1J1PH

Crystal structure of hyhel-10 fv mutant ls91a complexed with hen egg white lysozyme
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Role of Hydrogen Bonding via Interfacial Water Molecules in Antigen-Antibody Complexation. THE HyHEL-10-HEL INTERACTION
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j1pH00
2R1YB 5IBLC 4NP4H 4LSTL 1J0KA 4B7LA 1ZANH 3I6GA 4F7PB 5C0AD 3CFIC 1MIEL 3OAZK 2PUQT 4OCXL 2HP4A 4LLUA 1FAIL 2NX5D 4Y5VB 4FTVD 5IB1B 3P0YH 5IVNA 1S9XB 2XTJB 3LD8B 4HKZB 3TH2T 5MENE 3U1SL 1M71B 4C55A 4JN1L 5CSGA 1IRAY 1MF2L 1I7ZA 3BD4A 1M6OA 4EZMA 4M8QB 2G5BA 3U1SH 3NOIA 4QXGL 4WO4A 5C07E 3VD9A 4J7RA 1V8HA 1EVUA 2DRUA 5EO9A 3SKMA 3SCMB 1NCBH 1S7TB 4XGZA 4LGSB 4EBQL 3MRGA 4QLRA 2R1YA 2W9EH 4GRMA 5FM5M 1JZ4A 4KY1L 1KJ2H 4WEBH 3THMH 4NKMA 3MBXL 2HLFD 5GRZA 3BZEA 1AIFA 2O5XL 1QUNA 3T4AA 4BJLA 3C5JB 3HC3L 2FEEL 1EFQA 5KVEL 2IBBA 3N1QC 2H26A 2NYYD 5JQ6L 1D9KA 1XMWA 2KH2B 5GGUA 1A1OB 1DL7H 1HDMB 3ULUE 3MCKA 3LKNB 5MEOA 3VGAB 3VXNB 3HMWL 5F8QC 1UYWH 1P7HL 2OXGA 3W5MA 3WEXA 1NCAL 4Z7UB 4YXHH 2DJUA 3TPUB 3IDYC 5F44A 3TNNB 3UJIH 1MRFL 1NUGA 1BPVA 4LOUC 1A02N 3CUPB 1S9KC 1FC2D 5IMKA 4V1DB 1NCCH 4NBYB 1BFVL 4PJCE 2KKQA 1B0RA 5HDOA 4I3RL 1IZJA 1JFQL 5GISL 5ADOL 5HI3D 4DCQB 3VXQB 2F54D 2F74A 3IXAA 1INEH 3WFEH 3P11L 2FSEA 4MD4B 1CD0A 2CIIA 3WBDA 5IESL 4PTTA 4OV6F 3V5HB 5ESVB 5A16A 5TE7L 2EYTA 1RZGA 5EUOF 2DJSA 3O2VH 1SJEA 4OCYH 5EO0B 1IJ9A 3CU7A 5F1IA 3VI4F 4JZOA 1JGEB 3B43A 3QO0A 4K3DL 3RUGA 2CMRH 4P4KB 3MGTA 3NMEA 5EBMB 5EU5A 2DLIA 3TM6A 2AJZB 4UNUA 1C5CL 3CC5B 2VITB 1MVUB 2X9XA 2OTPA 4IMLA 1MRCH 3UBXG 2BNUB 3KPPA 8FABA 3LS5L 4LDLB 3UPRA 2YD5A 3QIBA 1N3NB 2XFXB 2BX5A 5JW5A 1QHPA 3TJHC 1EHAA 3V7AG 1QPPA 5IROC 3RGVA 2VR5A 3B9DA 4HSQA 5I1CL 4X4YA 4BSJA 3CIQA 3VXOA 2AJUH 2YZ1A 3NZHL 3NTCH 3O2DL 5D72L 3QUKA 3TIEB 4JM4L 3TP4A 2VABA 3GMLA 3HTLX 3FQNB 3NN8A 2WZPD 2DQEH 1G7HA 3BN9C 3DX7A 2WQ8A 4OF7A 2OZ4L 1J8HA 4OGAC 3S36X 1N5AA 3ROOB 3B9EA 2N1KA 3GMPB 4ZUUB 1JF5A 3RWCB 1MCPL 1XT5A 5F96L 4P2QD 3S88L 5DI8B 2OJEB 3NN8B 3V5HA 5FYLH 4OCSL 1I8IA 4KC3B 1DQQB 5EWIL 1NCTA 4R7DB 4I9WD 3KAAA 3KPPB 4PD4K 3GMNA 1LK3L 3MRJA 2HT2D 5D7IE 1LP9A 4PP2B 2OR9H 3ELAT 4R97C 4FTVE 1X5IA 4ZXBB 1FFQA 4UAOB 5C2UB 5EB9A 1F11B 5BZDB 3MX0A 4NKQB 1EHLH 1HIML 2X4OB 4FXKA 4YHIA 3DIFB 1YNKH 1LK2B 2Z91B 1I4FA 1JGLL 3HZVB 3EKCA 4PRIE 2HVKB 2FZ3B 2VE6B 2VQ1A 4P5TD 2VERN 4PJIA 4X98B 4XPAL 5EWIH 3RTQC 4D9QD 1WZ1L 3L1OL 4K94L 1MAJA 1F6AB 5CHNB 3B5HA 4CGTA 1QLEL 3BH9B 5AD0A 5I71C 4P46D 5IROA 4D0DB 1SHMA 3QO1A 5ETUA 2UZXB 4Q9BA 3HC0A 5FCUH 2AJSH 1NFDA 1FFOA 2NY1D 3OXSB 3IAPA 4GBXC 5GJSL 5GIRA 1G7IA 4PIRF 3MRRB 4XH2B 1RJYA 4ZS6D 5DHYB 1INQB 4ALAH 4UV4L 4UT6L 4TUKH 4LCWE 4PB9H 3H7LA 3QWQB 4KQ3H 1KV3A 4O2CB 2W38A 4YK4C 5I1AB 2GJ6A 3TJEH 4NKDA 4FN0A 4IRSA 3BXNA 4ODHL 3V7MA 4F2MB 1OAUL 1YMHB 4QT5B 2I9LB 3W11C 4WI8A 1RY7B 3FN0L 4FQJL 4HUUA 5D6DC 2GTZB 2M8XA 3CDFA 5T3ZD 1ZS8B 2G2RB 3LPGA 3GI9H 3OGOE 5HDLA 5ITFB 5DYOB 4XXDB 4Y19D 2XOTA 3E6HB 2ID5A 3LPFA 1LHZA 2YS4A 2IPKA 5LGKA 2VC2L 4NIKB 4RBPH 3UPCA 3T04D 3ARZA 5KN5A 3BIBX 3BZDA 3KXFD 5JOFA 1AIFB 1CT8B 1RK0A 3BIKA 4DUWA 5LQBH 1J05A 4E9LA 4HW6A 1DEEA 3Q3GA 2FX8H 4YGVA 2DQCL 2ZCKL 3MJ7A 4G5ZH 2QLVB 2QQQA 4J6RH 5T1MA 3SDCA 2R69L 2IPUK 3PWJA 1J88A 2NY2D 1A4JB 4TVPD 4I3SL 2H45A 1MCRA 2EIBA 2D31B 4D9LH 4PUBL 3ZSSA 3O11A 3OG6B 3WL9B 1F2XK 2YXMA 3MRKB 1D5IL 1FZKB 1KN2L 3AM8C 1R5WA 3GBML 1XCQB 3RVWC 3K8MA 1A4JA 1HQRB 4LSSL 2OMBA 1ZA3A 5C0FA 4O5LH 5TQ0L 2ICEA 3WIHH 1PZUB 3DJ9A 1R3JA 3OTTA 1CWVA 2BNQE 2JKXA 5HPOA 1G7LB 3S7GA 1VGEL 1M7XA 2R69H 1B90A 2OX5A 2X4SB 1JGEA 3Q5YA 5GGQL 4HMEA 1W0YT 4PRDB 1RUQL 2GK0B 3Q2CA 4YR6A 5FO7A 3EIFA 2QR0A 4JZNA 1NGWA 1S9WA 4G8IA 4ZUWA 3FQXA 2CXKA 5FUOH 4P3CL 4EI5A 2OZ4A 3T1WA 2E6JA 3VI3E 5I16A 3REVB 4MB3A 1ZLWH 4NCDA 6FABH 1Q9LB 1BAFH 1MH5A 4L4TE 3GSOA 2OS7A 1AGBA 4J2XA 3F58H 2F8OA 7CGTA 5D1QC 1QBLL 5DQDH 4Z95L 2FATH 2EE2A 3BT2H 4HDIB 1A7RL 4OAWA 1BBJB 4TULL 5CJXC 4PJ8C 2NXYD 3RZCA 4MNQB 3UTQB 1YZZA 1HWHB 1IQWL 1JHKL 1YDPB 4IDJL 5T1DH 1B0GB 1UWXK 5HVGB 3HKFA 3QNYA 1JJUA 5HXMA 3OKMB 2IGFL 3GMQA 2F58L 1BVZA 4KDTC 1IKFH 1S7XB 5I30H 3JV6A 5MERA 1HXMB 3MNVA 2X9YA 4DW2L 5F1IB 1X5LA 2GQHA 4JZNB 2R29L 2AERT 1F6AA 3OKEA 4HXAH 4K8RD 5D7IB 1H5BC 3E3QC 3V6OC 1R3KA 4L3EE 4OGAD 1I85A 3QFJB 2RJMA 5JHLH 4M7KH 4ZUTB 5B38B 4YAQA 5DDHA 5JPMA 4GRMB 2F5AH 3AC0A 3CSBA 5DVKA 4MLSA 1ZT4B 1ZLVK 5JA8B 4PJXF 5HYSB 5C0CE 5CKAA 3ARGB 3O41B 3S35L 5EIVA 4G6AC 1ONQB 2XFXA 3DYMA 3U46B 4NQEB 3UO1L 5INCB 3HZKA 1QFUH 5I1EL 1IZKA 1CICC 4XVUC 4X5XB 3IKCA 4G9FE 2D03H 3BYYA 2XRAH 4NT6A 5MEPA 5HI5D 3S3PA 1DQMH 3KLDA 4YDIL 1ACYL 1Z2KA 4GQ9H 5EZJA 1CGSH 1FRGH 2B4CC 4PJ9C 4ODVH 2XIDA 2BOCB 4MXWL 2UWEB 4P2QB 3WKMH 4EEEA 1RU9L 4LHUG 4FFVD 3B9KD 4Z0BH 3QHFH 4OB5L 2MMXA 1I8MA 5IM7B 1EEYB 1RURL 4ZFZB 4HS6B 3MRDA 4QHUA 3QIUA 1M7DA 4HKXB 3VDCA 1FQ9C 1NAKL 1YC7A 3B6SB 1RZJC 3ULVF 4IRZH 1FSKC 5FYLL 1L0YA 2R4RL 4JVUA 2ATPA 3UTSD 1T3FB 3OGCA 5JORA 4MD0B 2DM3A 5F1OB 2VLJE 3VWJD 1FFRA 3LRSA 1PSKL 4HBCL 1A3QA 1FNEB 3QG6B 4HIJB 3LQZA 5FM4A 