1J1PH

Crystal structure of hyhel-10 fv mutant ls91a complexed with hen egg white lysozyme
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title The Role of Hydrogen Bonding via Interfacial Water Molecules in Antigen-Antibody Complexation. THE HyHEL-10-HEL INTERACTION
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j1pH00
4ERSL 2DQHL 4WY7L 1NPUA 4P9MH 2AJXL 5J6HB 3CFJA 1SJXA 5HI5C 1A6ZB 4QRQB 4WUUE 1KJ2A 4U6YA 3ARED 3PWPE 5E2TL 2CUHA 3DI3B 3BW9A 4UDTB 3TJHD 1UEYA 1EFXD 1T03H 2O61A 3UTPE 3MBED 4PUBH 4X9BA 1U58B 4YC2C 4KJYB 1T6VN 3GMOB 2NX5A 1DANU 2MTPA 4KKCC 3VFMA 1ODAA 4N1HB 4LPUA 4JKPH 2F54E 5B8CC 2O5YL 4BK4A 5HHXL 2YHGA 2ZSVA 1TETL 2DB8A 3O2DA 2Q8BH 3VXRE 4JQXA 4QOKD 4RGND 1U91A 2X9YA 4HD9A 4Y5XC 3EJJX 4QHKJ 5J11C 1N4XL 1S7SB 4KZEH 1OAZH 3B6SA 1G7MA 5GS1A 2R0LH 1IAKA 4FOMA 4JY6A 5JIIA 1FP5A 1MCJA 4OCSL 2IC2A 3GBML 1B0RB 4PG2C 4PBWD 4Y19D 4XH2A 2Z93B 3FN0L 1RZGA 3MGTA 3SE4C 5E6IA 3OX8B 5EC1B 2D3VA 4R97B 2VDRH 2FO4B 1HEZA 3GK8L 5ESQA 7CGTA 3QAZB 4XB8A 2ICWB 5JHDA 1KJ2H 1AKJB 4IMKC 2NZIA 4HCRH 1RUPL 3MJ8B 4I0PD 4HS3B 4KK6C 4I9WE 2A9NH 1T80A 1P4IL 4JQIH 1EAJA 3QEGL 2VDOH 1A7RH 1BVKB 2XN9D 3D39A 1DP0A 2ICWJ 4HS8L 4JG1L 5GHWL 3OWEA 4V1DE 4RCAA 5CGYD 2BXZA 2ZKHH 3F7VB 1TVDA 3O2DH 1KCVH 3U9PH 5E4EC 5ACLA 4BYHA 2DRUA 5JPNB 4NQDD 1HZHH 1FVEA 2DQTH 1P2CB 1T21A 4ELMA 3QB7C 5ALCH 3NVQA 3D3VA 2EE3A 2Q86A 4X6CB 5GGVH 2VDPH 3NABH 4XVTH 4HQQH 4YNYA 4UV4L 2GJZB 2YS4A 1U95B 4EIZC 2C4FU 3SDAB 3F5WA 3C9NB 4EVNB 5FA4A 1FZMB 4M6OL 5C3TA 1F2QA 4AIZA 2EDXA 4BFBD 3TBSB 2WINA 2X2YA 2XKNB 1C1EH 2NXZC 3LRGA 4LSTL 3MRQA 4RAHA 4HKJB 4M8VA 4Z78A 3SPVB 1GGBH 4ZFOA 2X70A 2OQJB 2R1YB 3MNWB 5LG1A 4PGCA 4P57A 4X7TA 3BP5B 3HRPA 4PYGA 2WQRA 1RUKH 4KRPD 2D0GA 1QSED 2LVEA 4JFFD 5FOBA 4HIIB 1UXSA 3RPIB 1NGPL 2ITDA 1JRHI 1HOCA 3GHBH 3PHOB 1QO3A 4J8RA 5DD1L 5JUEH 1FYTB 3D2UA 4ZS7L 4N5UA 3G9VA 1GAFL 3B5TA 4S1DD 3CFKA 4P2QE 4O5LL 2P8PB 1X5JA 2EYTA 3QFJA 4JFEE 4P5MB 3KVQA 5LBSH 5GSRB 2EEBA 5E5MA 4WWKC 4LVHC 1DQQB 1EK3A 3MOBL 4DGIH 4HWUA 2HMIC 1UH2A 3RZWA 4NO5A 1IM9B 4Z7OE 2I60H 1IEAB 5F7UA 3MC0A 3CD4A 1PSKH 3C6SB 1FE8L 3SKOA 2E5EA 1I3UA 5TDPB 1DEEA 4K7FA 5I1KH 4G3YH 1MH5A 4WHYH 1A21A 2HJKA 1DUZA 1R0AL 4NZRH 1F13A 4R2GB 4ONGH 5DLML 2VLRE 2DTML 4AM0A 1GOGA 4PJ5D 1IZJA 1YN6A 5AYUH 1AXSB 4NZUL 4ZPTA 3EYQD 3RBGA 1UC6A 2YD9A 3RWJB 4M02A 4HZLB 2J8UB 1DCLA 3ZKXB 4K8RC 4CL7A 5TPWL 1JN6A 1B0GB 4U1KB 2X5PA 4IJ3C 3A6BL 3VXSD 1T3FB 5SWZA 5FUZL 1X5AA 4DKEH 1AR2A 3UJIH 2BNQB 4RMTA 4LQFL 4FQCL 4N5EC 2YZ1A 4GAJH 4PRAA 3U30B 5LKNA 3TNNA 4ESKA 4RGNE 3HAEA 5D71L 4KRMB 4P5TB 5K93A 3VW3H 5L88H 4NNXB 3ARFC 3ZKSD 5F7KC 2RJMA 2YC1A 4NQSA 3MV9E 3QUMB 1G0DA 3PWJA 1PKQB 3DSFH 2Y6SD 2YD5A 1FORL 3FO2B 3WEXB 3UTTA 3P3YA 2XZCL 3OKDB 3REWB 4AT6A 3MJ7B 3RVVD 4O58L 2ZOLB 5D72L 3MACH 5MHSE 1T83C 1XFPA 4NJAL 4WUUA 4X5XB 2FH6A 4I48B 1D5XA 2H3NB 4WVRA 3T4YA 3ZDZE 3G5YB 1JTTA 4U7MA 2QR0A 4F7PA 3Q5OA 1MCPL 2J8OA 2EDFA 3TCLB 1ZHNB 1A6VH 1AI1H 3MLSH 5I6XC 2AABH 1F4XL 1DN0A 3MLXL 2VXQL 4HBCL 4OCMC 3PXJA 3BKCL 1I7RB 3QRGL 4HUUA 1J05A 4LMQE 2XN9E 4GW1A 5J3HD 4JM4L 3KJ4C 2OSLA 4G80B 3SDXF 1MEXH 4YXKL 3VXRA 5KN5A 1HCFX 1G9MH 5KSVA 2OJZL 5DYOA 3RDTA 4J2XA 1MJUH 4NP4H 3PUCA 5B8CB 3QDGE 5I1JH 1VFAA 5F88A 5CD5D 1UQSA 4ALAL 5IFAL 4CJ0A 3SGKA 5E1AA 3O45A 5D7JD 3OAYH 2CIKB 1A7OH 4OGXL 4Y5XB 1DQML 4MJ6B 5D93B 3ZKQD 5J11B 3KWWB 4CKVX 1TMCB 1KEGL 5C07D 2B0SH 1FGNL 5DFWH 1UKTA 2HTLD 4I2XE 5CILH 4N0UE 4GJTB 1NH6A 2BHUA 1TJHH 1S9XB 3ZMRA 4TOYH 5IWLC 5KVEH 4FQIH 1UWGL 5IB3B 3D85D 4NO2A 2VQ1B 4FZ8H 3VXTB 1N0XL 3IB4A 1P1ZA 4XBPB 3SDYL 5BO1H 3U6RB 4XMKH 1A02N 4XI5D 1CE6B 3RTQC 2PO6A 4X6FB 3SKJL 5CJBA 4V1DA 1QSEE 4XPAL 5J1AB 4JLRB 5FGBA 4JKLA 1CS6A 1MCLA 1VFMA 2M26A 4XZUB 1S9KC 2ESVB 2UZYB 1F3JA 2EDTA 4XCCL 3W9DB 3BWAB 1RZJC 2XWTA 3L5XL 1ZT7B 5E4EB 4QF1B 1VFBB 3VFVB 5IW3A 2NW3A 2Q7YA 1J8KA 1HHGA 1WBZA 5E8EB 4PRDB 1BJMA 4IS6B 4J4PA 1EO5A 5SX5K 3LH2L 3S37X 5ITFB 3OXSA 4OGYL 5FYLH 2WWKT 1AQDA 4Y5YC 2EKJA 3T4AA 3ZDXF 5KS9B 1JYNA 1G9EA 3QQ9D 5C8JA 1S7TA 3IJYA 1NQBA 1IEBA 1U92A 4LLDA 3HS0A 4QHUA 4GLRH 4HIHB 4PJ9A 3RVXD 5HPMA 1KPUA 4CJ1A 1FG9C 2E7BA 2NY7L 4PJ5E 3VRLF 3V6FB 2OK0L 3D0VB 2X6MA 5TDNA 2GITB 5GS2D 1UCTA 2AV1B 2AXFA 4JQVA 1RMFL 1KTKE 4EOWH 4NQVB 5L9DL 2PYFA 4ODBD 4L29B 4B53A 1NLBH 3LDBB 4NN6C 1OGTA 2VITA 1MLBB 3PGCA 3RIAK 3HKFA 4AJ0A 4Y4KD 4P2QA 3RKPA 4DFHA 3LHPL 1OTUC 4ZUVB 1JFQL 1A22B 2BVQA 4NZDA 2XWBB 1R5WA 1I85A 4LHUA 5ICYA 1Z6JT 1QNZL 3BGMB 3ARGD 1DBBL 4R90L 2VLKD 2G2RB 3H3PL 1RJZA 5GSVB 2RQ8A 1MHPH 4NOBA 2HT3C 3P0VL 4P23C 1EEZB 3F62A 4PJGF 5BZDA 1H3PL 1TQCC 1YEIL 1QBLL 4YXHL 4LRNL 2EIDA 1DQTA 3B3IA 5IF0B 3T0AA 3VFTB 4OJFL 5I8CA 2VLRA 4OLXH 3A6CH 1CFQA 4NYLA 4P5KB 1QA9A 5HVHC 1N5AB 3RL1B 4F58H 1G6RL 3ES6B 2IF7A 1KLUB 3EYFB 5T5FL 4XVJL 3RZCC 2OL3B 4YDJA 2NLJA 3EOBA 3FB5A 4XP1L 5AYQA 3V5KB 3QQNA 2Y23A 4FXKB 2J4WL 4X98B 4EBQL 5A2FA 4Y16A 3N9GH 4ZPVA 5H35B 3QQ3B 4EDXB 5KG9A 1JCKA 3VXPA 1RZKH 5T3ZL 4WWID 1QLRA 4XPBL 4M8QB 1ZLUH 2O5ZH 3U2SA 4NT6A 1A0QH 4IJ3B 1JHKH 4D9QE 3K8LA 4ZTPH 3WJJA 4O4YH 