1J1PH

Crystal structure of hyhel-10 fv mutant ls91a complexed with hen egg white lysozyme
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title The Role of Hydrogen Bonding via Interfacial Water Molecules in Antigen-Antibody Complexation. THE HyHEL-10-HEL INTERACTION
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j1pH00
5IB2A 4JZOA 1DEEA 2OZ4H 5T5FH 3KPSB 4Y1AE 4UDTA 2EDBA 3ORJA 1FG2B 4QKXB 1MQKH 4Z8FH 4QGTA 1E27A 5C09E 4H26B 4P4KB 3VGEA 2RCSL 3WFDL 1X3DA 1AI1H 3M8OL 4YXLH 4JFEA 1T1WB 2PYEE 5ACLA 1DBAH 4JFZL 4Z7VB 5FYJL 1WEJL 3QI9B 2IAND 3HN3A 1OWWA 1P2CB 4K3GA 2OTUB 3ZL4L 1EUTA 2Z8SA 4G7VH 3WNPA 4FFYL 4X5XA 2MKLC 3VXQB 3O3AA 4OSUH 1ZWIB 2HLAA 1HXYA 4NKDB 4WI5A 2RJMA 2EDKA 3K0WA 3BD5A 4ZO7A 4MA7L 4LLWA 3O41B 4LPCA 4KDTC 5F1SA 2IANA 1FNEB 4D9QD 1XGTA 4QXUL 4J4PD 2A83B 1Q72H 2DDQL 2AXFA 3MRFA 2OL3H 1KCUH 3DI3B 2BP3A 1MI5E 3L95A 4LIQL 4Q6IB 3IETA 3NIDF 4JDTL 4KKNA 3P30L 1C16A 5KN5A 1CCZA 3TIDB 4JGUA 1R3HB 2H9GB 4Y1AB 2X9WA 4LNRB 1TQCB 4MGXA 4M1DH 4XVSH 3L3DA 3VG0L 2RR3A 1NCBL 5IV2A 5C0NC 3D87B 1XF3B 3LY6A 3JBG7 1XIWB 4NJAH 2OJZL 1X5ZA 2FGWH 2PYEB 1NGXB 1MCQA 4YDIH 4J12A 4YK4B 4Y5YA 5DUBB 3NIDE 3UTZB 2FX9H 5D7JD 3RUGF 1A4KB 4NN5B 4HG4J 2Q76A 5C0IB 1I7RA 1UVQB 1VEPA 3QNZA 2ZNWA 3O3EA 3TFKC 3Q5OA 2CXGA 4NGHH 4ALAL 1J12A 5FHBH 4D0DB 4K8RL 1GC1L 4ZFGL 3B43A 2FZ3A 2BSRB 3G6DH 3S88L 4G6JL 4M7KH 2A2QT 4YBQD 4Y5YC 3S36L 5D7JA 2X1WL 3P9LA 3H9HA 3RL2A 4XBEL 1CDYA 1DFBL 3G5XA 4P3DB 3UPCA 3N06B 5DI8B 4H5SA 1QSEE 2EIZB 1JI2A 3FTGA 4TQEH 5CD5D 1ORQA 4PGDA 4K7PX 3CFBA 3RKDD 1NGQL 3FO9A 3W9DA 4LCUA 3EIFA 4N0FB 1PGRB 4JANB 4OZHA 3MRKB 4KV5E 1D5ZA 4Z77A 4MS8C 1JBJA 3NABL 3MLSL 1W0WB 4P2QA 5EPMA 3VFOB 1SMAA 5FYKH 2A77L 3JUYA 5DJ2A 4KQ3L 1JF6A 5A2KH 5DR5L 1IBGL 1Q94A 1FYTD 1JE6A 3H7BB 4JB9L 1RZKH 3G04B 3VFTA 4Q9QH 1YMMD 4GG6F 4ZPVA 1MCFA 1FLRH 2NXYB 4PJ9D 5D7IE 3KLAB 2YEZA 3PWVA 2EDFA 1Q0YH 4PJGA 3C9NA 5E4IA 1YJDH 1MCOH 4ZPTB 2EE6A 3NIGF 1XR8A 2NY0C 5AZEH 4JAMB 1TTUA 4ONHA 2CDGA 4OB5H 4FQQA 2BNUB 4V2CB 4XP4H 1E0OB 4L8DA 1KV3A 1YEKH 4WW2A 4XVUC 4JJ5B 1F2QA 3ESUF 3BPOC 3HCVA 2VJXA 4RMTA 1QSEB 5D1ZC 4PJ9A 4Z95H 3R1GL 3BT2H 3LN4B 2LQRA 1N0XL 3WIHA 3MYZA 2M1KA 4EOWH 4HAFA 1YY8B 4V1DE 5DFWH 3P4OA 3KR3L 2IWGA 3H9SB 5GIRB 4ODTH 4P5TB 1MCPH 5T3ZD 1G6VK 4P4RA 4NKOA 5C0FB 4NQXB 4P9ML 3HRPA 1KJ3H 2P42B 3HC4H 3SCMD 3D25A 1EZVX 2N4IA 4C4KO 2A9MH 3EYOA 1JGLL 4XRCA 4XBGB 2F53E 3QNXA 2QTEA 3FB6B 1R3LB 4EUPB 1WK0A 1G7HB 1CGVA 1QLEL 2UZIL 3OB0K 3BAEL 3BX7C 4S11A 5I8CA 5KSAA 4WHYG 3D0VB 3RPIA 3ARFD 3VXTB 3PQYE 5EOQL 4DGYH 5D9SB 1NCAL 5F1NB 3VFRA 1WZ1H 1QPXA 4HG4K 3O11B 2V9QA 4G9FD 4PRIA 5HHOD 4U1KB 1BF2A 1Z9LA 2ICWI 3KYKH 1UJ3A 2WWKO 2P46B 4A6YH 1W72A 2FEEI 4JG1L 5DHYB 5FXCH 1P7KB 1RZJH 2G60L 3ARFA 4DZBA 5KSAC 4FS0A 1AXIB 5DD0L 4V1DB 1MJ8L 