA 2I60H 1B2WL 4M6ML 5IMKA 1QW9A 2NX5B 4PJGA 2FLRT 4KJQC 2P8LB 1FC2D 4WHTB 4YDLB 3P4NB 2YPLE 4JFFA 4OZ4A 1PYWB 4ATWA 4PJHB 4PJ5A 5CEZE 2A1WL 3GMRB 2AP2A 2FJFB 2VIRB 3O6FD 4N8PA 1GJUA 4JHZA 4Z7VF 3S9DB 5AUMB 1BAFL 3D3VB 1X44A 3AHYA 3EAKA 3I50L 2EABA 3SE3A 5JIIA 2OTUA 3JUYA 4UTBH 3IJ7A 3QEUB 2NY0B 3TOPA 3OSKA 1BGXH 3KPLB 3VWJA 3CFJB 3OJDB 4KVCL 4JY5H 4PJGE 2PKDA 3WSUA 4R4NC 5HVHB 1PSKL 2X4UA 4B41A 1R85A 3UTSB 3X13B 5EZIL 4X9YA 4KRPB 4Q9QL 4MAUH 3FT2B 3LV3A 1EEYB 5F96H 3VG9B 5DJAA 5IFAH 2DEPA 1G9HA 4RBPH 1GZQA 8FABA 1F11B 1HSBB 4QOKD 5DFAA 4X6DE 1U93B 4KVNL 1U8IB 3GSVB 5D1XC 1NMBL 4HEPG 4RFEA 4FQQB 4JM2D 2JCCA 3LPGA 1P4IH 2WKLA 4CVUA 3PZ9A 1JHLH 1YMMA 3EMZA 1ZL1A 1SMAA 4R5EA 4G42B 2OSLB 1LQ0A 1R3JA 4ZS6C 1E0VA 4JN1L 4CMHC 5L7XH 1KTRL 3QPXH 3S7GA 1MAKA 3UG4A 3IDUA 1K8DA 4MYWB 3CZ8A 1KJ3H 5HBFA 5I1GL 4K7FB 3O2DH 5FECB 1A1NA 3EO9L 2MPAL 2OJEA 4WWID 2DDXA 3O3EB 4PJ8B 3WH9A 3SDAD 4Q9CA 3OG4B 1IGTB 1NC4B 3AROA 2NZIA 2W67A 5A6JA 1RSFA 4I9WE 2ADGB 3V6OC 4NGHH 2X4QB 3SJVA 5IKCA 4R0LC 2G2RB 5B8CB 3OKDA 4M61B 1K2DA 4GIAA 3I02B 3TM6A 2Q3AA 3L95B 4OTXL 3AIWA 2AKRB 3MV9B 1MVUB 2IPKA 1T03H 5DHVB 5JXAH 5TQ2H 5ESAB 3BQUD 3FQRA 1TNNA 2NXYD 1P7QA 2G9HA 1UQSB 2DWEA 3QUXC 1HJXA 5GJTH 2YD1A 5TDNA 1T66C 1P2CB 5SWSB 2AJXL 3PWNA 2VLLA 2CLZB 2JF7A 5I16B 4LFHD 3RFZC 3DECA 5HBBA 5HYEA 1BIHA 3MBEA 4K55A 5JW4Q 1W1TA 1ZJAA 3ZTJH 3GYCA 3MXWH 4HIJA 2A3HA 3TBTB 2EDOA 4EN3B 1RJYB 2F19H 5D2NB 5FGCE 3GHBL 1F2XK 1YYLH 1KBBA 3G6JB 3WIFA 4G8GE 4D6IA 3KJ6L 1QBAA 5SV4A 3TH3T 4U4BA 4P7RA 3DX9B 1NOWA 4JIEA 5T1DL 2IMMA 2NX5D 1G1YA 3SGJA 5I1CL 4WEMB 2SEBB 2HWZH 3IXAA 3QAZB 4JAMA 5D7IF 1GOOA 1M1SA 4HS3B 3BE1L 2XICA 1Q6CA 6A3HA 4TSAL 2VLKD 1X5JA 5I9QC 2OR8A 4PP2A 4JZOB 4BQBA 4AJ0A 2NY5H 2VZTA 3HUJA 1QOXA 3T4YB 1KB5L 3EHBD 5E8NB 3VWKA 4OGYL 3OKOA 1EFXA 1MF2H 2ATPA 4OF3A 3TVMC 1NGWA 1CS6A 5A8OA 2WBWB 2FZ3A 3F7QA 3RKPA 4U1MB 1UB6A 3HZVB 3BAIA 3ZJ6A 4WFFD 2R9HC 5KEZA 4POZD 1U8MB 5DJYA 2NX5E 1YY8A 4FZ8H 1DR9A 2F8QA 4ONOA 2HLAA 3CZEA 3AIRA 1MF2L 5GGTH 4OLYH 5D9NA 4TYUA 5CXPA 2QHLA 5DHVH 5D70L 3N9KA 4LSUL 4PGCB 3TBVA 2EPLX 2PI6A 1X5IA 3PJSB 1K5NB 2OL3L 3L1OL 2EACA 1MJ7H 4DTGH 5E8DL 3INUH 4MXWL 4PUBH 4CL7A 4FTVD 2FO4B 2B0SH 3R1GL 1A1MA 4JLRA 2WANA 4XB7A 1RVFH 5FYLD 5E08H 2IFFH 1QVOA 3K2MC 2GK2A 4RA0C 3DMMC 4QHNA 3JWOH 4HS8L 5DJZB 3V7AE 2E7LA 2BERA 4AW7A 1FZMB 3GXNA 4ZTOH 3VGAB 2YC1B 4MA8L 3CDGB 2W65B 2J7CA 5C8JA 3MLTA 4UIMA 3CXDH 2HRLA 5T3XE 2IALA 2EEAA 2C4FT 3PL6D 4MB3A 2WMPA 4YBHA 1GPOL 1NANH 1IKFL 2EC8A 1T5XB 2J8UE 1E4LA 4E5XA 5J56B 1IARB 1T04A 3FONA 5J1AA 4TSBL 3IS1X 1PEWA 1CG9B 4NQEB 1FDLL 3EYSH 2L4OA 3CZLA 1RH9A 3FRPG 3RWEA 1H4PA 5BZWA 1MCSA 1CGYA 1QSED 1XGRB 4PJEB 3ZDYF 3ZDYE 1FORH 2APBA 1LHZA 4QRRA 4L4TB 2Z8RA 1F3JA 3O2VL 3FO9B 3W6LA 2GSIB 4PP2B 4N8CL 3HUJE 2ZCLH 1W2KT 5FM8A 1FCCA 2HVKB 1NCWH 5T3ZD 5LGJB 4BH7B 2NT1A 1ZEAL 4TQEL 4PRIA 5DJ2B 4Y19D 1QFUH 4M5ZH 4RWHA 3S4SA 3VIIA 2ARWA 1XH1A 3X12B 2BOBA 5FOBA 1UXWA 5C0GA 1JPST 3R8BB 2I25N 2PTTB 2ZXBA 4BFBD 2J8UF 1KJ2A 3I9GH 3OKYA 2LV4A 3VNYA 3WBEA 4GRWE 