1J1OL

Crystal structure of hyhel-10 fv mutant ly50f complexed with hen egg white lysozyme
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKFASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Role of Hydrogen Bonding via Interfacial Water Molecules in Antigen-Antibody Complexation. THE HyHEL-10-HEL INTERACTION
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j1oL00
3MREB 4AEFA 3QDMD 1NCWL 2DTMH 5E6YA 4O5LL 5A16A 1XAUA 4LSTL 2VWEE 2WK2A 1JGDA 2HVKB 3HMXH 3DBXB 2B5IC 5EORH 1KIPB 3QUMB 4YDIH 3CFBB 3RNQB 3Q48A 1ULVA 3I85A 3TZVD 5ALCH 1HHHB 2A1WL 5BZDB 1MAJA 1VFAA 5IBUB 4YH6A 1UVQB 2FBJL 1BBDL 2AJUH 2WBKA 5CZXD 2NZIA 4DVRH 4AG4H 4KTEH 1PW3A 3C09B 5BV7B 3RP1A 3CSPA 3T4YB 5L2JA 1M6OA 3CU7A 1X9QA 3KPLA 5IFAH 2DLTA 3V0WL 1SEQH 3V6FA 3MV9A 1RUAH 3LRSB 3MR9B 3R0NA 1FFPB 5ACLA 2QHLA 3VD4A 3G6DH 5DFWH 5IHZB 3V0VB 5DO2C 1AXIB 1DQMH 1KJVA 3AS3A 3U0WL 3WDIA 5KSBE 2PYEE 2XY2A 4X4YB 4MQSB 5IEHA 5KVEH 3WD5H 3ARSA 5HY9A 5CEZE 4MMZC 4KKLC 3L6FA 3MRLA 3OKDB 2O61B 2OL3B 5DFTA 3OJ2C 3D3VE 5C0EA 5I1DA 2ZUYA 4Y5XA 3SGDH 1QKZH 4IOIA 5HDBF 5GRJL 3CFJB 4G80B 2ZCLL 3TPUA 4JKKA 3MFFA 3QJFB 3GO1L 1FL3B 4LPVA 4W70A 4LASL 5D72H 5EZOL 1RMFH 3VXNB 1VADB 3EGSB 5GIRA 5IW1B 2YPKB 1FE8H 1U8LB 2V5TA 4QHLA 3X12B 5DFVD 2P8LB 3IXAB 4A6YH 5HHXH 4ONGL 1RI8A 4WU5A 3U1SL 3N1GC 1HI6A 4I2XA 2NY0C 1AGEA 4Z18A 1FL5B 1JYXA 4GG6A 2GTZB 5IB1B 1RZGA 4TRPL 2CDGA 4LIQL 4N5EC 3OKMA 2A73A 4L3EA 1I7RA 2WBWB 5E99H 1JNHB 4KROD 4UT7L 4ODHH 1KT2A 5AAWA 1ZXQA 4M02A 2R2CA 5B8CA 1MCSA 5D8JH 3BI9X 1A3LL 3WFHB 1OTUD 1SY6H 1FZMB 3WFDH 2QTEA 2P5WA 4Z6AT 2DQEH 3B9AA 2YKLL 2CRIA 2Z4QA 1IM9D 4R90L 1MHEA 2OR9L 3PWPA 1A2YA 4U1MB 1YEIH 3HNSH 4ZSOE 3B9EA 3VWKA 4JFDE 3WFCH 2M8XA 5F89A 5EO1B 3BPCA 4WU7A 1BIIA 1FNGB 4MA1C 4RAHA 3PQYE 2OTPA 4XCEB 3D3VA 5DZLA 1NDMB 3DUHA 5CZVL 4X6FB 5DMKB 3M07A 3HUJF 3DUSB 1HQ4B 5FHBL 3NZHH 4JFPA 4WFFD 5KAQF 3KPSA 4S1DD 2VXTL 2Q76B 3CZFA 4LQFL 5TFSH 1KPRA 4HK3N 3QIBA 3U4BH 4GRWE 1F4XH 5D7LB 2X05A 3W82A 2NXYC 4XP4L 5E4IA 2XN9E 1UJ3B 3BD3A 3EYUL 5FUZL 4EI6B 1RIVH 2Z92A 3G04B 1NLDH 3L7EB 4N1EA 5DSCB 4FQJL 1QYGL 4QRRE 4OD3L 4O2FA 3RVWD 4HCRH 4G9FE 1FL6B 4K9EH 5CIPH 5KVEL 3PHQB 5JW5B 4U7MA 1FCGA 2JTDA 3G5VA 4MAYD 3LPWA 4FQ2H 4S0TD 4YFEA 1D3CA 4U3XA 2Z8SA 2GFBB 1I7TB 4IS6A 3VA6A 4BH8B 4N0YL 5D5MB 4K94L 3HC0B 3SDCD 5AAMA 8FABB 4G8EA 5FO9A 3JXAA 5MEPB 5JA9A 5ANME 4ZFZA 3SGKC 3QO0A 4PJ7F 4JB9L 4KUCF 4HUUA 3EKCA 1T6WA 2F5BH 1QBAA 5JLZB 5HVWA 2VR9A 5IEKB 2LE9A 2PXYA 2MCG1 3JTSB 4XVUC 5KW9L 1D5BB 4YHZH 3OG4B 3HS0B 1OP5H 3F8UB 1AGCA 3B83A 4ONOA 2BSTB 3EOAB 5DI8B 4QRQB 1LK3H 1EUTA 4KGJA 3IFPA 3QQ4A 4X7TA 3IF1A 3LPGA 4D0BA 2VZ1A 4D0DB 2KH2B 3PGDA 1PSKH 3AAZA 4NQDB 3ILQD 2AXJA 5DJCB 2A83B 1EFXD 4APQD 5EOTB 1QUNA 5DUMH 4WO4C 4NWUH 3DX6B 3L5XL 5BRZA 5IBLC 3QUMH 2YD5A 5GGTL 3UYOD 1EBAA 3S4SG 5BCAA 2MCPL 2AK1L 1ACYH 3F7PC 3GMLB 4QXTA 4MJ6B 4JZOA 3HNVL 2J8UE 2EH8H 1I3RB 1K8DB 4NQEA 3KPPB 5FDWB 4XPTL 1KB5H 4HWZA 3QG6A 3STZB 3QO1A 2ZCHH 4TSBH 4YBHA 3VXUE 3NABH 2NY7L 3DXAE 2E9JA 4Y4KD 2OZ4H 3KJ6L 3WE6B 1KTKE 2NZ9C 5F9JA 4ZAKC 5IW3A 1MJJB 4ODVH 1QTYT 2XKUA 5SV4A 5JR1L 4EUPA 4TUJB 3MLZH 1Z5LB 4N8VG 2E9BA 4FFZL 2DQHH 3MUZ1 1YECH 1CVRA 4PPTA 3D0VB 5DGRA 3STBA 4HEPG 4HJGB 1OPGL 3PL6A 4HIIA 4Z7NE 4HJJL 3REVA 2CK0L 5GRXG 3IETA 2XI9A 3TO4D 3EYQD 4HKJB 2IF7A 4GAYA 1ES0A 1OARL 1NCWH 2DTML 4WTXA 3QPQC 1XCQA 4L4TE 4N0CD 1S9XB 2DWEA 4KKBC 3FQTB 2R56H 3QEUA 4XPHH 1J8HB 5I1JH 3RHWF 2D0GA 1AY1L 1YN6A 4DK6A 4LIQE 2LV4A 2JJWA 2QR0B 4Q58C 1I3UA 4IDJL 4UAOC 4R8WH 1W0YT 3F7YA 4WV1B 5HYJB 1OSPL 5D1QD 3WS3B 3BIBX 4U1NB 5IW6A 5BRZE 4Z95L 1H8NA 2PXYC 2LU7A 1T89A 2VTFA 2I07A 1LP9A 4JG1H 2W65A 3ALPA 4O9HL 3UTSA 5ICZB 3GHEH 4RMRA 2FZ3A 4PJ8D 1C5DB 1KIRB 35C8H 2WAHA 5I19H 1K4DA 3NZ8B 7FABH 3VMPA 1TCRB 4XRCB 1X5AA 1I1CA 1T0NA 2VRAA 3RX8A 4ZO6A 3WHXA 1EPFA 4LDLB 5CJXC 4J3UA 4ZTOL 3QEQD 4M1CC 3CDGA 5DK2A 4OQTH 2BY0A 1VKXB 1RD6A 1G6RL 2A77H 5TE6L 1CQKA 1ZE3C 2OR8A 3QFJA 2DM3A 5D5MF 3QCVH 3OJVC 4MJ5A 1BHGA 2NW3B 3IJSB 1KN4L 1WWAX 5GSVB 3FB6A 5JDJA 5HI3D 2FGZA 3GMQB 4NZUH 4X98A 3TBYB 1A9BA 3LEXB 3HE6B 3G5ZB 3GK8H 1IAII 4Y2DB 5C0BE 1XZ0B 5FOBB 2BERA 3ARFB 3HHRB 3DMMC 3BO8A 2DQFA 4PV9B 4X7SL 1NSNL 4QY8B 4GRWH 5I8CA 5BVJA 3D1MC 1KB5A 1ACYL 4Z7OE 1UXSA 5MP6H 2ATPB 2FH6A 4CU6A 3MACH 1K9TA 3D0LA 4DN3H 4YWGL 4FQXA 4AENA 2Q8AH 2B4CH 4LLDB 4LIQH 3MUGA 5FM4A 4OZHF 5JNYA 3PNWA 3EOTH 4ODWB 3BMWA 3ARDB 4TSBL 5EOCJ 2IQAA 3RI5K 4CMMA 4QTHB 3SE9H 3FONB 3D85A 1ZVSA 2M26A 4DUWA 1FORH 3FFDA 3ZHLA 1X6LA 5I0DA 1FVCB 3TA3D 3IU3B 3TCLB 3RTQD 4QTHA 1H8SA 4PGDA 4JRXD 2IQAB 4OZIB 3ARDA 4U1IB 5EU6A 3E8UH 1U91B 1S5HA 3PGCB 4JHBA 3MUGB 4XGZA 3AM8A 1FFRA 2UWEB 5CJOL 3ABZA 5HPOA 1CK0L 1MVUB 4PJBB 1KELH 4ZO9A 1MFAH 2DQEL 5I18H 3D0LB 1S9VA 5D6DC 1EMTH 2P49B 1N0XH 2A38A 1CXLA 3MOQA 4OSUH 3EFFA 3DLQR 4PV9A 3BO8B 3LHPH 4V1DE 3ARFA 1N0LA 2YBRB 3RVXC 4HS6B 2DQDL 4LCIH 3TBVA 2VDMH 3LEXA 4ZXBC 1A9BB 5I1KL 3IKKA 3MV8A 2Z35A 3GMQA 2FSEA 4ZG1A 2NNAA 4N8CH 4M7JH 5JW4R 3F7VA 4L1HA 5TDNB 2K9UA 2FNBA 2VUYA 2NW3A 4U6YA 4GMTL 4ZDHB 1HHKB 4LRIC 4OF7A 