5JW4M 3F8UB 2DBLH 4G9FA 2VDOL 1A7PH 3EOBB 3MV11 5HHOA 4UILL 5C7XH 2VYRE 2XN9D 1FNLA 3BDYH 5FB8A 1EAJA 4OF6A 4WFGE 2F5AL 3Q48A 1ZGLB 3H3PL 4MNQD 1P7HL 3RL1B 3VI4F 4LSSH 3SOBH 1YEEL 3AB0B 2FR4A 3D85D 3FQTB 4ZUTB 3V4PH 4BJLA 4YHIB 5J3HC 3V0AC 5A16A 1B6UA 2O5YH 2VZ1A 4M1GL 5D72H 3TZVB 3QXDB 3BSZL 1EA9C 1T7ZA 2JJTC 5EC1A 1I7ZB 2VABB 3EDDA 3DROA 1NEZA 1XGPA 2XN9A 3S9DB 4APQC 3D39D 5B8CA 1IGIL 4H0IA 4MNQA 4ODSL 1S78D 2VWEC 4F57L 1G84A 2GJZA 1KJ2L 3D85A 3VFUB 4MXQD 3V4UH 1EFQA 3LS5H 2FIRT 3VI4E 1VFMA 1A9EA 1DBMH 3EDJA 1HDMA 2JLLA 3WLWD 3CK0H 4O02H 2BSSA 4KRPD 1KELL 5E00B 4M4RA 5GS0C 2H1PH 5FYLE 3TGXA 1Q9LA 3WEXB 1LVEA 5E6IB 1I3RA 1IAKA 2H8PA 2N56A 3D39A 4KK5D 2PKDA 3GI9H 4OD3H 2WUBL 5B8CC 4MJIE 5F8RC 3BZEA 4HEPG 1U8KB 4LCCC 3IU3A 4P9HL 1JFQL 4N8VG 1XF2B 1IAIL 3GBML 3MRPB 1A6VH 4MSWA 4LFHG 3MGTA 3HAEB 4NNPL 3D69A 1KG0B 2DQCL 4N90E 2XG5A 1SY6A 3UYOD 1GJIA 5GGRY 4G8EB 4NUGL 4NM8H 1LDSA 2QJDA 4BFGA 2XPGA 4I2XE 1D6VH 4L29B 3PGDA 3U2SB 4GMSH 1NFDA 1HHGA 2A9NL 4G80A 3MUZ1 2V2WB 5J6GB 3INUH 2FWOB 1Q9KB 4XNMB 1F4WL 1T2QH 1H3PH 1HZHH 5BZDA 1PLGH 4XT1C 1OM3L 4OFVA 4OIIL 3FMGL 1EUUA 4BKLA 1F5WA 5SWZB 4MJ4A 1U8NB 3UAJC 4HMCA 4KK5C 2P45B 4S0SD 3Q5YA 2VXVL 4IRJB 3HMXA 2GTWA 1UZ6F 3X3GL 2A74B 4WUUD 2UYLA 2X10A 1MRFL 5LVEA 3GMLB 5I1LB 2HAZA 2NY6B 1CLOH 2APVA 2NYYD 4O58L 4ETYA 5IR1A 1U8IA 4MJIB 3TPUA 2ITDB 1BIIA 4NQDD 3NIFE 4HV8A 3JSSA 3BDXA 1NUNB 2XOTA 2XKNB 4JPWH 3WNMA 4F33B 3SPVB 3G5YB 3KPNA 3DVGA 1X5AA 2Y9RT 4WUUA 4HAGA 5ADPL 4PR5A 2Y36H 4XAWL 4QRRB 3U9UB 4I3RH 2W65A 4NKMA 1D9KB 4JQVC 4N5ED 5H8DA 3C6LB 1YEIH 3QIUB 4GRWE 4Q2ZB 2D7PA 4NQDA 4QNPF 3AC0A 5FKPB 1CG9B 3B8SA 3IXTB 1SJVA 2Q20A 4ZUWA 1BJ8A 4JFOA 2FHFA 1DZBA 4MJ5B 5AEAA 3BEWB 1IARB 4YGVB 1NGYA 1OAYH 1TLKA 2GFBB 3WD5L 1LO0L 5K9OB 1FN4B 1LO4L 3E3QE 5L2JA 2J8UA 3P77B 1KTDB 5HHNA 3VWJA 3OAUL 4R4NC 2EC9T 3V6BR 3FJTA 2VL5A 5LXGH 1OSZA 2FB4L 1MY7A 4L3EE 2FL5B 1QRNE 4CBPA 1G9ML 4X4ME 3QEHB 4N0UE 5DD3L 1WBXA 4HFUL 4XPFH 3CX5J 5GS2H 3DVNA 4TNVK 1KIUA 5TF1L 1ZKAA 1A6WL 3IDGA 3VWJC 3QHFL 4R0LB 3B6SA 2V5SA 3T0WA 3UMTA 3WDIA 1DN2A 4YPGA 4OGYL 3UROR 1W8NA 1J1PH 4QRSA 4XXCC 1JUFB 2XT1B 4ODBD 4R26H 3NN8B 3H0TB 3QPQC 4QHLA 1Z5LB 1JWMA 4U0RC 4YZFF 4QOKD 1AQKL 1FFPA 1UH4A 4FQ2H 3U0TA 1U41A 4JHWL 5CEZE 4Z7QE 1S9YB 4JDVB 4GKNB 3RZCD 1KJMB 2YUZA 2ED7A 5JHLL 2BVPA 3HG1D 1FVCB 4PJDB 2WIIB 4JPVL 4YIQA 5KVEL 1T1YA 2GSIA 5F9WC 1WWCA 4G43A 1G7QA 15C8L 2XYCA 4HPOH 1PG7X 2FIKA 4PJAF 5H37G 4YQXL 3S35X 1NDMA 5IW3A 5L88H 1A1NA 3EJZD 5LGJB 1T1XB 4WU5A 4L5FL 4Z5RB 2WBWB 4JM4H 4X7DC 3MODH 1HWGB 3V0VB 3HG1A 3NMEA 1GIGH 1MH5B 2VLMD 4UI2A 4W6XB 3IB4A 3KXFA 4UIKL 3GSUA 5KSVA 4WHTA 4OUOA 3FAXA 5DT1L 2WK2A 5IEHB 3HE7D 2VZVA 3DX9A 1BQHG 4YHZH 3IKCA 1UH2A 1ZA6A 4PJAE 4LLQA 1N7MH 4FQPA 4EBQH 5C86A 1HHIB 3GMPB 3OV6A 4GW5A 