1KBKA 4YHYB 3IDJB 4R2GB 1I3RB 3G6JA 1MRFH 3GJEA 2N7AA 1MPAH 2AJ3B 4QTIH 4JFVA 3L6FB 4ZE5A 3ZDZE 1V3IA 3TYFB 3C8HA 4OFVA 4U5IA 3L2LA 5FYLL 4S3JA 1A6AB 5DD5L 1A7QH 4XWGH 4K3DH 2WWCA 4LVHB 2XN9A 3GBDA 3U0WL 2IAMB 3KL5A 4FXKA 3O6KL 3WXVH 1EFQA 2VH5L 3QG7H 1JYVA 4PMQA 2ARJB 1HH6B 3I02A 5KW9H 1KTKE 3ZKSD 1UD3A 4JFDD 2FEDD 4M61A 3V6BR 3OKDB 3QCTH 4P49A 3EJSA 3WLBB 4R4ND 2ZE0A 2P24A 1IL1A 1FJ1B 4JFHD 3IRPX 5DR5L 4HKBB 5FUZL 3SO3B 4IM4A 1MVFA 5I1HH 5BRPA 2YL6A 2PO6D 2P5EE 4J8RB 1CFSA 3RIFF 3O4LA 1RZ8A 3HMCA 1FNAA 4P7NA 1H8OA 1TLKA 2HTKD 3KEHA 3S5LB 1TVDA 2EC9T 1XF2A 1S3KH 1DVFB 3NCJH 4A6YH 5D4YA 4YGVB 4FABL 1NMCB 4MZ2A 2AEPL 4ONHB 1EQPA 5B21A 5A69A 3Q6FA 1WCGA 1U8OA 2OSLA 4QWWC 3VX0A 3DSFL 5EFDA 4MB4A 4X0KA 5FYKE 2BJML 1TETH 3WUWG 4NHCL 3UP1A 2HLFC 1LDPL 1GVYA 4PJIF 2FE0A 2W0LA 4DM1A 1T0NA 3DTXB 4NN5B 3PHSA 3PQYD 4KHXL 3UR7A 5HVWA 3C2SA 1D6EA 2HYMA 2D23A 1QLEH 1ITXA 3FT2A 3LV3B 1S5HA 5C6TH 1NSNH 1B30A 4K9EH 1KCRL 1PW3A 2D7MA 3LY6A 2ZG2A 3WN5B 4S3KA 4R96B 3G5XA 5HHVH 4DVRH 5AD0A 3BSZH 2EDDA 5B38G 3WL9A 3S6TA 1DQQA 1RHHA 5E2WL 3WUWA 3QUKA 1UWXH 4O51B 1WP6A 3VD3A 3ELAT 1WZKA 2NY4D 3QI9D 4GXVH 4XCYB 1XIWB 4KFZC 3VGEA 1JDCA 3FZUD 1YPZE 2E7MA 3KJ6H 3OAYK 4KV5F 4UQ3B 5HGAA 1R5WA 3F7VB 1RZKL 2F9BT 2HT4C 2DQXA 3MA9H 4OZ4B 3TBWB 3IDXH 4OZGE 3WNLA 5IVNA 2C3XA 3GSRB 3PWPA 4JANB 5FCSH 3IFNH 4B9ZA 2GJXA 5GS3A 4NN6C 4ZXOA 1D9KA 5BS0B 4F9PC 4Z7QE 1TQUA 3RJXA 4AZ5A 1OAQL 2NQCA 4HZ6A 4HK0A 1K6QL 2J7HA 1L6XA 2R1YB 4U6XA 1DQTA 4L9DA 3LEXA 2JB5H 5IMMA 4OUUB 2EYRB 1ZHLB 1OF2A 4P4KA 2FIRT 5L88H 1V7MH 4LRNH 4G8IB 1CTNA 4XUYA 4LU5H 4FK9A 1HT6A 43CAA 4NXSA 1UZ1A 3CMJA 3MJ7A 5E0CA 4YHPA 2ITCB 3O4OC 2DSVA 4GI6A 3VRJB 3OGRA 4YHGA 2NW0A 3PZOA 3C60D 1X5YA 1XF3A 2X2JA 2YRLA 4V2XA 2DM3A 2YPVL 4GRLC 5H94B 1VERA 1JFXA 4FP8L 2ICWA 1J9CT 1QLRA 3LQAL 3BRFA 3NIYA 3QUML 3P2TA 5DJDA 3FFCA 3QXAB 2OZ4A 3B9VA 4H7VA 1K9TA 5DA4A 3MREA 4QRPA 1RULL 4KRNA 3LN5B 1GC1H 4U1NA 4ZXBC 2EQDA 3BLKA 3QI9C 1UVQB 1T22A 4ZDHB 4O2FA 4L29A 5DGQA 4FNTA 1ADQL 1JPFB 4W5UA 4PGZA 4LCIH 5B4MC 5JOFA 3MBED 1KPVB 1NBVL 4HIIB 1JVKA 4OQTH 5FO7B 1SJVA 5B22A 1E4KC 4EIGB 1C7SA 3WEOA 3VXPB 3TPKA 2PBOA 5DJ8A 2GJPA 4ENEC 4M7ZC 5LAXA 4DGYH 3WQWA 3H42H 4DWSC 2CBVA 1FGNH 1X7QB 4M1DH 5M17A 4L8CA 5IOPB 3G04A 1BD2E 4K7PH 3P40A 3UMTA 2EEDA 5C3TA 1BG9A 1NGYB 1HJQA 3U2SB 3QO1B 3VIMA 2VRQA 1UWUA 3TN0B 3RL1B 3WCYA 5IEHB 4XCNB 5GRWA 3FQXA 2O61B 1RJLB 3FAWA 4RWYH 4U6VH 1PIGA 2NNAA 3W9EA 1G7MA 4NT6A 1ZA3B 3GMQA 3LKNA 3HE7B 4KI1A 4R2GD 4Z8FL 2J79A 4G43B 4P4KC 1MWAB 1OQXA 3RPIB 1L9NA 2HKFH 2VURA 2ZZUT 3CLFH 1Y18B 4JFSA 3G5YB 4LHJB 2MHAA 5ICZB 4RRPA 1FH7A 3IYLW 2DJ4A 3ULUE 3KPRB 5D1QC 3MOQA 5F8QC 5AZEL 1XR8B 2PC8A 3KPPA 1RZGB 3MA7A 4POYA 5GS2D 1GAFL 1Q9KA 3U7WH 4DGIH 4ZNEA 3A4XA 1DQDL 4BUHA 1GCFA 4PJBB 3QR3A 3EJYC 3W9DA 5TDOA 1UWXK 5EU3B 5E8PA 5GZOD 4YUEL 3WD0A 1US2A 4R9HA 1AJ7L 4FQXD 1QFWM 1H9VA 4H8UA 1OAUH 1V6VA 1WAWA 4XXCA 3OMZA 3MLUL 5AAWA 4W5ZA 5EO0A 3KG5A 5GS0D 4X7SL 1FVDB 3MOBH 4GBXA 4WI5A 5EIIA 4O5LL 4NQSA 3IJ8A 4M7ZB 4D9QE 5SWSD 4PJ7B 4GBXB 5J11B 