5I6XB 2HT2D 3VXOA 5IROC 3CK0L 1I9RL 4UT9L 1LK2B 4HK0A 4HUXB 3KS0J 4X6BA 4BQBA 1HSBB 4E9LA 1WZLA 4FNLH 3HLAA 5A2LH 3CDGB 1QO3A 5E70A 5DQJB 4HGWB 1HH9A 1WLHA 3NBNA 4PJ5E 3B8SA 4FRWA 3QHFH 5LBSH 5CCKH 2AEPL 1NFIA 2CLRA 1T0MA 2IMNA 3O2WL 2R29H 5ICZA 1QSZA 4FMKA 4Z0BH 4E5XB 3UO1H 2W65B 2I07B 4NM8H 2GITB 5TE6H 3VXRA 4D9LL 3N9GL 2ICEB 3UPCA 2ZSWA 1KACB 5HYJA 4PP2A 3QI9B 4YC2B 1I3VA 1MI5D 1MH5A 3PQYA 3ZT7A 4Y1AE 1NCCH 4Z7QF 5JORB 3QRFM 3M45A 4QHKI 3QFJE 3OJDB 2GCYB 3SDXE 1J8HA 4N0YH 3QEUB 2BVUA 3FQTA 2DWEB 3RU8L 1S9XA 1C08B 5E08L 2WUCH 2G75A 3SGDI 4K8RC 1T2QH 3NN8A 3GIVB 2FATL 5JA8B 2R8SL 2GJ6A 3GSQA 4WWKA 2B0SH 4HJGA 3JTTA 4CAGA 3W0WE 3FB7A 4UINH 4XVUD 2CPCA 3GB7A 4YK4B 3A6BL 4YWGH 5SWZE 2BOCA 4I18C 3P9WB 3VXSD 3QIBC 3HPJA 5HYJD 3MJ7A 5HGGS 3DXAA 3EOTL 1G7LB 5F97E 3BT2H 4Y8AA 1I1YA 4NZTH 4JZNA 1FORL 5KSUB 4KTYA 4ZSOB 2YEZB 2W0LA 1IRAY 3QO1B 3SDAA 1T1WA 4HWZB 3ARED 3UXFA 1GGBH 5CJOH 3KG5A 5JIHA 4QHKJ 2PNDA 3PGFL 5D2NC 5F1NA 5C0CD 1IEAA 4H8WH 1KLGB 5ELIA 4ZMAT 3GMLA 4QXTB 1RV6X 1UH4A 3D69B 3BKYH 4X6DA 3CXDH 3RL1B 1Y18A 1T5XA 4OSUL 2ADIB 1EHXA 1PKOA 4X5WB 2CDFB 5EULV 4G6JH 1MF2H 4AMKL 1GZPA 2X9XA 4OTXH 1WJ3A 3DX6A 3N0PB 5LWYH 3VXRE 2DWDA 2ZG2A 2CKBB 5DLMH 4NQDA 4P9HC 2EC9T 2HA1A 5DS8A 1BVKB 4KI1A 4GW5A 1SJXA 2C1PB 3IF1B 3L5IA 3IFPB 3QQ4B 2Q20A 4XNYL 1UB6A 1LVEA 2W0KA 2GW5A 3TN0A 4R6UA 3CH1B 1YEJH 4UAOB 3T0BA 1AGCB 1TVBA 4ELME 4KZEL 3VFOA 4JFFD 3RDTC 5DJ0B 4QOKE 5DRXA 5KANI 4BELD 5IVNA 4JFHD 1F6LL 2MQ3A 3GSVB 5H94B 2Y36H 3K3QA 5JLZA 1J0HA 4MJIE 3ZKMD 5FO7B 2P5WD 5DXWA 3QO0B 4ZFZB 1BEYL 1S7XA 3VDCA 4P57B 4CBPA 3DURB 2VXSH 4UBDC 5K59E 3L3IB 5MEPA 5FO9B 3BXNA 5IJVA 2R0KL 1YNLL 1ZHLA 4R2GB 5D7KD 5AZEH 4JCMA 3KNBA 1UEYA 3G6JA 1CF8L 2IGFL 3L5HA 3AMLA 4X0KB 2EECA 4LU5L 1J1PH 1MCBA 1YPZE 5IB5A 4NUJB 3QI9D 1B0GB 3EZJB 2RGSA 3WNPA 2X4QB 4G6MH 4FTVD 1ED3A 4M03A 4O2FB 5M94B 4PY8I 3TJHD 5DRWB 2W59A 1GOHA 5J12B 1IVLA 5T33H 1KJ3H 2YS4A 4XCCL 1YMHA 2B2XH 4OLEA 5DFVC 4Z8FL 1IGMH 4M8VA 4UINL 1NGQL 3RWHB 3OAUH 4GW1B 1KPRB 4JGUA 2PR4H 2X4UA 3QUZA 4LFHG 5C0BD 4RQQA 3T3ME 4M7LH 4JM4H 4KQ3H 4NP4H 1UZ6F 5HYIA 4DZBB 3DUSA 1FLTX 3WIIH 1A7PL 1CTNA 1CD9B 5ETUB 1VCAA 2WNGA 1GGBL 3BW9A 2F19H 1FNGA 2WINA 3KS0H 1R24A 3MBEC 3BPCB 1Z9SA 4H8WL 4Q6IC 4PREA 3MXWH 4E41B 1CLZH 4UOW0 4YHLL 5TDOA 4LSVH 5A2JH 4OGXH 5GGSB 1LO2L 4PBWD 1NSNH 2L7UA 2ARJB 2X41A 3QHZL 2X1WL 3HG1A 2MPAL 1FO0A 4XWOC 1MHEB 2FEDC 1JGUL 4O2CB 4PJBF 1NGYA 5HPMB 1FNEA 5I1CL 3UEZA 5FHAL 1TQBB 3FOMB 3D5OF 1PJ9A 4M1CD 3ZL4L 2P5WB 1CG9A 3GGWB 4O4YH 1YMMB 1CL7L 3WJJC 1S9WA 3OF6D 2R0ZH 3MJGX 4I3SH 1CGYA 4L3EE 5ESQB 1KCUL 1Y6KR 4G8GE 4PUBH 4TUOA 1G1CA 2IALB 5F88A 1I7RB 4MNQB 3KLHC 4N8PA 3UBXA 3RZCD 2VZVA 2CRZA 5HHOD 5HVGB 4KZEH 2WV3A 1QPPA 5I6XC 4QRPB 4X99B 4ORGB 1MCNA 4GG6B 3DV6A 1FL5A 3O6LL 3V2AR 4B5EA 1JYVA 5C0ND 3T2NL 3J8F7 2P8LA 5DJ8B 2IEPA 3G5YA 2YD6A 5GIRB 5IW1A 2HG5A 4DN4L 4P2QA 2DM7A 2CJUL 1J18A 1IGFH 4X4XA 5D2LE 43C9A 3QJFA 2AKRA 4G80A 1PYWA 4JVUA 4GXUN 4Y5YB 3W11C 3L7FA 4N8CL 4Y5XB 3UJIH 4DKEH 1U8QA 1JGEA 5J6GA 1INDL 1NUDA 1ZSDB 3C5SB 4C59B 3SDXA 5D71L 2VZOA 5IUSA 4CDHA 4R7DA 4A2LA 1P9MA 5CJQH 5AYUL 3TBTA 4FABH 4JFDD 2BVEA 3WJLC 1R5VA 1PG7L 3N50A 2AEIT 3HPLB 4HH8A 2W9LA 4WWKC 4BZ1L 4BSWA 4C4KO 3MSPA 1DBMH 2CUMA 2W9EL 4GKSA 4B41A 4OF3A 5K59F 3U30B 4KVNL 4F33A 4MA1B 2QSCL 5IQ7L 4CJ0A 4YQXH 3KPLB 1XGQA 4FFWD 3H8NA 3A6CL 2VR5A 2VABB 4K2UH 4B7IA 3BISA 1VFAB 1X5JA 2J4WH 4RGMB 2XA8L 3KDMA 5B4MD 4RIRA 2RCSL 4G6FB 4HMCA 1ZLUH 1G6VK 2MQCA 3S5LG 5JHLH 3VFWB 2DM2A 4TSAL 4OCMC 4Z7VA 4LKCA 5HGBA 1KB9K 1JGDB 2HVKA 5EZIH 3TT3L 4N0FB 5GRWA 4NQSA 5A3IC 2JE8A 5C9KA 1CIUA 4AH2B 1CLZL 3DO7A 1JHTB 1JPSL 3NCBB 4PJEF 1DUYB 1MNUL 1I1AD 3LZFL 4RMTA 3V4PL 5IBLD 3QUYD 2FGWH 4TVPH 5EBLA 5I16A 1U8PB 3CDFA 2A74A 3WNMA 5ISZB 2CQVA 4JVPA 2QQNH 1RZJC 1I7ZA 4XB7A 2RQ8A 3C60C 4JRYA 4HAGA 5F93C 3QIUA 4JANA 5C9JA 4DCQB 3GSUA 3FQUB 5ICYA 2VLKE 2R1YB 3U0PA 3EDFA 4PJ8A 4J3OC 4FHBD 4ETQB 1L4IA 1K8IA 4JHZA 4KAQH 2NTFB 1LEGB 4OFKA 1JFQH 1ONQB 1P4BL 5F71A 1A1MA 4JHWH 3HMXA 4YDJB 1CU4H 2V7HB 1BWMA 3FT3A 3MTRA 5FKAB 3OAZK 4JPVH 2XWBB 5IF0A 1SJEA 4ZQKA 5ACMA 2R23A 3PGFH 4PJEB 3H9SD 3HC4L 3PJSB 2VDPH 4MAUL 1TQCC 3IGAB 1JWUA 3WO3B 1MQKH 4G5ZH 32C2A 2DOCA 1P4LA 3KPQB 3OKOA 4BH7A 5IB4A 3UYRH 1MHPH 4JM2A 2W60A 4JFFE 3HI6H 4WO4D 1YNTA 4XMPL 3ARDC 4M62H 5LQBH 4OCXL 5DLML 1NFDF 3GEWB 1EFXB 3L3HA 5FA4B 1C5BH 3WUZA 4Y19B 1LEIB 3UJTH 1MHCB 5TE4H 4L4TD 4L8CB 4JFQA 4DK3A 2W38A 3NIDF 3LB6C 1HZHH 3MUJA 4HZLA 1XH3A 4YDKL 3BDYH 1JZ8A 1NJ9A 1F3DH 2AV7A 5E2UL 1K85A 3VFNB 3MGTA 3UJJL 1DBML 5F7HA 4XWOD 1QQDA 1IC4H 2DRUA 3V6ZB 2XQBL 4K23L 1S7UB 2BHZA 4FN0A 5HHVH 4UI2A 1JVKA 3LD8C 2VH5L 2CR6A 4UOW1 1NBZB 3UTPD 4FZEH 1A3RL 1NC4B 2YC1A 4XCYB 1I1FB 4L4TA 1Q1JH 3TYGL 1ZKAA 1AFVH 1G7IB 3DX8A 1JK8B 5C3TA 2W1NA 5CP3A 2BSRA 5FGBA 5TDPB 5E9DB 3MYJA 5B21A 3EO0A 1MCHA 2EYTB 3ZSTA 2J8UF 3S8WA 3GSNA 2YD7A 3D87B 2YN5A 3T1FB 1JV5B 1CFSB 2RFXB 4WI5A 2HLFD 4G6KL 2F15A 5E8PA 4GBXD 5T33L 3LS5H 4M4PA 2ADJB 4PJDA 3OB0K 3MBEB 4TPRH 5DO2D 3X11B 3Q3GA 4MA3A 5L6YL 1Q9LA 5J57B 