3KNBA 3KGRA 1DVFD 3MV9A 4NKDB 5DC9B 4BQ9A 1WZKA 4DOHB 1S7XA 4U6XA 2BNRA 1YPZA 5ABDE 3P4NA 4MD5B 3V8OA 2FR4A 3GJFB 2ZUXA 5ID0A 5KJRH 3AS3A 1EGJH 1HHKA 4MXVF 5EOCL 3ZLQC 43CAA 2AEPH 1CK0L 3OF6D 1S7QA 4L8DB 4URTB 1RUMH 1LILA 4DTGL 1QHPA 1RIUH 4G8IB 1RZJH 4UT7H 4TNWK 1YPZF 3ZDYE 3C5ZC 1DE4A 5LCVH 2IBZY 3SDAD 4B7LA 3ZYJA 5KTEH 1LNUA 1AGEB 2D9QB 1FSKB 3S9DB 4DGYH 1UJ3B 1YNKH 2FJGA 4H8WH 4NN7C 5I66B 2AXGB 5DGRA 2IPKA 5TE4H 1FZOA 3SKNA 5B3JF 5HYQB 4UT6H 5EDXA 3Q48A 3F7YA 3QDGA 3PNWB 5HGAB 3ZHLA 3DXAE 4NKIH 3S7GA 5D1QA 2W9EL 3OKLA 1PD6A 1JWMB 1WBXB 1QQDA 5JIKA 5HGDA 3DMMB 4YHZL 4HC1L 3VCLB 5I16A 4NKMA 2CGRL 3FO0H 2FIKB 4DEPC 4W68A 1S5HA 5J12C 3TM6A 4Z95L 1I1AC 3DVNB 3VXNA 4FFVC 3CSBA 3BE1L 5CHNA 1FYTD 1SBSH 2VN7A 4I2XA 2GFBA 2CRIA 2P48B 3DX7A 1AHWA 1V3LA 1ZEAH 2CUIA 3GM8A 3MOAH 2HRPL 5SX4I 3SQBA 3BEVB 3GIZH 3V2AR 1K5NB 2E9JA 1EAPB 3IDJA 2RBLA 5JLZB 2OTWB 3PHQB 3FFCA 4Q9BA 3JVGA 3DVFA 1IMHC 4NSKA 1IM9D 1WC7B 2APXA 4KK9C 5EIVA 1J8HB 4HUWB 1I8LC 4LBEA 3GKZA 1MF2L 2Q6WA 1XR9B 4HFWA 5E8PB 3A6OA 4IOIB 4XAKE 3RTQB 5T1DH 3L7EB 4J6RL 4R2GD 5D96C 3L9RA 4G42B 3WFCH 4LPWA 3U7WH 3HMWH 1YEDB 1OAQL 3H42H 3LB6D 2FX9L 3WE6B 1MCKA 1QFHA 1R3IL 2EC9U 4OM0H 4HGWB 2PXYD 3HE6C 4CDHA 1XGPA 3HZYA 3ARUA 2P8LA 4KJQC 4R3SB 5EOTB 3FTGB 2X9XA 3ESUF 2XXMB 5DHVH 4YFLI 2BNQD 2VC2H 3KPSB 2Q76A 1IGIH 5L8LB 2GEEA 2IH3B 1F97A 1AY1H 1S7WA 1BAFL 5DS8A 1A1OB 1JK8B 5FEBA 2C26A 2HH0H 4Z7WB 1KN2H 4ZS6D 3TA3A 2JJSC 3D69A 3DV6A 5F7DB 3RWFA 1XMWA 2X7LB 1I1CA 1NMCC 5L2JB 3FQNA 2X4PA 5CEYA 2W9DL 2DLTA 3H0TB 5ETUB 1RJLA 1PX3A 3KPRD 3QUYD 4RAUB 2D9CA 3GB7B 1NBYB 1TCRB 2FNBA 4JZNB 5IHUL 1KIRB 4M62H 4OFPA 1D5BB 1NANI 4KVNL 4ZUSA 3AB0C 4KXZI 1A6WL 1WT5A 1WLHA 4IRSA 3KLAA 2DQDL 1NC4A 5DD3L 2GHWB 3EZ8A 5HI5D 5FK9A 4GAYA 1EFQA 3ULVL 4L4VD 1BOGB 5J6GB 3IAQA 4Y4FA 4Y2DA 5GRUH 3D6GA 4HXBL 1JHTA 4ONFH 2R0KL 3MLZL 1YJDC 2CR3A 4AG4L 4OFYD 1EPFA 5FKPA 2OR9H 4P2OA 4JB9H 3T08A 4KKCD 1NFKA 3IS1X 3LSOB 3TH2T 1T6WA 2E7HA 3QEQA 2W65A 1NKRA 4J3VA 1MFEL 4LGPB 4JFQA 4X6CE 3QJHA 5JPMA 3H9YA 1KN4H 1H5BB 4WI2A 4GAGH 1CLZL 1YN7A 1ADQL 3K4AA 5T5NF 2BSSA 1MREL 4RIRB 5HVHB 2O93L 2I25N 3QT2A 4MAYA 3GJEB 3ABZA 4LF3A 3RZCB 1N6VA 3L3JA 3QFDA 5HYJB 3MGOA 2GT9A 2YK1H 2CXGA 4F7TA 4K07A 1IC7H 3EYVA 4MDJB 2LFGA 1VEMA 3GI8H 4NOFA 5F7EL 3DV4A 1U8OA 1J0IA 3CLFL 2R69L 3WL9A 4NJ9H 5DDHA 3TBYA 1Q1JL 4WEBH 1U9KA 1ZWIA 5EU4B 4HUNB 5DJXA 4X6DB 3KG5A 4GMSL 3AVEA 3MXWH 1CD0A 3NA9L 5HDQL 1L0XA 3QIUA 1YMHA 2YMXH 5GGUA 4KK6D 5GJSH 4ZAKB 1JNHA 5C6PB 3OJVC 3DLQR 4NPYA 1FYTE 2EH7H 4OM1L 5L6YH 4JY5H 4JVWA 2ESVD 1NAKL 1HXYA 3O6FA 2DQGH 5IVNA 3F65A 5ADPL 1II4E 3OAZH 5LAXB 3PWLB 2FBJL 4KV5F 4PY7B 1BP3B 3WUWA 1A6AA 3H7LA 3AROA 4MB3A 1WV7T 4UTAH 3OKKB 4KI5C 2XG4A 4FQ2H 1F2XK 4P2CG 5E0QA 1XIWC 5E00A 2Z91A 3EIFA 1QVOA 2CK2A 3C5ZB 3D87B 3JWOL 4RBPK 4KQ3L 3B9KA 3O2VL 3BRGC 1OWRM 1KPVB 1J0ZA 4CADB 5JIPA 3DXAA 1UACH 4NN7B 1KXTB 4MJ4A 4ZSOB 1OSPL 3U0TA 1IGFH 1MRDH 1JGVH 2EC8A 2NXZD 4LGSB 1MWAA 2SEBB 1WFNA 4XGZA 4NRZB 4J3UA 3GRWL 3BPNC 1OARL 1FFNA 5IBLC 2J8UE 2FX8L 4UBDD 1NFDF 4JPKL 4NQXB 1EERB 4I3SH 1ZV5A 2LE9A 4MAUH 4YHIB 2K9UA 1CT8B 1BBJB 4YHKL 5FO8A 1DR9A 1EA9C 5J12B 1MOEA 2BNQE 1U8MB 1I1AB 3BP7B 2QQNH 3MLUL 4PJEB 3P4LA 3PJSB 5DJ0B 1KENH 2CPCA 4MX7A 4NBZB 2CD0A 1NGXB 4NQCA 4TSAH 2Z8SA 1WCBB 4JN1L 5D1ZA 3MRKB 1NDMA 5CMAA 4MQ7A 4MCZB 1SJHA 4M1DH 1PKQE 3QUXA 1CDBA 1YYLL 5AG8A 2QSCH 1BIIB 4WWKD 4K7PL 2HFGH 5I76A 1OGAB 1YJDH 4FXGA 4O51B 1ZT1B 1T1XB 3QUZC 3SO3C 2HMID 4ZO7A 3ARSA 7FABH 2DL9A 2VXSH 3UPAA 1Z3GL 2VQUA 3OR7B 4U1MB 1A6ZA 1FBIL 4QRQA 3P9MB 1ACYL 3RNKB 5C7XH 4G8FB 4HT1H 2VL5B 2VZTA 1NCNA 1MWAH 2HVKA 2CR6A 4K3JH 5FHBH 4HS6A 4GQ9L 5D96B 1U58A 4AL8H 4KJYA 4D3CL 3WXVL 3GSNH 5IFJB 5IESL 1UWEL 5FCUL 1ONQA 1SYVB 2BOCB 4PBXA 2I07B 3TBTB 5HVWA 4KMLB 5JXEC 2V2TA 4RWYL 4AEHL 5HGBA 3ZZ1A 2ICCA 4HKZB 3TIEB 1FCGA 5I1HH 3RI5F 4K8RD 3VJ6A 1N59B 3DX8A 2IG2H 5F1SA 2B4CC 5IGXH 4OBRA 4YLQT 3V52H 1B0WA 2R8SL 3HE6B 1M71B 3P30L 4XX1G 4XBGB 2B2XL 5FYLD 2AQ1A 1EO8H 5H94B 4OSUL 3HC3H 5I1LB 3RIFK 4N5ED 5FB8B 1FL3B 1HDMB 4HAFA 4G7VH 1GIGH 4LSSH 2WLZA 3ZE0F 3T8XB 5TQ0L 3IXAA 2EDKA 3W9EB 3UX9B 5HYEA 3ARFD 3R06B 1WBYA 2MOVA 3OX8A 5B39G 4M3JA 2JK5B 4TRPH 3CC5B 4MGXA 3S8WA 1NMCB 4S1SL 2FO4A 3GMLB 4MS8C 1X7QB 4W6XB 2G60H 2FD6H 3QSKB 1AKJA 4R0LC 2OCFD 4QNPF 1I3GL 2VABB 4QRUA 2EO1A 3E6HB 2JJWA 3WFEH 4FMFA 4UNUA 2B1AL 4C56A 1BVKA 3WNNA 2W0LA 3A67H 3WO4C 2DYPA 3W5MA 1P7QB 2GTZA 3HE7B 3MA9L 5HGGS 4Z7VB 4X99A 3E3QC 5DWUL 2QQLH 3M45A 4BFIB 3Q6GL 1BFSA 1P2CA 1A4KA 3QULB 4NWUL 5HSFA 1U3YA 4YK4C 4ODHL 4PGJA 4ZFGL 1J88A 2GJZA 2QQKL 5FYJH 1WIOA 1JNLL 3C9NA 4FFYL 5INCB 2MQ3A 1PZ5B 2D0FA 2VLLA 32C2B 3IDMA 1F4YL 2DF3A 3TBSA 1TXKA 3GSNB 3VXMB 1E0OB 2XKNA 2E9WA 1UZ6F 3OSKA 5F72S 3SPVA 3B9VA 5KS9E 3VG0L 3S35X 4HLZH 2R1YA 3GBNL 3MNWA 2D7QA 3WHXA 1CXEA 1G6RB 2HAZA 4HH8A 4GSDL 1E4WL 1Q0YH 3BAEH 4XC1L 3RY6C 4MA7H 2DL2A 4WI8A 1UKQA 3TN0B 1G9NC 3I02B 5DJ8B 2J7LA 1G7LA 1DQJA 3V0WH 1HH6B 1ZXQA 4XCNA 5ERWB 5ID1A 1VENA 3RTQD 4XNQA 4XXDA 4X7SL 4FQXC 1FRGH 1KJ3H 5C6TH 1WTGT 1FLRH 