5DT1H 1UZ6F 1GGBH 1IAOB 1LO2L 1OAKH 4QHLA 5GQBA 4WW1B 3CLEL 1KLGB 2E9BA 2ESVB 4M7JL 2O5XH 3D2UD 1GHFH 3FO2B 3QUML 3FAXA 3K74B 5T1LB 1AQDA 5C0EB 3DUSB 4OUOA 1P6FA 1JGLH 3V4UH 1X5XA 3VFGH 5D7LD 1TTUA 4U6XA 1CDGA 1N2RA 5BZWB 3W9DB 5DEZA 3RDTA 1EZVY 1U8QA 4IHOA 1T7XA 4PY7B 5IG7A 2R15A 3BW9B 4CVZA 4LCUB 3WUWG 1PSKH 4UT9H 4XAWH 5J13B 1NC4D 3O3UN 1QRKA 4N0UA 1D9KD 1HYSC 2GFBB 3MJGX 5DJ2A 4JZJA 5FEBA 1GZQA 5C0IA 1ZHKA 1V3LA 1AO7B 4DGVH 4LVNB 2CLRA 1LE5A 2AK4A 2D7OA 5ADOH 5T3ZE 4I0PA 3RIAK 4N0YH 1FP5A 1K4CA 4UV7H 3ZZ1A 4ZAKC 5FA3A 1EPFA 1P84J 4K2UL 3MFFB 4Y5YB 5L2KD 4P2YA 5IBTH 1UVQA 3G6JA 4KQ3L 4NWUH 1A1NA 1ACYH 1UG9A 5ECJE 5ID1B 4ODXA 1H3UA 1CF8H 4NWTH 1I8KB 1UEYA 2V17L 4WENB 1FV1A 4RIRA 4PJ7E 4RWYH 4DQOH 2FJGA 4EKXA 5D6CA 1C16A 3JTSA 5L7XH 4RRPA 1WICA 4FFVC 3N0PB 1EAPA 1TZIB 1TDQA 5GGUB 4LASL 4P4RB 2ZOLB 4J1UA 5E00B 2NZ9C 1X5KA 1JRHH 4DN3H 2HN7B 4ONHA 4JFDE 1F4XL 2W0KA 1QRNA 1FO0H 4NQXA 1FGNH 5LCVH 3MV8B 3MRFB 3DURA 3VA6A 1GCFA 3MRLB 2R0KL 1IARB 3NCYS 4KJWC 4ETYA 5AUMA 4JFFD 3VGEA 4J4PD 4XNMB 1K4DA 1CE1H 3FQTA 4EVNB 3QAZC 4QXGH 1OM3L 4PB0L 5BV7H 4GUPA 3MRQB 4WEUD 1HE7A 4G3YH 4H26A 3O9WB 5E08L 3P4NB 1XZ0A 3W2DH 3S98A 3BHBB 4PGEB 1KPRA 3UYPA 1BWMA 3ULUL 3BPCA 1XF5B 4WHDA 4K8RC 4YK4B 5HHOE 1F3RB 3GMMB 2Q6WA 1E6OL 4OKDA 1NCAH 1T2XA 1ACZA 3V9FA 2EE3A 3JTTA 3A6BH 4PGJA 4D94A 1MCBA 4QY8A 4NZTL 2BDNL 3MTRA 2ZNWA 1V5JA 1BFTA 3DMMC 5JHDB 1GGTA 3MO1A 4LFHG 3ARYA 2MNUA 2EIZA 4XNMA 3BPOC 3U6RB 4XPBL 1GVIA 3VXSE 3JWNC 4JPVH 1U92A 2F54E 1R6VA 5FECB 5D1ZD 3NH7L 1HINH 3WJLC 5ABDE 4HUVA 4QRTB 1G7MA 1T6VN 3KLSA 1KB9K 4L29B 2VDOL 2DIAA 3V2AR 1FVDB 2FIKB 5IV2A 3WS3B 4U31A 4X7FC 1NGPL 5F93C 3RVXD 5BV7C 1WTLA 1A7RH 4R4BB 1U95B 5EOCL 5I1KH 1E4XI 3MJ9A 4ZTOH 2QQLL 3EHBD 3AREA 5D8JL 1SEQL 1SQ2N 3B8SA 2CD0A 2XG5A 3CXHJ 4OKVA 4UNTA 5C9JA 2H2PC 1BX2A 1JHTB 3C08L 4H26B 3V0AC 1U41A 1WTGT 4OZIB 4GOSA 4K3EH 4LU5H 1XGPA 3HG1D 5TDPA 2A77H 1TXKA 1D9KB 3IDUA 1N6QH 4JPIB 2YRZA 1H3TA 1YJDL 4PJ9A 3QXDB 3BO8B 3VGBA 2BSTA 1FNLA 3BIAX 3MYJB 3FT3B 3LEVL 2NW3A 4WY7L 2KPNA 1YN7B 3V6OA 5IIEA 5DJ2B 4X9FA 2DN7A 3FO1A 3QYCA 4JO4L 1AR1C 4NHUB 4N0UB 5E8EA 3K8KA 4ZFGL 1RAMA 5A3ID 1B0RB 4G9FD 3G5XA 3QQ9C 3DVNA 3TYFB 4QRRA 2H9GB 1HK6A 2XZQH 4Q74A 3ZHKA 1S7VA 4ZUVA 3T2NH 2X4NB 5I8CA 1H9VA 5AAWA 1QBBA 5KVGH 1OF2A 2Y6SC 2ZUYA 5IVXB 1NGQL 2M1KA 5H2BB 3SDAC 1SM3H 1Z5LA 1AQDB 1G6RB 4KKCC 5KJRH 1DUYB 4XAKD 5D70H 1CDUA 1CGSL 1FRGL 4GMTH 5D5ME 3TF7C 3O3BA 9CGTA 5ICXA 5ALCL 2R23A 3T3ME 1EXUA 2AV1A 5SWZA 4PJ7F 1HI6A 1KF9B 2EDTA 3V52H 5E9DB 1S9VA 2QADD 4LEXH 2MKWA 1AXSB 2ATPB 1ZLWK 4U0RB 1XGQB 4ZODA 4MNHB 5KVGL 5E9DD 1XF4A 4NJ9H 4H88H 3GKZA 4MQ7B 3KPRB 2EC9U 3ESVF 2VIRB 4H5SA 1QFOA 3BUYB 1L6XA 3L9RB 2OL3L 1IAKA 2CDFA 4AIXA 4OZFH 3ZDYE 4R0LA 5J8OA 1ZE3C 4U6HB 3ARGC 5D7LB 1Z5LB 4XB8A 5CEZE 4Y1AB 2MTPA 4UQ2B 1YNTB 4S10A 3AXLB 3WXVL 1KPRB 5SV3A 4P5MB 2A9ML 5B21A 2X4NA 4F7TA 5I8CB 5HDBE 3K2MC 4GW1B 3BEVA 1BAFL 2PKDA 1DR9A 4N0RA 4OJFH 4MJ6A 4AEFA 5EBWA 3TZVC 5J1AB 1ONQA 5LKNA 2XV6B 4PJFA 1KIPA 3H7BB 3X14B 3QSKB 5DMKB 4JANA 3FZUD 1BIIB 2H8PB 2P5WB 4RGND 1MCCA 5F9AC 3VXPB 5BVJA 5DDHB 4F7MB 5JPMB 3KPLB 4KK8C 1RSFA 4OBRA 1XGQA 1TCMA 5CINH 4BA8A 5IR1A 3RHWK 3L7FA 1H8OA 1UZ6E 4WJ5B 4KAQH 5CBAA 3AM8A 1KELH 4Y4KA 2V7HB 2R9HC 3IDIB 1IEAA 1IKNC 4YIQA 3LN5B 4K55A 5JR1L 1RHFA 3NIDE 3QXAA 2NR6C 5K9QG 1INEL 2IC2A 1UM6H 5D70L 4L5FL 3DTXA 5LBSH 3FN0H 3WD5L 3P4MA 3JWOC 1FGVH 2PN5A 5DA4A 4JDVA 4GO6B 5DURD 6FABL 2A6IB 4PLOB 3PL6D 5ALCH 2X89A 1E27A 4KVCL 2MPAL 3TJHD 2I27N 4JR9L 4KKNA 4M8VA 1XZ0B 4HKBB 2Q1EA 3VXSB 5J12B 5IBUB 1CE6B 1JNNH 1V3MA 4DTGL 1F3JB 3C8HA 1P7KA 3MZGB 3BFOA 4U1KA 4U1GC 3WFHA 4ONFL 1FVDA 3GKWH 1LEGA 3UMTA 3S35H 2DM2A 4H1LG 1F4XH 4JG1L 4PJAB 3FO1B 5JR1H 4UQ3B 3U2SA 1BOGB 3RL2B 1TVHA 4NRZB 3OJDA 4I0PB 4XPTL 2ORBL 2ZZUT 5H8DA 3QNXB 1OPGH 4IMKC 5JXAH 5JO5B 5ESAA 3ARBB 3HUJA 2D9QB 3MYJA 4I3SH 1IGYA 3EO1B 3TBWB 4LLVB 3DMMA 2E8ZA 3EO0B 4ZUWB 3UBXB 4PJAA 5JMRA 3NCJH 4KHTH 4UOW0 5HDQH 4YHOH 4BUGA 1D5IH 1KN2H 2NNAA 3EGSA 4G43A 1HKFA 2GJJA 1J18A 5TDPB 1VACB 2FCBA 4TSAH 3DV4B 3V0VA 3QCVL 3GMOB 1X5HA 1I9IL 4OZHB 4YHPB 3ULVH 5FA4A 1NFDE 3JUZA 1MRCL 1MHHB 4F33B 3L3OB 3PWLA 1VADA 3INUH 1U8HB 4OZGA 2GSGA 1WFNA 3G5YA 1AD0B 5CSZA 3B8YA 1AQKL 3LB6D 4C56A 2ORBH 4YFLI 4GAGH 1TTFA 3FO2A 4KXZI 1TZHA 3EYVA 3BWUC 3U4AA 1D6VL 4NN6C 1FLTX 1UKTA 1GPOL 4KK5D 3WE6A 2Q8BH 5D72H 1VSCA 5IHUH 4KTYA 1MAML 3ULVD 1FNEA 5HHMB 4FMFA 2ITDB 3D3VD 4Q58C 1MHCB 5MI0C 2V2XA 1A6ZB 1UB6B 3L9RA 5CP7A 4MXVE 4OGYL 1OAYL 4JREB 2NY6C 3IFPB 3VFGL 1KIRB 3PWVB 5DQJA 2B0SH 1HI6B 1B6UA 3IJSB 1VESA 1BZ9B 2LAGB 3IXTB 2CO6B 3GRWH 4G42A 2WLYA 5DEGB 3GJEB 3KYKL 2GJ6D 5E9DA 4L4VD 1ZA3B 3RTQD 4RDQF 1QFHA 4LHUB 4OF0A 4U1JB 4J23A 1WAAF 2OCFD 1GXEA 2HJLB 4V1DD 3EOTL 5IHZB 1Z3GH 3RBGA 4PJHA 3MOAH 3MLYL 5ADPL 4NO2B 1QSFA 1RUAH 4R96A 4MAYA 4WUUB 2R0WL 4L8SB 4Z7VF 4NQDE 5DMYA 5DC4B 3Q6FB 4D8PB 5CJQH 1G9MC 4M7LL 1QFWL 5CUSH 4PV8A 3DX9A 2GUOA 4XCCH 1FZMA 5CZVH 4M93B 1U3HB 1TQCC 3O6FC 4Z0XB 3AS3A 1RZ8A 4TSAL 4OTXL 1BWWA 4GAYA 5EBLA 5IIEB 4OZIF 1IQDA 