2NY4B 2R2BB 2R69L 1JIBA 2NLJB 4QCIA 3VD7A 2VXUH 1F4WL 4MA8H 3EOBA 4ELKB 1VA9A 4HWBA 4XBGB 1WBZA 1NCAL 2AEQL 4OCRH 3C6LB 4JO3H 1RFDL 1U95A 2ZSVA 5CIPA 5I8KL 1RIUH 5SWQA 4Z77A 3GZKA 5C08D 3RNKA 25C8L 2EXYD 4CRPA 2ITCA 4JPVL 4CW1A 4P4RA 1H3GA 3CXHK 5C2BH 3SKMA 2XTJD 3SKJL 2F8OA 5I2IA 1UACL 3QXUA 4JGMA 4WW2C 4PLNC 4LSVL 4X9GA 5C0RL 2J8HA 1MQKL 1J8HD 3ZE0F 3UTTA 3NFNB 3V4VH 1P6AB 4M5ZL 1DVFB 5DJXA 2UV3A 3WN5B 2CLZB 4AM0A 2MKWA 3T4AA 2FRGP 2P42B 5IJKC 3NIGF 1UG9A 1IFHL 4ZS6D 2IPKB 1NAML 3SDXF 3L9RA 1SHMA 1UH2A 3OHXA 4H88L 4PJ9B 5IMKB 3OKEB 2VLJA 4UU9B 4GG8A 4Y8DC 1AJ7L 1BIHA 3C8KA 2GUOB 4YHKL 4WW2F 5DK0A 1CLCA 4YDKH 4M6OL 3U7YH 4PRBA 5HYEA 3QULA 5MHSD 3FT4A 4JN2B 2YXFA 4N0CC 4RWYL 1F13A 3IS0X 1EFQA 4ZUWB 1CFNB 1H3PH 1MCRA 1NCUA 1T03H 4IRJD 1RURL 1A7BA 4YDVA 2HH0L 3BPLC 3AREA 1N5AA 5E2TL 3NFSL 4I48A 3U79A 4P46A 4P99A 5EO0B 3NFPB 5H8DA 5GISH 4L3ED 3LKSB 4IMKA 4XAWH 5ESVB 2AQ2A 5DJ2B 3FL7A 3I2CH 3MOBH 2Z31D 2NY1B 3ARYA 2K7QA 1IGFL 5DMIH 3QB7C 2LFGA 4NZRL 3SDCC 3QIWB 1P2CA 1SM3L 4HIHA 5ALCL 3CCHA 3UJIL 2QQLH 2HT3D 3MA7A 1LO3L 1A6TB 1YDPA 3ECBA 2Q6WB 2QEJA 4NO5B 5AYUH 5IVXB 2DYPB 3RBSA 3TWCL 2NXZB 5J0BA 2H6PA 4BZ1H 5I9QB 3JWDL 5I1HH 4KHXH 1X6NA 1S7VB 3O3EB 2AI0H 2D0FA 2W9EH 3CVHL 3ZHDA 4NC1E 4GMSH 2B8OT 4QRTB 5IQ7H 5J6HA 3V5HA 1S7TB 3LEVH 3MRRB 1EGJH 5KN5A 1FYTD 2ESVD 1YA5A 3KLAB 4NO0A 1LO0H 1UYWH 4PJ9D 5JXEC 3WD5L 4DZ8A 1YQ2A 5F1IA 3SDDB 5B4MC 5KJRH 4D2NA 4MYWB 5HYQA 3ZTJH 1BJ1J 1WQVT 1PY9A 1D9KD 5L2KB 4J8RA 5J7CC 1SYSB 1X4ZA 5GGUA 3VRJA 1FZKA 1IC7H 4WHTA 1D5ZB 3SO3B 3GMOB 1T20A 1XGRB 4HPYH 4XVSL 5JHLL 4P23A 4P9MH 3L3JB 2VN7A 1RMFL 3BHBA 5A3ID 4M9PA 1EJOL 4LGRB 5D1XC 4M61A 3I6GB 5JTWA 5HHXL 4ONHB 3WUWB 3TPKA 4TNWF 4PRPB 1M7DA 4LMQI 2NQCA 3TC9A 5B38G 4R96B 1BX2B 4RSVA 1KG0B 4Y1AD 1TQCB 4PJXA 1U8MA 4KU1A 4Z7WB 3HR6A 1FNSL 1QEWA 1EEZA 5H35A 4BJLA 3DV4A 1REIA 3FT2B 4YR6B 4UT7H 3ILPA 2O5YL 4ODHL 1UZ8B 1U93A 1NAMH 1U3YA 1ZHBA 1SY6A 3QZWG 5IB2B 3FMGL 4YHPB 2QHRL 2VE6A 1IAKA 4YHKH 3G6JF 1SY6L 3WFDL 4DGIL 2HN7A 4LMQE 1H9VA 4NNPH 4Q6IB 1FVDA 4TQEL 5F9WB 2BY1A 4P4KA 4JFOB 5HHQB 2ARJQ 5SWZD 4OLZH 1AGBB 3O2VL 3CXHJ 1F3RB 5HYJE 1IKFH 3RWFB 3QNXB 1NBYA 4NNXB 4YK4C 1U8KA 3LKOA 3NFSH 1IEBA 4KVCH 3HRZB 4KKCC 4HFWB 2A6JA 4G5ZL 3QEGH 4QOKD 1K6QH 4HWBL 3CNKA 1G7QB 4JO4L 1UCTA 3R1GL 3LKNB 3X14B 4I77L 2HFFA 4MJID 4TNVF 2WLZA 2R9HC 3HI6L 4C83B 4U1GB 1F02I 3MGOA 3LD8B 4M8QA 1DCLA 4L8DA 4XP5L 5D4QA 2JCCB 3OGCB 3RTQC 4M6MH 3O0RH 2HT3C 5CEZL 1ZT1A 2BVOA 3UJTL 1D6EB 2J7LA 1ERNA 3ROOA 5DD6B 1YJDH 1IZJA 3O6KH 5K9JH 1GGTA 4EVNB 4HV8A 5JZ7C 4H1LH 2I9TB 3VXRD 3OF6A 4NKOB 5EOQL 3T65A 3GUTA 4PJFB 1QP1A 3QZWA 4HPOH 4NFBA 3C5ZB 1ZT4A 2H26A 1MRFL 4BZ2L 5B39A 3P4MB 1V7NH 3D25B 5DA0B 1QSVA 1U2HA 5D1QA 4R0LB 3O8XD 4G6AC 5HJ3B 4L4JA 3QJHA 1CE6A 3FJTA 4QXUH 3TF7C 4LGPB 5T1LA 4DW2L 1R3IH 5DUBA 4JHAH 4HT1L 4OCNC 5GZND 4ZODA 1J87A 4HH9A 4M7LT 1BZ9A 1CQYA 3ORJA 4R4FH 3RA7H 2Y5EA 3C6SB 4MXQD 4TOYH 3O3AA 5AD0B 1N3NA 1HXYB 3U30C 1RK0A 4NN5B 2DQTH 1OF2B 2V2WB 3RY4A 3K2UL 3LN4B 3LS5L 1CYGA 1PAMA 3BE1L 4LSRL 3HKFA 4F7MA 5I1AA 1HKLH 5C09B 3OX8A 5E5RB 1N5YH 1N8ZB 5D7SH 3PWVB 2HMID 2E6PA 3OKLA 4YHZL 1HNGA 5ACZA 1A14L 3SPVB 4S1QH 5CJBA 3DO3A 3HNTL 1DQJA 3EW3B 5JIKA 3U0WH 3IXTB 2X4PA 4PRAA 1V7MH 4RGMC 5E94A 1S7QA 3RWDB 2O5YH 3WN5C 2FWOB 3L3OB 4W81A 1M05A 3DOSA 3ESVF 3DIFB 3DRTB 4JY6A 5EU5A 4HUVA 1XF5B 2RR3A 1T5WB 1QG3A 1R3HA 1AQDB 4XMKL 5GGVY 5HI3C 1FG2B 1QVOA 1IM9A 1KULA 5D1XA 1ORQB 4NWUL 4JPWL 4RDQF 5EZOH 4Z78B 1DQQB 3P9MB 3QUML 2NPLX 3QDGA 5J1TC 2D7MA 1NC2D 1BFVH 1D5XB 3GSNH 3QEQA 3CSGA 4MNGB 4ZS7H 1MHHB 5FV2A 5I73B 4GRLD 1ETZB 3ARDD 3DVGB 4I77H 3GIZH 4ZOCA 1XIWB 2D7TH 1K2DA 3VI3E 2OK0L 5DC0A 4Q9QL 2XWTB 4UTBH 2ZUQC 3FB8B 5E99L 2F5AL 1V3MA 5GRUH 5BO1L 3W5MA 3UDWA 4CMHB 4IMLB 4OIBA 1MJUH 5JR1H 1YJDL 5D1XD 5GS0D 3GSXA 1F8TH 3VXPA 2DJ4A 3SDCB 1G9NC 3WXVL 5B8CC 1CI5A 5DVLA 1ZMYA 1DDHA 4ODXA 4M6OH 3U7YL 1KEMH 5EOQH 4KJQD 1JTOA 3H9HB 4J6RL 1ZA3A 3GJFK 2EDRA 2X4NA 5L9DH 4O51A 5KSBF 1RJYA 1TQBC 4KFZC 3LKPA 2BMKB 5EFIA 4BZ2H 1GGCL 3I84A 5D6CA 5FB8A 5F44A 5KTEL 3LQAH 4LCYB 3EYQC 3OR7B 4ZOAA 2LVEA 3T3MF 2GY7B 3KYKL 3TVMB 3C5ZD 4LLMA 4MAYA 4F9PC 3I2CL 4RGNE 1AE6H 2CIIA 3RTQA 5CZVH 4XAKE 4QWWD 4PB9H 4PTTA 5EU6D 4LCWE 5DEGB 2IH1A 4NZRH 4EDWH 5C6PB 4HT1H 5J13B 3BWUC 3K80A 4ZUSB 1HQRA 1CL7I 3MRPB 1OAYH 2QQLL 1M4KA 3SDDC 3HUJE 3ARZA 2OSLB 3BAEL 1BP3B 1YYLL 4WI7A 4D8PB 3IDMB 4CADA 1VGEH 1S8DB 2IBGA 4L9LB 3TWCH 1MPAH 4U1HB 1G7JA 5KSBB 2MFNA 4JPKL 5D93B 1WK0A 2DQTL 2G60H 3SY0A 5MEQA 4P3CL 4X6CE 1SBSL 4KHXL 3WEXB 2BRRH 1J0IA 3O4LE 3EYUH 4LLQB 4NQUA 4CNIB 4PJXE 1CDGA 5T1KD 1UKTA 5E1AA 3RZCB 4ZNCD 3HCVB 4KUZH 3FO9B 1D9KC 4HC1L 4S1QL 5T1KB 3WNKA 1MFCL 2JIXB 4AEIH 5T3XE 3PABB 1GAFL 4PJIE 1YEHH 1IGYB 4JFDB 1CGXA 4KY1H 4M43H 3E2HB 3O4LB 1EEUA 3KXFA 3JVGA 4UILL 2VDKH 1R3LB 1CGSL 5MEOA 4H25A 2DJUA 5LAXA 3S4SB 1UZ6E 3U2SB 1ZVHA 3L1OL 4H0HB 5ESAA 1OAXH 1HXMA 2WP3T 4K94H 3C6LD 4PGBB 4KTDL 2JB5H 1OM3H 3P2TA 5C2UB 1G6RB 3IFOA 3G5XB 1ZLVK 2GTWB 4LF3A 4JB9H 3GSNL 4ZS7L 2HKHH 2F5BL 2MJWA 5HHPA 4KJYB 3T77A 