4U3XA 1MNUL 1BHGA 3LN5B 3QG6B 4P5MA 4XB7A 3RWDA 3ZHKA 1WIUA 3VXUB 5LWYL 4PJDB 2APBA 3J7HA 5E03A 5I1GH 3OAUH 1KOAA 1LEKB 1SM3H 2B5IC 4L8SB 1CICC 1YECH 5C0JB 4MQXC 1IEAA 3KHOA 3MRGB 4OLUH 2Y5TA 2CJUH 3MV11 4JO2L 4F37K 1NAMH 2A2QT 4M3KB 3KPSD 2DICA 4RA0C 3S36X 1NCWL 2VB5A 4KKAC 2CRZA 2B4CH 1MAML 2MFNA 3BIAX 3I3DA 4R4FH 2VERN 1JGUL 2V2WB 3F12A 2XQYK 4X6BB 5E8NA 3TBVB 3VFNB 1MCOH 3MNVB 3RWJA 3JV6B 1GOFA 5I17A 3F58L 2UZIH 2J8UA 1WWCA 1M7XA 1C5DA 1IQDA 4U1KA 4XC3H 5C3LD 1ZS8A 4GRWF 5DXWA 4IOFC 2VQTA 3KPMB 4E42A 1KCKA 4XP5L 1JZ3A 4W4OA 1UYWL 4O2EB 1A5FL 3DUSB 3X3FL 4P5TA 3KYKH 4PBVC 3W0WB 2VO5A 4TULH 5C71A 3GMMB 4OIIL 1OTUD 4LSRH 4DOHE 3RU8L 5IB4B 3WEXA 2A9ML 1SY6L 1X5XA 3OKDA 3ZL4L 4MNQD 3REWA 3GHEL 4HV8B 3O3BB 4S1QL 4GRWH 1UFUA 5EOQL 1YYML 1LO3H 1TPXB 3LKRB 1A8JH 1MRFH 2HT3D 4P23D 3TVMC 2XQBL 4L9DA 4X5XA 1AQKH 1RZFL 3BDYH 4OGAC 1HQ4A 4PJCF 5CSZB 5FO9B 4I48A 4U1LB 3LKNB 3QUZB 3G5YA 4ISVA 5D8JL 3SO3B 1CLYL 3T3PE 1NCTA 1K8IB 5FGCB 1ZHNA 4GMTH 3KS0J 4GKNB 5HHOA 2B8OT 4HDIB 1I7RA 2ATPA 4KHTL 5D7LB 3P11H 4I0KA 1ZHKB 5CEZL 5HYJD 2OTPA 3WNOA 3QHZL 3PF2A 4MXQC 4G80A 3HUJB 3U7YL 2E8ZA 4RGOL 1LO2L 5MEQB 1IKFH 1I9IH 3NFSL 4DVBB 3KYMB 3TBWA 3IAPA 3AMKA 3ARDB 5BV7C 3RWHB 5T1KB 2DIAA 3T2NH 3FT2A 1LE5A 5IK3B 2R2BB 4OLEA 2NPLX 2VDMH 2VXUL 4YFLF 2HKHL 5C0CB 3S5LA 1QBBA 1L4IA 4LDLB 1LWRA 3I6LD 3KWWA 3WYRA 3EO0B 4HIJB 1AGFB 3ZE1E 4O2FB 2MPAL 1L7IH 2NNAB 4U2ZA 4Q0XL 1JL8A 3TYFA 3V95A 3MBXL 3AU1B 4LVNB 1RIHL 1F4WL 1S9XA 3UP1A 5EZOH 4YR6B 3HG1B 1DBJL 5DUPH 5IB3A 2YXFA 1F4AA 1MJJB 2VQ1A 2WMPA 4JCLA 4XBPA 3KPQB 1E6JL 4A6YH 3U4BL 3LQAL 4HPOL 4LNRB 1SYSB 1AIFA 1ZKAA 3W82A 4HJGA 4I0CC 4X6FA 1J8HE 4XMLL 4X8XA 2LAAA 2J8HA 3C5ZD 3RAJL 1CD1B 4OCWL 1A3LL 1E6OH 3MR9B 4LSQH 1Q9WB 5HHVL 3WO4B 3G6JB 3IF1B 5FF6B 4DKAA 2IAMC 2YWYA 4JG0H 3O8XB 2CLZA 3VFVA 3UJJH 15C8L 2BFVH 4P2YA 4QHLA 1LE9A 4JPWH 4TSBL 3CZFB 3GMNA 4IS6A 4YK4B 1IGYA 1NANH 1QFWI 2F19L 1WWAX 4EI6B 1TZIA 1Z9LA 1N5YL 4WUKL 5HDLA 4KXZH 3D9AH 3MLVL 4P46C 3BYTA 1XGTB 3KPSE 1I1AD 4FFVD 1N8ZB 3RY5A 3O3DA 5DMIL 5JW5A 5DUML 3O9WA 4Z7WE 5HDOA 3V6FA 1OW0A 4YDKH 1MFDH 3F6IA 3ZYIA 1T20A 5JA8B 1BQLL 3ROOB 2AV1A 3MRDA 3NZHL 1OGAD 3B2VH 4NQVA 5GRYA 1JV5B 3HNTH 5EULV 1IAIM 3F6LA 1Q9LB 4KK9D 4JJHA 1MLBA 3GMPB 1PAMA 4FQLL 4YGVB 2D0HA 1JPSH 1O5DT 2FIRT 4KHXH 2EE6A 3GIVA 4PPTA 1XGYL 4M61A 1HHIA 3QI9C 2YEZA 1LD9B 3BGMA 4WFHD 4M1GH 4FQXB 5CBAB 2ZSWB 2G2RA 4H0GA 2B20A 5DD0L 1M05B 5LGJB 5ALBH 5L7XH 2EIEA 1EEZA 3I2CL 2BSED 3M07A 4MB5A 2NY6C 1NGQL 3QIWC 3SE3C 4JO3L 5FA3A 4C57C 2V5SA 3HE6D 4NHUB 5EBLA 5K59E 1RJYB 4PGBB 5B39B 4KJQD 4YHPB 1N5AA 3RL1A 2R0WH 3PWNB 4DKFL 2AEQH 4Q9QH 1MI5D 5BV7H 1KLUA 4MJ2A 4UUJB 1T2QH 2EDOA 4K23L 2OL3A 5K9QI 3RL2B 3ZSSA 1GPOH 5BXFB 4P9HL 3V5KA 1PG7W 1JYVA 4F57L 3B8YA 5A43C 3TV3L 4X98A 1HXMB 2WBKA 5B38G 3VWJC 1BECA 2G5RA 1T5WB 3S98A 5H35A 2GK2A 2DQEH 1ZA3A 1FNHA 5HYJE 3BP6B 5HJ3B 1A7NH 4JRXB 3BPOC 2CRMA 4MA1C 2OBGA 5LXGL 3CVHA 4JKMA 3SDDC 4WV1B 3DUUB 5EC2B 1H8NA 1QFUL 5CD3B 1MAKA 4BH8B 3DX9B 5A16A 1UB5B 5BW7A 3LPFA 4X6DE 1FNSH 2R1XA 1JPST 4WW2C 3VA6A 1LEIB 2VRAA 3TYGL 1B3JA 2UYLB 3GJFA 5ILTL 4D9LH 2DJ4A 2HT2C 3MCG1 4LSUH 5DMGC 1N26A 1CDJA 4YHOL 3U1SL 4KTEL 2D03L 2XI9A 2P24B 4H88H 3NCCB 3HLAB 5T3XL 4U3HA 5L8JB 3PL6C 4KUCD 3VI3E 3T77B 1OAKH 4OKDA 4PG9A 1KYOJ 3CLEL 2Z35B 3DGCR 2V7HB 5DRXB 5HHMD 5CJ8A 4C58B 3NACH 2JB5H 1CWVA 2YPLB 1AGEA 5I8KH 4PJHB 5JHLL 4GQPH 1VPOL 1UJ3A 1IQWH 5A2KH 2DQUL 2L4OA 1AD9B 4ZD3H 2AW2A 3CX2A 5JTWA 1P6AB 4F80A 1A6TB 2IEPA 4H20L 4HWBL 5HYQA 2DM7A 3CVHH 1MIML 5E2JA 1IGMH 4EDWH 2UY7A 5K9OA 3IDIB 3PNWA 1NC2D 1DBKH 3HZVA 3BP4B 4LCCC 1C08B 2FEEL 4A2MA 4OQ1A 1B4JH 2EE9A 2R29H 1Q0XL 4ZSOE 1JWMA 4EUPG 1ZA6B 4E5XB 3DMMA 5KOMC 1U8NB 2JCCA 1JWSB 1E4XI 3MLWH 3VCLA 4FZEH 2R4RH 5DJZA 3MLPA 4QRPA 1C5CL 1I75A 5BS0B 2Y36H 5IQ9A 1Q38A 5EU6B 4F7MB 4QRSA 2H1PL 1EH9A 4WU7B 5DJAB 3RHWK 3TESA 3AAZA 5E8OA 1P7KA 5T3ZD 3ILQC 5BRZA 1E28B 3WFBL 5EIIB 2FJHA 3WFHB 4D0CB 4UQ2A 3GGWA 4PJEE 3BEVA 5IVXF 4JDTL 2L0DA 1K5NA 2EEAA 2JCCF 1EAPA 3VXUD 5JLZA 1W72L 1OPGL 3P77B 5F6HI 5KW9L 1B4RA 4XNYH 1WC7A 4H25B 1KT2A 1J8HA 5JR1H 5IB2A 5GRJL 4ZO9A 1K2DA 5DRWA 1XF1A 2Q20A 5ITBL 4GG6F 3SJVB 2BVUA 2W0FB 4KPHH 4GXVL 5E8PA 1MAJA 2ZWLT 2A6IB 1N7ML 3QNYA 4U6TA 2JELL 1PG7L 2NW2A 4IOIA 4RX4D 1MIEL 3O41B 3L7EA 5DC4B 4G9DB 3GI9H 5B21A 1XIWD 3CXDL 4G42A 2AJXH 2CKBL 3MX0A 4ZFZB 1AC0A 3VRJB 4F9PA 4OF8A 3HZMB 4XP4L 5E94B 1CLOH 2X4RA 3FN9A 1EBAA 2IAMB 1D5IH 1MCCA 2YXMA 4HGWA 4XCFL 1HKLL 4NO3B 5DHXB 1OTTC 5HHQB 3PABA 3VXOB 3SCMC 1MFBL 2BC4B 1QSFA 5FYJD 3FTGA 2Z8RA 4POUB 5IBLD 5E2UH 1CFNB 2O5YH 3KDMA 5FCSH 1U8JB 2ICEB 3IDYC 2IH3A 5HHPB 1JHLL 5E6ZA 5CFHA 2EH8L 1CFTA 1A1OA 1OY3B 1S8DB 1M7IB 5I30L 4Z7WA 5EA0L 3O3AB 4OLZL 4P46B 3SE8L 2IFFH 4YAQB 2D7TL 3FMGL 1FIGL 5F7DA 5I74B 2A77H 3T1FA 2X7LA 1IKNA 5L2JA 4LU5L 5A1AA 5ICZA 3H0TA 2N4IA 3IAGC 1BBDH 1R3LA 2G9HA 2OR8A 4P3CL 4RAUA 3GB7A 4K94H 4RISL 5EUKA 4KQ4L 4QT5B 4X80L 3UO1L 3QUKA 2F53B 3LRHA 4JZOB 1KIRA 3U0WH 5LQBH 1MHHB 1BQUA 4NQEB 1BVZA 2ZUYA 5JW3L 1OB1B 3GSXB 3FJTA 3QUZD 1DUYB 