1K9FA 4LLUA 1TQSA 1IC5L 3QDJB 4G6KH 4PJFF 4C83A 4TVCA 4PS4H 5I18H 3KJ4C 3ZKXB 5SWQA 4YPGA 4ZO7A 3D2UB 1BF2A 1MCPL 5KVDH 3HAEH 1MQPA 1T5WB 4OJFH 4X0VA 4W7WA 2W0PA 4Y8DC 1ZXQA 3EZJB 4P4RB 4X8XA 3VFVB 2V9RA 1KB5A 3NZ8A 3FN3A 2BCKA 1E71M 1G7HA 5C0BD 1LGVA 1VRXA 1Q94A 2EE2A 3DRTA 2DQJL 5GISL 1HI6A 4UDTB 5ABFB 2IBZY 2VISB 5C0CA 4OLZH 5HDLA 3QPXL 1HSAB 4QRRD 5E2WH 4LK4A 1BFSA 2JJSC 2G5RA 2O5ZH 4E41D 5C7XL 1JBJA 5A95A 1Q1JL 1Q6DA 1V6UA 1A6UL 1MWAA 3RPIA 2EYTB 5J13C 1RMFL 2XWTA 3W5NA 3MC0A 4HZ8A 2CPCA 2YHGA 4PJCA 2VN4A 4QGTA 1IAKA 3C6SB 3GMQB 3LKNB 3CHCA 2MQCA 4LNVA 5AZ2H 5E7BA 3O6LH 4PJ5D 5F6HJ 1HIML 5ITBL 1OT1A 4HZAA 4OQTA 1EEQA 1F4WH 1H3PH 3STZA 4HT1L 1GUVA 1YYML 3A6BL 5GGRY 5T1LB 1ZLWH 4BF7A 5JUEL 1EGJA 1TETL 4WI8A 4NHUB 1XYFA 1MI5E 3AAZA 1PSKH 3UR8A 2OZ4H 1NKOA 4OGXL 1BPVA 5FHAL 3C6LD 3VGFA 5JXEA 3SO3C 1ZHNA 2X4TB 6FABL 3EDFA 2LABA 3DMMD 1YEDB 1U8HA 3RWJA 3CD4A 3WFCL 2XHYA 1H0DA 4LCYA 3O2LA 5HHPA 4AT6B 1FORL 1HNGA 1VFAA 3RHWK 1P4BH 5IQ9A 1Z5LA 1QEWB 2YLLA 1E56A 1D2KA 2GQHA 4JPIB 2H1PL 1UVQA 4ZDHA 1QW8A 1I1AC 2FX9H 1WBXA 4WY7L 3A67L 4WI3A 3NACH 1PQZB 5BW7A 4HAFA 5CJ8A 3BI9X 1JF1B 1WVZA 3CLEH 5BROA 1NGPL 1CBVH 4JHOA 4WLCA 2PO6A 3BAYA 3FFCB 5FGBA 5EORL 5FDWA 3NFNB 3O4LD 1V02E 4CN6A 3BZEB 4MS8C 4G80A 4WU5A 3BZFB 3L2MA 4L3AA 4HUMB 1ZS2A 4CUCA 1MI5A 1ZHKB 3W25A 1CDHA 2GCYB 3BD4A 3DOSA 4M48H 4TN9A 4XH2A 3ZR5A 3U1SL 3GDBA 3NCYS 4XMKL 3L3OB 1G6VK 3S98A 1VFFA 1IC7L 2CO6B 2Y72A 5KSBF 1CVSC 1ND0B 4L3EE 1F3DJ 3OR6B 2HVJA 4TVPH 2XFRA 1PX8A 3VH8B 2XZCL 4BSVA 4KKBC 2YMXL 2EPKX 2G5BA 3OJ2C 4UINH 1S7QB 3MUZ1 2WWKO 4LPYA 4LPUA 1YEIL 5DRZA 3MLXL 1PFCA 4FA8A 4M6NL 1OINA 5IB1A 4F58L 3MO1A 4K94H 4PJAB 1P1ZB 3ABZA 1C08A 4FQCL 4UTBL 4WTXA 4Z7UE 1F8TL 4RMTA 3DO7B 3JTTA 2R4SL 3W2DL 1D5IL 2WWMD 5J9PB 2WUCH 3N04A 2WMGA 4R90H 2XWJA 1YY9D 4QXTA 3KYKH 1FNGB 1HNYA 4KKLC 3W5MA 1U3HC 1JK8B 3KLKA 1RHHB 2NY0D 5IFJA 3BW9B 1A6ZA 1DQLL 2DBJA 4PGBA 3UBXA 4TOYH 3WN5A 1WPCA 4FQ2H 2WBJB 4PJIA 3DBXA 1CLZL 3NAAL 2ERJB 4IOSD 5E70A 5FF6A 3AOFA 2WBGA 5JW3H 4HLZH 1F90H 2BC4B 4YHOL 4M7JH 3HPJA 4CD5A 2DMCA 3IKCB 2VVNA 2VZVA 4QYOA 3T08A 3BPOC 4DOHB 3I6GA 4XBGA 4OAWA 2VLJE 1QNSA 3DUUA 1RK1A 2ZOKB 1N6QL 1HK6A 1IM3A 2WV3A 1G7IB 1RZFH 3NA9H 4HJ0C 4LLQA 3WDRA 3IANA 5D9SB 1GIGH 3VWKC 4D3CL 5GZOC 5TFSL 1GOQA 1KULA 1S7UA 3VRLF 4AD5A 2GFBB 2FO1A 1XFPA 2JJVA 3QIBA 4DTGL 2M2DA 5F44A 2YPLD 1FFOB 3OGOE 5IF0A 2W92A 1DQLH 5IESH 2KQMA 4W4OC 3MRCA 5JOPE 1CIDA 1G9MH 5EU7C 3CMOL 5FK9B 1XF5A 3N0PB 1I8MA 4K3GA 4Z8FH 5INDA 3IDMB 4JRYD 3GXFA 1U92B 4ODVL 2F2HA 1L8NA 1T20A 2FWOB 1E6JH 3SKJH 4XCCH 4ODWA 3WELA 3EO0B 4XNXL 3TV3L 1HIMH 3UPRA 1H5BA 2HFFB 3VXNB 5ADPH 1G7JA 4G6AC 1X5FA 3LKPB 4WFEE 1YZZA 5DR5H 2CIIA 1P9MC 2WM0A 5BXTA 1MW3A 3S6CA 4AL8L 4O2CA 4MNLA 4RMWA 3MLVL 2ESVE 4QTHA 1EBPA 1JPSH 1DBML 1I1CA 4FXKB 1I1YB 3CJJA 3P73B 3M8OH 5BMFH 1A6AA 3PL6A 4GPNA 3B9AA 3RJDA 2XM1A 4DZ8B 4UINL 2WPGA 2AXGB 3QIUA 3O6FC 4LGSB 1D6VL 3PGFH 3VSTA 1KEML 3F8UB 3ULVH 3PWPE 3K4DA 3H9SD 3KPQB 4W7VA 2XZAL 3WFBH 3FQNB 1NFDF 5GGVL 5CEXA 4QTIL 4XAKE 3FFDB 