5FO8A 4ZO7A 5GS0H 3RWEB 2N1KA 5IBUG 3S35L 4NC2B 4Y4HB 4FQLL 4UQ2A 1A7QH 5CGTA 3F5WA 4HIJB 1DN0A 2NY3B 3AB0C 2F54D 1JF1A 3U7WL 1XF3B 4MNHB 3RHWK 5SWSE 3ES6B 3ARWA 3FMGH 3JZ7A 1MJUL 1RU9L 4AIOA 4KKAC 2WUBH 1FPTH 2EC8A 4JFZL 1DQLL 5A43C 1I85C 1CFVL 3VGAC 2FEEI 3VFUB 4HWEH 3MRNA 1A6ZA 4WW2B 4JPIA 1U8OA 2AP2A 2I9LA 3ALXA 4MDIA 3UMTA 2NY0B 4YHYB 2BX5A 3O2VH 1AO7B 1F90H 4Z9KB 1JZ3A 1IQWH 3HMWH 2FEDD 4XBPB 1EV2E 5DF0A 5BS0B 4OD2B 1H5BB 3THMH 2EO1A 3TO2A 4PJ5A 2DQDH 3T2PA 1KYOJ 3V7AG 3MLWL 3HNVH 3D18B 1EDQA 3DXAD 3NTCH 3UTZB 3C5ZC 4UOJA 3O6FD 1RHHA 5JMOC 1TMCB 1MCOH 2FO4A 3H42L 2BHYA 4GS7C 4R97B 5FF6B 4FTVE 2ZCHL 1RIHL 4WCYH 4EDWL 1QR1A 5JUEL 1ZHNA 2P48B 2PYFB 4DGYL 1DN2A 4FZ8L 4ODVL 1VGKA 5KVGL 4UV7L 1F3JB 2F58H 1WZKA 1CFTB 3MODH 3MROA 4JO1L 2AXFB 4LEOA 2QKIA 2VIRA 2YUXA 2DLFH 4LK4A 1ZGLP 1UH3A 3PL6C 1V3JA 1XR9A 4JPKH 3HI5H 3E6HB 3ARBA 2UWEF 1UM4H 3QT2A 2VQUA 5LBSL 2X7LA 5CCKL 2DIAA 2IFGA 4N0RA 2AJ3B 1JN6A 3WMSA 5HGDA 3LMJH 4ZFOB 3ULSA 4Z0BL 5C8JA 1QSEB 4Z5RA 1DQML 2QQKL 4A6YB 4POUB 1FFNA 4RA3A 4QF1A 1YEHL 2VLRE 4OFDA 5F96H 4M3KB 3SCMD 2IC2A 2HJLB 1VFOA 4H20H 6FABH 3UX9B 2KBGA 4LEXH 3TBSB 4MB5A 1AR1C 3MO1B 1CVSC 5GRJH 3C8HA 2CO6B 2OJEB 3B2UC 5DWUL 1KPVA 1K4CA 2BVQB 3QDME 1II4E 3P40A 3CVHA 3RU8H 4Z95H 2OI9B 4KWUA 4KTDH 2VB5A 5EWIH 4LSPL 3FZUD 1U8NA 1T1XB 2BNQA 5I9QC 4P9HH 1T3FA 3SGJA 1UC6A 4WFHD 4MXWH 5DRNA 4C58B 6CGTA 4KK9C 3GFUA 4HFUH 3QEQE 1I4FA 4DUVA 3MRJB 1DSFH 3DRQB 5FGCB 1IGJA 3GSWB 4EXPX 4RMSA 5T5FH 2OQJA 4XP9H 1MCCA 3OWEA 1KPUA 3H9SA 4ZTOH 2OTWA 3NGBC 1CGUA 3HNTH 1YN7A 4OM1H 3HRPA 1A4KB 1OGTA 1NH6A 4WUUA 1QSFD 5EZLB 2BJML 3RGVC 4OCSL 5DR5L 1NFDB 2BNUA 4J23A 3BKCL 2CO7B 4MD0A 2FR4B 2V7NB 1P4IL 3IDUA 1A1NB 3X13A 4CMHC 2Z9TA 4U6VH 3V8OA 4F3FB 3FQXA 5LJYH 2GSIA 3DI2B 1DE4A 5FCUH 2WBJA 1TZHA 3PDGA 3RUGA 1JGVH 5DHVA 5JDSB 2QLVB 4H5SA 1FAIH 5DEFA 4M3JA 3QG7L 1SEBA 1W0VB 2V2XB 3FQWA 3G9AB 2HTKC 2XZAL 4OCLC 4RAUB 1R3JA 4DN3L 1Q0YL 4XXCC 1QBLL 1QBBA 1BD2A 2V5SA 4JE4B 3CSYB 5E8NB 1IQDB 3QUXC 1LP9E 4ZPVB 1KEGL 2O93L 3LRGA 4GUPB 1FZJB 4GBXB 4Q9RL 1YY8B 4L4VB 5CSZB 4Q0XH 4XXDA 4NSKB 5FHBH 2P46B 3TJEH 5CLWA 1A9EA 3P30H 2VZUA 4Y16A 5EN2B 1U8JB 3WIFB 2Z8VC 3ARBC 2O5XH 2EDOA 2HJFA 5EIIB 3MXVH 1DVFC 4PG9A 5C0GA 2QJDA 5DQ9B 4CL7A 3DTXA 1NLDL 3GMMA 4LSQH 5GS2H 1I1RA 1OAKL 5SWZA 5A1AA 1H3TA 2B4CC 1EBPA 2Q1EA 1QZ1A 4XT1C 5C0AA 4CDGC 1OGAB 4K7FB 3OKNA 4QHUB 4G8GA 5B38A 4HF5L 3AXLA 5I71C 4PR5A 3F62A 1KF9B 3EYVA 3RIAK 1FV1B 4YXHL 1WWWX 4J12A 1UWEH 3JSSA 1ZS8A 5TF1H 3E2HC 4MD5A 4MVBC 3MV8E 3FN0L 2V17H 2VZ3A 5D7JB 3BGMA 4LHUA 1QLEL 1JPGB 1JHKL 1VHPA 3TFKC 4U6TA 1GPOH 1JE6A 2CRYA 2OYPA 4MQ7B 4L29B 4J7RA 5KG9B 4TTGA 2C7UB 2NY5L 5EU7E 1T4KB 4GQ9L 3R0MA 3VH8A 1NUGA 2ZPKL 4UDUB 2R29L 3BEWB 5D2LF 1HSAA 4UUJB 4OM1L 1MLCA 2J88H 4UZGA 1G7PA 5F70A 1QRNE 2BJMH 3UTTD 1NMAL 1JJUA 4JQIH 1M71B 4QNPE 4UIMA 4XC3L 5L8LB 5AWNH 3IJYB 2P5EB 4MNGE 2EYSB 1AXSA 4NN7C 5IM7B 5DTFB 1LE5A 3O8XA 4NO2B 4F7CB 4JRYE 3QWRA 2WW8A 5I17B 3BIKB 5B22A 4ZFFB 3D2UB 5BXFA 3MXWL 2C3WA 3FFCA 1URLA 2GJZB 3SE3C 5TGBB 2ADGA 5ENWA 2Z31B 3MCKB 3P9LB 5GXBB 3QG7H 3TM6A 1MEXH 1LGVA 3FO2A 1F4AA 1W8NA 4XH2A 2DAVA 5F3HB 3D6GA 1NUFA 3PDOB 4JDVB 3M1BA 1FYTB 5EC1A 3S35H 2JJUA 4EUPH 4IRJB 3P4LA 1A7QL 4ODUA 2F53A 1WV7T 3D9AL 1KCUH 3QQ3A 3OSKA 3VXTB 1S9YA 4JRXB 2R39A 3B9KC 3V5KB 3BP5B 4PS4H 3HE6C 3L5JA 1R0AL 4H0GA 15C8L 3N85H 3RFZC 3Q6FB 5AG9A 3DMMB 1DQLH 2DQHL 1P5UA 3DYPA 1IL1A 2A6IA 4JN1H 1JPST 3O6LH 5L0QB 3TBWB 4K3EH 1X5GA 3BQUB 1A22B 1IQWL 1J0YA 3HMWL 1DEDA 4RFNB 2O5ZH 5C0IB 3CGTA 3EJZC 1H3UA 4JQXA 2PTTB 3S3PA 3ZKNC 3LN5A 4F8TA 1AGFB 2OZ4A 4M1GH 1ZGLM 4LCUB 1F4YH 1JHLH 3MRBA 3IVKA 4F9PA 5I66B 1NGPL 4HF5H 3OKKB 2F54B 1GL4B 2CKNA 3QDJA 3MLSL 4URTB 2BSSB 4W6WB 5TF1L 1CD1B 3SGEH 1KJ2L 4FTVA 1YMME 3PDDA 3PP3H 5CKAA 2E7BA 5MENA 5E6IB 4U31A 2VLRD 5SWSA 1A7OL 1U0QA 3UZEA 2DQJL 4PJIB 3F12A 5DYOA 2ZZUT 4JDZA 4PD4K 3LQMA 2IPUG 1LE9A 2ZUVA 3KPNA 4DUXA 4R3SA 2PO6C 4GQ9H 5D9SB 7FABL 1ZANL 3P77A 5J3HD 1FH5L 3OPZL 3DVNA 5DUPH 1HDMB 1OTSD 3O4OC 4QRPE 4ZXBB 1AGDA 1RZFL 4JY5L 1MCJA 2D4DA 1WIOA 2N56A 2YA1A 4YNYB 4ZD3L 1T7XA 1KJMA 4RFEA 2EXYC 4JLRB 1SJHA 4PRHE 5F7DA 3T1WA 4Y4KB 3BUYA 2AJVL 4YPGA 1D6VH 2HTLD 1HK6A 4NQED 5EC2B 5SX5H 2XA8H 4UIKH 8CGTA 4PJFF 3N1MC 2P8PB 3ARGA 1KN4H 1TZGL 5FM5O 1T21B 3SE4C 2BCKA 3EYOA 2ZOLA 4OM0L 1AC6A 4Z76B 4TN9A 2HRLA 1QA9A 1KSRA 2A6KA 4F7EA 2EKSA 3GK8L 3MA9L 1S78C 1JPSH 1LQSR 4UQ3B 4Z7UF 4NNYA 2F8VA 2QQNL 4RMUA 4DFIA 1A1OA 1CFQA 3BQUD 2X4SB 1D9KB 4OZ4B 4YIQA 1Y0LA 4ZAKB 3KWWA 5DDHA 1DSFL 4NKMB 3FOLA 5BRZD 2GAZA 2PYEA 1K5NB 2PR4L 5GZNC 3CZJA 3VFVB 4OF8A 4YHIB 2EE6A 3VE0B 1UKSA 4L8BA 3VFPB 5JHDB 1X3DA 4F7TA 3KXFE 4YXLL 5H37H 3MRHA 5L7XH 1I7UA 4NCDA 2IMMA 1CU4L 4KHTH 4MJ4A 3UCRA 4Z7UA 2YMXL 3VWJB 3FO1A 1A7PH 3HB3C 4W4OA 3GHBH 3OXRB 1R0AH 4HUWA 3LQZA 1L7TL 2MNUA 1ZV5A 4P49A 1CGVA 1XR8A 2NXZD 3G6AA 2X4OB 2XKNB 1RZIA 4PJAB 4YX2L 3T0EE 4K9EC 2ED9A 2OX5A 3UBXG 2HVJA 3ROLB 3VXUA 4LCWA 3SKNA 1JMZA 1S7RB 4L1DA 5IWLC 2ADFL 3AS0A 4IRSC 1SVCP 5FDYA 4WFGD 2H41A 1S7WA 4X4ME 3O2DA 3MRDB 1GOGA 