3CMOL 5DK0B 1YMMB 3KYAA 4LHQB 4OF3A 2EYSB 1LO0L 1SQ2N 3L5HA 5I15L 2VIRA 1RUPH 4QXWA 1XF2B 4PTTB 5K9KB 4BZ2H 3EO1A 4Q74A 4WDIA 1PYWA 1T0PB 3QI9B 1IGJA 4F3FB 1OT1A 3H9HA 4JKWA 4I3RL 3KLDA 4JG1H 1A3RL 1DJSA 3V8CA 4PV9B 4QKXB 4Z7VE 1U8QA 1NCDL 4Y5VC 4OCRL 5JXED 1FC2D 5E7FA 3WMSA 1GC1C 1N3NB 2NY6B 5T1KD 1CFSA 4O02H 1KNOB 2UUDH 5KVDH 1H5BA 1F58H 1XCQB 4GXUN 4FABH 3QNXB 1HHHB 4OCXL 1INQA 4RIRA 4JO1L 5FV1L 3GKWL 3LN9A 4JAMB 3RZCA 5KAQG 4LAQH 2ZPKL 2FGWL 3GO1L 4ZFFB 1EMTL 2H2PC 3O4LB 4MDJA 1V3KA 4EIGB 2FB4H 3VXME 3OAYK 4DN3L 1KBGH 3RVUC 3MUHL 2E27H 3DOSA 2DBLH 1RZ8A 3KAAA 4PS4L 4GG6B 2VLMD 4P9HC 4KY1L 4MS8D 4UB0H 5JW4M 3QZWG 4G9FB 5EO1B 4X6DA 4KDTA 5DSCB 2FL5B 2PW1B 3TFKC 1EZVX 3SDDB 1QG3A 2IJ0C 2E6PA 3MRCB 4L8BB 4XMPL 1BM3H 3ZE2E 1CFVH 5I18L 3NGBB 2P5WB 3NIDF 4GBXA 3REVB 2PUQT 4YFDB 3BXNB 3RWGA 4ZAKA 4WW2B 2E3VA 1RULH 3HR5A 2OXGA 4AEIH 4FTVB 1ZE3C 5T3ZE 3L7FB 1PEZA 2Y07L 3HFML 3BPLB 1FDLH 4RMSA 2H9GB 4Z0BH 1DSFH 3PGFH 1S3KL 4LLYA 5LAXA 3PWLA 5D7IB 1GHFL 2VDNL 5DQDH 3VXUE 4PJDE 4U1JB 1GZPB 3PL6B 3H9SD 1IILE 5IR1B 2ENSA 2NY2C 2Q87A 5AG9A 5BJTA 4P2RB 1WEJH 1FAKT 4MWFB 5MERB 3LEVH 5C2UB 1NLDH 2LU3A 3ESVF 5KSBA 3PWVB 4Z9KB 3IYLW 2P44B 4U3CA 3KYNB 3MJGX 4KI5E 3KR3L 1R0AH 1KELH 3DO3A 2A1WL 3OPZL 3QWOB 2OI9C 4U6VL 4M6NL 1T7YA 4HWEL 3RWEB 3VD7A 1EHLL 4EI5B 2SEBA 1ITCA 5IUSA 4NRZA 4QTIH 3TH3T 2FECI 3SY0B 8CGTA 1L9MA 5KSAC 4NRXA 3AS2A 1QFPA 1JUFA 3UDWA 1D6VH 1J5OL 3K4DA 4ODTL 4TUOA 4D9RD 3MRIB 3GSWA 5KSBF 3EOTL 3SE9H 4LSDA 2WZPD 5C0ND 2C1PB 1A9EA 4LQFH 4PJEA 5DJ0A 3PJSA 1V3MA 2MQCA 4PRPA 3G08B 1W0VA 1DBML 5D71H 5DJ2B 3BJLA 4FQXD 1NGXA 5F70A 3W0WE 2R0ZL 1WCBA 3X14A 3KPNB 3LQZB 2XZQH 3KXFD 3ARBC 1AJ7H 4MCZA 4UOJA 4DQOH 4QYOA 1OD9A 3VFRA 4APQA 3V4UL 2DIJA 3R4DA 3ZYZA 4MDIB 2XZCH 5C9JB 5L8KB 1TVHB 4O51A 1JWUB 5DD6A 4LLUB 4M48H 4ACPA 3A0OA 5CCKL 5I1AB 5DT1L 1CICD 4MQXD 4RRPG 1VGKB 4NJAH 3P9MA 5CS7A 4GG8A 3PP3H 2CLRA 2LQRA 4MSWA 1F02I 1UM5L 2VL5A 1GC1H 3UTSB 5HYSA 2Y9RT 4KKAD 4L4JA 5FGCE 1A7PL 2EDQA 4JPVL 4U6HB 5GRXG 3C8HA 5J89A 1LO4H 3T3MF 5FUOL 2B7DT 5IFJA 3BKCH 5D7LE 3KPOB 1SYVA 3PP4H 4HKZA 1KB9J 4LQ1A 4JRXD 4OZGB 3HUJE 4OZHB 1IAII 4YXKH 4DN4L 3UTZB 3CDCA 4IOFD 5EU5A 4XBGA 3UBXI 2NY5C 4N9GA 1IC1A 5H94A 1ORSB 3SDCC 5E08L 1Y0LB 4DAGH 3LD8C 5I1LA 1QBAA 5BZWA 2HFEA 1KIQA 5FB8A 3IDYB 3BI9X 3UYPA 5I9QC 1NCAL 1PZUB 3T8XA 3AM8A 2NY0C 1A14H 1ZLUK 4K2UH 5C0CE 3BKYL 2R4SL 2BERA 4ZXBC 1NMAH 5IMMB 2X4TB 1GZQA 1K6QL 1R24B 2JK5A 3P4MA 3RUGA 3CC5A 3V0AC 2DKMA 5KVFH 2OX5A 4F9LA 1FN4B 3CK0L 3TZVB 4X9HA 3OKOA 4JM2A 1S7VA 3IFLH 3H3BC 3VGFA 4YDVA 1ZANH 4TUKH 3HG1E 1C16B 1A9BB 1RUQL 3TVMD 1UWGH 4RMUA 1ZGLM 2VABA 2R1WB 4OGAD 5CJ5A 1QBMH 5D1XC 2FHBA 4AEEA 3CDGA 1J12A 1N0XH 3MV7B 1QFWH 3K74B 3MRFB 1P7QA 1PFCA 3RUGF 4Q9CA 5I1IH 1FO0L 3GNMH 5F3HA 1QP1A 3HE7A 4EUPB 1WVZA 4Z7VA 4POYA 4WW1B 5F7LB 4XPAH 1I8MB 3ZHDA 2I24N 2ILLA 4JM2F 3G6JE 4Q6YA 4NWTH 5IHLB 4ETYA 2FX7L 2HFTA 4OZFG 4MXQD 4YO0A 1CXFA 5IMKA 4EN3A 1RURL 3E3QE 3BH9B 1T7VA 1G7HB 3QIBC 1KIPA 4Y5VB 3MV8D 4O9HL 3CUPB 1ZVSB 3BKJL 1JPFB 3QDJB 4MQSB 2ZG2A 4NZTL 2W1NA 3NFNA 3ULVE 1OAYH 5KAQF 3BZ4B 4FQHB 2I9TA 3QEUB 32C2A 1EDQA 4JFZL 4V2BA 2IPTL 3QXDB 5SWSB 3VXMA 5I1DA 3ZTNL 1CZ8L 2BRRL 4KMTL 4HH9B 4WO4A 2ADJB 5EORH 2DMKA 2HRLA 2GJ6A 3K0WA 3U7AA 2FEDC 5AZ2L 1G6RA 3DIFB 3C6LC 2BSRA 4X9GA 3SGJA 1RU9H 3DNKA 5CEXB 5GISL 5FECA 4YWGH 3TN0A 5DJ8A 2KBGA 4FMKA 1WISA 1HH6A 2C9AA 4UINL 2EIZA 2IGFL 1RIVH 2BSTA 5C09A 2HT4C 1XCTB 5I75C 1S9VA 3VWKB 5KZCD 3IRZA 2HWZL 3MJ9A 2C1OA 3T1WA 4FQJH 2DM2A 3Q6FB 2EXYC 2R23B 1MPAH 3QG6A 1P4BL 2UVFA 5FM4A 1D5MA 4M7JL 4PJDA 4OT1H 1QNZH 2IAMD 4PRIA 3QXTA 4L8SA 3QH3A 2I5YL 3BPCB 3LEYH 3L6FB 5HVFB 1P84J 4MA3A 3GMRB 5DJCA 3WIHL 1QBLH 4LPCA 3H2WA 2NY2B 4J1UB 1F90H 4LRNH 2PW2B 4CN1A 1DLFL 3HHRB 4K7PX 4ORGB 3P73B 4UOW0 2V2WA 1ZK9A 5FO7B 3V6ZA 2NY4B 5D7SL 3NIGF 5CZXC 35C8L 2NY5H 3TBVA 1JGDB 3F8UB 3VFNA 2NCMA 3UCRA 3JV6A 4YHMH 1AP2A 4G5ZH 3EO9H 3FZUC 3MYJA 4DVRH 2F9BT 1B88A 4XP1H 4LPYA 5ACMA 1X3DA 2OI9B 3BT2H 2UWEB 2HJLB 5F93C 1MQKL 3JV4B 4OD1L 5CBEB 3DROA 4F33A 2ZZUT 3KPMA 2YA0A 2IADB 4AZ8A 4NQED 3MBEC 5C0EB 5B22A 5KSAB 4O2EA 1PLGL 4JRXE 3MJ9H 4LASL 4X6EA 3DUSA 2GCYA 5LGKA 3WS6C 2FATL 1YMMD 1KF9B 4H0IA 3W0WA 4HW6A 3UYRH 2DWEB 2X1XR 3STLB 4JRYD 2WUBL 5IB4A 4HC1A 3QI9D 1HSBA 4I4WB 2GI7A 3QDMD 3ARBB 3O6KH 2A74B 1ZSDA 3S34H 3FOMA 1FAIL 2EDNA 3QCTH 4ODSL 4NCC2 1A7QH 2OJEB 4CVXB 5CSZA 2EIBA 1I4FB 2NY6D 1E4XH 4XPGL 4N0YH 3QIWD 1Y18B 3CCHA 1RJCA 2YKLL 5IROA 1M4KA 2W0PA 1KUMA 4GKNA 5E6YA 4KK5C 4FNLH 1NKOA 1JPTL 3D18B 1ZTXH 2EDEA 3IETB 1OLLA 5D7LA 3VDBA 1V7ML 1ZHKA 1OCWL 3THMH 2IQAA 5BMFL 2YPLE 2F5BL 1UA6H 4PJHE 1I9JL 2ZUTA 4HXAH 5CIPA 3MRRB 1I1RA 2PKDA 3BGAA 4YHLH 3F7RA 1J10A 4XP9L 2XPGB 2BVPB 5JXAH 2YUZA 3VWJD 5MEQA 4UT9H 4DVBA 4ODXA 3ARDA 4PJAA 1N6QH 3V4VH 4MNHA 5ADOL 2CKBB 3ROLB 4MNGB 5M94B 1UH4A 2R2EB 3OGCB 2W9EH 1HIML 2R2BA 1FZJB 2CDGB 3SDDD 2VSCA 1T22B 5C0CA 3IDXH 5HBBA 1IGTA 5AD0B 3SDCB 1UGNA 3GZKA 3LD8B 5BS0E 3RWCB 2AK4B 1OSZA 5EU6E 3CGTA 4HIJA 4Z95H 5I9QB 3UBXG 4HFUH 4O2FA 5C0AB 1FL5B 