5EUOA 2IALA 4PJIA 3WFBH 2EDDA 3O4LE 2WWMC 1CD1A 5HPMB 4WCYL 3H6JA 4AG4H 4POZC 4LNVA 4JFDA 2FRGP 3RA7L 4L9LB 1OTTC 5E2UL 3CSGA 1NCDH 1VGEH 4U1MB 4B5EA 2X70A 1RMFL 4IJ3B 3ISWA 2MCPH 4WI2A 3X14B 2YC1B 3ESVF 4F58L 3RTQB 4AEHL 4X7CC 2N7BA 2VXUH 4AIOA 5GJTH 3RIFF 4IDJH 1QVOB 3RGVA 1TCRA 3V6OC 5ICYB 1SBSL 4G6AD 4PRPA 4C83A 1EK3A 4U1SB 1XH3B 5I1KH 1V8HA 1IM3B 2QHRH 4P5KB 1HK6A 5INDB 5FF6A 5J89A 1C1EL 2Y4SA 4RWYH 4DAGH 4PJFF 5D7KD 3W0WB 5HHQB 3REWA 3QQ4B 4JRXE 2AJXL 1ONQB 1KXQE 1CE1L 1MFEH 4FNLH 4XMKH 5C08D 3CX5K 3RGVC 3L5XH 3UTQA 3O45B 3NFPA 1QA9B 5FGRA 3TBTA 1UJTA 3MRMA 1DBJH 4RDQG 3O4LB 2I60L 5KSBF 3V5KA 5MEQB 1EO5A 2W91A 4OD1L 4UQ3B 4NYLB 4G8GB 4ODUB 1JGUH 3ES6B 2CKBL 3I02A 1N8ZB 5SV3A 5KG9A 2ZUVA 4OV5A 4X8JA 3V79C 5FA4B 5C08A 2VLJB 1T04A 4RMQA 2XZCL 5DRWA 5B39G 4IIQC 4KRNA 5J1AB 3QIWA 1FNHA 4AQ1B 5C0JA 2JE8A 3HLAA 3MUGB 2VDPL 1OP5K 4M6NL 3O6FC 2AEPH 5TQ0H 3VRLE 4F37F 4CKVX 3BQUD 1QO3A 1MFAL 3BD3A 4X6DA 1DQJA 2OMNA 4FFZH 1MRDH 5IK3B 3E6HA 5JW3L 2R8SL 4LHJB 3JUZA 4XB7A 5HHXH 1UWGH 1U2CA 4JO1L 5IT2L 1RUQL 2PYFA 3SKOA 3QIWC 5CJOL 4BFIA 3QO1B 5BW7A 5EZOH 4MCZA 4PJXE 3BW9B 3BQUA 4PYHA 2VQ1B 4DEPB 1C08A 4JM2B 4JRXB 4X7TB 2F54D 1F6AA 3LRGA 2DQGL 4EIGB 4NHCL 4QHKI 4H20H 3BMWA 3EYVB 1U8MA 1IEBB 3QA3A 5CBAB 2Q7YB 4F9LC 3LSOB 4D3CL 5C0CE 1DVFB 1JHKL 4IRZL 3ROOA 3HPLA 4Z76A 2R1YB 4FFWD 4OCRH 1S9XB 2AW2A 4OLZH 1VB9A 5BW7C 4C56D 3S34L 2HKFH 1FC1A 3HS0B 1MCLA 4H0GA 4N8VB 4H0HB 1C5BH 4UT9H 2YRPA 3MRCB 2IBZY 1ZK9A 3MJ8A 3T09A 3VI3F 2PUQT 2GKIA 1GH7A 3IFLH 1YNTB 4PJBB 4BK5A 1I3UA 5F6HJ 3MV7D 2PTUA 2P5ED 5AD0A 4NUJB 1U8HA 5A3ID 2C3GA 1TDQA 4MJ6B 5IHBA 3NA4A 5F7WC 3OZ9H 1T22A 4AIZB 3WE6B 3DGGB 2VZTA 4P2RD 5EA0L 5DK0A 3MV7A 1HHKB 2P5EA 3PWUB 2JKXA 5BCAA 1U3HC 4PJXB 1L4IA 1A7BA 3VXSB 1HQRB 1GL4B 4KHXL 4G8FB 2M8XA 3G08A 3UBXI 4XWOD 5IFHH 2GK0B 1CR9H 3O6KH 5EOCJ 3X11B 3RPKA 2QLVB 3KPOA 4FQXD 5D7SH 1N5AA 5KSUB 3NCCB 4P2RA 3LB6D 1S8DA 5DJXA 1OTUD 3FOMB 1NMCB 4MDIA 1S5IH 1GHFL 1U8JB 5DQJB 4KMTH 2ERJB 4GBXB 4RMUA 2CLRA 4FQLL 4OCWH 3VXOB 5I1AA 5J7CC 1QEWA 3GNML 3FOLA 5F1IA 2VH5H 5KTEL 4NOBA 5HDOA 1A1OA 4FQXA 2PW1B 4KKLD 1YMHA 2R29H 4RAHA 3CFCH 4IOFD 5GS1A 4NRXA 3OKMB 2R0ZH 3B2VH 1D5IH 3D3VE 2FGZA 3ULSB 1VACA 1QQDB 4IS6B 1G7PA 1J1OL 3DUSA 2B4CC 4Y4KC 4LSRL 4F7EB 3IF1B 1IAII 3LZFH 4PGCA 2WBKA 4WVRA 3QG6A 4LMQI 4NM4L 3EGSA 2E7LC 1F6LL 4ZFFB 4Y4FB 3MRDB 5HGBA 2VLKE 2HFGL 1CFVL 2V7HB 3W5MA 3WFCL 1ZGLP 2DKMA 2C1PA 3JTSB 1YEGL 3O81A 2A73B 2R4SH 4M6OL 2O61B 1J87A 2PETA 1PG7L 3FKUS 3UZEA 3RNQA 1DE4A 1AGFA 1BD2D 1OAZL 2CIKB 1D3CA 4CU6A 1NANH 5KAQF 1Z9OA 3JV6A 1M6OA 4PJ8B 4KKBC 4JJHA 2VLLA 8FABB 1YN7B 4N0CD 2HT2D 4PRDB 2GI7A 5ICXA 2YBRB 2X6MA 1JPTL 1BAFH 2NY5C 1S5HA 3MO1B 1BD2A 4GW4A 4HC1A 5A2IH 1AHWC 2NY7L 2P8MB 2DD8H 2DQDL 2HJKB 5C2BH 5FUZL 5I1EL 4GKSA 