4OZFB 3FB5A 2O5ZL 3QEHB 3QXDA 4YBLC 4BQCA 3UYRL 1Z9LA 1EZVX 5IHUH 1T83A 1IMHC 4U6XB 4BFBD 1WBXA 2NY3C 2XZAH 3AB0B 4WVRA 2WBJC 1A0QL 1T22A 3GKZA 4PLJD 4HZAA 1L9NA 2XT1B 1VFBB 4IIQC 1CCZA 2B39A 1FGNH 4OF6A 4H1LG 5C70A 1IM3A 3PWNA 3BZFA 3RWJA 4AT6A 4LVOC 4LARH 5DMGD 3GJFB 3GBML 4UT9H 2C26A 3VGAB 4QRRB 1RJZA 1OAZH 3ILQC 5EB9A 5T1LD 3S7GA 2XG5A 3S35X 2E6JA 3G9VA 5EUKA 2I60L 1P1ZA 5BMFL 4DKDC 5E00A 3VD5A 3MXVL 4XNZB 1HHIB 4NKDA 5IBTH 2PF6A 2GKIA 5KS9A 2YRZA 3FRPA 4KI5E 3T2NH 5I76B 3O2WH 2E7CA 3IT8D 2NX5B 4E0RB 2OXGA 1INEL 3RVTD 3KPSE 4GS7B 4FZEL 3HR5A 4LAQH 3UAJD 5CP3H 3R8BB 5IIEB 5ISZD 5CD5D 2IAMB 3NAAL 4G7VL 1CXFA 1G7MA 4HBCH 3QDGE 4LLYA 3JV5A 2BNQE 1G9EA 1W0WB 3UPRB 3S36H 4UDTB 1D5IL 4DKEL 4JFFB 4F9LA 1AD0A 1WC7A 4HWNA 2F74A 1AD9B 1WUNT 3TA3A 1B6DA 4MWFB 1NAMA 4K71C 1BWWA 5CJQL 4FABL 1HCVA 2MHAA 1F11B 2WUCL 2VERN 1JF6A 1E27B 5FA3B 1BAFL 4GOSA 3VGFA 4P46D 1MFEH 2DQGL 2BRQA 4PGCB 5IVZB 1QBML 1MLBA 4ZTPH 3X17A 5L6YH 1FLRH 5C08B 4BSJA 1B0RB 1WWCA 1UXWB 3LKQB 1JZ2A 1DEEA 2VNCA 4YQXL 4MA8L 4JO2H 5I15H 3EO9H 1UWXK 2AEQH 2A0LD 4FQXC 1KN2L 4HKZB 2NY4D 4KRNA 5IMOB 4KHTL 4JFXA 2VL4A 5EBWB 3VMNA 1BJ1H 3QWOB 4HEME 1CXIA 4ZUTA 3V4UL 5AWNL 5JPMA 5E8OA 3KAAA 3O4LD 3SGEI 5AZ2L 5GQBA 2B1AL 5C2BL 1PZUB 3CPLB 4HIEB 3B9KB 2B20A 1WF5A 5DJAA 4QO1A 3IDXH 1UACH 1SMAA 2ICWA 1CICB 4M93C 3BD5A 4NRZA 4OZHA 4WWID 4IJ3B 5DJZA 5E9DE 3CXDL 1QFWM 1C1EH 1T04B 3WKMH 4L3CA 3L5WA 3GI8L 4OTXL 4KDTC 1MEXL 4M5ZH 3NGBB 5L0QC 5IHUL 5AUMA 4EJ1C 2HTLC 5T1DL 1NBVL 1NC4D 4N8VA 4ZFGL 5TJWK 1I9EA 1I85A 4WI3A 3MRGB 5T3ZD 2JB6A 4EN3B 1LDPL 2FHCA 3ZT5A 2UYLB 4UT6L 4RMVA 3MRIB 4I4WA 3IDJB 5DJ6A 5INCA 2KL6A 4HJ0D 4I9WD 1W72L 3DVIA 4PJGA 4HHAB 4PGEA 1LD9B 5CBEB 1B2WL 5INCB 1I9JL 4G6AD 3SN6N 5HDLA 2VR4A 4MB3A 2UYLA 1MJ8L 1YUHB 2HH0H 3T8XB 3CLFH 2BP3A 3TO4B 2VITB 2P8MB 4WEUD 3QRGH 3CUPA 4WUKH 3SOBL 2V6HA 4H8WC 3U6RA 1C5CL 4LAQL 3IB4A 1MHPL 4FXGB 4HBQA 3V6OE 1F2QA 2R0KH 5T3XH 2P47B 1V3KA 2XPGB 4M62L 1T04A 3MJ9H 5L88L 4PB0H 1HILB 4X9IA 4K7PY 3RX5A 3BH8A 1NGPH 2K3TA 3GSOB 3UBXI 3A6OA 3NCEB 5DJAB 1T7WA 1VACA 4DQOL 1JGLL 2ATKA 3IFNH 1E4WH 5IFJA 3TJHC 3V6OA 1HINH 4K3JL 5IB3A 3AFLA 1ZT7A 1U41A 5JPMB 4ZUTB 3QWOA 1QNZL 5EBWA 4P5KB 1KJ3L 2IQ9L 5D7LE 3VFGH 4RA0C 1QBMH 4OT1H 5IMOA 3TV3H 1F5WA 4WEMB 5D6DA 5IQ9A 1U3HA 3MNWB 1I9IH 5CBAA 1JNNH 1P7QA 1DBAH 1J10A 2XYCA 3TIEB 4U1LB 5IR1B 1GGUA 3OAUL 5HHVL 4WI8A 1RZFH 4NWTH 1DEEB 2PETA 1D5MB 2BC4A 1A3RH 4YAQB 5D2NB 4MXVF 2R1XB 1FNFA 4Z7WF 3CAFA 3S96B 4D3CL 1B6UA 2BNRD 3LH2H 4JFEA 2M1KA 1NGZB 1N2RB 4Q9CA 1WITA 5EO9A 1E27A 3QHTC 1I1AC 4P9ML 2MHAB 1WCBA 1J05A 3WL9A 2HFEB 4Q6YA 1U2CA 3TA3B 1TETL 1HE7A 4JFFA 3AMKA 2Z91B 3EUUA 4M1DH 4DKFL 5E24E 1VFMA 3PWLA 2UVFA 3BEVB 4LLYB 3WKML 2H3NB 4TPRL 2AGJL 3GMRA 3VFSB 1Z3GH 3IKCA 4NO3A 4OZHE 2CXGA 2XV6B 2H32B 4O58H 1OWWA 3V5DB 3FO0L 2VDLL 1HIMH 2NY2D 4XVJH 5CAYB 1IC5L 4KKLD 3LSOA 2DMKA 3T0EC 2WMPA 3HI1B 1XF4A 4JFED 4X7EC 4FS0A 2QHRH 2NY6B 3QDGD 4UT6H 5B3JE 1BJMA 4NHUA 3CFKA 3QXWA 3HE6D 1Q94B 1WGOA 1X5ZA 4IIQB 4AEHH 1TTUA 3UDWC 1RJZB 1DL7L 4QRRA 2DQCL 2J6EA 2AQ3A 5F3BB 1G9MC 3MRFA 3VRLF 1YYMH 2W0FA 4QLRA 4AT6B 2DMCA 4YXKL 1L0XA 4LLWA 5GHWL 1EX0A 3VWJD 3TN0D 4E42A 4PTUA 5FYKU 1KLUB 3SOBH 4MS8D 1T22B 4JO4H 4RZCB 2X4TA 5HHMB 1C5CH 4C56B 2CJUH 3O2DH 4IRJC 1V5JA 1DBKL 5GGSY 3S97C 4LSSH 5L88H 2EXWC 1XCTB 4HS8H 4QGTA 1S7WB 1MJ7L 43CAB 2MKLC 1OWRM 3V8CA 1RQ5A 1Z0MA 4X6EB 3TCXA 4WEBH 2PTVA 4KKAD 4J4PC 3GNMH 3DVFA 1I8IA 1RZIB 3MRQB 2X4OA 2XKNA 4PJAA 5KSVA 4IOFD 2KDGA 3NH7L 4HUWB 3OXRA 1NC2A 4MNQE 4YBQC 4HS3A 3MV8D 1RULH 2AJZB 3F7RA 1GRWA 5IBTL 3OJMB 4P3WA 2IH3A 4P5TA 3QUXB 2HLAA 1JRHI 4OJFL 5IG7A 1K5NA 2BNQD 4NQCE 2PYEB 4EI5D 3EO1A 3KWWB 4ZAKA 5GJTL 1RZKC 4YIQB 2J12B 1D9KA 4KKNA 3AS2A 4BUHA 3DHJA 3MRMA 3O45B 1FJ1A 3ARPA 2YPVL 3MRKA 3P73B 3MJ8A 1O7VA 1KOAA 5D2LB 3RY6A 1SM3H 3H9YA 3MLRH 2ZOKB 4TTDC 1UCBL 1OB1B 4P23D 1BF2A 3TZVA 3QUZD 2YOCA 2VDNH 5C0BA 2AQ1A 2VXVL 3BH9B 1TITA 1QA9B 4K7PX 2XTLA 3BGFB 4XPAH 1TETH 4Q2ZB 3HAEB 4J3XA 1T1YA 3RWCA 1GGYA 4KI5F 3ARGB 2DI7A 2DQGH 2AI0L 2X2YA 3GM0A 5F72S 5I1LA 1SJHB 3IJHB 4BQ6A 4RFEB 2OCFD 2HYMA 5I71B 5GGRA 1AQKL 1TJHH 1UYWL 1KN2H 4JEGB 5KVDL 5D9SA 1JL8A 4OQ1A 5D7JC 1KNOA 1E28A 4OKDA 1P4BH 5DJDB 4DOHB 5D8JL 2UUDH 3DETC 4JDZB 1LE9B 3MV7B 3QFDB 4R7NB 1IC7L 1YEKH 1LO4H 1J86A 1L9MA 2EEAA 1CD0A 5ECJE 3AU1A 1TTGA 2YKLH 5FKPB 1R5WB 2FB4H 2ITDB 1MCWM 3O9WB 4FTVB 4XP1L 2X40A 5CMAB 2C1OA 3WKNA 4R26L 4V1DA 3QDJB 3MV7E 3OB0H 3I6LE 5EOCH 5IVXE 3WFCL 4PJHA 3IVKB 1G7HA 4L9DA 1SBBA 5K9KA 3KJ4B 3DSFL 1VPOL 1AGFA 2D7TL 3LN5B 4R2GD 2BY2A 4OGAD 4XMPH 4G42B 4IBLT 2BNRB 1FNSH 4S1SH 4OCXH 4WI6A 1EGJA 4NN7B 1OW0C 3BP6A 3QH3A 4AL8H 1J7VR 3IAQA 5GRUL 5BO1H 1AKJB 3TBWA 2KZ1B 1CDHA 1LDPH 1BM3L 1IL1B 4L8SA 3VFMB 2DDQH 4PJDF 2VJXA 1F8TL 1RSFA 2XXMB 2BNRE 1AHWA 4DGIH 2V5MA 4JFYA 4NNPL 5CWSA 1F4XL 1YPZF 1QRKA 4J3TA 3U9UB 1Q9OA 1OL0A 3L3DA 4IRSB 4J1UB 3V5KA 1I9JH 1DLHB 2DICA 3SCMC 3WBDA 4CVWA 4N5UA 1KIQB 5EUOF 3P11H 3QDMB 2F53B 2P5ED 4G43B 3PWPD 1FNLA 4OD3H 2XQBH 4K23H 1YPZB 3M1BB 4P3DA 5TH2B 4N90D 1K6QL 