2NY0B 4FTVD 4PJAF 1MCRA 4UTBL 4YDIH 4ZXBB 3AU1A 5TF1L 2HT2D 5FYJU 4HJJL 2RFXA 5EZJB 5DMGD 1YNLL 2GJJA 3HG1A 4ONHB 1CU4H 4L3EA 1I3VA 5SWQB 3BKML 4ZUWB 3DGGA 5F9AC 1MRCL 3KPQA 3PL6D 5IMLB 2X1QA 5LGHL 1D3CA 3B9DA 4I77L 1ZT4B 3LRSB 1YEFL 1CD1A 5D1XB 1MF2H 4JN2B 3WDHA 1NEZG 3FAXA 3MR9A 5DRZB 5FDYA 3SJVE 3FAWA 3OAZK 4OI9A 2QHLA 4GT7A 1JJUA 2V2XB 4GRLB 3FN3A 1T89C 2VXTL 3TIDB 3MLRH 3K2UH 1VESA 5ENWA 4TNVF 4PJXF 5GGRB 1LO5B 3WKML 1KFAL 2K3TA 3O8XA 3N1MC 5J7CC 4YHYC 4D0BB 3UMTA 1UT9A 4IHOA 3T0EC 4PRHB 5CP7A 1R3IH 1TENA 4FG6C 3LN4B 4LARL 1I7UB 4QY8A 5MI0C 1IFHL 4PJ8D 3BD3A 4P59L 2ZOKB 2WUCL 3VD5A 4JZJC 3KJ6L 3KPPA 4M4PA 5F1NB 2A38A 4MVBC 1N8ZA 3WN5B 1KB5L 4M43L 1WK0A 1FV1B 5EZIL 3NTCH 1CR9L 4QRTB 3CFCL 4LLMB 3WLBA 1C5BH 2VJXA 3ILQD 5M7QA 1MUJB 1UCBH 2EO9A 4PIRF 5C0BB 4PY8I 1U3HA 4XPTL 1YEEH 2XYCA 1ADQA 3ROOA 4E41A 2H6PA 4YDLC 5CUSL 2W9DH 4X7FC 4QTHB 1BJ1H 3RY6A 2DI7A 2APWA 4TSCL 3GMPA 1CN4A 4YGVA 1XR8B 2F53E 1TNNA 4UILH 3S88L 1FJ1B 5DJYB 4NQEE 5EUOF 1EEYA 2PYEB 2A6DB 5D2LA 5EG6C 5F6HJ 3QHFL 3IJHA 2ZCKH 3UTSD 3W81A 3E6FA 5CJXC 1YMME 4OLYL 4CVZA 5CBAA 2RHEA 2ZSWA 5EO9B 1CCZA 2V5TA 1M05A 2GTWA 1ZAGA 5LGJA 4LCWA 3MCKB 1BQHG 4LEXL 3ARQA 1ES0B 1V8HA 4LEOB 2BY0A 1RFDL 1EJOL 5TDOB 3CPLA 5AUMB 3BEWB 1FFOB 2ZUVA 4IRJC 4P9ML 5D2LF 1W0WB 3D48R 3I85A 5GGQH 1OTTD 5DFTA 1RJYA 5I71C 4JJ5B 3SCMD 4DW2H 3FB6B 4Y4HC 5E9DB 2VR5A 5TE6H 3BHBB 1T03L 1D9KC 4O00A 1JZ8A 1SJEA 1HXMA 4JE4B 4F7EB 3VFUB 1T5WA 1QEWA 2D31B 4I18A 4JKPL 1DL7H 4FFZH 3DRTA 1VADB 4RDQG 1R5IA 1W8OA 1AH1A 2ZNWA 4KTDH 3O4LE 5HY9A 2Q8BL 2AJVH 4H5SA 1I1FA 5JDSB 2ZCLH 5GGSB 5F7EH 4WV1A 1KCRH 5IJKC 2R69H 1UZ8B 4KZEL 5CD3A 1OAZL 1RD6A 4DGVH 3MBEB 3NCYS 2R0LL 5D9SB 4AYFA 1UB5A 4G9FE 2BCKA 4MLIA 4PJIF 2VZOA 4OZFB 3NA9H 2JKXA 3RVWC 3STBA 3RI5K 1AE6H 3ALXA 3ELAT 2YPVH 3ZKMC 2Z92B 4F8QA 2UYLA 4JEGB 5GGTH 2P5WE 5IEKB 2R2HA 3DURA 1CG9B 1PW3A 2BJMH 4QOKB 1UM4H 5DI8B 2P24A 3HLAA 5CSBA 5SV4A 4OM1H 4FTVE 3FHQA 1J11A 4HCRL 3WJLA 3T77A 3P0YH 3BX7C 2CH8A 3MUY1 3HCVB 3UZEA 3N1QC 3MODH 2VUOA 5F7HA 5JA9A 5HXMA 4HK0B 3TPKA 2PTVA 2A9NL 5D7IE 2V7HA 4JQIL 2VDOL 1A7RL 4Y19B 4PGEA 2YPLA 2IMNA 2DLIA 2CK0H 3BIKB 3V5HB 4NM8H 5A2IH 1BJ1J 2H26B 4P2RE 1FVCB 5SWSD 4CNIB 2ZKHL 1AD9A 2C3GA 3O2DL 1CXIA 1KCVL 3MRNB 3Q2CA 3IJSA 3U9PL 1A6TA 1T04A 4KQ3H 1HZHL 2DQTL 2J2ZA 4S2SB 3L3HB 4PJ7F 1T4KB 1OM3H 3IDIA 1I3RB 5ALCL 5C0FA 2APFA 1BGXH 1JPGB 1TTUA 3EFFB 2VDPL 3PQYA 2PNDA 4I0PB 3NABL 4XVTL 4XXCA 4K9EC 3QCUH 4HBQA 3RVUD 2HVJB 1U8NA 4RQQB 5ISZB 4PJBF 4XBEL 1YEJH 2WQ8A 5BS0A 5EU6A 3LPWA 3RP1A 3TFKD 2AV7B 2VLJB 3S6CA 5DJAA 1ZHLB 5CEZE 5JMOC 4WTWA 1F4HA 1D7FA 3CX5J 2VUYA 5J0BA 3U46A 2FZ3B 1R6VA 3WFHA 3AC0A 1GGBL 2VL4A 3MLUH 4QRRD 2D4FA 3ZYOA 1DQLH 4G8GA 4N9OB 1U3ZA 3LIZL 5JZ7C 3MRPB 5CSGA 5F1OB 3WNLA 2IH1B 1RUKL 2CDFB 3IFNH 1IAIH 1CVRA 3GHBL 5JUEL 4GKOA 3SJVA 1OF2B 3MO1B 4YBQC 2NY2D 4U1NB 3QQ4A 1U8LA 3O41A 1OAXL 4LAJH 5TFSH 4ZFZA 1IVLA 1KEMH 5C08A 3IDUA 3BDBA 4YBHA 1K4DA 1U3JA 5LBSL 3UTSE 4Y8DC 2BVTA 4KRPB 3MFFA 4GQ9H 2AQ2A 3W39A 4JFFB 2I60L 4OQTH 4KROC 1JF6A 4HWNA 4YHYB 1PSKL 5HHQA 2Z31C 4PJFB 3VXOA 1UWEH 4NNPH 6CGTA 5GS0C 1INEH 4RFOL 1L7TH 4WJ5B 5I1KL 4G3YL 5KSAD 2CLVB 2VDLH 4OZGE 5HHPA 5MI0B 4NZRL 4OZHE 1AGCB 4ONGL 4HULB 1GH7A 4JY4B 4JZJB 1A2YB 2A6JB 5IOPB 1M7IA 5AYUL 5C0DB 3O3AA 4P46A 4LP4A 4NM4H 3WFZA 5T1LA 4M5YH 3QPXH 3OHXA 5ACZA 1KJMB 1JGEA 2L7UA 1AGDA 1MCIA 3ARBD 1JF1A 1NUDA 2BHZA 4OD2B 3NOIA 2FBOJ 4ZQKA 4DKEL 4QT5A 3VI4F 2F53A 3UJIL 4HKBB 4X7CC 5DEFA 1MHHA 3T0BA 4KMQA 4GAJL 1OB1A 1DUYA 2WLYA 5DK0A 5CWSB 4OUOA 2EYSA 4UIKH 4NC1C 5L88L 3VFGH 4JVPA 2X9WA 1I3GH 5HD8C 2GW5A 4NKOB 4PJ7B 4Z7UB 3M17B 3DSFL 1MFAH 2FRGP 1VSCA 3MV7E 4R4BB 4Z7QF 4P48A 3VXSB 4HK3N 4MJIB 1QD0A 4R7DB 4F3FA 4X5WB 5A40E 3OGOE 4PV9A 2PN5A 4JHAL 3GBLA 3MACL 1E27B 5DWUH 4HX1B 5HVGB 1FG2B 1NBZB 1WFTA 5IV2B 3Q6GH 1GCFA 2NMSA 4QCIB 2KQMA 4OZIB 1QRNB 4IRJB 1A6VL 1AI1L 2DS4A 3MLSL 4K9EH 1CI5A 3CFDA 2G5BB 3QNXA 3SOBH 1HHHA 2AABL 4ZFGH 3DBXB 2FYYB 1VGEH 3FQTB 2A83B 2MHAB 3SDCD 3TWCH 3QDJE 2VSDA 3C5SA 1JNLH 1DFBH 1A64A 3TH4T 4GKZA 3GUTA 5C0AD 1A3QA 2NY0D 1B90A 2RCSH 3O4LA 1MEXL 1AFVL 1G9ML 5HI3C 5SWSE 2IFGA 4ZXBD 4OZ4B 4XRCB 3DO7B 2ERJC 3MRJB 1MJUL 4NP4L 3ULUC 1KSRA 5I1JL 1PX4A 1BWWA 4DZ8B 3IFOA 1LP9A 1M7DB 4UQ3B 4G9FA 5EO1A 2DDQH 2JIXB 4Q9RH 5DSCA 2FL5A 2HG5B 1UWXH 1A7OL 3SO5A 1TITA 1P6FA 4CGTA 1CQKA 3O3UN 3MRCA 3G6DH 5IM7A 2P5WA 2YPKB 3REVA 5D1XD 2B0SL 2BDNH 1JE6A 1YEGH 3P9WB 5CILL 2K7PA 3QJFA 5D2NA 1KTLA 3U0PB 1LP9F 1I1YA 1TJHL 5DQJB 1GGYA 4ENEC 3L7FA 1E4JA 2D7PA 4TOYL 5DURD 5KVEL 4NUGH 5FHAH 2OMBA 4FQIL 5I1EH 1N2RA 2XOTA 5C0RH 5D7JB 3HPJB 4YX2H 4FZ8L 3DVGB 4XNMB 4PRHD 1NDGB 3PGDA 1AD0A 4XMKL 1BZ7B 3O0RH 5C07B 3QIBD 4WHYG 4P2RA 4PB0H 4C4KO 1RK0A 1TQBC 1S5IH 3X11B 2FSEB 3WV0A 1NCWH 4A2LA 4Z7NF 1OTSC 5DMYA 1PG7X 3L3DA 5CINH 3D85B 2F8XC 4JFOA 3RWEA 1S9WA 5D5MF 5J9PA 5C0BD 4EI5A 2ZP0T 1UH3A 2O5XH 3DHMA 3ZT7A 4UNTA 3SY0A 2OZ4A 2FEDD 2J6EH 2UWEE 2NY3C 2VDQH 3RNQB 3EYSH 3MZTA 1KPRA 3C6LD 4JQXC 3WBDA 4OKVA 4U1SA 1JNNH 1URLA 3O3EB 4JDZB 4OTXH 2ORBH 1BQHB 