4F37F 4IEFB 4M03A 5I8KH 4W4NA 4LHQB 1GNXA 3SDXB 1QRKA 5IR1B 1JI1A 1W9UA 5GSRB 3I6KB 1NOFA 1EQCA 2D7OA 4W88A 3A5VA 2APXA 3BZDA 4WNQB 4GXPA 3DX7B 4YBLC 4E8CA 1ISYA 4PRIB 2GDVA 3GXIA 2FR4A 1BTCA 2XXMB 1B6UA 1E6OL 2DM2A 4OD1H 5F9OL 4L4VE 3PN8A 1MJUL 2YPVH 3H42L 5I1IH 2CH8A 4KK6C 1FAIH 1EHXA 3VI3F 4PJXB 2X89D 4G5ZH 2C9AA 3MLUH 3ZE0F 1YEFL 3EYFB 5T5FH 1J0KA 3BJ91 4PP1C 5KN5B 3GNMH 2OCFD 3BUYB 4UIKL 3QXVA 2GVYA 1TTGA 2E7BA 4PJ7F 5D1ZB 1WBZB 2VXTL 3MRPA 5GGVY 2FWOA 3G08B 3IXTA 2VYRE 1W72L 3D18B 5I9QB 2JKXA 5EBGA 3IDMA 1GOWA 1KXVC 1GQKA 3I6KA 3Q1SH 5I1LA 5HHME 2Q76B 1WCBB 1XF5B 3SDXA 3RL2B 4NJ9H 4ODSL 3V7MA 2F7PA 3HZYA 2IMNA 4GBXD 4JREB 4OI8A 1FAKT 4PGDA 5CGYC 4NWTL 4H1LA 4KUZL 3H9SB 3PHOA 1ZLUK 3GBNL 5CJXA 2Z9TA 4DZBA 4HT1H 4NM4H 2X05A 1SY6H 5DJZA 4U6TA 4WW2B 3VINA 1BX2A 4U31A 1DANT 1NMBH 4WU7A 2WHMA 4OLWH 4RISH 1U3HB 1UWGL 4YO0A 3PTMA 4HV8B 4G6FB 1CDIA 2R1XA 4EZMA 4NM4L 1ZKAA 3EYUH 1A6UH 1S9VA 3OLDA 5EO1A 4KZEL 1YNKL 1NGXB 1OAQH 5FF6B 3TJHC 4Q2ZB 2B31A 3GNPA 5E1QA 3C5ZA 3VFUB 5HHVL 5IVXE 4DVRL 2JJTC 1QNRA 4KVCH 4RA3A 1J86A 3OZ9H 4QOKA 2QQNL 2V2WB 1ACYL 4NDMA 3FTGB 4XCFL 5I1KL 4KKCD 3OV6A 4XPHH 1LEKA 4E41A 3DX2A 5ELIA 4ORGA 3CZGA 2FX7H 1BQCA 4IRSC 1UG6A 5A16B 3NJ3A 1PPIA 3UJTL 4U1SA 1JTPA 1I9JH 3OAZH 1RHFA 3AS1A 1AQKL 2VITA 3VFOA 4LHUG 4WW1B 1WIPA 5E6IA 1IGMH 5K9OB 5DK2B 3VWKB 1ADQH 2HFGH 1VB9A 3KPOA 1CGVA 4MMXC 1Q4NX 3BH9B 1YUHB 4MQTB 1KF9B 4CADA 3THCA 4G8FA 5HPMA 1LD9A 4V27A 4PJFA 4Y5VC 3UDWC 3IKCA 1U8JB 1J9YA 4W8AA 1MH5B 3UESA 3MACL 2RAMA 4QNPE 2J7BA 1KTDB 2QSVA 3K4ZA 3WJJA 1U42A 5ICYB 1M04A 5D1XB 3C6LA 4CU8A 3THML 4PMYA 5DMIL 3UPAA 2D20A 2ZIDA 3C5JB 3BDYL 4PV9A 2BNQB 1QFWI 1S9XB 1RJYA 2WLZA 3D25B 4ONGL 3Q5TA 3DHMA 2AEQH 3MRQB 3V6OE 5DJ0A 5DSCA 4Y1AD 1H15B 1PIFA 1U41A 2NY2D 2PW1B 2DWEB 5I75B 1AKJA 2WSPA 2NYYC 2G9HB 4ZFFA 4PRWA 3BIAX 5ESAA 4XNYL 4F57L 3BAEH 3DROA 3MRQA 5LXGL 1I1WA 1BQSA 4U1KB 3GUTA 4V28A 3O41B 2EXWD 4UQBA 4FQJH 3BUTA 1V7NL 5K9QG 2R29H 3QWRD 3L4ZA 1CDBA 3V52H 4AG4L 3LB6D 3HLAB 1JF1A 5JDSB 3RMEA 5AC5A 4UT9H 4KZDH 3T8XB 1EAJA 2ZX6A 5KSBE 4K7FA 3BKMH 4JY4A 3GFUA 2QKIB 1LD9B 4J3UA 3K1KC 4IRJC 5E0QA 3M1BA 2OK0L 2GHWB 3OKEB 4PJDA 4GMSH 2Z93A 2WYSA 1M7DB 3ZJ8A 4E42A 1OW0A 1KPUB 4YDKH 3JWDH 3IAQA 3S5ZA 1WUNT 5FYJH 1JNDA 2V3EA 3FQUA 4FZEH 4XNZB 4APQC 4YR6B 4EK7A 1ECEA 5C70A 2XWDA 3S5LG 5DGRA 4QLJA 3ULVD 3M45A 2XTJC 3HNVH 3PGDA 1V3HA 3D0LA 5T1LA 4BQCA 4RGNB 2DQEL 2JJWA 3PQYB 1Z9LA 3CSGA 4L4VB 5HGHA 1QRNB 5D2NE 2NY3C 4O58L 5FGCB 3F5LA 2CK0L 3BEVB 5FM5O 1JAEA 1LP9F 2XN0A 3MRKA 3WUGA 2WZPD 2NY2B 3IJYB 4NPYA 4M7KH 5MENE 4P7OA 3QUMH 1B6DA 3VFMA 3CFJA 1E6XM 1KQYA 3CHFA 5IQ9B 1I8LA 3UG3A 1IEAB 3GRWA 1LG2A 2FB4L 2KH2B 1R24B 3QQNA 5CQ1A 2OTUB 3PZNA 1UB5B 1EJ6A 4I3GA 1KYOK 2PN5A 3BRDA 2VLRE 3CH8A 4HS6B 1FOBA 3SE8H 4X9GA 1KLFA 1K4DB 4PFEA 4NHUA 2EDLA 1MOEA 1KN4L 5FD0A 4J28A 2E40A 1T5WA 2DAVA 4E41E 3P4NA 3LKRA 3RL2A 2A74B 3RVWD 1FH8A 4JG1L 4MNJA 3MROB 4RGNE 2Q76A 2XKUA 2P8LA 3HCVB 5IFPA 4PB9H 5DUML 4IRJD 5IM7A 1UWRA 1PAMA 2DQTL 1R47A 3MUGB 4TVPD 2YPKA 3AY4A 5I1DB 