2I5YH 4Z8FL 1IFHL 3I6LE 2JK5A 5D7IA 4KI1A 5B3JF 4XMPL 2ZCLH 3O45A 5CHNA 1A2YB 2A83B 4I18C 5D5MF 5DJYA 4EI6A 4LPCA 3MLYH 4HZLA 1ZWIB 4RISL 2CGRL 1KNOB 3TBYA 3QG7L 3RWJB 3KPQB 4JFZL 5TJWK 4M6OH 4LCYB 4MAYB 1RUKL 3LSOA 1KCVH 3BE1L 4GMSH 3CX2A 4K71C 3EBAA 3FFCA 5E8NB 3QHFL 4B53A 4GRWH 3UZEA 5B3JE 4Z7VA 4RWYL 2X9WA 2AAVA 4YGAB 4HMCA 4D0CB 3ARDD 2O5ZH 5EORL 4JHZA 1QSEA 2ADFL 4OZIE 2EDRA 2Y9RT 2H2SD 4AEHH 4Q2ZB 1OD9A 5DT1L 3CU1A 1I3UA 1HEZA 1U93A 4ZQKA 1U6AH 3R06B 3SGEH 2I07A 3RU8L 3HPJB 4C4KO 3MRNA 4LGPB 2GJZB 4OD3H 2APWA 5I15H 3FQRB 2PYFA 4OF3A 4LOUD 4GMSL 1N64L 1FO0B 1FORL 1IL1B 5GRWA 1SVCP 4FQCL 3KYOA 2VR4A 1N2RB 3PV7A 1NUDA 1AI1L 2J2ZA 4QHKJ 5EZJB 2P48B 1HSAA 2A1WH 3SE8L 2DQGL 1RJCA 1AI1H 4GRLC 5CMAB 3ZSTA 5DD3L 2NXYC 3D0VA 4JLRB 5I19H 3D87B 2X1OA 4JFYA 4N90D 4ZS6C 4A6YB 4XVTL 1ZA6B 1WIPA 5GRYA 1DN0A 3OJVC 3TO4B 1CF8L 1EEQA 4NWTL 5MEQB 4Y16A 3C09B 2E7CA 4U1SA 5E1AB 1MCOH 3PF2A 3WIHL 4ZDHB 1KJVA 4Y4HB 1E6JL 1WFTA 4HEPG 4PY8J 5EU5B 1ERNA 1I3GL 2MOVA 3WN5B 4K3JH 2NY0D 1BFOB 4GLRI 2FEEI 3QEQB 2YXFA 3FOMB 5IBTL 3SE8H 3TCLB 1RIUH 5B39A 1FDLL 4LLQB 5HJ3A 4JFZH 4MXQC 5KN5B 2UVFA 4OIAA 4XPBH 5LJYH 4MS8C 1YEGH 1J5OH 2ZP0T 5GSRB 5TE6H 5D2LE 3FZUC 2AXHA 1HEZB 1U93B 1OGAA 3B2UD 2ED9A 1D5ZB 3RPKA 1M05A 4KUCD 1QYGL 1ROWA 1JNHB 1KFAH 3DRTB 4WU5B 5D1XD 3SBWC 4DCQA 4DW2H 3U0PA 1A5FH 3ZKQD 2OL3A 2R29H 3RWIA 5JW5B 3MV11 5E6ZA 4O2EA 2FDBP 3J8F7 1BBJA 4NYLB 3KGRA 3D3VE 4PP1D 2Y5TB 1S5IH 5BXFA 3OXRA 4G3YL 5D6CB 2EE6A 4JQVC 5C0AE 2DBLH 4PRIB 5F7DB 3CMGA 3SKNB 3VW3L 1K4DB 1F5WA 3PWPE 4KKBD 4JG1H 4YEFA 4NQDA 4S1DD 4HLJA 4TOYH 5CJOL 4NPYB 1N5YL 5DO2D 1NBQA 4P9HL 3LVEA 2HLAA 5J6GB 4APQB 2DQIL 1JGUH 3IDIA 1EHXA 4KJPD 4OCWH 1OW0A 1OLLA 2VDMH 1EH9A 1NANH 4PJXE 3DXAD 4DEPB 2ZNXA 1Q1JH 2P5WE 3ALXA 1XF3B 5DVLA 3J7HA 3WNOA 4JGUA 4RMQA 1B6DA 3SJVA 1JNLH 4J12A 4PLJC 3WFZA 1FG2A 2DBJA 4I4WA 1OLZA 4FXGB 5AWNL 1EAPB 2VMFA 3OKDA 1QPXA 5F3HB 4KKBC 2HH0H 3SKMB 2FJGB 2WNGA 4OB5H 4XPGL 3W0WE 5ACZB 5GGRA 3RX7A 2E9IA 5EBWB 3CPLA 3ISWA 1EMTL 3BEVB 4DKFH 2FD6L 2HAZA 5TF1L 1Y6NR 1AKJA 3HRZA 3RDTD 4JFHD 1F11A 4NCC2 5IEHA 5IGXH 1FLRH 4HS8L 4YDLB 1DQML 2OL3B 2QQLH 4JKMA 4GS7C 3T2PA 3C8DA 1NDMB 4ZOAA 4I2XB 5SWSA 3NACL 1JWMA 3QZWB 4CN1A 3GMNB 2FHFA 3DWTA 4DZBB 1V3KA 4OD2B 2B4CL 3ZL4L 3PJSB 3NACH 1T5XB 1FIGL 1N7ML 4YHKH 3T3PE 3DRQA 1MCFA 4HKXA 1VERA 3QO1B 5ETUB 4F9PA 1YJDH 2GK0A 4YR6B 2MSPA 4MD0A 4AIZB 1A6VL 1F90H 4NUJB 3RNKB 3DARA 3VI3F 4NFBA 5CP3H 4QKXB 3IETB 4D9RD 1BEYL 4YDVB 2DQDH 2ZKHH 4YLQT 2D9CA 4XNZC 4MWFB 3WFDH 1FJ1A 4G8GA 1MELA 4B41A 4U1SB 5E1AA 3ET9F 4L3AA 1GJIA 2VQTA 1QSFB 2AEPL 3SBWA 4BSVB 2BHZA 4X83A 2FECL 1BQLL 5L2KB 4YH6A 4G8GB 4M7LH 3CC5A 2C3VB 5F3BA 4KKAD 3NFNA 4CN6A 1SYVA 5FYJE 3LKSA 5F9OL 5CJXA 4K23L 4YHPA 1NMAH 5K9JL 1G0XA 3AROA 2DQDL 2ZKHL 1IL1A 1NGYB 3CXDH 3EGSB 1F58L 4G43B 4LNVA 1OAXL 3ULSA 5JA9A 1YEDA 5ELIA 3RGHA 4EOWH 4YDKL 4JFFE 1BFVH 4XWGH 1N6UA 5JLZB 3CH1B 4M7ZC 1RJLA 4OCXH 3O6LH 1JMZA 1SEBB 1UB5B 2JJWA 5DJCB 3PGFH 3OKMA 5MEPB 3IJYA 1C12A 3ARFB 2QADC 5ESQB 4MA8L 3G6JF 5LG1A 3CLFH 5DHVB 4K9EH 3FB7A 4HCRA 1VFBB 3MRBB 4P2OD 1LO3L 3U7AA 4PJDF 4HF5H 5HYJA 2J4WH 3SDCC 3BWAA 3MNWB 1SYVB 4JHWL 3RWIB 3D18A 5CSZB 1JGDA 3OX8A 4EN3D 1EJOL 4PUBH 3S5LG 3PE9A 4H0HB 3ZLQC 4BK4A 5DRXB 4F37F 1TETL 1U95A 4OZ4B 5L6YH 3BWAB 4O2EB 4XAKE 4NNYA 4AEHL 3SY0A 5EOCJ 5C6TH 3AAZB 1YECH 3SE9H 5JXEA 1KLFA 1FFNB 4PRAA 4BZ1L 2EDFA 4DFHA 4OLVL 5FYKL 1MFCH 3IFNL 3DVIA 2RFXA 1NMCC 3RWDB 3OF6A 5GGQH 1Z9OA 1MFEH 1MCKA 2YPKA 4HK3N 4XMLH 3GZKA 4U0QB 2DLEA 3D3VB 1WZKA 5CD3B 4I5BB 4MS8D 2VH5L 3MRIB 4PJBB 4XP1L 1B0GA 1OGTB 3NCEB 2CR3A 1OTTD 1PG7X 1L0QA 4JM4H 4S1QH 5DD5H 4MJIB 5D1ZB 1F13A 5T1LD 3DO7B 4HWNA 2YA0A 3MLSH 2DYPB 1IC7L 4S1QL 3H9ZA 4PBWD 3QUYB 2R2BB 3GIZH 3D25B 5B39G 3O2DA 4MJID 4GBXA 2FBOJ 4GJTB 1CGVA 4M3JA 5IP4A 5C0NC 1XF2B 4PJXB 5DFWH 4PJGA 2RB8A 1MH5B 3S8WA 2JB5L 4POYA 3SE4A 3VFVB 4L8CB 3FB5B 1XEDA 4Y5VA 5ILTL 3PDOB 2GTWB 1LK3H 3O4LB 4U3XA 4IDJH 3IS0X 5GGRB 2R4SL 4POZC 1C08B 4N8VA 4TUJA 4C59B 3ZO0A 3K80A 2PO6B 1JPTH 2F58H 3SKOA 1MCNA 4LNRA 3ROLB 3HMXL 3W0WB 1J8HB 3PWUA 3LKPA 3HE6C 1JGVL 1CFTA 5I73C 3QJFA 1NLBL 4ZTPH 1IMHC 3ZHLA 5ITFA 4NUJA 2EDLA 4KK9D 5HHOA 1CS6A 3PJSA 5I1DA 4HWZB 2IBZY 2XA8L 1WF5A 4P59L 5DGQA 2YPVH 1TITA 2R1XA 4HH9B 5C0BA 1NCWL 1J0HA 4GRWB 1P69B 4GRLB 1JFQH 3EDKA 4FQHA 3ULVL 4Z7NF 2ICWI 4ZNEE 3PHQB 1U8NB 2DICA 5CCKL 5IUSA 1YECL 4W4OA 5IEHB 5I1CH 5E2TH 1Z9LA 4NKIH 3LIZL 4KRPB 4QF1B 3K46A 2B2XH 4BFGA 1L7TH 1D7FA 1U0QA 1ZWIA 3BZFA 4TVSa 2IFFH 3V0VB 2IH3A 1ZEAL 1A22B 3L7EB 3N50A 4LSQH 1FZJB 1G6RL 2DQUH 4P46A 5EIIA 4ELKB 5I1DB 3FTGA 4X4XA 3EO9H 5DWUL 3ZMRA 4FXGA 1YYLH 1RZKL 1QG3A 4XZUA 4NGHL 3W5NA 5C0DB 2DLFH 3VXRB 4CUCA 3MBEA 5F8RC 3VI4E 5JQHC 5JNYA 1TNNA 2XWBB 3FT3A 3KPOB 3RUGE 1J87A 2HG5B 2OSLB 3GI9L 4O51B 4HUUB 2D4DA 3MCLH 1IC4L 1DCLA 4YNYB 5IT2L 3UTOA 2BNRB 3BXNB 1I9RL 4PJIB 5FKPA 1K8DB 4L3CA 3AB0B 4I77L 2C7UB 4NRYA 4Z7WB 1BQHA 4RX4D 2HFGL 4PJCF 3RVXC 4XT1C 4LHJB 5GZND 1IBGH 2B1HL 4U1LA 5IB1A 2HT3D 1KCVL 4PV9B 3EJZC 1IGFL 5F89A 3MV7D 1WCBA 