1KYOK 1KTRL 5FYLL 4XP5H 3BQUD 3WSQL 4L4TA 1BD2D 3IU3B 4RSVA 4GOSA 5GS1C 5JOFB 1A5FH 4FXLA 3EDKA 3SKMB 3G08A 3GSOA 1RQ5A 3FT3A 2HT4D 3EAKA 1NL0H 4RAVA 4Y1AD 3BZDA 5DJ2A 4PGDA 4PB9H 3LQZA 3RX5A 5E6IC 2EXYD 1YEKH 3C60A 3TGXA 1BLNB 3RU8H 2VWEC 4HMEA 1FNEB 2GQHA 4MDIA 3L5WA 2WBWB 5C9JA 5TJWK 1J0KA 1NLBL 3MROB 3AMLA 4LLUA 5I1AA 2DQFA 2E7LA 2X1WL 1G1YA 3G6AB 2C7UB 1VGKA 1AO7A 3JTSB 5IW6B 3ULUF 5E56A 2VN4A 3BH8B 5ELIA 3VGAC 3FQUA 3FONA 2XRAH 2X4SB 1BFVH 5KANI 3OZ9H 2OZ4H 5CZXD 2P1YA 1MHPL 3Q1SH 4UV7H 3OKEB 1S7UB 3KPOA 4KHTH 4JPIA 3FZUD 2CO6B 2P46B 4K3HA 1QLFB 3STZB 3QHZH 4Y4KB 3HAEG 2JB6B 4OZGA 2P5EB 4YHNA 4D0DB 5F44A 5F3BB 3U7YH 3NCMA 2GUOB 1I9RH 4RGOH 4U1HB 3BSZH 4OLXL 2Z31B 3A6CL 1QUNA 1MHCB 3ULUH 1ORSA 5HI4C 2X89A 3ARGB 2VLKB 2AAVA 3E8UL 4MNGE 1I8KB 3IU4H 4QHNB 5FKAB 3L3OA 4FQPA 3N9GL 3C8KB 4LMQI 1DLHB 3ET9F 5L2KB 2AK4E 3MXVH 3TO2B 1RZKL 3BRDA 4Z76A 2BMKA 4TUJB 5C0AE 5I73C 2H8PA 3HZKA 2O5ZL 3KPLB 2MCPH 1A0QL 3TZVA 3JTTB 1ED3B 4ZTPL 1KB5B 5CJOH 3FQRB 5F7FA 1C16A 3UXFA 4CMHC 1F3DH 4P4KA 3MNZB 3EOYG 1JGLH 4M1CC 3MV7A 2GK0B 3S4SB 3U4BH 2NXYC 3OJDA 1GYAA 4HPOH 5BOZG 2WWKO 4WRLA 4N90D 4JFXB 5DD5H 4KK5D 1A47A 4XCEB 5F7YC 5KJRL 1EGJL 1GGCH 5C86A 4WW1A 3ECBB 1A3LH 1I8MA 5JNYA 4KRLB 3B4NA 3EKCA 2VYRE 2AEPL 4U1IB 2OTUA 1MCNA 1RUML 1DVFB 4F7CB 3DHJA 1RIUL 1VFUA 1RZJL 2EYRA 4UT7L 3BH9A 5JMRA 1NUNB 4JFDA 3OR6A 5ISZD 4EJ1C 5LCVL 4GW4A 4NFCA 1ACZA 3QDJA 4PRHE 5DF0A 5KTEL 4P4RB 2J5LC 2AGJH 2X4OB 2VLJD 4DGYL 4FQHA 1FHGA 3QEUA 1IC4H 5IB5A 4RFEB 3QXDA 5SWSA 5TE4L 2F19H 4TVPH 4X83A 1OP5H 1O7SA 3B5GA 4HH9A 4HMDA 4OBSA 3EYOA 2XFXB 3VH8A 1E4KC 4AH2B 1EHXA 1EBPA 1RZ7H 4LCYA 4CVWA 4NKIL 2J1KA 5CLWA 4OCYH 5DMIH 5ANMB 3C5JB 4HSQA 1NGWB 4G6MH 4J23A 1HINH 3DIFA 4XP6H 1ROWA 2Y1VA 3V79C 1UXWA 4KAQH 2DLHA 5C0BE 1QYGH 3FCTB 3FO0L 5CEXA 4LVOB 5HYIA 5DTFB 1G9MC 4OFKA 4ELMF 1SBSL 4PV8A 1K4CB 1BFTA 1XCTA 3LKSB 5FUCC 4PLNC 1CGXA 1ZEAL 3VWKA 2X10A 3MOAL 1T0MB 3ORJA 1FCCA 3Q6FA 4UBDC 3GIZL 2PYEE 2R23A 5CLTA 1INDH 1VACA 1QKZH 4BQCA 5BCAA 5ECJE 2QKIB 2WW8A 3EW3B 5T1MB 4HUXA 25C8H 5DD0H 2F8VA 5F9OH 1CL7I 2YUXA 4KDVA 1W0YT 2XTJC 5DA4A 3T0ED 1RUAL 2FLRT 3S3JA 4FG6D 4JCMA 1FPTH 1LDPH 1ETZB 1NGQH 4OCNC 3W2DH 4JFPA 5DR5H 1CGUA 3WFCL 3P73A 4L5FH 1TDQA 1TQBB 5EO0B 5FO7A 1KJ2B 4U6YB 5GGRY 3U7WL 3HMWL 4YZFE 5JO5A 3H42L 1ZGLA 5E9DE 1JGDA 1F3DJ 4LFHG 4MVBD 1LQSR 3O6MH 1K3IA 1Q9OB 3MUJA 4OM0L 4MB4A 3TO4D 4F57H 2XNAB 5IVZB 2NX5B 4YUEH 5CBEA 5IG7B 1RV6X 3RDTC 1R3JA 2ARJA 5FFLA 3CH1A 1CD9B 2IADA 2PR4H 2VC2L 3SHSA 4LHUG 1IGIL 1AY1L 2NY3B 3OTTA 3S97C 4L9LB 4HWBA 4PY8J 2YSSB 1UB6A 2HKFH 4R7NA 2HH0L 1KN2L 1QFUH 3NN8A 4IIQA 3STLA 1G7MB 1KG0B 3TT1H 5GS1B 1ZLSH 1YY9C 1IBGH 2PXYB 2XA3A 4ETQB 1KXQE 4MJID 4TNWF 1XGUB 3FQXA 2A74A 5ILTH 4F15C 1AGBB 4C4KT 4M62L 4YHOH 4QOKE 2OJEA 5ESQB 2HN7A 4YEEA 1VERA 2PCPA 5JHDB 5T3XH 3C08H 3GSQA 1QRND 4IRJD 2PO6C 5CGTA 4OLWH 1VCAA 2EEDA 3ALPA 4LOUC 3D18A 4Y4HD 1BFOA 1DBAH 3WLWC 1RHHA 3R1GH 1W72A 3D25B 5FGBC 3IETA 4RFNC 3KPRB 4Y19E 3QUYB 3VGAB 1P4LA 4GRMB 3D39B 1D9KD 5IBUB 3MMEA 3VGDA 4WCYH 2OR9L 4N90E 4CW1A 4JB9L 2UUDK 1HSAA 3PWPA 4WFFD 4HWBH 5KANG 2F5AH 4LNVA 1ZVHA 4KWUA 5FYKD 2CKBA 1NFIA 2M2DA 1KN4L 2JIXD 4FHBD 5D6CA 4GAGL 2XZZA 2KKQA 1FZJA 4L4VB 2VZUA 1JRHL 1YY8B 4J4PC 5ISZE 2F54A 4RA3A 5AD0A 4NO0D 2AK4A 4YC2B 2YK1L 3GSVB 2VLJE 3RVWD 1IC7L 1FL5A 4R96A 3WS3A 2H1PH 3SQOH 1PQZB 3GI8L 3HAEH 4NQDE 3ZKMD 1F42A 4PJ9C 1C7TA 12E8H 4ZODA 2DJSA 4NJ9L 5EZJA 5GGSY 3OB8A 4WEBL 4NQUA 4ZFOB 2X70B 5I73B 4HPYH 4NUJB 3I50L 4JQVC 4PGCB 3MXWL 1KB9K 4ZDHB 2AXHA 4S1RL 1W72H 1OPGH 4LIQH 3LS4H 3DWTA 2YMXL 5IHBA 2DKSA 1RZKC 3G5VB 2K1MA 1MVFA 3LRSA 4CMHB 1TJIH 1UXSB 3GMQB 4JN2A 2EKSA 2XXCB 4J8RB 1I85C 2AEIT 4GRLA 5L6YL 3TIDA 4JY5L 4J3OC 3MJ6A 3BZEA 2DQGL 3CXDH 1LO5A 5IKCA 1A6UH 3MTRA 3T2PA 2EYTB 1F6AB 4PLOB 4D0BA 1BF8A 3VFWB 1H8SA 5E5MB 2IBZX 1JBJA 4XP4H 4UTAL 4X4XB 2WBJA 1RK1B 3JV0A 1JIBA 3LN4A 4JFFE 2IBGA 4FQ2L 4NO5B 1HKLH 2DLFH 1H3XA 3Q3GA 1G84A 2ZOKA 3NIFE 1F8TH 4PJFE 1PBYA 3SKOB 4OLVH 2J5LB 1MH5B 1P7HL 1JTPA 3EUUA 4Z0XB 3WN5A 2HJKB 1UACL 3CVIL 4OFIA 2V5RA 3QCVH 1WIPA 4LLMA 4Y16C 4AM0B 1MRDL 1JGVL 1YN6B 5I30H 1HHJB 1NGZA 4N8CL 2BX5A 1NEUA 1JTOA 4H8WC 3X3GH 4AIOA 5JZ7D 1JN6B 4I3SL 4Q58C 4QTHA 4MAUL 5SWZB 4NZJA 3WJJC 2BZDA 1XR8A 4AMKH 3OQ3B 3RGVA 3NAAH 4XNUH 2PYEA 1BVLA 4YBQD 3OXRB 1KENL 3ZSTA 4PRAB 5EN2B 4HHAB 2NXZB 4M6ML 4RMVA 4TSAL 1REIA 1WUNT 2YC1B 4M1DL 4Z7UE 3MCKA 3ULSB 4JHBA 5HHNA 3QWRD 1ES0A 2QSCL 5KBNC 2YD6A 3UTTB 3PP3K 4IM8A 1GSMA 3VXSE 1HYRC 1YJDL 4HIEB 2FWOA 1T7ZA 2VXSL 2P5ED 4KROD 4WEMB 1W0WA 4JFEA 3JZ7A 5DHYA 3IDNB 2Z31D 2XTJB 5GS0D 4JJ5A 3ZTJH 3K2MC 3SDXB 3FB6A 5C7XL 3T4YB 5E9DA 1R5VB 5E5UB 1TZGH 3BHBA 2V9QA 4K3JL 5FHBL 4OZIE 4HEME 1QRNE 4MA8L 2ADFL 4M7KH 4AL8L 1XGQA 4OCXH 2QTEA 1QSVA 4WWKB 5H2BA 3GSNL 3NCEB 1Z9SA 4LVHB 2P49B 5L2KD 1J05B 2D31A 2CUMA 4GW1B 2WANA 1L6ZA 5I1HL 1IARB 2FGWH 5ESVA 2IG2L 2VKWA 3GO1H 5IGXL 3BJ91 1FFPA 5D1QC 3V52L 3AREA 4WFFE 1BZQK 2D7MA 5KSVB 1T1WA 5DYOB 3RDTB 4Z7OF 1HN1A 1AC6A 1EFXA 1VFAB 3MBEA 3HC3L 5J4MA 5F88B 4FS0A 