1ZEAH 4IOIB 3U83A 4Q9CA 1H8SA 4F7CA 5FECA 2DQFA 3D3VB 4AM0B 1WLHA 3DETD 5I1CL 3I50H 1M4KA 3FO0H 5DRNA 2E9BA 4KMLB 3FQWA 1K4CB 3SKJL 1NCCH 5AUMA 3B2UD 3IAQA 3FCTB 5IQ9A 2VR4A 1TETH 2HVJB 1I7UA 4K94H 1EIBA 3FO1B 4N68A 3IDJB 1T6WA 1YYLL 1A02N 5TH2B 1H3GA 4P4KD 5BZWA 3U1SH 4Q0XL 3AU1B 4MD0A 2HG5A 5HHVH 3BP7B 5IKCB 4O9HH 3NA9H 4HMEA 2OSLA 1RI8A 2V2XA 1MEXH 5EBLB 5EU3B 5HY9A 4ZD3H 3F7VB 5CBEB 2W59A 5F96H 5GZOD 1AGDA 3UPAA 2B1HH 3DO7A 2JCCB 4HXBL 3ZYIA 3CDFA 2VO5A 3BPCA 1OAXH 4J1UB 3S3PA 3KPTA 1A6AB 2J8HA 2NTFB 5DTFA 1F4XH 1KPVA 5JHDD 4HWBL 5ESQA 4NN6C 3ILQC 1EPFA 5D71H 4NBZB 3WFEH 1YPZE 2Q3AA 3MRBB 1BQHB 2YZ8A 1O0VA 1H5BB 1KFAL 4OBSA 4BM7A 4M6ML 4XCCH 1B90A 2R2EA 5D93B 3E1F1 4TULL 4I3SL 3H7LA 3ARPA 4DKEL 1HKLH 4O2FB 5CLTA 2B2XH 4YDKL 3UEZA 5EIIA 1SVZA 5JHDA 4ZOCA 1FYHB 3LRSB 3JWDH 4X7SH 3NZ8B 4Y1AD 3I3EA 1E28A 3IJSA 3NCFB 5C09D 2HVKA 2IMNA 3UZVB 1G6RB 1I9RH 2PYED 5CEXB 2P8PB 2I5YH 1KB5A 4PJEF 1KPUB 1F13A 4XP5H 4HIJA 3QRGH 5JDJA 4EQ2A 2YWYA 4P57A 1QSFE 5KANI 1NCUA 2W9LA 2AABL 3RWFB 4FG6D 2AEQH 3BVNB 4KI5F 1XGRB 3D2UB 4DW2L 1FO0H 4MXVE 5C09A 1PKOA 3S6CA 3LN9A 4CNIA 3PHQB 4XCYB 5EUKA 2AJ3A 2FYYA 3NTCL 4GXUM 3MMEA 1N59A 1N64L 4P59L 4UQ2B 4XMLL 1SEBA 4LEOA 1MRCH 2IH1B 2MSPA 5HYIA 3TYGH 4U6XB 1J11A 4XPTH 3TNMB 5CJXC 3OR7B 1UCTA 4W4OA 4BZYA 2VN7A 2EICA 3B9KC 1M7DB 2NW3B 2CKNA 4P23C 2IBZX 1MI5D 5IB4B 2VZOA 4L4TA 4RGMB 4WI3A 1FFQA 5MEOB 3I84A 2HYMA 3DMMB 5F6IB 4I9WE 2XA8H 2QSCL 4XP6H 3HE6B 4ACPA 4LEXH 5I0ZA 1F4YL 4LHUG 3EAKA 4NFCA 1K8DB 4XTRD 4ZS6D 1INQB 2OI9C 1G7IB 4EXKA 1MJUL 3NCJH 4W4OC 3THML 5F9AC 1P7QB 1MI5A 3LDBC 1ETZA 1JNNH 2IFGA 4U1NA 4NT6A 3U4BH 3B83A 2YHGA 2D0FA 3AS0A 2R0KL 1FVEB 1BBDH 1F90H 1QSFB 1QR1A 5T3XE 5F3HA 4BSVB 4CMMB 3U4EA 4EVNB 3JVGA 2B1AH 5FAAA 2OR7A 3HB3C 2NXYD 2P7TA 2DMCA 2VAAB 3M1BA 4YEEA 3X13B 1FZOA 2ZCKL 1RUAH 1RZFH 4KUZH 1CS6A 5ACMA 5J9PA 4ZQKA 3VU2A 3OJVC 3I6LE 1EJOL 2V17L 2AK4B 5JOFA 1CBVL 1A7NL 4M7JL 4R2GD 2ZUSA 4M93C 2YN3A 4YHKH 4HFWA 1FPTL 5FDYA 1QSED 1H15B 1TVBB 1JL8A 1JGDA 3HNSH 4OGXH 3RWCA 1KACB 3AVEA 2Z92A 5C92A 5L2KE 4AQOA 3B9DA 4HJ0D 5F9OL 1HYSC 5DJ8B 3SGKA 1NAMA 1IT9H 3T3PF 1D5BB 4HF5L 2XIDA 3QDHA 2R23B 4PLKC 4PTUB 1I8IB 4PG2C 1AH1A 2FX7H 1LEIB 5IESH 2R1WB 4HJJH 1M71A 4H8WL 1EHNA 2ICWJ 3ARDC 3MUY1 2DS4A 5E8NB 4M9PA 2QSTA 2H6PA 1LDPH 5CMAB 1TJGH 4OF5A 3SGKC 2RQ8A 4MXWH 4PJ5E 4EJ1C 1SY6H 3BHBA 2XWTA 4OLUH 3CZFA 4MA1C 3GSNH 4UDUB 3FQUB 3HMWH 4LU5L 1IQWH 4HKJB 5E70A 4M00A 1N6UA 1CGWA 4HQQH 2R2HA 5B21A 1WTLA 1KJVA 3NVQA 35C8H 1ZXQA 1RULH 2VLRE 4V1DD 5EZJB 4KKCD 5C6TH 2N7AA 1E6JH 1E4WH 1L0QA 3BGMA 1NUDA 1TZHB 5E1AB 3OAYK 5CILH 3WIFB 2YD1A 1I85C 2HRPH 4MNHA 4K23H 4JKPL 4FXGB 1CICD 2H2SC 4MQTB 5HGAA 3IFOB 2JJWA 4GG6A 1IQDB 1I1CA 1RQ5A 2NXZD 3RWIB 1RUKH 4RIRA 1GGUA 1NBYB 2XQBL 4WY7H 1KLGA 1CI5A 