4QHLB 3SDXA 3CSYA 5KVDH 3GUTB 4G42B 1IGIL 3FL7A 4KVNL 4U0RC 5T3XD 4X6DA 2OJEA 3FONA 4KKAC 1MPAL 1VB9A 1GOFA 1SYSA 4ORGB 4KVNH 3C5JA 4E41E 3MRIA 4PJBA 1E28A 4RQQB 5JTWA 4NZDA 3O6FB 4F8QA 2P1YA 1ZOXA 2VDRH 1OAZH 3D39B 5IJVA 1K9TA 4YHML 1OP3K 2RFXB 4UT9L 5IB2B 5BS0B 4F37K 4BQ9A 4U1IA 4Z5RB 3TWCH 1KSRA 1J12A 4EDXA 4W70A 4K8RH 4HKJB 4WTXA 3QEQA 3PG2A 3DECA 3C8KB 3BISA 3KYMA 2X7LA 1E4JA 4RA3A 2J8UB 3R8BB 1U58A 3QCUL 3RWEA 2Z0BA 3VFVA 3C6LC 4HIIA 3DPBA 1S7SA 4XBGB 3OB0K 5BW7A 1T80A 3O4OC 3RVTD 3U36B 2BSED 1U8IA 4E41A 4Y5XB 5F97E 3GSWB 4FA8A 5D1QD 3KJ4C 4KZDL 4EUPG 2ATKB 5KSBB 1QOKA 4Z7OF 4P9HC 3CPLB 3H3PL 1AD0A 3GNMH 4MJIA 4KZDH 1U3HC 4UMGA 4F7PA 1OTSC 3PV6A 1L7IL 3S37L 3BGFB 3D3VA 5T3XH 3UX9B 4I4WB 1T2QL 4PG2A 1S5HA 2BCKB 2WUBH 4JN2A 4Y16C 3MREB 3QO0B 4P48A 2VLKA 3LKOA 3MRFA 4H8WC 4X6DF 4JPKH 3ARGD 3WXWL 1MHEB 4X9GA 1RUML 4XCEA 3QQ4A 1H0DB 3WSQL 2VLJD 3UJTL 4L5FH 3LEXB 3TVMB 1HXMA 1JIBA 4KMLB 1NFIB 1W2KT 3ARUA 2YRPA 2X4PB 3T65B 2PXYB 4LF3B 3DOSA 3ZE2E 8FABB 3PL6C 5J12C 4HKBA 4OQTA 3R8QA 1QQDB 4TPRH 4YXKL 2BOBA 1JZ5A 5I17B 1MI5A 2DLHA 4G6FB 1AFVL 1HILA 5E56A 4JQIH 1IGTA 1ZSDA 4OGXH 1FYHB 5HHXL 1J1OL 5DD3H 2N7AA 3WLWC 4NO2A 5IKCA 1K8IB 4F7CA 3GDBA 1PQZA 3MV7A 3AUVA 4GUPB 5I15L 5FUCC 4RDQG 1ZXQA 3VD4A 5DA0B 2HJLA 4XPGH 3WEXB 4QRRB 4EI6B 4UU9A 3S34H 1UADC 4Q9QL 2NY0C 2HFEB 3VJ6B 3M8OH 1SEBA 1UB5A 4KRPC 3EO1A 3GJFK 3IRZA 3CFBA 1F4YH 4QNPF 4TRPL 4HZLB 5HVFB 3OQ3B 3QNXA 4YHOL 3UC0L 4GKOA 2X70A 4CJ1A 4P5TB 1E4XL 25C8L 4NRZA 3BDYH 2AGJL 4JFEB 3ARTA 3C6LD 4K7PL 3IDYB 1BHGA 3LQAC 4QTIH 3MOQA 3TN0D 3F58L 2Q87A 5IMKB 3VU2A 1BGXH 3O8XA 5J1AA 4JM2B 5DR5H 3C60D 2FJFA 3CFJA 2YPLB 4LMQE 4QRUA 5F88A 5C9JB 1VGKA 2BHYA 5JW4Q 4K7PY 4ZO6A 5DJDA 2DI9A 3ZKND 1V3JA 1YMME 5MEOB 4LIQH 5L8LB 3VXRE 4RMRA 4LIQL 2ERJB 5GS2H 5EFIB 2A73B 3QIUD 1BGXL 4JQXC 1EDQA 3I6LD 3DLQR 4P46C 1OAYH 1FIGH 5AAMA 5FGSA 5CP7B 4P9HH 1IC1A 1BREA 4JO1L 2FO1A 2SEBB 2XQYG 3KPRE 2DDQH 1MEXH 3QIUB 4RMWA 1JE6A 2A73A 4M62L 2BERA 4FQLH 1XF4B 2XA8H 4FQXB 4ZFOB 3E6HA 1HYRC 4L9DA 3P73A 1X5ZA 1XGUA 1P4LB 1DFBH 2JJTC 1U8QB 3EZ8A 3GSUB 3NA9H 2XKNB 3MGOB 3ZDXE 4ELMA 1NC2D 3PHSA 3VW3H 1ZT1A 3VXUB 1FNSH 1Z3GL 5CIPH 3L3JA 2HH0L 4HUNB 2CUMA 1FNSL 3MLRL 5C0JB 4YPGA 4RMVA 3U4EB 1CDJA 1AKJB 2ZCLL 3C60B 4KROC 4LBEB 1G6RA 1UXSB 1A6WH 5GRXG 1B2WL 4MAYD 3TT3L 3WJJC 1FH5L 4FQLL 1VCAA 3LQZB 2Q3AA 5F3HA 4K3HA 5CZXD 3DRTA 4XNUL 3NZ8B 4OBSA 2YUVA 2APXA 3H2WA 2VOTA 1DQLL 3QEHA 4I5BA 5EG6C 3T0XA 4KZEL 3CFCL 3GI8H 1J0YA 4ZUTA 1Y18B 3V6ZA 4DVBA 1JI1A 3QQ9D 5J11C 4IRZL 1XF3A 2XI9A 2XZAL 3SE4C 1MHEA 2AV1B 4BFIA 5CBAB 5IB5B 5IQ9B 3QDHA 5GSVA 3FAWA 1DDHA 4MAYC 4PBXA 2J5LC 1FH5H 2GKIA 2IQAA 3RL2A 4JRYB 3QISA 1QBAA 2WBJA 3U83A 4B0MM 3RPIA 5FOBB 4MA1C 4XNUH 3H9YA 4X7DC 1FAIH 5GS1A 3V6FB 3P0VL 3HHRB 1XGRA 1WFOA 3U9PH 1AJ7L 1JTTA 4FQCH 1GGIL 4MGXA 2W9LA 4XWOC 2X44D 5B8CB 4LCWB 4CJ0A 3MSPA 2X1WL 1F8TH 4U1NA 1MLCB 1E4KC 5I1JL 2AEQL 2QKIA 1TZGH 1RZJL 4PJIF 2YOCA 3LKRB 3KPLA 5IQ9A 4NQVA 1K3ZA 1U9KA 1A0QL 4JFDA 4ZSOB 2Z31D 2CH8A 3NPSC 3S35X 2WBWB 4ZQKB 2RR3A 5BMFL 3ZT5A 3NCCB 3E2HC 3LRGA 1ND0A 1A1MB 2YUXA 2GCYA 3ES6B 3EYOA 2QHRL 1QSEB 5KSAC 4DGVL 4EQ2A 3VXSD 4ZD3L 4LQFL 3STZA 2YSSB 5FHBL 4KDWA 4R4NC 1KC5L 3IDGA 5C0RH 1G0DA 3IDJA 5FYLE 3U0WH 3PL6A 1YNLL 3BN3B 4X6DB 5JXEC 5A40E 3WS6A 4PRPB 3TT1H 4Q9RL 3BP5A 1IM9A 1IKNA 1L9MA 1BZQK 4JFXB 4YQXL 4NQUA 1CGWA 5FYKD 5CGMA 1HH9A 2BJMH 5EU4A 3FQTB 1QHOA 1T5WB 4FRWA 4JFEE 4YQXH 1FNAA 4F7EA 4OZHA 4PRHA 2V5RA 4ZPTB 1MNUL 4IRSD 2OTUB 5KG9B 5CSBA 1OB1A 2VL5A 1J05B 1YEKL 4QEGA 4HCRH 3OB8A 2PCPB 5E99L 1IGYB 2JTDA 3LDBC 4R7NB 1UH3A 2VLRB 4WI3A 1RI8A 3P0VH 4AJ0A 2J8UF 3BAEL 5J11B 2BSSB 4ENED 3IDNA 1UC6A 3LAFA 1HCFX 5L6YL 4MJ2A 4R2GD 3IF1A 2AI0H 2YPVL 1MCWM 4JQIL 3I9GH 2DKSA 1JNLL 3VFNA 2OP4L 1E6OH 5DJ0A 4JG0L 1GH7A 1VFOA 5J3HC 3UTTE 4WUUE 3SDCD 3MV7E 5EC2B 1F97A 5FKPB 4NZUL 3TYFA 3W2DL 3TYGL 5IW1A 4NRYB 2OK0L 1LEKB 2DQIH 3NPZB 5E2TL 3AMKA 1C5BH 4NO0B 4Z7NE 1F2QA 4PGCA 5DK3A 4N0FA 4OUUB 4Y19A 5GSVB 1DQJB 4FFZH 1BD2A 4ERSL 3RWGB 2VDKH 1NFIA 1EERB 4MQTB 3ZKSD 2F53D 4G6MH 2JK5B 3BH9A 5AD0B 3VG9C 2W0PA 3RAJL 3NIFE 1RZKH 5KVFL 4CVZB 3MNVB 2XT1B 1XCTA 3K4AA 4TNWF 3UTTA 3ZKMC 4NQSA 2G9HA 2BCKA 4JN2B 2NR6D 3KLHC 3NZ8A 3HZMA 3NABH 4X7SL 4JANB 1X5JA 1A6AB 1T6WA 1YDPA 5BJTA 3DIFA 4U1MA 3FB8A 1W0VA 5ALBL 5FAAA 2Y5TA 1DVFD 2PR4H 3QFJE 2AK1H 1CVSC 5E8DH 5C0JA 2IF7A 2WWKT 2YBRB 5KZCD 3GSWA 4EIZC 1T22A 5E4EB 5CGTA 4HX1B 3UDWC 3V8CA 3X3GL 4BM7A 1KB5L 5J1SC 1CTNA 1G7MB 3O9WA 5FGBC 2GK2A 1R3IH 4JCLA 1UT9A 4ODTL 2ICWJ 2FIKA 4R26H 4QRRE 5D1QB 4X7SH 4XMKH 5D1ZA 2NNAB 2WW8A 3MRCA 3W0WA 3K1KC 4G9FB 2DQUL 1FVEB 1NAMB 4PTUA 4LLQA 3GIVA 3IJHA 2ESVE 4XBEL 2VLKB 5DMGC 1JYNA 5GZOC 5DD1H 2NY5C 5DWUH 5JHDA 3QCTH 4HFUH 4NO5B 5J6HA 3O3AA 1S5HB 2PXYC 1KJMB 4PJ8A 2HLFC 4HPYL 1TVDA 1KENH 3CX5J 4XBEH 1EAJA 4M00A 2EIZB 2UWEE 4Y7MA 5C09E 3LDBB 1JV5A 1W72B 3GHBH 2CGRH 4RFNC 4YHIB 3VRJB 3W39A 3G08A 1CICA 5FO8A 1UA6L 3MUY1 3QA3B 3U46A 1DANT 1N26A 3M17A 5IK3A 4FFZL 4KDVA 4Q0XL 1HILB 3SE3A 3T0DA 4LP4A 5DLMH 4WUKH 