2DI8A 1H09A 5D70H 3VCLA 3WUFA 3RWFB 3T2PA 3GSNH 2D3VA 2VT0A 5C6WH 4LSPL 1T7WA 3EYFA 4GKOA 1JGLH 4IMLA 3BPNB 4UNVA 2FBJH 4X6DB 4JVPA 4I13B 1HHKA 1FVDA 2YZ8A 3G5VA 2J7FA 2NR6C 4ZTOL 1FNLA 5E9DD 5ITBH 3J7HA 4ZXBD 3GSNB 4HGWB 2NW3A 1XH3B 5AZ2L 3MRHB 1F97A 2DMBA 3I75A 3T2NH 5CCKH 1FE8H 5L8KB 4R7NB 1N5YL 2V7HA 2YD8A 2XQYG 4AYGA 2NR6D 1QHOA 5A6AA 1V05A 1EZVY 3DETC 1KCKA 1SYSB 1OD8A 4RCAA 3U83A 4DKFL 3CVHL 5A2FA 4UBDC 1HHGA 5FYKL 4HH8A 4EEEA 1U0QA 1GGBL 3OBAA 2ORBL 3FO0H 5IR1A 4PRDB 2EIEA 3TN0D 4ZS6D 3OAYH 3OLIA 1KELL 2CKBB 4L8DB 2ADJB 2GI7A 4KI5E 4EKXA 4GG6F 1RU9L 4X0NA 1WV7T 2CXGA 3V4PH 1LDSA 4NJAL 5HI5D 3ZE0E 2QPUA 3KAAA 4PRPE 4ZMAT 3BMWA 3NFSL 3MFFA 3TN0C 3HG2A 3S35L 3VCLB 2D0HA 2PWGA 1OP3K 2A1WH 5EO0B 3VXUA 2PCPA 3TNMB 4Y5VA 1V3JA 2NY7L 1WWBX 4U7MA 2NNAB 4KDTC 3FO1A 1I1YA 5DRNB 5EBMA 3X17A 4M81A 3F58L 3FQXB 35C8L 4QTHB 1G9ML 2IG2H 1RUKL 4LDLB 3NTCL 4CVWA 1S5IH 2QTEA 4HDIA 5FYJE 5D2NC 2FJHA 4NOFA 5E6ZA 4Y19B 4OGXH 2OP4L 2DDQL 4DKFH 4LPCA 1AGDB 2EDXA 5IEKB 3IJSA 5TFSH 3AIUA 5C0NC 4L3CA 4PRNA 1B4RA 4JFED 3B2VL 4FQXB 3KPRA 1XGTB 3SCSA 4JJ5B 2UZYB 1K8IB 1OAUL 2YWZA 5A6LA 4OCNC 4RGNC 5FK9A 2AEQL 5F7UA 1S78C 2BNRD 2A3BA 1QD0A 1NUFA 1RIUH 4Y89A 4NZRL 5EULV 3E6HA 1AQDB 2HT3C 3ALPA 2NY1B 5EPMB 4RGMB 4ODTH 4XCEB 4KUZH 3ARXA 4R97C 4X5WB 3RWGA 4NRZA 3C8DA 3QXUA 3CTTA 1T1XB 2KZ1B 3S34H 4OB5L 4BFIA 4YWGL 2A38A 2WCGA 3BO8A 1NFDA 2CR3A 1QLRB 4P2RD 5E99L 4YDVA 2B7DT 3PQYA 5GRVL 1PD6A 1KGUA 3HPJB 3L3GB 2HFGL 4UFMA 5CPSA 5MI0B 2H1PH 2OL3A 4EUPH 1CLXA 3CUIA 2ICEB 2XA8H 4IISA 4MAVA 4IIQB 1W8OA 1DQML 3W0WD 5DJ8B 1CLOH 1JZ5A 2IGFL 4CBPA 1Q0YL 4J23A 4MLSA 1RU9H 5TQ0L 4E42B 2XSBA 4XPGH 5CJQH 5IHUL 4WIQA 3UAJD 4EUPG 3P3YA 4UU9B 2IAMC 5HHNB 5TF1H 2O9OA 4OI7A 2A83A 3FL7A 1CE6A 4OFDA 5EBWB 1JDDA 1I7ZB 3W37A 1G6RL 2QEJA 4HOWA 3VFSB 1KFAL 3UAJC 5C07E 4QF1B 1LLOA 2EIZB 3HLAA 2XVGA 2ZOLA 5FKPB 2FSEA 1EVUA 1IQWH 2COQA 1WTLA 4KZDL 4HFUL 3BOVA 1EOKA 3TONA 5H94A 4QRUB 1OTSC 4F33A 5HGAB 4JKLA 3ULUC 4OIIL 4NO3A 1N26A 3ZE2F 1D9KD 3V4UH 2YKLL 5L6YH 4XNZC 4APQB 1J87A 4KV5E 4XCYA 3QH3A 1FNFA 1IV8A 1U8NA 5L9DL 2IPUG 4P5TC 5F1KC 1AXSA 4YWGH 3WD4A 3EYOA 3C60B 2QADB 2Q7NA 4P4KD 2YFNA 1RQ5A 5FGBC 1J18A 4K7PX 1JL8A 4ODTL 1SVZA 4LPXA 4B0MM 2XSAA 4I48B 1SYVA 3VM5A 4WFHD 1MLCA 2GCYA 1E55A 1CPUA 4XNXH 1D9KB 1ZHKA 2P48B 3TV3H 1QNPA 4FLSA 4MADA 5I8OH 2XKNB 5DO2C 1D6EB 3GXTA 4UR9A 1BVLB 1G7QB 1TPXC 4AIXA 4PTWA 3VFGH 5E08L 4OZFB 4G8FB 2GJZB 5HPMB 4X80H 3MANA 3FFCD 4LEXL 4JHWH 1REIA 4MAYD 4D9QD 2D7PA 2OQJA 3SGEH 1RP8A 3QUZC 4GG6E 1NWRA 1CGSH 4UQ3A 3THDA 1J8KA 2FNBA 1BOYA 1FH5L 1XIWA 3UTSD 2DJUA 2CLRB 1VADA 4KJWC 1HXYB 4UZUA 1OPGL 1YEJH 1AXTL 5DYOB 2XIIA 1JYWA 2QSTA 2DLGA 3AI0A 3ZZ1A 3CFBA 3FTGA 5E8OB 2ZUQC 1P4IL 2IADB 3VXME 3BJLA 3QWRA 1XR9A 4KKAD 5T5NG 4RMRA 1HWGB 3BP7B 4PV8A 5I1KH 4L4JA 1UXSA 1TJGH 1IL1B 1FJ1A 2UZIL 1NC2D 3VFTB 3OJMB 5ABHA 2W9EL 2CDGA 3QUYA 3GXPA 4HK3N 5E00B 5GNYA 2JJSA 4KKCC 4M1GL 4PJHF 1C8XA 5HGBA 4FP8H 3AIBA 5LGHH 3T3PF 4JY6A 3NSXA 1ZANL 4J2XA 3RWGB 1BYBA 4HPYL 1R6VA 1Z9SA 1GQLA 2WMKA 2YKKA 