2YPKB 1BQSA 2YA1A 2NY2B 1HHJA 2F53D 5GRJH 1QFOA 1A22B 1IGML 4TSAH 3MXWL 2FEDD 3IDMA 1IRAY 1CICA 4PJ5B 1ZAGA 3PQYD 2GCYA 3N85L 4G8IB 4DN4H 1SJXA 2UVFA 2C5DC 5EFIA 4HXAL 3UDWA 3ALWA 4Q6YA 3BPNC 1F4HA 2F53A 1FV1A 3KLSA 4GS7B 5FO7B 4HUKB 3FO2B 4WFHE 5ACZA 2BZDA 4OGAD 3DX7B 4ELMB 4OM0H 3SO3C 3E0GA 1VADA 1NUFA 3OGCB 2X42A 3PQYA 4OV6F 3MV01 4Y4HC 3GMOA 2VLRB 2Y07L 2E5EA 4PD4J 1XF5B 1I9JH 1L7IH 5AG9A 1PSKH 4JRYE 4QY8B 1IAOA 4WFGD 4HKBB 4ODHH 3LVEA 5FYJU 5BV7C 4HH9B 5EU4B 3MA9L 2DICA 1QFUH 2OL3B 3P9WB 3T08A 1NMBH 2YPLE 5HJ3B 1GGBL 3MRNA 2X4SA 5DMJB 4ZAKB 4FQ1H 3LEYL 3CFKB 1IKFL 2FBOJ 2AI0H 3EFFA 1IC5H 1U92A 2V5TA 3RVWC 1KB9J 3PL6C 2IGFL 3BUYB 3REVB 3R8QA 4RGNC 5JW4R 3ARQA 1I7TA 5IQ7L 2R56H 4TRPL 3AXLB 3C6SA 1JI1A 5GGQH 5C0AA 1ORSA 1AC6A 3OKYA 1SEQL 4KKAD 4UMGA 3S37H 5DJDA 5D5MF 5FYLD 5FYKE 4QTHA 3C8DA 2IFFL 3RU8L 4K3JL 3QG7L 2C1OB 5IUSA 3FB7A 1ZHLA 5E94B 4NKIL 3T2NL 5IVOA 3OKEB 3S96A 4MJID 4X83A 4EDWH 3ARYA 4XP1H 3TBSB 1K4DB 2HTLC 2D4DA 1CF8L 1BOGB 4NZUL 3O2WL 4Z9KB 1FGVH 3ROLA 3V4VH 2H32A 3DVIA 1WBYA 2AERT 4N90D 4WHDA 1FIGL 4EEEA 4E5XA 4HDIA 5FUOL 4JRYB 3WO4B 4TTGA 1CDIA 3C6LD 1P4BL 4ENEC 3GUTA 3LN5A 1O5DT 2YPLB 3L6FA 4MNGE 4NSKA 3GSXB 4CN6A 3PV7A 3GRWL 3VWKD 3L7EB 1RZ8A 4G6KH 1JPFA 3AREC 4YE4L 3E8UH 3VMNA 5HTSA 3LKOB 1AXTL 1CWVA 1KN2L 4KJWC 4PGBA 1KYOK 4I2XA 1MCSA 4S2SA 4ZG1A 5IW6A 3M07A 4X0KB 5EU6E 4HCRH 5EU7E 4LLVA 4KZEH 4N0YL 4L4VB 3VWKA 1H3WM 4MD4A 3BPLB 3HI5L 3MJ7B 2DQEL 4JHBA 2RIKA 5F44A 1JPSH 2NTSP 4LSDA 3O3DA 3ARBB 5I8EA 2UV3A 4KJYA 3TV3L 2N1KA 4BUGA 4EI5C 5JO5B 3QUKB 3DSFL 1R3JA 3PHSA 5I66A 5LQBL 3LMJH 3T1WA 1YEDA 5EULV 5LAXB 4JDZB 4WFFD 3VH8B 4AJ0A 1MHHA 3DURB 5HXMA 4OZFA 3FHQA 1YEHL 5GGTA 3GSWA 3V5HB 3QUZB 3SE9H 4L8SA 4MNGB 3QEQA 3T0EC 5F3BB 3FQXA 4D9LL 1OWRM 4R9HA 4S0TD 1X5LA 3O4OC 4K8RC 3QFDA 2VB5A 1HNFA 2DJUA 2DM7A 4LGSB 4PPTA 1QACA 4YUEL 4JZJC 5CD3B 1T03L 1CE6A 1J5OL 4HS3A 3EHBC 4EIZC 3FT4A 4AEIL 1KB9K 4ERSH 2NNAA 2AXHA 3A0OA 3LS4L 2DB8A 4JO3L 1AC0A 1LP9B 1QFPA 4IMLB 4O2CB 4L3ED 2UWEB 1XR9B 1QRND 4G42B 4G6FB 3ULVL 3CCHB 1RJZB 3HHRB 2XZQH 1BQLH 1B0WA 2FECL 2XTJE 1SJEB 2DIBA 4P2OB 4AK1A 5ADOH 1AIFA 1FDLH 2HA1A 2JK5B 1J0HA 3MOBH 5I17B 1MFDH 3DBXA 1RUML 4L3EA 1QRNA 1I4FB 4BELD 5IVXE 1N2RB 1ZT1A 1OAKL 4N0UA 2ATPA 3VFSA 5EU5A 1RK1A 1UYWL 4UT7H 2GTZB 2DQJH 4TNWK 4Y5VB 3AY4A 1CL7L 1H3TA 5DQDH 1AGCB 2VERN 4FFVD 2KBGA 2BVEA 5GXBB 1XT5A 5ECJE 5CEZD 4LCYA 3UTOA 3F7YB 1XF1A 3LH2L 4F7TB 2ORBH 3RVTC 3M17B 2W9DH 4WNQB 4PY7A 2ARJQ 3VXNA 5ID0A 4KJQD 3QDMB 2YA0A 3AY4C 4BH8B 4JREC 4OT1H 4XCFH 1UB5A 1CDJA 3O3BA 4X5WB 3KPPB 2LVCA 1O7SA 1OSPH 2GAZA 3MLYL 1TQBC 2FH6A 1P1ZA 1TJIH 1N5YH 4YDLB 4UV4L 2BC4A 2DJSA 3O9WB 1VGKA 4FABH 3VDBA 4PJCB 5IFJB 4KGLA 4D8PA 5JQHC 4LLDB 3MNWB 4I18C 3WUZA 4MCYB 25C8L 5IVXB 1A7QL 3RI5F 5C3TA 