3IKCB 4TTDC 1MHHA 1YJDC 3VE0A 3W82A 2HFGH 2BZDA 4JDVB 1EEUA 1A4KA 5CGYC 2RAMA 1KBGH 3OGCB 5JORB 1AD9A 3RFZC 3KS0J 1AO7E 1A7OL 1CIUA 1IAII 5M7QA 5T33L 1JF1A 4YBHA 3VD5A 2O5ZL 1MJJB 2CDGB 2X4QA 1CG9A 2WBKA 4BFIB 4NNXB 1FZOB 3GHBL 5D7KE 3WNLA 4E0RA 4L4VE 3QDGB 4WJ5A 3S36L 1NBZB 4NSKA 5BS0A 4AL8H 1S7QB 5AYUH 4Y4FD 2XY2A 4J6RL 4TNVK 1BOGA 5CLTA 4X5WB 5J1TC 4UU9B 3QUXC 1KLUB 1PKQA 4KRMB 1QKZL 4KUCF 4BQ8A 1QD0A 4KJQC 4F2MA 3VFRB 3QDMD 2GJ6E 5BV7B 4WU7B 3MLUL 3G9VA 1RZKC 2MQCA 4FFYH 4IMLB 5HD8D 5LGHH 4OLUH 1I1AD 3L3GA 5IFJA 1L0XA 2PYEA 5D5MA 4YHMH 5TQ0H 5ENWA 3SKJL 4JB9L 1RMFL 4J3SA 4XB7A 1RZJH 3MGTB 3SEPA 1GZQB 4EI5B 4ZFOA 1Q38A 1KIQA 4LVOC 2VIRA 2DMBA 4HUVB 4GS7B 3VRIB 1WBXB 5CEYA 1XGTA 4D0BA 5C86A 2J88H 2H1PL 1S7XA 5ILTH 1S8DA 2OQJB 5IG7B 3MFGB 1L9NA 4X4XB 4FABL 4RGNB 1I3VA 2XXCB 2VXSL 1ZGLA 5IVXF 5FO7B 4P57A 5F9DC 2D7TH 3PABB 4HPOL 2IMMA 1WK0A 5E70A 5E8OB 2CLVA 4XPFL 3RZCB 5DMIH 4TTGA 3WIFB 1HHIB 1BMGA 3U9UB 2NY5H 4RAVA 3RZWA 5F89B 4ZO7A 3W9EA 4EJ1C 5LBSL 4OLEA 5CEZH 4MJ4A 4MSWB 5GGVY 1OSPL 2F5AL 1IC5L 2WP3T 2WSKA 2C7UA 4YXLL 2BSRA 2R2BA 4HWBL 4YHYB 3WDIA 1R24B 1AGCA 5B4MC 2DBLL 4XI5D 3GJEA 3O8XB 3MCG1 1CLZL 1E0OB 4JFOB 3DO7A 3FQXB 5ACZA 5IFHL 4FQ2H 1F4AA 1ZGLB 3QUZD 4XP6H 3LKQA 2Q76A 1UM4H 6CGTA 4OSUH 3TT3H 1NFDF 5BOPA 5HPMB 4JM2D 5C7XH 4XTRC 4ODBD 1MRDL 3FO9B 3CCHA 1ZHBA 3HAEH 1TFHA 1EFXB 4JY6B 4YO0A 3WNKA 3ROLA 2P5EE 5HHXH 4I18A 1LO4H 5J06A 1ORSB 2HN7A 3QUYC 2ADIB 1CFNA 4J8RA 1CN4A 4UOW1 1HH6B 1Y6KR 3GI8L 4KKLD 4M61B 4M5YL 1BD2E 2BY2A 3FRUA 4MMXC 5EA0H 3VG9B 3VFMB 3PDDA 2NCMA 3DGGB 5DR5L 1UACH 5GS3A 2NTFA 4KMQA 4KQ4H 1JWMB 3QPXH 3QZWA 1QO3A 3PQYE 3KPSD 4R4FL 3FN9A 1UACL 2KZ1B 1OPGL 2EECA 3DYPA 3OAYH 2IBGA 3H3KA 4HC1L 4Y2DB 4R4BA 3TBSB 3BDYL 3QUXA 1MRDH 3GJFB 4GAGL 4MZ3A 3RY6C 4M1CC 4OFYA 4Y1AD 3QXTA 1TNMA 3WKML 3MRBA 1CT8A 1DN2A 1DBML 3BESR 3DV6B 1INQA 2VXSH 5TDOA 3SQBA 4LPTA 1NMBH 5J89A 5CIPA 1DTUA 1RJZA 3H9SB 3UJJH 4RGMB 3TBWA 3MXVL 1DBAH 3O9WC 4M93C 5C71A 3L6FB 3O6FD 4OCSH 3QPQD 5I1GH 2HTKD 4N68A 4OQ1A 5IVXE 2XZAH 2GTZA 1MPAH 2Q7YB 1VFUA 4KTEL 3TCXA 3ZYZA 1A64A 1LD9A 1GPOH 3OXRB 3WN5A 1HSBB 1JHTA 1A7PH 4YUEH 3L5JA 2XN9B 4TVPH 1IBGL 3MXWL 5JIHA 2CIKB 2C3VA 3TA3D 3PXHA 1EHLL 3AREB 4IOFD 3KLHD 1N0XL 3K0WA 4XXCA 5DK0B 3O4LD 4ODSH 2V5YA 1WQVT 5FIEA 1A6TB 4L4VB 4W4NA 3MLRH 2EZ0C 1KLGA 3NGBC 4XVJL 5DJZB 4PRHE 5DQ9B 2W1NA 1WEJL 4U33A 4X6EA 5DJ8B 1Y6MR 2ZUXA 3D0VB 1J8HD 1X6LA 3MROB 1WWWX 1YEJH 2Z31A 3WV0A 2DOCA 2ZWLT 4JREC 1T83A 4PRBA 4M7LT 2VAAA 1T3FA 4Y4KB 5C0ND 3HMXA 2ZUVA 4YGVB 3PWNB 3QULA 2X4SA 2EKJA 1NCWH 4ZAKA 4I0CC 3QDJD 4JE4B 4FHBD 5I9QB 2NY6D 5DK2A 3L3DA 2BMKA 3QDGA 4PJFF 3BPLB 4QXUL 3FFCE 3VGDA 2P8LB 4KQ4L 1X9QA 3AREC 1J0JA 1NGYA 1I3GH 4HWEH 4K3JL 1MFBH 3P11H 4P4RA 4UTBL 2E7LA 4ZNEA 4S2SB 1D5XB 1GIGH 1KTRL 3D9AL 3DHMA 3UPRB 2NY4D 1SJHB 5DRXA 3FOLA 4JY5H 4CMHC 5I18H 3X12B 1T7VA 2EDHA 4OTXH 3TO4A 1U8JA 2AK4E 4FTVB 5ID1A 3G5VB 2VTFA 4HFWA 4NGHH 2FYYB 4U1MB 1A5FL 3EZJB 3P40A 2N4IA 1K6QH 5FO9A 1A7QL 4LLUB 3NIGE 5C6PB 4WHYG 1JK8A 3SDCB 4RISH 5C07D 1AFVH 3ARBC 2BHUA 4AL8L 2VISB 4ISVB 4M48L 4OM0H 4ZOBA 3OKEB 2R0ZH 3IYLW 4AYFA 1VKXB 2OTWB 1XGTB 4OLWL 3TBVB 4D0BB 4M1GL 1DEDA 1GL4B 3NPSB 5HHNA 2J5LB 1N5YH 4PB0H 4N8CH 3X11A 5CZKA 2V2TB 3RGVB 2CLZB 4JFOA 2UUDK 3N1MC 3GUTA 3WFBL 2H41A 1UKQA 2AQ1A 4Z9KB 3EYQD 1FVCA 3RRQA 4Y2DA 3TBSA 1NANI 4WRLA 2HVJB 5D2NE 4P2CG 3EHBC 3SGDI 3V6BR 3WFBH 4HQQL 2ARJA 1AHWB 3NFSL 3HZVA 1G7JB 1HHGA 2F8VA 3NH7H 4IRJD 5EU7E 4F3FB 4Z76A 1RZIA 3Q5OA 4APQD 5I19L 1A0QH 2VZTA 43C9B 5DC9B 4JKKA 4XC1H 4U6YA 2DTSA 2P49B 2CR6A 4LPUA 2P43B 1PZ5A 5J9PA 1G7JA 4YZFF 4NC0B 5DZNA 4AM0B 1I7RB 2BRQA 1PLGL 4QRQB 3MLTA 1G0YR 3JSSA 1RJYB 1DLFH 4ZTOL 4NZTH 2OTWA 1A3RH 1EZVX 1FL5A 3A0OA 1IEHA 1CCZA 3MGAA 1EO5A 1NFDB 4NM8L 1AY1L 5IEKB 4BH8B 1JPTL 1M7IB 2Q76B 1EV2E 5HSFA 2VLRA 3VMOA 1KTKE 2FHBA 1FZMB 1G9NL 3C6LA 4O2FB 3PQYB 4R90H 2L7UA 5C09A 1NBYB 1OGAD 5HHOD 4LP5A 4ODTH 2C4FU 2BNRE 1NGPH 5DMIL 2YEZA 4JKLA 4MXVF 1ETZA 2HLAB 3KXFB 2VDNH 5D7JA 4ZS7L 1ZAGA 4PJHB 4F3FA 3GNML 3BN9D 5CEXA 5I0ZA 1L7IH 4A2LA 3MRMA 4C58B 5DEFB 4JHAL 4O9HH 2NTFB 5FYKU 3NCYP 5HGDB 4FQQB 3HZKB 5IK3B 4LRNL 4H8WH 4M8QA 3BJ91 3EOBB 4GRWF 1MCHA 1B9ZA 5E8DL 4WI7A 1FNGA 1CICB 5FO8B 4RGOH 4KPHH 3DUHA 4PJ5A 1EK3A 3TGXA 4OCYL 2H26B 3QG6A 4HIJA 1TQBC 5FYLD 2K1MA 4OCWL 3AY4C 4U7KA 2XZZA 3STZB 1CYGA 3BAEH 1HNGA 1EFXD 3DX8B 3IETA 4QRTA 5DRNB 2JJTA 2YD8A 4BKLB 1MREH 4QRPB 1URLA 4HIEB 2R8SH 1MFAL 3V4PH 4U05A 3BD5A 4H20L 1T1WB 2CK0H 1HHKA 3UBXA 3HR5A 2J8UE 1NCUA 4NQVB 3OR6A 5JO5A 3VGAC 3QULB 2DQJL 2ITCB 1NBVL 1H3PH 4PRHB 5E2UH 4F57H 1RFDH 4X7EC 3ZYOA 5D93C 4L4VA 1OY3B 4XNXH 2RBLA 3I84A 1CR9L 3EDEA 1TPXC 4DKEL 4R9HA 2YKLH 3MBEC 2BK8A 5K33A 3D85D 1JF6A 2HKHH 1W72H 3RIFF 4C54A 2R9HD 2X1PA 1IM9D 2WBJD 3HE7C 1BIHA 5FA4B 2B4CH 5AG9A 3WN5C 1HHIA 4C57C 4XC3L 1T0MA 3EYSL 1VFBA 1AC6A 3GGWA 4ODVL 4Z7UA 1DQLH 4P57B 5T1KA 2IALA 4OD1L 2Q86A 3LRHA 4C56D 3QUZC 3ZKXC 3S88H 3OKDB 1U8OB 4G6AD 1XIWB 1T66C 3HNTH 5EBMA 4AT6B 2L4OA 2P8PB 1KB5H 3T2OA 4YBLB 3OV6A 1D6EA 3MXVH 