2LAGB 2UZXB 1SM3H 1IVLA 4FQPA 1AQDA 3H54A 1DVFA 3ZDZF 2A77L 3RGVA 2B1AL 5I76A 1TIUA 1YEJL 3ARED 3UBXI 2BNQE 3JTSA 1N3NA 4NHCH 2V2TA 1BVZA 1SQ2N 3GSNL 1QI4A 1RUAH 2FECI 5J6GA 2VL4A 2DTML 4N5EC 3BWUC 1EH9A 3ARZA 5IVZA 4P4RA 3VFVA 4HP5A 4UFLA 3S4SB 3BUDA 1LEIB 3IDNB 4TX6A 3S3JA 4H26A 1G9EA 4MDPA 4RE4A 2R56H 4EN3C 1PEZA 4X80L 1FNEB 2X1PA 2ARJA 3D2UA 5IV2A 3LX9A 4IIQC 3DI2B 2FHFA 3C8KA 1RZFL 1X5KA 1YJDH 4JDVB 5BV7L 2GTZB 3WD3A 5JR1H 3TNMA 2DKMA 4LFHG 2FL5B 5F1IA 2Q7YA 2J5LC 2J12B 3VFRA 4RZCB 1G9NH 4MHHI 3LZFH 3RWEB 3WJJC 2OI9C 4OFIA 5DZLA 2QHAA 3ZYZA 5KS9E 3FN9A 4RMUA 1E4IA 3A24A 5AZEH 1FL3A 3CUFA 4R97B 1A6WH 4GRWF 1R34A 2X1WL 4YHLL 3I6LD 4ELME 3OWEA 2XYLA 3MJ9A 4EE9A 4PMDA 2CDFB 3MV8B 4CD6A 1U8QB 3LKQB 4M7KL 3BCFA 1IJ9A 4PLKC 3N1MC 3VD9A 1ZGLA 1J0HA 2B5IC 5C9JB 3FFDA 1NMAH 1UD5A 1W9XA 1P4LA 3ARBB 2OSXA 3PTKA 1FP8A 4PREB 4U6YA 1RZ7L 3QUZD 1E6PA 5C0BA 3KPPB 1MIML 4DCQB 3SCPA 3RU8L 2PUQT 2E3VA 5D7JB 4W8LA 3MXVH 1I9JL 4ZUTA 5C0CD 3QUXD 4KHTH 4ZXBA 4YFLF 3V7AG 3D6GA 4KTDL 5KSVA 3IFOA 2EKSB 4Q9QH 4XP9H 2QQNH 5D5MF 5C09B 3RWDB 5I6SA 3DX3A 1KC5L 1K5NA 2YPKB 1KCUL 1OGTA 3V0WL 4BFGA 4F9LC 5I1DA 3UZEA 3F4VA 4LLAA 5F8RC 5T3ZH 1IE5A 4JO3L 2ENYA 4L5FH 1RJLA 3PP4H 4X6BA 2O61A 1CDCA 4PRPB 2DICA 2JELL 1XCTB 3TN0A 1DDHA 3AJ7A 4GW1A 3O6LL 1UWGH 2DD8L 3IS0X 1AP2B 4H2CA 3KS0H 1KT2B 3FO2B 5JNYB 5HOSA 3CUPB 4GLRI 1XGYH 1JGIA 1K4DA 3ALXA 5J06A 2XXCB 1UWSA 4JG0H 3ILQC 4NKOB 4YBQC 3CMOH 4YHIA 3U9PH 1KCSH 1WE5A 2JIXA 3RA7L 2GJ6B 5E99H 4LLDB 5LAXB 1DLFL 4UILH 2VC2H 2WBKA 2A9NH 2DQIH 2HN7B 4F2MA 1B4JH 3BSHA 4QHNB 3BAEL 4WI4A 2GTWB 3T4YA 5DMGD 3MUJA 3O8XB 6TAAA 2GAZB 3QFJB 4Z7NF 3C5ZD 1J1PH 5EC1B 3SDAB 1OP5K 3NCBB 4OV5A 2JB6A 1CGWA 2BC4A 4X6DF 5EUKA 3U9PL 5I1AB 4OCXL 2RFXA 3NOIA 4KKLD 1UH4A 1RIVH 3BEVA 4HS8H 4QHKJ 4GS7C 4JFUA 1R33A 1CGTA 2VDPH 2BVDA 1HKJA 2A3AA 5E56A 3LEYL 1H5VA 4ZPTA 1LE5A 5GPRA 4BQ4A 1WZMA 1KXTA 2BNRA 5C0AE 3UBXB 5E6ID 4D9RE 1A5FH 4LMQI 5F7EH 3WDQA 4S1DC 1OSZB 3IDGA 1I9IL 3TA3B 1P7HL 5ICXB 3VIKA 2ZP0T 1HKLL 5ECUA 3WEXB 3GH7A 2WWMC 2IEPA 3QZWB 1DWAM 1T7YA 4R0LB 2IG2L 5JHDB 3TA9A 3HAEB 1NANI 4D0DA 4GLRH 1HYSC 2OR9L 4OZHB 4TRPH 2Z93B 5F1OB 3U7AA 2DN7A 4BCEA 2F8XC 3DO7A 1UASA 4OUUA 1C08B 4XPFH 1ONQA 5GRXG 5FA3B 1G7LB 5LQBH 4HS3A 2BHUA 4Q7DA 1FHLA 3MV7B 5EIQA 2WLYA 1EO7A 1U33A 3QJFA 2X4QA 4HWEH 4OCXH 2E8ZA 4QHLB 4JDZA 1OHQA 1KELH 4GKLA 1I8KA 5C07A 4PJBF 1RMFH 1FCGA 1T1YB 3SCUA 3H0TB 3MJ6A 5HVGB 1ND0A 4HPOH 4KTEH 4EN3A 4G8EB 4Y2DA 3H9SE 3QRGH 4HC1A 1JPGB 3MBEB 5I16A 1DBMH 2VLLB 1A3LH 4G6AD 3BGMA 3NCCB 5SX5K 1MFBL 1MJ8H 2VDLL 1H15A 5HI4C 4FFYH 3PP3H 4JM4H 5ALCL 1BP3B 3NN8B 3WF4A 4S1RL 1SEQL 1YEHH 4KHXH 1U3JA 4BSWA 3W2DH 3SKJL 1CENA 3D25A 3GXDA 5FDYA 4FMVA 5D1ZC 1GZQB 5B8CA 3GBNH 4WUKL 4NFCA 4KMTL 3RX5A 4M6NH 4MAYB 4OCWH 4IDJL 4DW2L 2I9LA 2ZUXA 2J8FA 1GOMA 1I3GL 3DGGA 3B9KB 2Y1VA 1U6AH 4ZUWB 1VA9A 2EDNA 1H8NA 3O2VH 1JN6A 4OCSL 1C5BL 4YXHL 3WHXA 3SE3C 4PJGF 3QULA 1F4XL 5TE6L 4CADB 2OMNA 1YUHA 3HI5H 1QTYT 1HN1A 2EIBA 5EOQH 3T2QA 1DBJL 2FX9L 1H0DB 1IC7H 4L9LA 1WIUA 4P5TB 