3IDNB 3HRZB 4HJGB 3TA3A 1MNUH 4ZUVB 5C70A 4MVBD 3KJ4B 4JVPA 4PS4L 3SKMB 4LLUB 3O4LD 2XNAB 3HUJF 1RZIA 3OG6B 5CAYB 5IB5B 3L7FA 3DRQB 4YFLI 1ZA3B 3OKNB 1SBBA 4HUXA 4PJAA 1ES0A 1KC5H 3TH2T 43CAA 2YD2A 3RX8A 2EKSA 3TA3C 1KTLB 3G5VA 4TVPH 3Q3GA 5HVFB 4OLXH 1CQKA 2NX5D 2NY3C 1BM3H 1I3GH 4QHKJ 4Z7UB 1GOFA 1UM6L 2VIRA 1JV5B 4M5YL 4AYFA 2PR4H 4H1LH 1T0MA 4QGYA 3VXPB 1U93A 4GRLC 4QHMB 2QQQA 4DK6A 4OAWB 4FMFA 1A14L 5I15L 3KLHD 2Y5TA 3AUVA 2B4CH 1IM9D 3P3YA 4YNYB 5JDSB 3QWOA 3MLRL 4YWGH 3U7YL 43C9B 3ECBA 5ALCH 2NX5A 4JM2D 4JRXD 3MLWL 4MA3A 4JN1L 4NRZA 3C2AH 5EN2B 1F3DH 4JFQA 4S1QL 4K3DL 3SDAA 2ZPKL 4JGJA 5D8JH 1IM9A 5LG1A 3A6BL 1A6TB 4LAJH 4PUBL 3NBNA 1MIMH 1S9VA 3PF2A 4P46B 3LAFA 4QTIL 4M7LH 3MRQB 3GMMA 2VDKH 3OTTA 7FABL 1BLNB 3WUWA 2Q7NA 1KEML 3DWTA 3JWOL 1CU4H 4CGTA 5HDLA 4Y7MA 4RQQB 3B9EA 1B4JL 3SDAC 1NMAL 2X40A 2Z93A 3EYUL 4WV1A 4DKFH 2J6EH 1B3JA 3CFJB 5CGYD 1A3QA 1MCCA 4PRBA 4C57C 4PRAA 1RY7B 2NY5H 3C87A 1MVFA 4P9HC 2BJML 4PJFA 1FCGA 3F62A 3SE8H 2X05A 5BOZG 1GGCL 2R69H 2WLZA 2YMXH 4I0CC 3ZKXB 1BVLA 1ZVYA 2ZG2A 2CIIA 5DGRA 2FJHA 5GPRA 3RWDB 1ZV5A 3FQNB 1MLCB 4KVNL 1NGWB 1X44A 1IE5A 2PTVA 3MLTB 3PUCA 5DQ9B 5IFAL 3X3FL 5KSBA 4UB0L 4ZFOB 4HC1H 2NY1C 1ZANL 4O5LH 1VPOH 1QSVA 1U6AH 2P1YA 5C0CD 5DD1H 4RMVA 3SDXF 2ADFL 1ZLSL 2VDRL 3SE4A 5JPMA 1WVZA 3WIIH 2PNDA 2BRRL 3HC0B 1HEZA 2KKQA 3LPFA 2A6IA 1DANU 1NDGA 3G6AA 4OZGE 2WNGA 3BKMH 4MYWB 4XCEB 1F2XK 1KCVH 1W0YT 4PBXA 3QQNA 4ORGB 2RGSA 3GJEA 3LIZL 5C0CA 5FFLA 4PB9L 1KGCD 4GG8A 5HHMB 4ZOAA 1UGNA 1JYVA 2XWBA 5I74C 5TDNB 3F7RA 3WBDA 3S4SG 5CIPH 5IVZA 4NO5B 5E95B 4LCWB 2GSGA 4Z0XA 1UWXH 1S7SA 2HFEB 4ZDHB 1I8KB 3SE3A 2D9QB 1KLUB 2K1MA 3QFJB 2BOCB 3V7MA 1QBAA 5EBMA 2DTMH 1HQ4A 2ADJA 4HWUA 2IPTL 1I1YB 4YHMH 1JWUA 2VXSL 1WC7B 3QXWA 1UWEH 4MDJB 2DQIL 1N3NB 2Q8AH 1JF1A 5JMOC 1TZGL 4FTVB 3CPLA 4KFZC 1M7XA 3RDTC 3WJLA 2GJ6A 5DWUH 5J12B 1HSBB 3IJYA 1LK3H 5L0QB 3TLRA 1CXKA 4HMDA 3MLUL 1BFTA 5J1TC 5IEKB 4XPGH 4DN3L 2WBJB 3QJHA 2OMBA 4RISL 1G6RL 5DURD 5IB3A 1E4XL 3P2TA 3WJLC 2Y7QB 2ADIB 1HCFX 4OTXL 3D3VD 3PGCA 1G9MC 4HGKC 1WGOA 1UACH 2AJVL 4NWTL 4BQ6A 2EH8L 3PWJA 1DQLH 4U1JB 4PJBF 5DRXA 1U8OB 1MAKA 1ZLWK 5CCKH 1I1RA 1EVUA 5ISZA 1BZQK 1FL3B 3MX0A 4S1DD 3W39A 4BSJA 2VLKD 3NZHL 5ICZA 1QLRA 1DN0B 1RSFA 1BGXH 4YHLH 3KYOA 1UZ8B 1TXKA 4K2UL 1NGPL 5IHZB 1A6UL 2PXYB 1ADQL 5JOPE 3OQ3B 4MB4A 2XY1A 1V7NH 2CQVA 1QG3A 3N1FC 1YDPA 3OGOE 4JG0L 1EERB 2BFVH 4WWKB 1DUYB 4XMPH 3EFDL 4X6FB 5FK9A 1FCCA 3WSQL 4WO4D 1NGZA 4ZXBC 2GT9A 1J8HA 2F74B 4KTEH 3VRIB 3O2DL 3WKNA 1CT8A 1INEL 1T2XA 4NO3B 3BKCH 4L3CB 1B9ZA 3VGBA 4XNUL 5BRZE 5EORL 5L8JB 1BVZA 4RAUA 3G6JE 4U6YB 4PP2B 3L3IB 5E5UB 5KVFL 1KCRL 1YECL 3FB8A 4YR6B 2VMFA 5F7DA 3I2CL 5JUEL 1JPST 4WO4A 5BJTA 4QT5B 3BI9X 3FT3A 4UAOC 3TCXA 4MD5B 3TO2A 3SJVB 1SYVA 1U8LA 1QZ1A 