4G6KL 5I76B 3BDBA 3G04B 2GAZB 1AE6H 4KHXL 4NP4L 3C9NB 4NN5C 1NGWB 1S9WB 3VXQA 1YC8A 3OHXB 4KUZL 4CVXB 5DJ6A 5F1NA 5DTFA 5LAXA 3SY0B 4EI5D 3AU1B 2CQVA 1U3YA 2NYYC 1VDGA 5AYUL 4S0SD 2X1QA 5JW4N 3LKSB 5JDJA 1GAFH 1TCRB 4OLZL 2P5EB 5C0FB 1NMCB 3ESUF 1KXVC 2AKRB 1KENL 2OR8A 1MCSA 4PRIA 4DKDC 4NHCL 3TNMA 3HA0A 4Y16B 2ZSWB 5C0CB 5IVZA 4NO3A 4XPAH 1ITCA 1KN4H 3M17B 4CNIB 5EC2A 4HDIA 5C9KA 3FRPA 5GRVL 3OKKA 3ULVC 2AW2A 2V9TA 1ZTXL 3QFDA 1DVFC 2WINB 4LCCA 4X6FB 5ISZD 3NBNA 5GRUL 5F6HJ 5FV1L 4WO4D 1VPOL 1J1XH 1FPTH 2DB8A 4JRXB 3WD5H 1FIEA 1T20A 2A9MH 1FGVL 3AVEA 2ZSVA 4F9LA 3HZMB 1EFXA 4OCNC 5I66B 3MGOA 1XFPA 2MCG1 3CCHB 1NJ9A 2XTJC 1PEWA 2DWEB 5F70A 2IPTL 4IOSD 3LS4H 2N7BA 4E42B 3VXPA 4XCFL 5D2NB 4Q97A 3TH4T 3VGFA 4OFIA 4BSWA 1UA6H 2V9QA 3DV6A 5EO9B 1J1PH 2VDLH 3UTTD 4F7MA 2VDPH 5L9DH 3OJMB 1UYWL 1YNLH 5I9QC 3HMXH 3N06B 4I2XA 4PG9A 2XWJA 4XCYB 4D0CA 4U2YA 2HMIC 4ZTPL 1KT2B 3QA3A 4UB0H 1UQSB 5KSUB 1G7PB 2FX7L 3CXDL 2QSQA 3BP4A 4KMTH 4LMQI 2VN4A 4R0LB 3RHWF 3KR3H 5DEFA 3OJ2C 5I1IL 5DUMH 3OKOA 3PIQA 3VXUA 1A6PA 1X6NA 1Q94A 3CFJB 1I1CA 4DK3A 2WUCL 1LWRA 3EOAB 5I1LB 2FWOB 5ANMB 2V2WA 2XKUA 5KTEH 3TH3T 1NAMA 2BVUA 2PETA 4LKXB 4XPTH 2I07B 3IFPA 1CXEA 3OKYA 4N1EA 5CBEA 5C0BD 3ULUC 2AJYH 3RX5A 2NY3D 5IHUL 3BDXA 5J13C 2IBZX 1OOAA 3U9PL 3HB3D 5EOTB 1YY9D 2AJUL 3TN0A 3L3IB 2A74A 4NOFA 5I1IH 3HMWH 1JWUB 4CBPA 2VH5H 3QXDA 4PBVC 4JPIA 4X6BB 5I74C 1X5GA 4D9RE 4RBPK 5K9OB 4FQ1L 3S96B 2BNQD 1CLOL 4H0IA 1MJ8L 1WITA 1JCKA 5EZOH 4EBQH 4XC1L 3ZTNH 1TVBA 4IOFC 5D2LF 5H2BA 1HKLL 5ISZA 1RV6X 3K81A 5MENA 1HHJA 4KAQL 4JDZB 5E6IC 3BP7B 3QWOA 1DQTA 2YWYA 3IDMA 4F8TA 3KYAA 3ES6A 2DQEL 1GHFL 5JZ7D 5KS9E 1BD2D 3B4NA 4FFWC 5GRVK 4X5WA 3DXAA 3I3BA 1IGFH 1W0WB 5B39B 4ACPA 2Y25A 4U7SA 5C92A 3PWPB 4GKZB 1MJJA 5E2VL 4JVWA 4GAYB 5EBLB 1SJVA 5EZOL 4Y4FA 3QI9C 3WHE1 3TIEA 3VMNA 5IFAL 4JRYE 1HKLH 4JY4A 4LLYA 4FS0A 4H25B 3SDDB 4H1LB 5F6HI 1Q9OB 2EC8A 2WIIB 3DYOA 4GAFB 3O2WL 1ZLUH 3L3GB 1OAZL 2NMSA 4PJCA 5F1SA 5MENB 1GGCH 2O5YL 3GGWB 4PJFB 2GW5A 4WU7A 3QDMA 3TWCL 3U0TA 1B4RA 3I75B 1PKQE 1RHHB 2AABH 4HFUL 5EC1B 2VXVH 5IVZB 2X4TA 4EXKA 1QR1B 1VEPA 5I0DA 3DXAE 5A2KH 5JXAL 1NEUA 1C8PA 2QSVA 4P2RD 4CN4A 4ODSL 1OARL 2A6JA 2AJVH 1IT9L 4Q6IA 4WIQA 4XBGA 5F7LB 1DQQA 1UWXH 5TH2B 4DGIH 2HRPH 3QDJA 2PXYA 2EDKA 2Z4QB 4P3WA 1IAKB 4WFFD 3LEVH 5TF0A 2VZUA 3AU1A 1IEAB 1X5AA 3EYQC 5IMLB 3BUYA 4NRXA 4G8IB 2VRAA 3HPJA 1XH3B 3QJHA 3HNSL 2I5YL 4U1IB 1WJ3A 1T2JA 3QDME 1KG0B 3NAAL 3MCLL 3OKLB 1A6ZA 3LZFL 1P2CA 3MOBH 4J4PA 2F54B 2W9DL 4FQIH 4ALAL 2FB4H 1VEMA 4E41D 3C5ZA 4AEIL 4BFEA 4X6DE 1OQXA 3UTPD 1AGDB 3VXRD 5D1QA 2VC2H 5E00A 2DM4A 3K3QA 4XI5C 4UTBH 5F7HA 2HTLD 4PJ5B 4LDEB 4MJ6B 1W72L 4Q6IB 1FYTA 5FCSH 2YN5A 5D71H 5MHSD 3Q0HA 1WISA 4XCYA 3ARSA 4F58H 5MEND 2HKFH 1V7NL 4OGZA 5J4MA 5CWSA 2IAMB 2ENSA 2AP2A 5E7BA 2IQAB 3V4UL 3GM0A 5KVFH 3CVHA 3QXAB 1KG0A 1WBZB 2P47B 1A7QH 3QHZL 4E5XB 4NZRL 5L2KE 1KCSH 4NC2B 2B1AH 1NCBL 3IT8D 2VLRE 1I9RH 4G8GE 3O2WH 4O51A 4RMSA 3S5LA 4P49A 3VH8B 5EZIL 4Z7VE 1YPZB 1EUUA 3EFFB 4DVRL 3OB0H 4YDLC 2LQRA 5DRNA 1GC1L 2WIMA 1A7NH 2NY7L 3S5LB 3JWDL 5HTSA 3MA7A 2X41A 2VWEC 4XPHH 5DMKA 4OZGE 4KI5F 1PD6A 4HWEL 3JWDH 3OZ9H 3CUPA 4TNVF 4YWGH 1R3HA 3QWOB 1UCBL 3FB8B 1VFMA 2X4UA 4U1LB 5K9OA 1E4WH 3L3KB 4HS3A 5KAQG 3SPVB 3N1FC 2MQ3A 4K94H 5SWSD 3VXNA 1JHLH 1K4CB 3D2UB 2CUIA 3L3IA 4DVRH 1OSZA 3I6KA 3QEGL 2Z93A 2VXQH 1ETZB 2H9GA 3NIFF 1NCCL 4BELD 4PJBE 4UV7L 3LS4L 4YDJB 3IF1B 4U3HA 1U8MA 4FQXA 4S11A 2XQBH 3SGJC 3KG5A 3CX5K 4QOKE 3HPLA 5TE6L 3HE6A 2Y36L 3VWJC 4NKOA 1CLYL 5C0IB 1WBZA 4HGWB 3BKCL 5L0QC 2DQHL 3BE1H 3LY6A 4KXZH 4RFEA 1EEYA 1LEKA 1NC4B 2DL9A 5D71L 2X2YA 1QBLH 2F53B 2Q86B 2E9WA 4NC1C 2AV7B 5HHQA 3IRPX 5BO1L 4KGLA 1UXSA 5BQ7A 4ZS7H 4GW5A 4GFTB 3VA2C 4M62H 2C3HA 2RCSH 4NO0D 4JDTL 1KCKA 3DSNA 4JO4H 4YXLH 3HG1A 5D7LE 3G5YB 4HQQH 1LVEA 5K93A 1U6AL 2X4TB 1QR1A 1ZT1B 1KB5B 3LEYH 4MJIE 4WFEE 2R0KH 4N9GB 2NY2C 4WGWB 3SDAB 4TSCL 1RUMH 1XGUB 3DHJA 3ARFC 2CXGA 2B7DT 2CLVB 4N8CL 2NY3B 2ENYA 4NFCA 4NZJA 2LV4A 1KJ2B 2Y1VA 4MQ7A 1NGXA 5E03A 3H42L 4U6VL 5DK2B 1A3RL 3GSQA 4YHZH 4LKCA 4HG4J 4LEOA 4P23C 3BRFA 3ULUH 1AY1H 5TH2A 3SKOB 3V5KA 5EA0L 1T20B 3FT2A 3S4SG 4Z7WF 3O4LA 4WNQA 1DBKL 3AY4A 1MY5A 1MLCA 4YE4H 2XA3A 1H8SA 1E6JH 4JKPL 2ZSVB 5CILH 1T03H 1WT5A 3CNKA 3M8OL 4LCWD 3WKNA 4Q6YA 3LCYA 1DBBL 3C5ZD 5JW3L 1ZANL 1MCEA 4DOHE 1UGNA 1CK0L 3KNBA 5ALBH 1Q0YL 1G9EA 4MQXC 4JPVL 5EC1A 2IADA 3HI6H 4MAUL 5FDYA 3OKKB 1SJHA 4JRYA 4J3XA 3BQUC 1U8KB 1T4KA 2HA1A 1ND0B 3AMLA 4MD5B 1MWAB 1KLUA 5D7SH 2CRIA 4C83A 3TO2B 4BSWB 4OFPA 1IGJA 4JFPB 5FOBA 5IB5A 4JFEA 3F7QA 4JN1H 4O02L 5JXED 2DDQL 4RRPG 5H35B 1KYOJ 4HK0B 3SDDD 3UZQA 5EUKB 3MRHB 4BH8A 4LRIC 5C0GA 4N5EC 1DSFL 3QXUA 3ULUF 3O6FA 1RJZB 3H9SA 2J6EH 4NQXB 4Z78B 4DAGL 4KUZH 3CK0L 1VHPA 4LRNH 2OYPA 3ZT6A 5KSAB 2GT9B 4NNPL 2OR7A 2IPTH 4HXBH 2EO9A 4MA7L 2IH3B 2DTML 2NW2A 2PO6C 2X4RB 2IMNA 1O5DT 1DFBL 4HAGA 4NUGH 4QF1A 5BW7C 3PHOA 1A6TA 2I25N 2YD2A 5BMFH 3ARFD 1Z6JT 1FYTB 4K7FA 4OZFG 5F7YC 2XN9A 2AJVL 3DVFA 4JKWA 4Y4FC 4FQHB 2DYPD 4GG6A 1SMAA 