4LSTH 3SE8L 3VXUD 1WISA 2VLLB 2ZKHH 4PD4J 4X5XB 4XH2B 3UZQA 3FO2B 4OI9A 2EE3A 3WFEL 1AXTL 3WLWC 3DJ9A 4OUOA 1RUQL 4M6NH 3RAJH 1FO0H 2Z31A 5J3HC 2YPVH 5F6HJ 4PRDA 4LVOB 4P23C 1AHWC 4ESKA 3EZ8A 3GBNL 1RZ8B 2ZG3A 3ULUL 5I1IL 4KK6D 1TZIA 3D2UA 1YYLH 2CUIA 3OZ9L 3QXAB 5I17A 5LGJB 4XNUL 3O8XB 5GRVL 4EI5B 3UROR 3Q1SH 5DTFA 5IFAL 1AXSB 3QA3B 2Y07L 4H26B 1I1AB 5H2BA 5DHYA 2VQTA 3T0AA 1M71A 2FCBA 2CIKB 5EG6C 1BOGB 5KS9E 3HE7A 1MY7A 5HYSG 2D7NA 3MRCA 4OT1L 1X7QA 4WIQA 1OP9A 5JIIA 3RDTD 5IK3B 3RUGF 3O6FA 2E27H 2CXKA 1V7NL 2EO9A 1EHNA 3BX7C 1FGVH 1FIGL 1IAIL 3BUTA 5I8OL 3NMEA 4EOWL 1GAFH 3QIWC 4PLKD 2D31B 3B4NA 3L3GA 2BDNH 4DW2H 1N6QH 5HGAA 3TNNA 3OQ3B 5DD5L 1U8IB 3GO1H 3BWAA 2VLKA 1LEKB 4GLRH 4OV5A 3HFML 4K7PH 4JCLA 4F58L 2EYRB 2DQIL 2VISA 1UQSB 4RMQA 5BZWA 3OG6B 5E56A 2Q8BL 1NAKH 2HJKA 3CFDB 4H1LA 3HE7D 4OFYD 3REWA 5J06A 5F9AC 1E6OL 3EYVB 2MCPH 3PWUB 3AXLB 3TLRA 4DFHA 4G8GB 4HAFA 5E2WH 3E0GA 3V4VL 2J8UB 4FQIH 3EYSL 4L3AA 4P46C 1Z3GL 1XGPB 5SWZB 3FRUA 4X6CB 4JKPL 3JWNC 4FP8H 4LPWA 3EDKA 3ULVE 1IFHH 5C0GB 5TPWL 4MX7B 5J9PA 1RU9H 2NXYB 1A3LH 1RZKH 3MLZL 4LCCC 1QRNA 4NO0D 3O3UN 4XMKH 4TVPE 1ITBB 4YO0B 1DL7H 3INUL 1PZ5B 3WXWH 3QUKA 1OPGH 5IVXF 3W5NA 4JR9H 4OGYH 4Y4FB 2FHBA 4GO6B 3MLXL 4NGHH 1GGIH 4OLUH 4GBXA 5DT1L 5I30H 4ZPVA 4POZC 3N1QC 2E8ZA 1IQDA 2YPLB 5GISL 2FX9L 2R56L 1R3JB 2ZKHL 5I1JL 4P2OB 4WUUD 3RVTC 1D7FA 2YPLA 1SEBB 1MOEA 4GT7A 3WDJA 5DEFB 4UTBL 2W92A 2EIBA 3N1FC 3DX9A 2VDQL 1TZHB 4YHNA 5KSAA 4Y4FA 4OQTA 3M8OL 3IFLL 1JPFB 1U58B 2GSIB 5BQ7B 2NW2A 1HCFX 3FQXB 5I1IH 4WW1B 4YO0A 2AJSH 2IBZY 3OZ9H 2E5EA 2V7NA 3WXVH 4M4RA 4MD0B 2FR4A 4RDQG 4LQFH 5TFSL 1XGUB 1QRNB 5MI0C 4MCZB 3T3PF 4NKIL 3SJVE 1GC1C 1MVFA 4XP4H 2WIIA 3QR2A 1ACZA 5L9DL 2JJTA 5J1AB 1RIVL 5EA0L 3TN0C 1LP9F 3B5HA 3VXME 4P2CG 1A4KA 3K4AA 1TPXC 5ANMA 3LQAL 4HCRL 3LEVL 5ID0B 4OJFH 1EGJL 4EOWH 2OQJB 5SX5K 1IGJB 3GSWA 3NCJH 2DBJA 3OTTA 3QCVL 1BLNB 2EDFA 4NC1C 5IMMA 1I4FB 2P24B 1H3XA 1QD0A 4HC1A 5FYLD 4I2XE 2GJJA 1J11A 5DRNB 3MV11 5DZOA 2XXCB 2MQ0A 4OAWA 4X6DF 1UQSA 5BZWB 1NQBA 1U8NB 2QL1A 2VLJD 1HYSC 1KCSH 3ARXA 1B3JA 4OV5B 1LEKA 5IHLB 4R4BB 2VLKB 1U8IA 4LGSB 2BVQA 5E95B 4APQB 4KRPD 4EZMA 3UTSD 5J4MA 1MI5E 4NQDD 4OZGB 2FECL 3VCLB 3TBSA 5GGQL 4ALAH 4OLWH 4YGAB 4UV4H 4EIGB 3S6CA 4Q97A 1WIPA 3R06B 4LPXA 4PJCB 5CEYA 5CLTA 2JJSA 4QRSB 2Q8AL 1XEDA 4YDLC 1NMBH 1DQDL 3I6KB 4DEPC 3O6FB 2NMSA 4ELMA 3QWRD 5B3JF 5C0CE 4BKLA 4TSCL 5HGDB 1JN6B 2AABH 3MRCB 3HE7B 2BSED 1BOGA 4I18A 5FYJU 2HMIC 4OCSH 2X7LB 5BS0D 4XBEL 4UILH 1TXKA 1I1AA 3BMVA 3WNLA 5K93A 3QA3A 4I0CC 4ZS6C 2H1PH 5KANG 1QFOA 5IV2A 1M7IB 4EDXA 3TEUA 5F1OB 1OAXL 4HSQA 4TQEH 3MV7D 2VIRB 3OAZH 5LGJA 1A6UH 2AXFA 5DD0L 3P4OA 5DHVH 5INDB 2W9DL 2F54E 1XMWA 1MUJB 2YD3A 5GGTH 3OBAA 4PBXA 4NGHL 4XPBL 5C0JB 1Z9MA 3PXJA 3RVVD 3ZO0A 4EUPG 5FF6A 4KZDH 2EC9U 4JVWA 4LCIL 2R4SL 1RHHB 2EH8L 1FVEA 4OLVL 1Q0YH 2VLLA 3EBAA 2OL3L 2XTJB 4GRLA 4PYHA 4PJ5B 4HKXB 4P3DB 1UFUA 5FM8A 1G0XA 1TVHA 1OY3B 2B1HH 1F45A 2ZUXA 1I8KA 1DLHA 5GGVH 1RPQA 2I9LB 2VLMD 4GRMB 4JPIB 2JF1A 1Q9OB 3U9UA 2DM4A 2AJSL 4GSDH 4FNLL 5CWSB 4NOFA 1B90A 1E6JH 2DMBA 4IJ3C 1B4JH 4NQCB 1AHWB 5CILL 4UNVA 1FPTL 3W0WA 3ZHKA 4XWGL 3T08A 4P2RE 4CVXB 4HWEL 3I75A 3GKWL 2ZNWA 4PJ8C 4MNHA 1U36A 4QTIH 3QIUC 3QH3B 5I73C 4NJ9H 4PRIE 4OKVB 2VWEC 2W07A 2ENSA 3C60A 3F5WB 4HIJA 4JZJB 4MLSA 4KK8C 1OARH 4G42A 4Z0XB 5F7KC 3SE8H 3EJZD 1AH1A 2UZIH 1FFQA 3N9GH 5K9KB 1J0JA 3LDBB 4KJYA 2APTA 4NT6A 5HHPB 3RRQA 4QXUL 1QSFB 1E4XI 4J2XA 2HRPH 1NCCL 2GTWA 2ZCKH 4Y2DC 3ULVL 1M1SA 5CMAA 5JUEH 1NL0H 1HYSD 4DAGH 3W9DA 1R5WA 4NC0B 5FKPA 1W2KT 2JELL 2VAAB 3C9NA 3ELAT 2A2QT 4BQ9A 3GHEL 1VFUA 2APFA 5LAXB 4LP5A 3PV6B 1NEUA 2NX5D 5DJDA 2EDXA 4D0CB 1KNOB 3O4LA 2ESVB 1NGWB 4XC1L 4Y5VA 4N0UE 5MERB 2D7OA 5EBMA 4FG6C 4WFHE 3RZCA 5BOZG 1F6AB 3JUYA 5I1LB 4WUUE 3FQNA 3O3BB 5J13C 1NMAH 3A67L 3V95A 3RWCB 2BOBB 1FYHB 2V5RA 1A6VH 1G7JB 3RVUD 2X1XR 4Q2ZA 3PQYD 4LLVB 4D8PA 5C0BB 4ZUUB 4AJ0A 5DK3A 2WBJD 3MRPA 1AIFA 1YEGH 1HQRB 1GYAA 3MLPA 2ZOKA 2X70B 4P9HL 3Q5OA 5D2LA 1R6VA 1L6XA 3MJ8B 5DEGA 4Y16C 3TIDA 4TULH 4PTTB 1FJ1B 2VYRE 1LNUA 5D70L 1KENH 5E4EC 2X9YA 3EO1B 5EUOE 2XACC 3D39A 2R4RL 4OLVH 3ULVD 3GIZL 3OR7A 5IOPA 1PEZA 4LCYA 3QUXA 4JKPH 1VENA 4FQQB 3BPNC 1XGYL 4XXCA 4ZO8A 5EFIB 4KJWC 3R4DA 3CFCH 2AJZA 4G9FA 3HB3D 1DBJL 4KQ4H 2X4NB 4HX1B 1LO5B 4HS3B 3H9HA 4HDIA 1MIEH 3IYLW 3KPRA 3X3GH 15C8H 3PP3K 1B4JL 2VXQH 1EHAA 1MFAL 1BQHB 4O02L 1H15A 4LNVA 3INUH 2Q86B 3WXWL 4IMLA 2APXA 2ZNXA 5C0CA 1I8LA 4MA7L 5FCUL 4NRXA 43CAA 3SEPA 2D3VA 5MI0B 3FB8A 4JDTH 1BBJA 3MLUH 4RNRB 5HHOE 4OCYH 2Q3AA 5C0AD 5IGXH 3ZE2F 3O11A 5KZCD 4O2EB 1KXQE 1E0OB 5ID1B 1MHHA 3W81A 1TPXB 2DLIA 4PTUB 3P0GB 3U46A 1D5XA 2HRPL 1J1PL 1XF2B 3KPRD 5KSAC 1QLRA 5DA4A 1KJ2H 1R5IB 3B9DA 4Z78A 1BREA 3VW3H 3CK0H 3MRFB 3BN9C 5F3BA 4Y7MA 3WIHH 2JELH 4HXAL 4LP4A 3O6MH 4LHUG 3VXMD 2DKSA 2ED7A 5HSFA 4NHUB 5KSVB 4QXGL 3DIFA 1M05B 3L3OA 2P1YA 4XCFH 1H5BC 2AEPH 2FWOA 1H0DB 1TNMA 4X8JA 4Y2DD 5JOPE 2Q7YB 1S7QB 5E94B 3V5DA 2N4IA 5ACZB 4R97C 3DYMA 4C55A 1NEZB 2H8PB 1FZOA 4JQVC 4KY1L 3STLA 