5FYKE 1U8IA 5T5NG 4G7VL 1GIGL 4LSSL 1P84K 2A6KB 5E1AB 2MJWA 1NSNH 3O45B 4OZFA 3H3KA 3ZT6A 1XH3A 5DZOA 3LZFH 4ZTOH 5J56B 4NNYA 1AHWC 4XMPH 5HD8D 4M4RA 4L3CA 3HI5H 4TRPL 2HA1A 5EBWA 4QOKA 3RWIA 2G60L 1UVQA 1XF5B 4YGAB 3I3BA 3HNSH 2FD6L 3T65B 4P3DA 3I75A 4CU8A 4NC0B 3JVGC 1TVBA 3ME0A 4F15B 2Y07H 3I9GH 4BK5A 2X4NA 3WFEL 1P1ZB 2P8MA 4Y19A 3ARFB 4U7SA 1CDUA 4XNZC 3BUYA 5C07E 4WTZA 2H32A 2H26A 4QHMA 4V1DB 2JLLA 3MRNA 1CGYA 3QBTB 5D6DA 3HC0A 4RFNB 4JGMA 3L3HA 1T4KA 2F58H 1JPGA 4I0PA 5IW1A 4WHTA 2OR7A 1F3JB 3VMOA 4MJ5B 3WFDL 5HI3D 4YIQA 1MCDA 5MEND 4RQQA 2XN9A 3ULUD 4MMXC 5FYJL 5CKGA 2Q7YB 3B2UC 1WWWX 1ZHBB 3QPQC 1HHGB 1WBZB 4R8WH 5I6XB 4LRIA 3IDGA 4C83B 3T09A 1X6LA 2VLJA 3ZDZF 2XICA 4GW5A 5JQHC 4GAFB 4NQDA 1NGYB 5E99H 2FZ3A 2R9HC 1FLTX 3KJ4B 3OXSB 4ODVL 3TA3C 3T4AB 1OAUH 3WUWG 1S7RB 3G9AB 5C8JB 4LLDB 4WU5B 3HS0B 3MRPA 5DEGB 5JORB 4JDVA 1JZ6A 1Q0YL 2I9LB 3BAEL 4ENED 1XZ0A 1CGSH 1WGOA 4G6KH 4MA7L 3QWQB 1QHOA 2CXKA 4MQTB 2CDFA 3CDYA 2H32H 3V4UH 4N0UA 4QXTA 3TJEH 2AXFB 1OF2A 3MO1A 3L1OH 3AXLA 4GO6B 4PJGB 5EFIA 1OGTB 1R3KA 1V7NH 1WT5C 4RMWA 4IRSC 2VITB 5DT1H 1KJ3L 5C6TL 1Z2KA 2R2CA 4BSWB 3CDFA 1FLRL 2DAVA 4Y4FC 2BVQB 2EE2A 1R5WB 4LHUB 4Y2DC 3TT3H 1UM5H 5ICYB 2PTTB 1Q8MA 2P7TA 4FQQB 5EBMB 3PV6A 1DQDH 1OTSD 3OAUL 1SM3L 3G5XA 1QSEA 1A7PH 4HWZA 4JFFA 4P2OC 1YECL 2NX5D 2DQCL 2FJFB 4OLUL 2VZSA 3RIFF 1K8DB 1JP5A 3U79A 5BZDB 1FO0A 1NAML 2Z0BA 4WJ5A 1EHNA 2VDKH 3INUL 1NJ9A 3B3IB 2NY3D 2P5EE 4N0FA 3FB8A 2B4CL 1I7ZA 3FRPG 3V7AG 2V6HA 5IJVB 4JY4A 4TVPD 4YQXL 1A2YA 1CFQB 4NYLB 5IOPA 4MD0A 8FABB 4MAYC 2VLKE 1MFCL 1CE1H 4YDJB 5HDBE 2V5YA 3VMNA 3EOBB 3DYMA 4XC3L 4Y16B 4ZPVB 1J7VR 5E6ID 1J1OH 5L2KE 3U4EA 5KG9B 3VXPB 1H0DA 4HKBA 1QLRB 2HYMA 3NPSC 4XNXH 5JHDD 4WHDA 4NT6B 4PJ5A 3CK0H 3M8OH 3BESR 3OKNB 4K71C 4Y5YB 1YUHB 1OP9A 3KYKL 3QIUC 1WCQA 1IL1A 1X5IA 4TTGA 1MLCA 4ODUA 5DMKA 4HMCA 4Q97A 4U2YA 4BZ1H 1S7XB 5F7WC 2BNRB 1YPZB 3D39D 4YPGB 3VXSA 2YN3A 4BA8A 3P4NB 4NC1E 2FR4B 1NCCH 4X5WA 1OD7A 2XG5A 1SEBB 2OP4H 1WAAE 4XWGH 3O6FC 2X4UA 2JJVA 4BSJA 5ID0B 1LO3L 5IBTL 1HHKB 1DZBA 2ID5A 1XAUA 1AQKL 5IV2A 4NN6B 4QGTA 4L1DA 2QL1A 3D3VD 2W0KA 1S7QB 4PP2B 5IB1A 3SGEH 4GMTL 3X12B 4FFWC 4UDUB 2G5BA 3S96B 1VFOA 3PG2A 3NZ8A 1EXUB 2FYYA 4HIXH 2MHAA 4Y0GA 3HNVL 5HI4D 3P11L 3BKJH 4MNQB 3B9KC 3C8DA 4Z5RB 4H1LA 4NZTH 4YFEA 2C5DC 3WIIL 1MELA 3PIQA 2X40A 4G7YH 4P23B 1WZ1H 2QSQA 5CJQH 1LMKA 2IPTH 3SN6N 1TQCB 2IPKB 3WIHA 1FZOB 4HLZG 3ZTNH 4XRCA 3DO7A 1U41A 4QWWC 2BRRH 1CBVH 4KMTH 4XPFH 3QDGB 3L95A 5DC0A 5KVGH 4U4BA 3T2NL 3LKQB 5ANME 3L3GA 1CL7H 5EU3B 2HG5A 3OL2A 5C6WH 3QXAB 1F00I 1QQDB 2VDML 5F8QC 2B39A 5HGDB 3QO0A 3RJDA 5I16B 2V17L 4NKMB 1G9NL 1S5HB 2Y5EA 3KYOA 4DUVA 1U6AH 1U8KA 4M1CD 2BNUB 4GUPB 3D2UD 2NXYD 1PY4A 1W8NA 2GFBB 3LKOB 5H37H 1GGIH 5DHVB 1AHWB 4AQ1B 4DCQA 2MMXA 5EZOL 5DQJA 4PRBB 5D1ZC 4CMMA 2HWZH 1M6OA 1C8PA 3QFJD 5DUPL 5MP6H 2BVOB 3QUXC 2YA1A 5D7JA 4XNMA 4A6YL 3OJMB 2P47B 1H3TA 3FFCB 1ZLWH 4ZUUA 3TP4A 1BZ7A 4D94A 5C07A 2BP3A 4PP1C 2DQJH 1KV3A 1CDCA 2I5YH 3VMPA 2G75B 1E6OL 4LSQL 4XVUC 2Q6WB 3X11A 2XZAH 2XWJB 4XNZB 3X13B 3IXTA 3L9RB 1IRAY 1IC5H 5TH2A 4HG4J 3D85A 3LEXA 5K9JH 5F9WC 2KQNA 5FM5O 4WI5A 1WFUA 3TPUB 3UJJL 2BFVL 3BWUC 1ND0A 2AQ3A 3S37H 3WIFB 4JPWL 1QTYT 3BD5A 1PJ9A 2E7MA 4ZYKA 2NX5E 4TNVK 1MCQA 1ERNA 5IFHH 2IQ9H 1XGPB 5SWZD 5CKAA 2ZCHH 3O3EA 3D9AL 2YN5A 3P9LB 3ZDYF 3IU3A 4FP8H 1PEWA 1Q94A 3SKMA 4LASH 4BM7A 1S7WB 3EBAA 3BDXA 1O7VA 4BH7B 5CZVH 1Y6KR 1J1PH 5F97E 1X6NA 1CDHA 3VRIA 1FH5H 4YDKL 1MFDL 2X4QB 4UIMB 3TA3B 5FYKU 2VISB 3D69B 3DV6B 2WK2A 3UTTD 2MKLC 3FQNB 1FNEA 2WWMC 2X4PB 3B2VL 3HI1A 4Q2ZA 4DJMA 4CVUA 1RJLB 3HNTL 3U82B 2WIIA 3MROA 4DEPB 3UTQB 1IT9H 1P53A 1MJ8L 3G6AA 2C7UA 2XTJD 4WUUD 3JTSA 5DUBB 2VR4A 5IW6A 1JPSL 2Y4SA 4JFHD 4ODSH 4ZUSB 4EEEA 5JHDE 4KJWC 1J1XH 4IRSB 3KLAB 4X7DC 5I8EB 1NC4B 2YKLH 1F45A 4Y89A 5FK9B 5DZNA 5DVOA 3CX5K 2DM3A 5L7XL 4Y4FB 1LK3L 1S7UA 4Y2DB 4WNQA 3KPRE 5I19H 4QEGA 1JHTB 3D39E 4S10A 2YD8A 1TJGH 5J6HA 5FKPB 4Y4KA 3NFPB 3EYUH 2JB6A 1KCLA 3VXRD 5F3BA 1T66C 1PDKA 1H3GA 2GUOA 3QR2A 1X44A 3RDTD 4UDTA 1T5XB 3QEQB 2R0WL 2W65B 2AEQL 1MHCA 4Q9QL 5BV7L 3M1BB 3ARGA 1T2QL 2VLKA 4JFQB 5T33H 5BVPL 1I8KA 4MMZC 3GMOA 5JPMB 1GPOL 4TQEH 5FKAA 1CF8H 4L4VE 4IDLA 1YN7B 5FGRA 1HILB 3LMJH 3OKMB 4LKCB 3SGDI 2DQEL 4LF3B 3TO2A 3MGOB 1YY9D 2HFFB 1A7NL 4TUJA 4F7TB 4OB5H 3R8QA 1S7SA 5EU7C 1U8OB 4NKQB 1MI5B 1ED3A 1KB5A 3FQRA 4X9IA 5DJXB 5GGVY 1B0RA 3MGAA 1FNSL 4LLWB 2Z93A 3S4SA 1EEUA 2WP3O 1MCHA 3O6LL 4K71B 3AFLA 5EC1A 4LPTA 3QIUB 2PO6D 1YMHB 5INDB 5LGHH 1WAAA 5GGUB 4V1DD 3JUZA 4XCEA 4LSUL 1QACA 4I77H 4LOUD 3WLWD 1YEHH 2ICWA 4XWOC 2Q7NA 2I26N 1JNHB 4NPYB 4KK8C 3L3KB 4U1IA 3C87A 2VXTH 2F74B 3MJ8A 5TQ2H 4HS3A 1HXYB 1DVFA 4F7CA 3LV3B 3S5LG 3SBWA 3BN3B 3AB0B 1BEYH 5I8OH 1A6AB 4LCIH 3NACL 1CXLA 4MXWH 1HK6A 2GKIA 4KGJA 5I8KL 2X4OA 3IS0X 3F7VA 3NH7H 1IQWL 1SEQH 4J4PD 5E00B 5JPNA 4RFEA 4ZD3L 4P59H 1X9QA 3K8KA 1NFDB 1FZKB 4OV6F 3B9KB 3CVHL 3OF6A 4X6CA 4EDWL 2ESVE 4BKLB 2YD1A 3AY4A 1DBKL 2QBWA 3DXAB 1B4JL 5ANMA 3C5JA 5E2VH 1NGWA 2R29L 3KPTA 4UI2A 