4ZFZB 3MFFA 1T80A 5M94B 5BXFA 3IAPA 4YAQB 4FZEL 4FQCL 1UM5H 4MLIA 1FORL 2DRUA 4TUOB 5FOBB 5HGHB 2O5XH 2RB8A 1ZHKB 3I6GA 4XGZB 3SDCC 5E4EB 2ZKHL 3TO4B 1B4RA 4FXKA 3OSKA 5E2WH 3W2DH 1AD9A 1MF2L 3N9GL 2A6KB 4YHNB 4GAYB 4Y5XB 4OZIE 4ODWB 4KDVA 1MFCL 3DUUA 3MXVL 4NZRL 2IAMC 4NHUB 1K2DA 4QCIA 4UUJB 5DA0B 4EZMA 4FQIL 1U8PB 3U82B 5ENWB 1ZLUK 1HH9A 1M7IA 4JPIB 5B3NA 4JKMA 3HNTH 4LPWA 4G9DA 5I1HL 4KHTH 1XCQB 3V52H 1NAMH 3DX6B 3MOQA 1JJUA 3G6JB 5HYSA 3TVMB 2BSTA 5IIEB 4OJFH 5T3XL 3EKCA 4QRQA 2P24A 2FECI 3TBWA 4LDOB 1DQML 5E8EB 4MZ2A 5K9JL 3P40A 5SWSE 1YPZA 32C2B 4UV7L 4RSVA 3OAZK 2Y06L 1R5WB 3OXSA 5I9QB 4YBLC 2C3VA 4JFEE 4R7NA 3WNOA 1BFOB 3QRFM 3LKNB 2KQNA 3V6ZA 1J05B 2IADB 2IF7A 1YN6A 5SWQA 1OGTB 2DQUH 4WU7A 1MFNA 3K81A 1X9QA 3ZDXF 1EEZB 2VSCA 3WS3B 4LPXA 2I27N 4OZIB 2AJZB 1WWAX 1NLBH 3FONB 5HHPA 4ZYKA 4TSBH 4JHAL 4CW1A 5FUCC 2B39A 2AKRA 5C0BE 1JNJA 4HZAA 2IPKA 3GM0A 4ZTPL 2ZJSL 5HI5D 2DWDB 3VFWB 4YX2H 1MAMH 4OIAA 2JCCF 5TPWL 1DLHA 2DWEA 4YXHH 3BIBX 1MELA 3T0BA 5ESVB 3GSVB 3ZDXE 4Y2DC 3GI8H 3BP6B 5C8JA 2YKLL 4XC1L 3U0PA 5D96B 1HH6A 4PTTA 3HZKA 3ZKMD 5F89A 1BVKB 5T5FL 3VD4A 1I9IH 2ZOLB 3C08H 4I9WD 4HS6B 1ZHNA 4AY0A 5IB2B 3TWCH 4JZOB 4I0PD 1S7UA 3SDDD 1DEEB 1CYGA 4XXDA 4UDTB 5DMGD 1AI1L 4YXLL 4YDVB 5E9DA 1E27B 1T89A 2ITCA 4MMXC 1CXFA 1DBAL 1JHLH 2ZUQC 4JFEB 3F6LA 3EOTL 1T4KA 3MNVB 5F7EL 3SDDA 5E5RB 5T3XD 4JE4B 5CZVH 5C3LD 4IMKA 3SKNA 5BV7H 3MRRA 4WTWA 3TESA 5E2VH 4OSUL 2Z31D 4I0KA 4L8BA 3O3AB 4KI5C 2HLAB 1HXYB 3D6GA 1EHLL 3UBXG 3NFSH 5D1QD 4LLWB 4MB3A 2AJYH 3QNYA 3I6LD 2CO6B 2IANB 1Q72L 1XGTB 4PLJD 2K9UA 2OL3L 1KCUL 3CSBA 1BFVH 5K9KA 2AXFB 3MRFB 2Z31A 3NACH 4OCSH 3L95B 4XWGH 3IETB 2HT4D 3FAWA 4V2BA 5D1QA 4PBVC 3RBGA 3L1OH 1ROWA 2EE2A 1S7QB 1C16B 5KN5B 1YYMH 5L2KD 1Y18A 3QUYD 2X2YA 5JXEA 4G5ZH 5IF0A 5KVGH 3C60A 5F7MC 5DJCA 4OZHE 5IV2B 4CVZA 5MERA 5D2NC 2FGWL 2G9HB 2VQTA 5EZLA 4YDIL 4KH2A 5DFVD 3HNVL 4RDQF 4P2QE 5E1HB 2YN5A 2RCSH 3WFDH 2FX9L 1RU9H 4Y5YB 1CK0H 4OCLC 4HH8A 4OLVL 5L2KA 3QUYA 4WTZA 2Q76B 2ZCHL 2NY2D 1I7RB 5JXEC 3QNZB 2EYSA 3C60C 3O3EB 5FHBL 2OR9H 2HP4A 2QHLA 1S7RA 1X4YA 1XCTA 3G6DL 5SX4H 4FFYH 2VZ3A 5AG8A 4NKDA 2HFFA 4M7KL 5BVPH 1IMHC 2H32H 2FZ3B 2WANA 3QCVL 4ODVH 4PJGE 1W8OA 5TJWK 1PD6A 4KUCF 3QI9C 4X9HA 4LKCA 5D7JB 3K7UA 5IMKA 3P9LB 2ZWLT 3H9HB 3RL2B 4M8QA 5KVMC 3G5XB 3MZTA 4OFDA 2OZ4A 1NSNL 1JMZA 4CAGA 1IC7H 4H5SB 2DDQH 4Q6IA 2NPLX 3FTGB 1ORQB 1P9MA 2YS4A 3CFBB 2W0PA 2VLRD 5DYOA 4JDTH 1ZSDA 3FO9B 3W9DB 4LCUB 1QKZH 3QJFA 4WJ5A 1WZKA 3QCTH 1EV2E 4OZHB 4HEME 5K59E 1D5ZB 3GGWA 3VG0H 5EO9A 4Z77B 4NQSA 4Q6IC 1NGXA 5EPMB 2BNRE 2OJZH 4NC1C 3B8YA 4TNVF 1JZ3A 1RFDH 4XX1G 2RHEA 5DJ2B 5FM5O 3QIBD 5C0IA 4UTBL 4Q9QL 1PX4A 1Q94B 4XNXH 2FLBT 3BE1L 3VFTB 1TQCC 4MAYD 1K85A 3WHXA 4U6VL 4ZPVB 3N50A 2P47B 1XIWC 3GEWB 4KAQH 4ORZC 