3RZWA 3BEVA 4MZ2A 1MIML 3K8KA 3K8LA 4PRPE 1RK0B 5C07D 5LGKA 1CE1L 1Z9OA 2DQUH 3GMNA 2IANE 3FHAA 3C6SA 1J05B 3WL9B 2V17L 3EYFB 1QLEH 1PFCA 3HUJB 5EO9B 4H0IA 1N2RA 3IDNA 4WO4A 1CLOH 5I0ZA 5T3XD 2GK2A 3BDBA 3QCUH 4OD1H 4PJXF 3S96A 2RAMA 2R1XA 3ZE2E 1CE6B 4OF5A 3QJHB 3GSRB 4OLWL 3HN3A 2BC4B 4UTAH 4ZOBA 2R4RH 3GI9H 2PCPB 3WHE1 1IT9H 4U0QB 5DHXB 5IR1A 3FN9A 1DQDH 3OKYA 3P4MA 4NHCL 4YE4H 4C56D 5KVFL 3NCCB 5K9OA 1ZT4B 3CFCL 3IDIB 3C5ZA 1G1YA 5CZKA 2EE2A 3IDIA 5K9OB 4JQIL 4PJFA 3GUTB 3GHBL 5IB3B 3X3GL 4Y1AA 4PV8A 1MREL 1VACB 4ODSL 3SGKA 1G0YR 3ARVA 3H3PH 3ROOB 3QQ9C 3CVIH 1OLLA 2ADFH 1P5VA 4UBDD 4KRPB 2HWZH 2JCCA 2VLKD 3DETD 5F7YC 3RL2B 1YEIL 3HNSL 3IDNB 4WO4B 4M00A 3THML 4QRUA 5ADPH 1IEHA 4FXGA 3EYFA 5LWYL 3OV6A 3NTCL 4P2RD 3U6RB 4JFHE 2MWCA 1A0QH 5I1EL 1IAOA 2P8MA 4P0DA 3BGAA 3HRZA 2QADD 5EU4B 4KXZH 1YUHA 3RWFA 3HG1E 3DX7B 1IZKA 5D71H 2H8PA 4FZ8H 1VERA 1NEZA 3CC5B 5IKCA 1PKQB 1KTDB 4PS4L 1LD9A 1PVHA 2FJFB 4P4KB 4PJGB 2IG2H 2HN7B 1Q0XL 3O6ML 5F7FA 1CXHA 1EIBA 5CILH 5KZCB 4Y4FC 1MWAH 2Q7YA 3MRIA 4I4WB 5KOVC 5DD3H 4QXGH 5C7XH 4X8JB 4KVNH 4YHPA 3IDGB 2JB6B 4EN3A 1CD8A 3MRGA 4I1NB 4K3EL 1UZ8A 3ILPB 3K74B 3ZLQC 1WTGT 4MSWA 4YR6A 3BPOB 1AKJD 4PJ7A 4LDEB 1INEH 4N8VB 4P2OC 3V9FA 1O0VA 1QEWB 4MLIA 4KMTL 4LKXA 1T2JA 4HLZG 5AUMB 4GBXC 1YNLH 2A0LC 3ZKMC 3ZDZE 1QLRB 1PDKA 4L8SC 3WV0A 1XF2A 2D7PA 1M7DB 1GZQA 2FD6L 2IGFH 1FC1A 3U46B 5DJZB 1CICA 4NRZB 4OZHB 1GOFA 4TSAH 1CE1H 1YNKH 1IAMA 1F00I 2AXHA 4O2EA 1BD2E 3B9KA 1IE5A 4HIEA 3BHBB 3CPLA 3O11B 3L3JA 4MXVE 5JO5B 1F58L 2UZXB 4LSPH 4G6FD 1HKFA 5E8OB 1BAFH 1BBJB 4RNRA 1D5ZA 4WHTB 1FZKB 4XB8A 2IANA 3U9PL 4MXWL 1JRHL 1MFEL 1Y6MR 4NRXB 3CX5K 5L2KA 2ORBL 2X5PA 2B2XL 5FXCH 1N64H 4ZTPL 5HYQB 4LPTA 4HKZA 1AI1H 1QACA 1NMCC 2Q86A 5B3NA 4N9OB 4DZ8B 4G9DA 3KLAA 4NO0B 4X9FA 5T5FL 4AYFA 5KW9H 1WBYA 5I15L 1S7TA 3MV9D 4F2MB 5J6HB 3U36A 1UXWA 4ZD3H 4BK5A 5C08A 5E4EB 1LO5A 3BZDA 4M7LL 5F7NC 4F15B 2UUDK 4G9FB 4PGCA 2QV2A 4UIKL 1HHJB 3LS4L 2H6PB 1OAUH 2R1WB 4M6AA 5F21B 4P5MA 4L4VD 1KB9J 5EZJB 2PW1A 2J5LB 2EDDA 4U7SA 3KPMA 2DIBA 2F19L 4MWFA 4APQC 3D39B 3ECBB 1YDPB 3LEYH 1AD9A 4KRMB 3IDXL 4WI9A 1AD0B 1F4HA 1WC7B 3BKML 3PHOA 5K33A 1VESA 4HIHB 1P2CB 4IOSD 1W0WA 1JGVL 3UPRA 2X70A 2MPAH 5HHNB 1EA9C 1KJ2B 4EEEA 3GI8H 3QP3A 3AVEA 4ZUUA 3ZDZF 4Z7VE 4DEPB 4JRXE 5I1GH 1R3KB 1KENL 2Z8RA 2WM0A 1ROWA 5ESVA 1NBVH 4HMDA 4Z7WE 1ZGLA 5KBNC 3HE7C 2YUVA 3NFPA 1YEFH 3KPSD 2ILLA 3KHQA 3AREB 2BOBA 1JNLH 4YFDB 3NABL 4JGJA 2IBZX 3MFGB 1A21A 1CGTA 1ZLSL 2MSPA 1T1ZB 2N7AA 3W39B 2FEEL 5E00B 3FQNB 3O3BA 4FQCH 4LDOB 4DGVL 1GSMA 4KQ4L 4NBXB 3TJEL 1JWSB 1P84J 3WLBA 5C0FB 5EIQA 5EBMB 3LPFA 2YD9A 5DMJB 1U9KA 2VXQL 4Y5VB 4BK4A 4YX2H 1NGWA 1IAIM 4GG8B 5DD3L 1MCFA 3RWJB 1X5YA 3BZFB 4KK5D 2KZWA 5I74B 1MCPL 4P5TC 4D0CA 1IM3B 4HJJH 2IPKA 4RBPK 5FEBA 1TENA 2EZ0C 1WAAE 5MHSE 2E6QA 1WBXB 4PBVC 3WN5A 1DVFA 5DJXB 3ARBD 1TJIL 4YDIL 3QEHA 1AFVL 2FJHA 4PB0L 2M2DA 4GKOA 1KGCD 1QLFB 2PUQT 3WFBH 4PG2C 2YWZA 4KI5D 1YC7A 1INDH 1GIGH 3SKNB 4QRRD 4AG4L 2GY5A 3VXUB 2HVJB 3ROLA 3FN0H 3SKMB 4N0UB 1XR8B 2I5YL 4Z0XA 3V0WH 1P69B 4CW1B 1KTLA 1C16B 4HXAH 3VWJA 4OKVA 4Z7UB 5SWSD 2I60H 2GHWB 2XFXA 1A47A 4YBQD 3MRHB 4PY7A 1P84K 4F7TB 3G6DL 4JZJC 3PF2A 3WS6A 3TNMA 4X7DC 4YHIA 2AW2A 1WFNA 3VFVA 4MQXD 1F4WH 5FECB 2IAMD 2XQYK 4Z7UE 2C5DC 4OQTL 4ODTH 5DDHB 1Q9LB 5F7UA 4ZUVA 3Q3GB 1A1OB 3NAAH 5CKGA 1I8KB 5CGMA 1QKZL 5HDOA 2ZCLH 1A7RL 1MFBL 2RCSH 1TVHB 4FQPA 1TCMA 1D5IH 1N6UA 3ULUE 1CXEA 2Y7QB 4GRLB 2EKSB 2DTSA 3SKOB 4IEFB 3TT3H 1UA6L 4KROC 4Z76A 3JV0A 5FFLA 2ZOLB 3Q6GH 1MNUH 2P8PA 4X80H 3DX8B 2FGWL 4JG0H 4TVPL 4CN6A 2QQQA 5C3LD 1IGCL 3O4OB 5FV1L 2AGJH 1MUJA 4Y4KA 4YPGB 5FGRA 1I1FA 5F7DB 5INDA 3P4OB 2YC1B 1FN4A 3RY5A 1NC4A 3NA9H 4YNYA 3GI9L 1OQXA 4N5ED 4YEEA 1RVFL 4XVJL 1C7SA 4ZXBA 4P2QD 2B4CL 3DVNB 1GHFL 1LHZA 3D9AH 4TNVK 4I18B 1AJ7H 3Q2CA 2CGRH 1CDUA 4LVEA 1WWBX 4LNRB 5EBGA 3F12B 2PKDA 4ELMB 4P4KD 12E8H 3LV3A 1P53A 4NBYB 5MENB 5LCVH 4RWYH 4QRSA 1WZ1H 5CEYB 4R9HA 1CD1A 3ZE1F 3MC0A 2BSSA 5C86A 3PXHA 1EMTL 4P4KC 1N0XL 1K3ZA 3QWQB 1LEIA 4Y19A 2F54A 1U3HC 4Y5YC 3FAXA 4OZGA 4CN4A 2EDBA 2HWZL 1EFXA 3L3HB 5DMYA 4HMEA 5LGHL 2QBWA 1EO8H 2UY6A 4LCUA 4R4BA 4I13B 1FCCA 3VDBA 2W60B 4FQ1L 1WT5C 4P59L 2YK1L 1MAKA 5C0IA 4NOBA 3KPQA 1B4RA 2G2RA 4HS8L 3BQUA 1QHOA 4MS8C 3NA4A 3IGAA 4I0KA 4QHNB 1KCKA 2QSQA 5IMMB 1BLNA 1GIGL 2GQHA 4GMTH 2R23B 1VB9A 3WUWG 3U0TB 1RUPL 3DMMA 3JV6A 3Q6FA 4ZQKB 3ZKND 5ID0A 4J4PA 4RRPG 3ZYZA 3NIDE 5IF0B 2XWBA 2Q87A 3BP5A 5CZXC 2NY4C 2V7HA 2GSGA 3UJJH 5DQDL 1E4KC 1MWAL 2XY1A 1S9YB 5C7XL 1ONQA 3LN9A 4GMSL 3VGBA 1CDYA 2VQ1B 5FYKH 2HFTA 4IRJA 3OPZH 4MCZA 5DUPL 4GJTB 4W68A 1KYOK 5F3HA 2XNAB 3IU4L 5BQ7A 5JXEA 1JPFA 1U58A 1BQUA 3MCKA 4FQ2L 2VKWA 5FUCE 5ISZA 4YGVA 4RGNB 5E2JA 5ENWB 2GEEA 1O7SA 2ADGB 3ZDXE 5TGBA 1MFBH 1RY7B 3DX9B 1TZGH 2GJZA 1DUYA 3C87A 1JHTA 2H32H 2Y06L 5LVEA 5JW3L 4NQSB 3HA0A 3ARTA 4XNXL 4N0FA 5F7MC 2YD1A 5KVMC 3BIKA 4FFVD 1OTTC 2V9RA 4YHML 3H6JA 4NO2A 1LE5B 2ARWA 4Y19E 3VFWA 1YY9D 1ZA6A 4XNZC 1T89C 2P5EA 3IJYA 4TTDD 1T2QL 2CUHA 5HD8C 3IAGC 1WFOA 2DF3A 