4X6CA 4Y4KD 3MV7D 5T1LD 5K9OA 5B38B 5I1HL 1HXMA 2P42B 5D8ZA 2YD9A 3NFSH 3TWCL 2WINA 4G42A 2ZPKH 1YMMB 3GMRA 4Z7UB 3KXFB 4ALAH 2WUBL 7A3HA 2D0FA 4BUGA 2FX8H 2YPLA 1S8DB 1OGBA 5KW9L 5FB8A 1ZANH 5KSAB 1RZJL 1H0GA 4PG9A 1N0XH 2V2WA 4MJIE 3TT3H 3N13A 4HPGA 2EE9A 1G7PA 1JPTL 1DFBH 5BRZB 1S9WB 3SGDI 4KMLB 2GSJA 1EEYA 3BE1H 3RY6C 5IMKB 1T7ZA 1TQWA 5C0FB 3F12A 1XIWD 3UTSA 1RD6A 1B1YA 3IT8D 4IJ3B 3CNKA 4Y2DC 4MCZA 2EYTA 2J1KA 1XHGA 3SCMD 1HKKA 2C0HA 4YHKL 2JF1A 3MLYL 2F7OA 1JGDA 2BFVH 4LAJH 5IHZB 5CKAA 1N4XH 4U6VL 4RWYL 5IIEB 1RVFL 1A7PH 4JFYA 1PG7L 1AXTH 4C4KT 5ABFA 2R56L 5K9KB 3TYFA 2FJFA 5A6BA 4HPHA 3H9SA 4K7PL 5DK0A 1NC2A 4M8QA 3WS3A 4NNPL 3WBDA 1OW0C 4D71A 3SCVA 3U7YH 4HJGA 4P23B 3ES6B 4Y5YB 3VRLE 4TUJB 5ACMA 1JZ2A 1AHWB 2HKHH 2W60B 1VHPA 1O0VA 4C83B 1HILB 4OD3H 3VFNB 3AC0A 2ED7A 4R3SA 3T0ED 32C2A 4M93C 5CP3H 3VXTA 2HVKA 2DSKA 3K46A 2VABB 3PWVA 2Q86A 3RGVD 4W6WB 2GSIA 2BY2A 2H26B 5DJXB 3MTRA 3F6IA 3ZL4L 4N68A 4BSJA 3QDME 3WMCA 3AREA 3H3KA 3QDJE 1LP9E 4ZFMA 4M3JA 3WS6C 4AZGA 1DWIM 4NZFA 4KROB 3HRPA 4LYPA 1ZK9A 3C9NB 2FX8L 2ESVB 1Z2KA 5TDOB 1J8HB 4NQEA 3GHEH 3LD8B 2Y23A 1OQOA 5I74B 2CDEA 1V0KA 3L3HA 4YAQB 3SUTA 4XI5C 4X4ME 1MCQA 2XN2A 4JRYB 3RNQA 1RZJC 1ZA6B 5K59E 2GSGA 3IAGC 1V0LA 1EUUA 4XX1G 1M71A 5EU5B 5CBEB 4IOIA 3VXMB 4GG8B 1CD8A 5E0FA 5F7KC 3ROLB 5C0DA 4MAUL 1UHVA 1OP5H 3VD7A 1N64H 3WIIH 4LRIC 4PRIE 1N59A 4AIZB 1HYRC 3ARVA 5D7IA 5HTSA 3UYPA 3VMOA 3ZO0A 2Z1KA 2XTKA 2H8PB 2YEZA 2OK0H 1IFHL 2VZUA 4P2QD 3IK2A 3SE4C 2AI0H 2O5YL 3TGXA 1MXDA 4H25B 3WKNA 2VUYA 2CIIB 2OWCA 5CLWA 2M1KA 3GBMH 4R4FH 1G7JB 3VGBA 4JFWA 3CIQA 3FQWA 4Z77A 1QSEB 3G04B 3C9NA 3H3BC 1UA3A 1GGUA 3T1FB 1Q6GA 2CBUA 4IRSA 2XN1A 1BGGA 1T1WB 4WVRA 3PHAA 2WC4A 3D0VB 3PGFL 2HLAB 5IQ7L 3F62A 3QUXA 4NUJA 4L8BA 1OGAE 3H8NA 3QDMB 1DWJM 4X5XA 5IMLB 4LMQE 4Z7NE 2GFBA 4UT7H 1BVNP 3BUBA 2H32H 4O4YH 4K9EL 4O2FB 3SY0A 3RIKA 3CV5A 4WO4B 1AD9A 4OF5A 4OIIH 1HOCB 1IC4H 4U1NB 3GM0A 4GZEA 3WF1A 1JYNA 3TJEL 1E43A 4AY1A 5GRJL 1G7IA 2W60A 2JF6A 5HVFB 1A14H 2Z91A 1NAKL 4HBCH 4M56A 1K9EA 2CKSA 4QNPF 3FW6A 1OB1B 1OSEA 5IG7A 4QYOB 5DMIH 3O2DA 5CGTA 1TA3B 3QIUC 1TVHA 2CJUL 4P46A 2IJ0C 2XFYA 2RCSH 1ORSA 4ZO9A 4GRWB 1O5DT 3VWJD 1OTTC 2JIXD 2YBTA 2V7NA 2NPLX 4MMZC 1UR1A 5AYUL 2FD6L 4QCEA 1YJDC 2C4XA 4QLKA 2D31A 3QPQC 3N1FC 2FLBT 1AE6H 5TH2B 5JIPA 4JFPA 4MA3B 5CSGA 1MCJA 3RX7A 5F93C 2UWEA 4BA8A 4Y1AA 3QNZB 4OLUL 4Z2LA 4D6EA 1KXQE 5EA0L 5ENWB 1RULH 3IF1A 4M7JL 5JIKA 3NUKA 1A7OL 2MPAH 4HUXA 5D1QD 5HGDB 1QWNA 3OGVA 4TVPE 1KJ3L 3EJZC 1VJZA 1ZBCA 4DO6A 1DLHB 5BO1L 4K94C 5D7IE 1P7KB 4LL9A 1E0XA 2J8UA 1A6WL 3V0VA 4Z9KB 4LKCA 2QV4A 4TOYL 3EOAB 1EHNA 4PYHA 1EPFA 5F9DC 2BDNH 4JFZH 4OOZA 5GGQH 1OCWL 1EXUB 2DQDL 1KGCE 2HISA 2BP3A 1HXMB 4NZUH 3ECQA 4LSRH 3OJVC 3PE9A 1AC6A 4OM0H 5KS9F 4L9LB 3O6AA 4XVUC 3QZWG 2A6KA 3OKLB 2VERN 1XZ0B 1DE4B 2VLKB 2JELH 5ESVB 1DBBL 1VIWA 3LXBA 3PP4L 1UH3A 3WJLA 4QCIA 1X6NA 4NWTH 4JL1A 2V5MA 3MRNA 4AENA 1MI5B 1QFUL 4M5ZL 4YDKL 3A23A 4MAYA 5A2JH 1UR4A 4QXUH 3BQUA 1Q8MA 2J47A 3BZFA 1QP1A 1WAAA 2CR6A 3L4TA 1BWMA 