2KQMA 5DJAA 3ARBD 1KC5H 2YD1A 4XHJC 4YIQB 3TV3H 4BQCA 2G60L 5ESQA 1U2CA 3P9WB 1LO4L 3MBED 1QLFA 3PWJB 4YXHL 3QIBC 4RFEB 3KPOA 2QBWA 4YDKH 4M5YH 5EOTA 3P73B 4DGYL 3BZEB 4MNHA 3HZYB 2D0HA 2W9DH 1HHKB 1S9VB 1FN4A 3HCVA 1MIMH 2BRRL 5EIIB 4L4TB 4WI9A 4NWUL 1BOYA 1Z0NA 2DI8A 2R23B 4GMTL 4GH7B 2BRRH 1ED3A 4MZ2A 4X4ME 3T0AA 5IESH 4XXDA 4LBEA 4KJPC 5I66A 2OL3H 5F3BB 4FTVA 1EJOH 2A38A 5D1XC 3CFCH 1BM3L 1D5BA 1XCQA 4MLIA 4RCAA 2ARJQ 3TFKC 4AEEA 3HN3A 2YPLA 5CLWA 1RURH 1K8DA 3B2VH 3RA7L 5DRZB 4WW1A 2H32A 5C3LD 3QQNA 5JIPA 1PBYA 1MFDH 1I75A 3P4LA 1FL3A 3MFFA 1T21B 4IRJA 4L9LC 4NDMA 3RZCC 2DI7A 2R4RH 5I1GL 2WWMD 5IW6B 3PUCA 5L2JA 4OLVH 2FX9L 3OAUL 4KK8D 2IH1A 4JAMB 4P5TC 5E7FA 3GSXA 3OXSA 4Y2DC 4Y89A 5JDSA 5IJVB 1LO5A 5GGTH 3HPLB 4H1LH 1W0WA 5IOPB 5DTFB 3QZWG 4KY1H 4WEBL 3THML 2E6QA 1R5VA 3O3EB 2BVEA 4WI4A 2Q20A 1BD2B 4JRXA 3MMEA 3B9KB 3MLSL 5GHWH 3KYNA 2DQGH 4EI5C 2W07A 3Q5TA 5KOMC 4NM4H 3SDXF 2GEEA 1I1AC 3IDMB 4AT6A 2VDPL 3ZKNC 4YHLL 1XIWA 3BZ4A 5IW1B 3TV3L 1LO0L 1QACA 2BVPB 1T7YA 1MCPH 4JCMA 2AVGA 3NCFB 3GMRA 3D25A 5FYJL 4CAGA 2GY5A 2LABA 4ZUVB 3MUGB 1R3LB 5GGTL 1RUPH 4QGTA 2YD6A 4OZFB 5GGVL 2R4SH 5HVHB 4NQTA 1MI5B 1MLBA 2VLLB 2VLKD 4OFKA 2C3WA 4QHMA 4D0DA 4CVXA 1MQKH 2IGFH 4DUXA 4G8FB 2QHRH 1EBAA 1NEZG 2Q7NA 3CZFA 3QH3A 4NC1E 4GKNB 3UTZB 1MCDA 2QL1A 3PWUB 3LH2H 5DJ6B 5F1NB 5FHAL 3RWCA 4JY5L 5I18L 5EPMA 2E9JA 1BM3H 2EXWC 1GGYA 2P5WD 4NNXA 3SKUD 5CGYD 4DOHB 5IMLA 1H5BA 4L9LA 1PZ5B 1YPZE 1FFPA 1QLRB 5J9PB 4UT7H 3NCMA 3D85A 2FYYA 3BOVA 4MMZC 4KI5C 4WI5A 4ZOCA 4JO3H 5LXGL 5BZDA 1JK8B 4JHAH 4NT6B 1P4BH 4P23B 4ORZC 2YRLA 1MJUL 5F9WC 4FOMA 4PJGE 3X12A 4DN4H 4PREB 5HI4C 1SBSH 3SQOL 4YFEA 3QPXL 1F02I 2FB4L 4KWUA 3VFMA 4U2ZA 3NFPA 4PJ5D 3VRJA 1QP1A 4PJGF 3T2NL 2K9UA 4H1LA 1JWSB 3NA4A 3FT4A 1ULVA 2XPGA 2Z92A 4GT7A 1J86A 4GQ9L 5BOZG 1JBJA 3QFJD 1KJMA 1VEOA 4PJ8B 4KROD 1DEEB 3RI5F 1UH2A 5GS1C 4IOIB 3I50L 2BVOA 3D39A 3VH8G 3RJQB 3PWNA 4HS6A 4L9LB 1YEDB 1JZ6A 3DBXB 3ARPA 3BKMH 3L5XL 1T1WA 2JJVA 4QOKB 1C08A 4N8VB 4TUJB 3CSPA 4ORGA 2OZ4H 5C2BL 2EYSB 4P2QA 1A7OH 5FO9B 4QRPA 1TJGL 5CKGA 3AGVA 4GKNA 3UTZA 1YEIL 1DVFB 3V52L 4XHJD 15C8L 2BY3A 1P4IH 1SY6A 1EMTH 1QA9A 5AEAA 4LEXL 3OR7A 1NKOA 2C1OA 4A6YL 2A9NL 3Q6GL 3L95A 3EDDA 3FOLB 4HK3J 1U3ZA 4NFDA 3VCLA 2P5ED 4GXUN 1CFQB 2CPCA 3EOBA 1I9JL 4PJDB 3GRWA 3MUHL 2FH6A 4PGBA 4NM8H 2EXYC 4K3EL 4LU5L 4QWWC 5BQ7B 4PRPD 1KPVA 3O0RL 3C8KA 1EGJA 2AQ3A 3HS0A 3O9WD 3WUZA 4W4OC 2F53A 4YDVA 1QNZL 1NDGA 1SJEB 2HVJA 4Z5RA 1HSBA 3KXFA 5D7JB 1AO7A 4FZ8L 2G5RA 1X4YA 1HCVA 1D5MA 5DD0H 5CBEB 3CFEB 3GSRA 5DRWA 2BFVL 1IEBA 1BF8A 2AXFB 4Z8FH 3ME0A 5HHMD 3RNQA 5JHDD 1KULA 5EOQL 5B38G 4OLZH 1I1YA 4MYWB 3RWGA 1XGYL 2C4XA 4MA1B 4NKMB 1H15B 4WV1B 2DTMH 3JWOL 4TUKL 2APVA 1H3WM 1U8OA 3O6MH 4JDZA 1MFNA 4YX2L 1C16B 3JTSB 1T7ZA 4BZ2H 4HX1A 3TJEL 3SKNA 3RVWD 4JPKL 5SX4H 3H0TB 2RQ8A 4KK6C 2YK1H 3BGFC 3BPLC 4WHTB 4WUKL 3MNWA 5GRUH 4YWGL 2NX5B 3RWFB 2P24A 4NYLA 4PJDA 1RZIB 4TQEL 1RUKH 2R2EA 5BJTB 5JUEH 2I24N 4J3WA 1P5VA 3L95B 1PG7L 1QRND 2PYEE 5K9QI 5FYKE 2VXTL 3LMJH 4I2XE 4F58L 2FLBT 1UJ3A 1ZHKB 5JLZA 1G9ML 1FG2B 3HUJF 4OGXL 3MMEB 5T5NG 2X40A 1OSPH 3RBSA 3LKPB 3MLXL 2IH1B 4R8WL 2XQBL 4DTGH 1J1PL 1JPSH 2BC4B 5DQJB 3TBVA 1S7TA 3PGFL 5FGBA 1G1YA 3VWKB 1PVHA 4HAFA 2DQCH 2XXMB 3OWEA 4OD3L 1IKFL 3EDFA 3E3QE 3V6OE 1BBDH 5DLML 2BNQA 3T0EC 1ZT7B 3KPNA 1HIMH 4W68A 3VD7A 2WK2A 3QDGD 5IB4A 1I1FA 1CE1L 3W11D 3FFDB 4S1SL 1RUQH 4ZNCD 3K7UA 2Z91A 4ZO9A 4OD1H 2E3VA 3V0WL 3SO3C 1MF2H 4AMKH 5F7MC 4NQDD 1G7PA 3OZ9L 3I2CL 4LSUH 2NX5A 3RWFA 2P45B 1Z0MA 4QXTB 4O2CA 5I1AA 2VAJA 2RCSL 1IAOA 1HWGB 2IAMC 3W39B 3V8OA 1FE8H 3IDXL 3PL6B 3QBTB 1YYML 2Q8AL 4I48B 1N64H 1OGTA 4JFDD 4ODWB 3P0GB 2H6PB 1HSAB 5EUOE 3TO4D 3FO9A 1F6LL 3SKJH 2BMKB 1KJ2L 3O3AB 1AO7D 3KHOA 1P2CB 1E4XH 3VWKA 3LN9A 1TJIL 2GT9A 3P30L 3LKQB 2Q7YA 5EZLA 3U4BH 2HFFA 2OBGA 2XRAL 1U2HA 5FYJU 5GS0D 3C9NA 2NY0B 2LTQB 3BGAA 3MC0A 3RI5K 4WWKA 3P4OA 1OB1B 3CFBB 1P9MA 3FB5A 1RK1A 4KRNA 3FT4B 2VJXA 4ONGH 5DQDL 3X13A 4UQ3A 3U2SB 1QLFB 4JPWH 4JEGB 4TSBH 3QR2A 4PJXA 5FK9A 1KPVB 5D1ZC 3KJ6L 3QNZA 1T22B 2ZUTA 3T0EA 4FNLL 1U36A 2LVCA 3BRDA 4OZFA 3PHOB 5D1XB 1ZA6A 3BP5B 3DETD 2AEWA 4HHAB 1CFQA 3C87A 1NC2B 3VXSA 5I1KL 4M7KL 5D5MB 4PREA 4X6CE 5CJ5A 3A67L 3I85A 3RZCD 1K85A 3H6JA 2C1OB 1X3DA 2APTA 2XWTA 3PWLB 4BUHA 1E27B 2P5EA 2E8YA 1LDPL 2NY3C 1EIBA 3WFEL 2FO4A 1QFPA 2UYLA 2Z31C 4XX1G 1LD9B 3MCKB 4QNPE 2LAAA 4WNQB 1RQ5A 3QUMH 5DZOA 4WWKB 4OSUL 1MUJA 1JYXA 4HT1H 3D1MC 5IFHH 1FSKB 3WFCL 4CKVX 2ADJA 3U30C 1JYVA 4P59H 4HUMB 4EIGB 4X98A 1I7UA 1Y18A 3V6ZB 4JAMA 5TDNA 5LXGH 3QUZB 1G6VK 3RY4A 4OCRH 4OLXL 3GK8L 5IBLD 5INDA 4LSSH 5IFJB 3I3DA 4C83B 8CGTA 1I1AB 1JGDB 4IS6B 2VB5A 5ICZB 1I8LA 4M03A 4U6TA 1QEWA 5C08A 4LSRL 1ITBB 2H32B 5HYJD 4QXUH 1R24A 1NAKH 1WWBX 2EXWD 2CJUH 1XR8A 3LZFH 1OVZA 4JFYB 5E6IA 3RWHA 4M1DH 2BNUA 4QO1A 4EN3A 1I7ZB 4Y5XA 3FB7B 4HMDA 5MP6L 3QIWB 1UM4L 3MLWH 2ESVD 3QUYD 1NL0L 4LLAA 5DVNA 4MXWH 4RNRA 4I18B 4PFEA 1T0PB 3O2DH 1BJ1J 5DJXB 1MAKA 4EN3C 4J4PC 5C1MB 2X10A 1RK0B 3VWKD 4WWID 5HGBB 5C09B 