1U95A 3L5IA 4PJ9D 4POZC 1J0YA 1CR9H 2AJZB 3SDAA 3MCLH 5HHMB 5J13C 3MLWL 1MWAB 4FZEL 2R4RL 4XGZB 4EVNA 3FCTA 3UEZA 4XPTH 1FZMA 5TE7H 2Y36L 2WAHA 1FFNB 4LFHD 2CO7B 5F96L 2YD3A 4X6CF 4JVUA 4HKJA 5SWZE 4E9LA 1NC2B 5FO8B 4P2QD 2OQJA 5E8DH 5AZEH 4LHUD 2VE6B 3QEHB 2BHYA 3BP5A 1U93B 3HC4H 4ZG1A 5FUCE 2QKIA 4NQCB 5C0NC 4BFGA 2AK1H 4HIIA 1KCUH 4XNYL 5D1ZB 1NDMB 4MQ7B 3RPIA 4XVSH 3PHOA 2ZG3A 4LCUB 2YD7A 1Z0MA 2E8YA 1FYTA 1Q72H 1IGCL 3UTTE 5I76B 1T0NB 1ETZA 2CMRH 3B9AA 2P8PA 3GI9L 3U36B 4PLKD 4TPRH 5EO0A 2VLRD 2XTJE 5GSRA 1B2WH 4Z6AT 3SDXE 4JFHE 2NY1C 1DQQA 4HCRA 5ESAB 1ZVYA 4AEFA 2HVKB 3IKCB 1T1YB 1CLOL 1IM9A 4HS6B 1Q9OA 1D5IL 3C6SA 2DOCA 2XNAA 5IVZA 4Y16D 5F9WB 4JHWL 1A1MB 5IG7A 5TDPA 1ONQB 2EXWC 4HUMB 2V2TB 5HGBB 5E2UL 5DEZA 1XIWB 3VJ6B 3DX8B 4L9LA 1AXSA 2YSSA 2CRYA 4W70A 1R3HB 5D93C 4HZLA 3T0VA 3Q5YA 2IFFL 3K46A 2D7OA 3MV9D 3PWUB 5H8DA 1KG0A 4KFZC 4W6YB 2A77L 1B0GA 1D5ZB 2AP2A 2PXYA 1EIBA 2BNRD 3IXAB 3HI6H 1T3FA 4ETQA 3BPNB 1BX2B 1BBDL 1NCBH 4BUGA 1XGUA 4K94L 2KH2B 1WBYB 2BNQA 3VGGA 5JW4N 1AGBA 3U0WL 5MHSD 2DBJA 5LQBL 1F6FB 4S0TD 1L6XA 4JO4H 3RBSA 3HMXA 4DUXA 3N0PB 4NNXA 5FYLE 2J8UF 3QUMA 5TF0A 1PKQA 4L8CB 3FO2A 4QRUB 4BZ2L 2APTA 3D25A 4ZOCA 4C56B 3KPRA 3QUYA 3MJ7A 4IMLB 4GRMA 4IRZH 2DYPB 2ZOLA 4KI1A 2GTZB 2JJTA 4RNRB 4X99B 4YBLC 2H3NA 2VH5H 5I0ZA 3QNZB 3QDGD 1A4KB 3TCLA 4O02L 1L0YA 3RHWF 5KVDL 5D1QD 1F58L 1CTOA 3ZDXE 4FABL 4L4VA 3V4PH 1YY8A 2NTFB 3DUHA 4XBEH 4OFYA 3VRLE 2H2SC 4LAQL 5IQ7H 3GSVA 3V5DB 2VLLB 3IDMB 3OG4B 2B1HH 5GQBA 1NAMB 2FB4L 2XKSA 1PQZA 1UWXK 2AERT 1KBGL 5B8CA 2M8XA 3O9WC 3HMXH 2E27L 2DBLL 2Q8AH 1OW0C 2LVCA 2VXVL 3QUMH 1FNFA 3V9FA 2CIKA 4UB0L 3W11C 3UC0H 4Y5XA 4NUJA 4MJ6A 1HWHB 3WHXB 1GJIA 3FFCD 3FT4B 3LIZH 3QYCA 4ZDHA 3RX8A 3WKNA 1NMBL 1H9VA 3LDBC 4B41A 3GSUB 2H41A 1BM3L 3G5VA 1CFVL 3N85H 4JR9H 1UM6L 4Z18A 1G7LB 3GMQA 4NGHH 5J1SC 1IZKA 1CLCA 1DQJB 4PG2A 4Z8FH 4XAWL 4XCNB 1RULL 4TYUA 3SE4A 2R39A 5ID1B 4PJGE 4AEIL 4XNQB 4M5ZH 4XXDB 4HF5H 3TCXA 2KZWA 1OAXH 1CDIA 4Z0BL 1FDLL 4S0SD 1DSFL 1H3WM 2C3WA 3T2QA 3PGFL 3VXTA 3FQWB 1F6AA 4FA8A 4IBLT 4IMKA 4R0LB 3U6RA 3VFWA 3RWDB 5DQDL 1CE6A 2Y06L 4YE4H 1CXKA 2R56H 4X4XA 1JYXA 1RK1A 4TVSa 2X41A 5J1AA 4JLRA 1FVDB 3EJYC 1LDSA 2Y5TB 1WEJL 3LEVL 4XZUA 5K33A 2HJFB 5EWIH 1NLDL 4OFDA 4I5BB 3B2UD 3QPQD 4RFOH 3VD3A 2ESVA 3W9DA 4GRWB 3BWAA 4Z0XA 1ZT7A 4M7LH 3NPZB 3WO3B 1KELL 5C1MB 4QF1A 1VFBA 4P0DA 1JMZA 3F12B 3LS5H 1TTGA 2R9HD 5FDWB 1HHJA 3IVKB 5E8NB 3JWDC 3TA3D 5E8EA 3H9SB 2AJSH 4QTIL 4PRDA 1E4KA 2DQIH 5I17B 1I7TB 1C5DB 1X5GA 2N7BA 1K9TA 1D6VL 2WP3T 1IQDB 5F9JB 5AEAA 3SE9L 5ITFA 4CU6A 5J13B 2UZXB 2JE8A 1ZS8B 1F5WA 1N64L 4HAGA 4E42B 5KS9A 5BW7C 3OXRA 4HIHA 1OQOA 5HGHB 4MXVE 4UZGA 4HHAA 5EN2A 4IRSD 5FIEA 4PJCB 1L0QA 4YH6A 3D0VA 1NC4D 4KKLC 2XZQL 1G0XA 2AJYH 4G6JH 3T2OA 2GITA 1J86A 4JFYB 1AJ7L 1U42A 4DQOL 2NQCA 3ULSA 1CQYA 4Y4FD 4N1CA 4HEPG 4Y2DD 4L29A 1WZLA 5DJDB 3KLHC 2BNRE 1YPZE 4HIEA 4R4NC 3PDGA 5KS9F 4G6FD 1XF3B 4M48L 4P2OD 1RAMA 2GIYA 2YWZA 4OFVA 4X0KB 4ZUVA 4JHAH 3IDNA 4KZDH 2XWBA 1C7SA 3DX6B 3VE0B 2QHRH 3QEQD 2V7NB 1HQ4B 3SDXA 3WXWH 1GRWA 1MJ7H 2FCBA 3K7UA 1GC1L 3BISA 1R5VA 3EFDL 4ISVB 3KXFB 5B3JE 2XACC 4IDJH 5F21B 5GSVA 4LSPH 1FSKC 1UJ3C 1RZIB 1LO4L 4M7LT 5HHOB 1OVZA 4WWKA 4A6YB 5I1CL 2NY1B 2ATPB 4MAYD 4MNQE 3PP4L 5IF0A 4XPHH 2B5IB 4ZUTB 1CICB 3ZKNC 1T7XA 3VFTA 4P5KA 1M1SA 4BQBA 1AFVH 3ES6A 1KCSL 3EYFA 4D9QD 3DMMC 3TBWB 3SKUD 3NBNA 4DAGL 4GS7C 4E0RB 4S11A 3QG7H 2ZJSH 5GRVK 1BMGA 3UJTH 2C3VB 4FXKA 1ZMYA 3FT2B 1LE5B 4OD3H 2A6KA 4LDEB 3OBAA 4QXGH 2LU4A 1A14L 4K2UL 3QIUD 3QQ3A 4EDXA 1MVUB 3S5LB 5JQ6H 3ZO0A 1NMAL 3H7BB 3RA7H 5HPOA 4M8QA 1AXTH 3WNPA 5KVFL 4BJLA 1XF5A 1FFQA 3TYFB 5C2BH 3T65A 3O6FD 3IFLL 4NKDA 1ZANL 4RZCB 4TUKL 5BVJB 4LPXA 1QBML 3DARA 1Z0NA 4LSVH 4MD5A 4K94C 1QFWL 3ARFA 3FFCE 3I6LE 1QRKA 2XIDA 3RPKA 5I1IL 3GNML 1AIFB 1C12B 4HJGB 4FFWD 3Q0HA 3BOVA 4PYHA 3WD5H 2GAZB 5E2WH 2Z9TA 1HKFA 3RVTC 3B9KD 4NHCL 2AI0H 4L8DA 4F9PC 4NWTL 3G5ZB 2DD8H 3DXAD 4G8IA 2OL3H 1T83A 3TVMB 1XEDA 4MJ5A 4YBLB 3C2AH 4R26H 1YQVL 2CLZB 4QWWD 4X8JB 1A7BA 1GGTA 1OP5K 3JWDH 3N1FC 4QHLB 1ZHBA 2IPUG 1LE9B 4DK3A 1OAYL 4ZNEE 4C83A 2BY3A 5AWNH 5I66A 3HRZB 2AXGA 4K8RH 3GMNB 5IIEB 1IGYB 3S35H 3T3PF 1OP3H 1TZIB 1NGYA 5HGAA 4X7EC 3WSQH 1S7RA 5EORL 2IANB 3O3DB 3MOQA 2XA8H 1WBXA 5JW5B 1ZGLP 3JSSA 1IKNC 4MCYB 4PJ8C 2YUVA 3MV8B 4WU5A 4NQCD 5BV7B 4PGZA 3O9WB 5DEGA 5JORA 2FIKA 2I9LA 5D1ZD 4N1EA 3GJFH 1CDYA 3DVNA 4K3EH 1RU9L 2E9BA 4WIQA 3T0DA 2RGSA 1T20B 4Y7MA 4YWGL 3QUXD 4EXPX 4D2NA 5KSUB 1AXIB 4BQ8A 3MRDB 1BOYA 3G04B 1RIVL 1WWBX 3I6GB 1JI1A 2BXYA 1V3JA 4PJGA 4XAKD 4B5EA 2E6JA 4PP1D 2EDHA 4FQJL 4BSWA 4XVUD 1MPAL 1H15B 2OTWA 3PHQA 1DEDA 3P4OB 1MCEA 4QXUH 3GIVB 4M61B 1U2HA 1HHIB 5IWLA 2PTTA 4LKXB 4FQQA 4OT1L 2YEZB 5EBMA 3ZE1F 2FO1A 3SGDH 2AJUH 4HUWA 3RY4A 5FAAA 4YXLH 1XR9A 3S36H 3DRQB 5DO2C 2FJFA 3LEYL 1OGAE 1K8DA 2Y72A 3UPCA 3RTQA 4ERSH 2DQHH 5D70L 4WY7H 2V9RA 1SMAA 1F90L 5KZCB 1EGJA 5FA3B 1H5BC 4OUUB 1YEDA 5E2TH 3MLYL 4K3GA 5EBLB 1JYWA 5CGMA 5IJVA 3WE6A 1EX0A 3QEQE 1BZ9B 2NY5L 4EQ3A 8FABA 4WFHE