1QZ1A 3VD5A 5JMOC 2YD3A 3OG2A 2IQ9H 1XSKA 1MQKH 3BKCH 1W72H 1I8LC 1QSFB 1UC6A 4DGVL 1QPXA 4FLOA 4TVUA 3A21A 3MR9A 4OLXH 3WQ6A 3MNZB 4HW6A 1BG4A 4HUVA 5TGBA 1FG2B 3K1DA 3HC0B 1UR0A 1H41A 3SQBA 5I18L 2VZSA 4PCSA 1DQJB 1KQZA 4YC2C 1NL0H 5BVPH 2R69H 4F57H 1T1YA 3WY2A 4J8RA 3CVHH 2X10A 5F7EL 1MLBB 1UM5H 1KGWA 4BK4A 3ISWA 3P4MB 4WUUA 1K3ZA 1AIFB 4CVXA 2AK1H 2QV2A 1FH9A 2UV3A 4HQQL 3EFFA 2QSCL 1NBQA 2PBGA 5FOJA 3IETA 1ISXA 1SEBA 5C0IB 1KV3A 5DT5A 4ODBD 3VM7A 5JR1L 4PJGB 3MZGB 4IRJA 1DVFD 4Z78A 1V7ML 2NXZB 4LRNL 4JCLA 1JHKH 4ZQKA 2LTQC 4NWUL 4WTZG 5JHDA 3BN9C 1F4XH 3HZMB 4JKPH 2ESCA 1U8LB 4LARL 1F4AA 2CKNA 2K7QA 5CMAA 4XVJH 4P2RB 2YRZA 3EYQC 1PY4A 3R1GH 3WFCH 4AH2A 2ZOXA 4LCCB 1WJ3A 4N1HB 5D7LE 4FN0A 3MGOB 3OXSA 5IXEA 3S96B 4FMFA 1N8ZB 3OAUL 1QR1B 4D0BA 4DO4A 3GMMA 3PHQA 4LSSL 5HJ3B 1UM4H 3BEWB 3IFPB 3WL1A 3SQOL 2H2PC 4TVDA 5E9DA 4W87A 3ARWA 4S10A 5JUEH 3GSUA 5KANG 5DFTA 3VX1A 3MJGX 3UTPD 4KQ4L 4QRSB 4KMQA 2Y8KA 1TQVA 5D5MB 1UZ8B 4HIEA 2RFXB 5CSBA 2AJSL 1A22B 3SE8L 4OGAD 1V03A 1H3XA 3V5KB 4ZUVB 4FFYL 1RZIA 2V2XB 3RVXD 1P5VA 1AFVL 5I2IA 4ZD3H 4D6HA 1FLTX 4OGYH 2Z91B 4O9HH 1ACYH 1MFDH 4YPGB 3ZKXC 5K9QI 4F3FA 2DPEA 1IGYA 1MVYA 3N12A 1DWFM 4NRYB 4QRTB 4ZOCA 2XWEA 5H35B 3QHZL 4MWFB 4X9BA 2X4SB 3C5SA 3D4YA 3SY0B 2F18A 2JIXB 1KJMB 4PBWD 4NF7A 2AJZA 3O6FB 3IFLH 4MHHG 2VXUL 3VILA 2VCCA 5A6BD 3RM8A 3OHXB 5CJOH 4GUPB 3WMBA 3T2NL 2DQCL 3TO2A 1T04B 4Z7VB 1GGIH 2E9BA 3WUZA 2F7QA 1N6QH 1ERNA 1WO2A 4RAVA 4PRPA 3RTQA 2ZG1A 4KJPC 4UMGA 3BVXA 1T5XA 3L7EB 2OXGA 4RNRA 2WZEA 4ACYA 1AQ0A 5EU3A 1QSEA 2PWHA 2DQFB 4BYHA 1NFDE 2R4RH 4OT1H 1MAJA 1VESA 3VIGA 5DEGB 1FYTB 1O7SA 4PRID 3U30C 1ZBVA 1W8NA 5BJTA 4JHWL 3LPFA 3T04D 1KBGH 2YEZB 2W9LA 1G9NL 1CK0L 2J74A 2EDTA 1X5LA 5DHYB 4GMTH 4WJXA 4JE4B 1GGCH 3VE0A 3P11L 4PREA 4PLKD 4NGHL 4G7VH 4ZYKB 3KJ4B 3LQAC 4YEFA 1P4BL 2AW2A 1EBAA 4LVNC 3EJUA 1ZGLB 2YD2A 3HNTH 3KPRE 4HF5L 3QCTL 2NY5C 1CE1H 5F9AC 5IHLB 1E3ZA 1WT5A 2EO1A 3F7YA 1FBIH 5TPWH 1A1OB 3MJ9H 2DGAA 4F37K 2FECL 5D6DA 3U2SA 1YY8B 5C0AB 3LVEA 4LLVA 2BSTA 3BT2H 4OF7A 4P57B 4FNQA 2VQ1A 1UB6B 3HZVA 3ZL4H 1LO4L 3SCTA 4MQ7A 1NEZG 4HJ0D 1P69B 4MWFA 4JFDA 5FM5M 2FL5A 3ROOA 3GMPA 2OM5A 1E5JA 1KNOB 4P2QA 5C08E 3RTQC 1MJJB 4AQOA 2ENSA 5CEYA 5D9PA 2O26U 2DMKA 1NDMA 2ERJC 3AS2A 4JZOA 4YGAB 1JYXA 3VNZA 4XWOD 1KPVA 1RI8A 4HIIA 4RRPG 5FO7A 5JOFB 5HDRA 2WWDA 1CXIA 2EJ1A 5C0EB 3MLWL 4WUUE 3IDNA 1T22B 4R3SB 5D8JH 5IBLD 5IW6B 5JORA 2B39A 3BHBA 2R0WH 3MMUA 3AXLA 3GKWH 4XVSH 5J6GB 4LSUH 4GKZA 3OZPA 3ES6A 1AD0A 2XA3A 5SX4I 5BCAA 5E9DB 5CUSL 3F7RA 2A6JA 1FIGL 3HE7C 3KYMA 4D9LH 1XAUA 2NY7H 5HJ3A 2UUDK 3TCLB 4W85A 3OF6D 4M8QB 3PWUB 3WS3B 1Q6EA 4M8UA 4N0UA 4D0BB 4HKJA 3V4VH 2B4CH 3B3IB 1G01A 1KPRA 2CERA 4LCCA 4PJ9C 5HYJE 1CECA 4PMOA 3CH9A 3VRJA 2GITA 4P2OC 4G7VL 2ITCA 3UC0L 3O3AA 3MV11 3MJ7B 5TE7L 4D9LL 2PYEE 1CZ8L 2X9XA 4IRJB 4M62L 1PKQB 5C09E 4DKEL 5A1AA 4HSQA 1GONA 4BKLB 5C07D 3TT1H 4MJ5A 5E6IC 5F21B 1E6OH 3HPLB 4DW2H 1D5BB 1LEGA 4CVXB 1EOMA 5J6HA 3ARRA 4JFXA 2EZ0D 3BLPX 1FFPA 1UGNA 1B0WA 3CC5A 3FT3A 3G6AA 3W39A