3PABA 4H5SB 3SHSA 1KOAA 3TCLA 3HE6D 3IU3A 4POUB 4LKCB 1LO5B 5BCAA 2FR4A 3DRQB 3I3EA 2DF3A 1R3JB 3VD3A 2CRZA 4AG4L 4WWKD 1RZ8B 4JJHA 2V2XB 4NJ9L 3QG7H 3HE6B 2WLZA 3SE9L 5C6WH 4G9FA 1CI5A 2Z31B 3TPKA 4QRQA 2V5TA 2VLME 3F7VB 4OM0L 3MR9B 4WO4B 1B88A 2PNDA 5EZIH 4GW1A 4N9GA 4BSVA 4GG6F 1UWGH 4PJEA 4UQ2A 1GC1H 3LQAH 1CXLA 5HVHC 2OJZH 2YBRA 3IDJB 1CU4L 3QDGE 3KPQA 2E27L 3HG1E 5D7LA 4K2UH 5IJKC 2ADFH 2Y06H 5CZVL 2B0SL 3O81A 3GO1H 5HDBF 4CRPA 2RGSA 4V2BA 3IVKB 1WZ1H 5DS8A 3B3IB 3K2UL 3GK8H 1E4WL 4X0KA 4L4TD 1MWAL 3BPOB 4LDOB 3MODH 3VFUA 3EFFA 5DD6B 1OCWL 5DYOA 3BGMA 4HJGA 5CIPB 4OD2A 1F6FB 2EDXA 4HJJL 4WW2A 5JZ7C 3MLWL 1YEEL 3S4SB 4UT6H 3HC4H 4UV4H 1T21A 4AY0A 4PRNA 4E5XA 2PW1B 3O6KL 4DQOL 1P7KB 4U1HB 4KJQD 4YHNA 4CMMA 1IAIH 4TQEH 3KLAA 2BNRD 3OKNA 1CD8A 3WMSA 5DJDB 1OAXH 4RZCB 3WDJA 3ZKMD 4LLDB 4P4KC 1JPGA 4JR9H 3EYUH 5DHYA 3RTQB 2LU4A 3QT2A 3U79A 1OP5H 2YUZA 3S37H 4CW1A 3CD4A 1KJ3L 3VFNB 5KS9B 1JRHL 1JUFA 1U8PB 4AQ1B 4LLMA 3KYNB 1FBIL 5DSCA 5BS0D 1KJ3H 3AFLA 1KTLA 4UIMB 5E08H 3LPWA 2VR9A 4NQCE 4AH2B 2VO5A 4L29A 4JY6A 4YO0B 2C26A 2BY0A 4RFNB 4HH8A 4XCNA 1I9EA 2ZPKH 3QUMA 5DUPL 4ZUSB 3LIZH 1D5ZA 2R1WA 4HF5L 2EDBA 5EH1A 1IAIL 2MFNA 1ZLSH 5KG9A 4GAJH 1U3HD 5FYKH 3OJDB 3H9SD 4W81A 3MJ8A 3HAEB 4O00A 5CZXC 4ETQB 5BV7L 5BRZE 5HHPA 2OJZL 3FOMA 1FL3B 4IRJB 4NDMB 2R56H 2O61B 1MREL 3G5ZA 3CVHB 4PGBB 32C2B 1T0MB 1Q1JL 4JFXA 3UXFA 1F3JA 4U1KB 4GG6B 3CFDB 1CICD 4XVUD 2BP3A 3KJ4B 3WNMA 3OAUH 2FLRT 4RAUB 2HJFB 5F96H 2I9TB 4Z7QE 1A47A 1KCSL 5CEZD 1MJUH 1I7TA 3IDGB 4DN4L 1TIUA 2VYRE 1M05B 4OCLC 1NLDH 3GMOA 2XKNA 5EU7C 1X7QA 5IV2B 4P4KA 3H42H 4ZXBC 2IWGA 1WFUA 1B3JA 4R7NA 3S3SA 3PWVA 3R1GH 2V5MA 4L1DA 5DD5L 5EO0A 3T8XA 1C5DB 3MQIA 4I3RH 2B1HH 3N85H 4HS8H 1FLRL 2W0LA 4ZD3H 2P4AB 1Q0YH 3P9LB 3OAYK 1G7HB 1OWWA 5I1HH 43CAB 4MQXD 2DQFA 4YBQC 4PPTA 4I1NB 1CTOA 1C5DA 3QEQD 1KIQB 4LSDA 4ZDHA 2GSIB 4PJ5E 1CQYA 3VFSB 4NNYB 2B5IB 1N3NA 5HGGS 5T3XE 4GXUM 5SWQB 5ERWB 5CD5C 1NEZB 2BFVH 1A6VH 1F90L 1ODAA 2WWMC 4K07A 3UZVB 1PEZA 1DSFH 3VDAA 4JLRA 3GMRB 3V6FA 3IFOB 5T1KD 2DQTL 3JV4A 4OZGF 3D18B 3V4VH 5EOCH 4GW4A 4FZEH 3JZ7A 3E2HB 3K4ZA 3F62A 1FL6A 3HR6A 3BP6A 2A6IA 1FDLH 1GAFL 5TE7H 3QCUH 4O9HL 4P2RA 1Q9KA 1N8ZB 3QUXD 4HUXB 4YBQD 4X7TB 3KPMA 4G80B 2NXZD 4XMKL 4XNZB 4UILH 5IHLB 1OARH 4LSVH 2AEPH 1HH6A 3RWJA 3UYOD 3QP3A 4DWHA 5DC0A 2WWKO 3V4PL 5HD8C 1DBJH 3VFTA 4ODUA 2YR3A 4NQSB 3TN0B 4LPWA 3WIIH 3V5DB 1C5CH 2JJSC 4NSKB 5C0DA 1T1YA 1UM5L 2MJWA 5E2WL 3S97C 1VPOH 3LHPH 3G6DH 1U3HA 2OP4H 1HOCA 3MA9L 2WANA 1SEQH 2Q3ZA 1F4HA 2DLFL 5HHME 1AH1A 2H3NA 5T3XL 3VWJA 3WHE0 3MYZA 1CR9H 4LCIL 2EIEA 1XGPB 4CVUA 5E8NA 1EUTA 4DGYH 5TQ2H 1I8LC 4CW1B 1ZVHA 1Q9KB 3G6JE 4PR5B 2NTSP 3TPUA 4OFYD 4Y1AA 3REWB 1IGTB 1ZSDB 3UJTH 5B4MD 1QO3B 2CRMA 4NN7C 5KW9L 2VDLL 1DBJL 5E4IA 3DGGA 4FXLA 5I71B 5DMJB 5E2WH 1P1ZA 1A1OA 1DE4A 1A9EA 1SMOA 3U7WH 5CJBA 2HJKB 4HH9A 5C0BB 3FT2B 3G5XB 1YNKL 2EH8L 3KVQA 5SWZD 2YSSA 4Y88A 5GGRY 5A3IC 5D96B 3QIUC 4NQCA 3L7FB 1UKSA 1YN6A 3QAZB 3HZYA 3V5DA 2G75B 4R4ND 4J3UA 3RVUC 1CFTB 1PY9A 4PP1C 2P46B 3RU8H 4WW2F 3BMVA 3MRCB 4HGMA 4LNRB 4PJ7B 3FCTA 3UAJC 3BO8A 1QLEH 3OKOB 2JCCB 5BVPL 4L1HA 2YC1B 2XACC 3O3BB 3CVHL 4IHOB 4ZPTA 1OWRM 3BKJH 4URTB 2BXYA 5I8KL 5DMGD 3A6CH 3HFML 4JRXD 2A6JB 1WV7T 1U42A 1ORQB 1QFWM 5T1LA 2VN7A 2B5IC 1KIUA 4RAUA 1EEZA 1S7SB 4WY7H 3T0VA 4OT1L 3MV8E 1JTOA 1U3JA 2UUDH 4GRLD 3JV5A 1T1ZB 3VXTB 1YMMA 1LE9B 4GBXD 1CFVL 2GSGB 3G5ZB 3MA7B 5SWSE 3SGEI 4W6XB 4XAWL 4QYOB 4RGNC 4XHQA 2G9HB 4O5LL 2UY6A 3VDBA 4I0KA 4D2NA 2YN3A 4R3SB 4LCIH 3HUJB 3BKJL 4L3EA 1IC5H 5IW3A 5IB2A 3O8XD 43CAA 5E4EC 4NHCH 4ZAKB 5FKAB 1WBXA 5LAXB 1S7WB 2YK1L 2R2HB 1DL7L 5SWZB 1YQVL 3AS1A 3T8XB 4V2CB 1U8MB 4LK4A 4NM4L 1P7QD 1CLYH 2L0DA 4P3CH 5GJTH 4OT1H 5DJAB 4PGCB 1CZ8L 5HYIA 2J7LA 3QEHB 4MHHG 2D7TL 4P2RB 2FX8L 2HT3C 4ONGL 2ZCKH 2JB6A 4NO3B 4PG2C 2UY7A 3ARDB 5E2VH 3CZJA 3C6SB 3TA3A 5EO1B 3NCJL 3IFOA 1CFSA 4KHTL 3SO3B 3WLBA 5BXFB 2NXZB 4RIRB 2AKRA 4IRJC 1AGFA 2X5PA 4OFDA 1A7BA 1K8IA 2I60L 4F7CB 4M1CD 5SWQA 4UT7L 1S5IL 3UCRA 2PTTA 5GS0L 3BPNC 3FN3A 3TLRA 1IE5A 5C0CA 1KGCD 4WWKC 1L4IA 4YPGB 1OGAE 2FRGP 3WO4B 1P9MC 2UZIL 3C5ZB 3LV3A 5HYSA 2WIIA 3MLZH 5CJOH 5DFTA 2CJUL 2NZIA 5F7FA 5AUMB 4YAQB 4LEOB 4LGRB 4R4FH 1DDHB 4UUJB 1RULH 1B0WA 4ODUB 1ES0A 3GBNL 3FO0H 5D7KD 3QQ4B 3T2QA 5BRZD 3MLUH 4ZSOE 3ARQA 7FABH 5GXBB 2AQ2A 3I2CH 2PTUA 5C7XL 2R56L 25C8H 2DIBA 1J10A 4DVBB 3OPZH 1JI2A 1K5NB 3D39D 4GKSB 1HHHB 4MD5A 2F15A 1TETH 2EICA 2FO4B 1OHQA 3BP6B 4IEFB 3CDCA 1GOHA 4Y0GA 1FC1A 2QQKH 2EKSA 3E8UH 2ILLA 3T0BA 1NC2A 2F19H 4H0GA 4Z95H 2W9EL 1O7VA 1T0NB 4QRPE 2P7TB 2FL5A 3NIDF 4GRLA 4HBCH 5KSVA 5I1EH 1C5BL 4KTEH 3BD3A 3GBNH 2P42B 4GXVL 1KT2A 1G6RH 2P8MA 1LO2H 4K7PH 3CJJA 4R97B 4TVPE 1KCUH 2WV3A 1Q72L 3X13B 2XTLA 1I1FB 1WT5C 3QHTC 3L5HA 2XG4A 5GHWL 2DQFB 3GEWB 3LQAL 3L5XH 2X05A 3T1FA 2YEZB 1GSMA 5EU6E 4WI2A 5I8EA 3WJLA 5C0AB 3IS1X 4NQCB 2E27H 5D7JD 4ZFZA 1YEFH 2VL4A 1CLOH 1G84A 4HT1L 2GITB 3U30B 2HJKA 2E5EA 1O7SA 4NZRH 3QDJB 5F7EH 1S3KL 4PY7A 3I6KB 2Y4SA 1PAMA 2GTWA 2A9NH 4ODWA 5IFAH