3C5JB 4BYHA 4LHQB 2B0SL 1VDGA 3WDHA 1AI1L 3LDBC 1PZ5A 3NA9L 4RRPA 2F8XC 3ZTJG 4C57C 1BMGA 4PJ9C 5JXED 1CR9L 4QXWA 4UDUA 1S3KH 4W6YB 3VH8B 1EAPA 1CWVA 5J9PB 3UP1A 1T4KA 4MX7A 4GKSB 3SDYH 4PRHB 3D2UD 5KG9A 4L29A 4BSWB 3BQUC 1YEKL 3F7QA 3HPLA 5A2KH 3AREC 3SJVA 3FRUB 4FOMA 1XGPA 5LCVL 4LHUB 1ADQH 3TBTB 2YXMA 5EU3B 2J8UA 5JXAL 2F53D 4MD5B 1ZS8B 4GKZA 3LEYL 3SDXB 5KAQG 4G7YL 2OP4L 1EHLL 5J6GB 2AK1H 4MNQD 4PR5B 3L7FB 4Y5VC 5EOCL 4Y5YA 4ZFOL 1PYWB 3JWOH 1PX3A 4GKZB 2HJKB 3CFDA 3OKNB 4QHUA 4K7FA 4UMGA 1EO8L 1UENA 1WSST 2VISB 4G6JL 2EYRA 4X4XB 4JM2C 5C0AB 5EU3A 3ZTNH 3DSFH 3BFOA 2L4OA 3TGXA 5LXGH 3O81A 4P2QB 2HG5B 3SJVB 4O58L 2L7JA 1MCWW 5IJKA 5HGAB 1QPXA 3DTXB 3TNNB 3MCG1 4PRHA 2X89A 3K4ZA 2E7HA 3FKUS 5C0AE 1IC1A 1JNLL 4DWHA 3L3GB 1EAPB 3DV6B 2KUTA 1BM3H 5EIIA 1BVZA 1JP5A 4KRLB 5DD1L 4ACPA 1U8JA 3WIFA 4Y16B 5EN2A 3P0VL 4MNQA 2A9MH 4NN6B 4XHJD 1MRCH 4PLJC 4TYUA 1X7QB 4I3RL 1YYML 4WGVB 4NSKA 2YPLD 3C5JA 1T03L 5DHYB 5H2BB 3EAKA 1YY8A 4H26A 1S9WB 1FZJA 4YUEH 2HLFC 1ZA6B 1YMMA 3CSYA 1CZ8L 2WQRA 1BD2B 3DI3B 2VXSL 2FECI 3FOMA 1TZIB 3FQWB 3SO3C 2OR7A 5DVMA 1TJIH 4RX4D 5DMIL 2HT2C 5E6ZA 1CDIA 2BVYA 5JDSA 4PRDB 2ARJA 3RUGB 4HUMB 4YGVB 1DE4B 2GJ6D 2HFGH 4LU5H 3RIFF 4E41A 1NBQA 2D4FA 4PREB 4XNXH 4R4FL 4WWKD 2XNAA 3JWOC 4X5XA 3X13B 1FAKT 4KK6C 2DN7A 4YFLF 3Q1SL 1YPZA 5TH2A 2BNUB 1NFDA 2ZUSA 3C2AH 2VQ1A 1J88A 5I19L 1KIQA 1FP5A 1QFPA 2VSCA 1N5YL 1RULL 2GSGB 4DTGL 4HWUA 3L3DB 4IRSA 3FN3A 1YEEL 4MB4A 1H3WM 5JHDD 3DPBA 1J9CT 2OTWB 2L0DA 4JFYB 5E7FA 1FIGH 1IAIH 5I8OH 2BK8A 4XPFH 4GW1A 3JV6B 3U0TA 2DLHA 3RWHA 1U6AH 4Q7DA 1OP3H 4EN3D 4L8SB 3VFMA 2DD8H 3S98A 5GJTH 3MZTA 4LAJH 2NY0D 4QHNA 5KJRL 3LY6A 5CUSL 3SQOH 4P2YA 3DECA 3BP6B 1A7RH 2G2RB 2BNQB 2BNRA 2VDOH 1ED3B 3HAEG 5HI4D 2Y72A 3HFMH 2X4QA 4K7PL 4YBLB 5D5ME 4F58H 3CVHB 1T6VN 1B0GA 4NUJA 1DTUA 1FYTE 1E6OH 1BFVL 1JYWA 4MXQC 4RGOH 2COQA 4X0KA 5MP6L 4I0PD 3UC0H 2C1OB 3KNBB 1V05A 4QF1B 3T2OA 3ZTNL 2ITDA 1FFNB 1AC0A 3BXNB 3K8MA 3WFZA 3LV3B 3F6IA 1QSEA 4ENED 4R7NA 4LNRA 4XPGH 3X3FL 3I6LD 2AJ3A 1JNJA 4X4MA 2XQYG 3MLYL 3FFCD 2BXYA 3GSVA 3E6HA 3E8UL 3BPLB 2J5LC 3VI3F 1J8KA 5DRXB 2FH8A 5HHMD 5DJ0A 3ZKXB 3T3PE 1NFDE 2ERJB 5T5NF 3P0VH 4J6RH 1FN4B 3CH1A 1F3JA 1MRCL 1VGKB 5DURB 4OGYL 4C56E 3CMOH 1QR1B 2VOTA 4WENB 1T1YB 2C1PA 3CLFL 4OLUL 4LRNH 3HAEA 1F3DJ 2DKMA 2BVTA 3QRGL 1QSED 2H2PC 3GBLA 3SKOA 1PY4A 3D18A 1VPOH 1DFBH 3SBWC 4FQ1H 2Y7QA 4OD2A 4S1SL 1OB1A 4KJPC 5BS0A 3QPQD 2ADIA 5JQ6H 1AO7A 1BFSA 3ESUF 3O45A 3MRMB 1MY5A 1L0YA 3B9VA 4ZUVB 1OQOA 1KLGA 2X6MA 3MRNB 2DDQL 2GIYA 4KKBD 4FA8A 5FECA 3P3YA 1YJDC 3IFNL 3B8YA 2HLAB 1T1WB 3SDAB 1IGIL 4OLXL 4NKIH 3TNMB 3QHFL 2IQ9H 1FHGA 2AJXL 5DQDH 2WLYA 4PY7B 2YUZA 5KSUA 1NCBL 2DJSA 2XFXB 1JF1B 5EA0H 4LSDA 1G7LA 4NZJA 4GAJH 2R0LH 1JNNL 3DXAB 4DJMA 3MJ7B 1C16A 4UQ2B 5FYKL 1KTLB 4P5TD 5EH1A 2BOCB 4N0UA 1OAQL 5FO8B 2DYPD 5F8QC 3FB7B 2A9NL 3JTTB 1J8HE 1AXTH 1OTTD 5CUSH 1QLFA 2GJ6B 5E7BA 3G5XA 2FJHB 1T0PB 1UM5H 3IFOB 2WWKT 5FGSA 2BY3A 3QIBD 4K3DL 1PLGH 4PGBA 4GLRI 4W4OC 4C56A 3TH4T 4WI4A 4TOYL 2GCYA 3S36X 1KXTB 3RGHA 3U2SA 1H3VA 1KLUA 4A6YL 5JORA 1MH5B 3PQYB 4PLOB 3CIQA 3LZFH 4LLWB 3KXFB 3MBXL 2ZSWB 4WI2A 2ICEA 3BE1H 2EDLA 1WTLA 1XIWD 3ARGD 4LSRH 3A6BH 3PABA 5GS0L 5FYJD 5TF0A 2JIXA 5T1KA 2F53E 3FO0H 3HCVA 4E5XA 5C0FA 1CR9H 3WLBB 1JWSA 3LB6D 1Q94A 4XPGL 3X3FH 3CFKB 2BFVH 1T0MB 1T1ZA 3W39A 3ALWA 5LKNA 1NFIB 2CLRB 5D7LD 2XOTA 3SY0B 2LU3A 1XF4B 2DL2A 4AEEA 1ZGLB 1S8DA 4CADB 1QO3B 1U3JA 3HLAB 3RVUC 1CFVH 4Y89A 1A6UL 1HSBA 1R3KA 2DQCH 1I8LC 3IKCB 4NO3B 4N1CA 3VXOB 3ZE0E 1KJ2A 3MV9E 2OR9H 4M9OA 5HHNA 3MPCA 3QUXD 2IH1B 1ADQA 3NACH 5AG8A 3PHOB 2CIIB 3RTQB 4LRNL 3TP4A 2Z35B 4LLMB 1U3HD 2HFEA 4F15C 2NY3D 4B7LA 3KPMB 5C09D 3TBVB 2VN4A 2PW1B 5DZNA 5EZJA 3WJJA 1IKNA 4P5MB 2OK0H 2JKXA 1NGZA 1TLKA 1RIHH 2D03H 2R1WA 4WCYL 4Y4FD 5JQ6L 1HHJA 2BMKA 5F8RC 1C5BL 1RJYB 4XX1E 3TH2T 4TVPD 3QQNA 5KVGH 4PP1D 5D2NA 4YAQA 2YHGA 4WEBL 4XI5D 1S9VB 4NZDA 1D5MA 1P7HL 3GNML 1NLBL 4ZXBD 3U36B 4F2MA 1WBYB 2NXYD 3LRHA 4XGZB 1KEML 3CLEH 3DSNA 4EBQL 4G9DB 1P7QB 2Y36L 5CBAB 4PGDB 1CICD 3TCLA 3IU3A 4I3RH 4JR9L 1MCKA 1U3ZA 2AJYL 4FFYH 3I9GL 1IC4L 4P5KA 2IANB 3B9KD 4CMMB 3LMJL 1AR1D 2XWTA 5I30L 2QQKH 2VAJA 5JO5A 4AENB 4YC2C 4PJ5D 4G8GD 5F96L 3VGHA 5E03A 1T2XA 3QEQB 1KBGL 1ZTXH 1Q1JL 3TYGH 1KB5B 1GZQB 2ZCKL 1BZQK 1HILA 4CJ1A 2DQFB 1ZLWK 3MLRL 2A1WH 1UCBH 4RGND 3CDYA 1ORQA 3G5ZA 3HE6A 5I74C 4LKXB 1FG2A 3PL6D 3CUPB 1VEPA 4XPAL 4PJ7B 4MSWB 1MPAL 3ULUD 4HFUL 3NIFF 1XF5A 3T8XA 5CSGA 3IJSA 1PG7W 4MJ5B 1IGML 3IDGA 1X5XA 1SBSH 4UB0H 2BRRL 4K3HA 2FBOJ 3RWDA 1YC8A 4KUZL 4PGEB 1EVTC 2Y9RT 4HHAA 4M7KH 5DK2B 2FJFA 1KTDA 1PKQA 3TVMD 3CC5A 5IKCB 3UTSE 2FHFA 5DJ6B 1N8ZA 3OX8B 4JM4L 5I1AB 2BFVL 4XRCA 1LK3L 1TCRA 3AC0A 4HIXL 1RFDH 3DX7A 1KCLA 4IRZL 4W4NA 1MCLA 3NCMA 1OF2A 4L5FH 5FOJA 5I8KH 2VDKL 2EIDA 1C5DA 5EU4A 5SV3A 5AD0A 1IAOB 5HDBE 3UTSB 4NQDE 1LP9B 4LRIA 4QRUB 1BZ9B 1OP3K 4HH9B 3L5WB 4NJAL 5EIVA 4XP1H 5F6HI 3PHSA 3RL2A 1OD9A 1UKQA 3F7YB 4I0PC 4ENEC 2QR0A 2CK2A 1HWHB 4KUCD 4UV4L 4PJFE 4PV8B 3RBGA 4Y1AB 4KK5C 3WCYA 1ES0B