1F58L 2YEZB 4ZFGH 5AZEL 4PJGB 3C9NB 4YK4C 4G6JH 1ZLVK 4OZFH 1XR8B 4PRIE 4XP4L 3QIBA 5D6DC 4NN5C 4ONHB 3KYNA 2CDGB 3S36H 2A6JB 3VXUD 4MAYA 2I26N 4L8DB 4WFHD 4XBEH 4Z0BL 3HR5A 4WW2B 5IOPA 1EHAA 3TBVA 3HCVB 5CZXC 3BT2L 3BH9A 4EOWL 2B0SH 4KXZI 4RBPK 1MCWW 4PJ9B 2MJWA 1MY5A 5JZ7C 2MHAA 4CRPA 3ME0A 4YDJA 1YUHA 3S5LA 3P4OB 2EIDA 2CR3A 3AS2A 1MCPL 3VXUA 4DVBA 4OI7A 2VWEE 2XWJA 3TP4A 4P4RB 4NKOB 3RKPA 5GHWL 1BHGA 1P6FA 4U1HA 1IL1A 1EVTC 3MLSH 2A9ML 2KPNA 2XTLA 4M3KB 3D25B 5DF0A 1EGJL 4CU7A 3EYOB 5JXAH 3DJ9A 4XRCB 1AP2B 4ZOEA 4KQ3H 2VXQH 3ZHKA 5DR5H 1CDUA 2IH3A 3QNXB 4ZTOL 5DK3A 4BUHA 3PABA 5D2LB 1CLZL 5I8CB 5KSAB 3T04D 3T65A 1E4XI 3RPIB 1Q0XL 5AZ2L 3VFRB 1P53A 3L3OA 4E41E 5FGBC 1JHTA 3SCMB 2VE6A 4PRIB 1A4JA 2CJUL 2FJFA 5FYKD 1T66D 5KANG 4PBWD 2X4OA 2BNUA 4OLYH 1UJ3B 3ARBD 1WIUA 1TENA 3DO3A 3BGAA 3TBYA 3STBA 4JHZA 2CGRL 1W72B 2GW5A 3MOAL 3ARFB 3HZVB 4HUWA 2DBLL 4DZBB 4XNYH 4LGRB 5C07E 1K5NA 3ZTNL 3SO5A 3BDYL 4G9FB 4OCXH 5HHOB 2EZ0D 1DQTA 4ETQA 3H9SA 4KROC 4ELMF 3UPRA 1A3LH 5FB8B 4LSSL 3KDMA 3KR3H 3SOBL 2BHUA 3V4PL 5DJ6A 1CIDA 1A1MA 1V5JA 2O5YL 2FR4B 2AEWA 1NFDE 5C0FA 5D72L 5A16B 4G6ML 3N1MC 4DJMA 1J0YA 4P9MH 5EC1B 3DV4A 1OP3K 1MHEA 4TPRH 1ND0B 1FZMB 1NEZB 4KRMB 1XGPB 2XN9B 2HH0L 1JGLH 5D5MA 4P5TC 1G7HA 4MNQB 1VDGA 1DBML 4AH2A 2GJZB 3D85B 3FFDA 5EU6D 4O02L 3VXTA 1QLEH 3ZE2F 2UZIH 5D9SA 5HYJE 2DLTA 1A9EB 3BAEH 1HDMB 2H1PL 3T3ME 2BSSB 1NCAH 1CFSA 1KN4L 5MENE 5K93A 1Q9LB 4OD3L 1I3RB 3QZWA 1IAKB 2JB5H 4G6FD 3D39B 3BN3B 5DEGA 3OKOA 4M8VA 3EDFA 2JF1A 3BZEB 1A6VL 1AR1D 5EU6A 3IU3B 5DZLA 1P7KA 1JYWA 4X4YB 4JG1H 1E6OL 4MSWB 3MGTB 4KRPB 2CRZA 4J3OC 5B38G 4NM8L 5HI3D 1WCBB 4MQSB 1MJ8H 3MV9E 5DDHB 5DJ0A 2EDHA 2VDOH 2XPGB 4GMSL 2VR9A 5I16A 2DQTH 1HE7A 2OQJA 3UP1A 3PGDB 5TGBA 2F5AH 1NFDB 4Z7WE 1HHGB 1Y6NR 3INUL 4GAJL 4NQDE 2OS7A 2AV7A 3QUXD 5SV4A 1YEEH 2EXWC 4G80B 1UQSA 1H3PL 3TZVA 1QP1A 3ARUA 4JO2L 1PLGL 3MJ9A 3EJYC 1AO7E 2I25N 5BZDB 3BSZH 2EE9A 1EO8L 4BKLB 3D5OF 3R06A 3CH8A 1HSAA 1GGIH 1IGIH 3AB0C 3ULUL 4A6YA 3QUXA 4OM1H 2GTWB 1BEYL 4NFBA 5IHUH 3TZVC 4Z7OE 3WEXA 1CLOL 2UYLB 5E6IA 1KELH 2W9EL 2RAMA 4LSTH 1RIHL 3CU1A 4D94A 4ODXA 5IR1B 3EZJB 4J6RL 1U8IB 1WJ3A 3TPUB 1BIIB 3MRHA 2MQ3A 3HC3L 5E8OA 2WUBH 1UEYA 5JMRA 2QSQA 2WM0A 4W6YB 3ZSSA 4KWUA 1ITBB 2XTJD 2AXJA 1JFQH 4P9HH 3IDXL 5MP6H 3KPNB 3DVGB 3GBMH 3U9PH 1K8IB 1EX0A 4WUUB 3PV6B 4NNPH 5DA4A 2DQCH 4PR5B 2W65B 5E6IC 4NKMB 1JP5A 3P0VH 5IBLD 3K8KA 5EO1A 4K3EL 3HFMH 4NQDB 1CDGA 4ZSOA 5IHLB 3VFGL 2X4NA 3ZHDA 4ZUWB 2BX5A 2E9JA 1OAYL 4JFOB 4OF3A 2EDOA 1GZQA 3LRHA 1ZS8A 2R9HD 1NGYB 1U8NA 2E6QA 4OIIH 4P2CG 1J0JA 3VGGA 1N26A 4KPHH 5KJRL 1EAPA 2WV3A 5L2JB 2J8UB 2YD7A 4BQBA 4ZFOL 5HHNB 4YJZL 2MTPA 2XQYK 2D4FA 4P3WA 5LXGL 2V6HA 3WNLA 2ZUWA 2VL5B 5FHAL 3MLZH 1OSZB 3CDGA 5IJKA 1BOYA 4XPFL 4GJTB 3C5ZD 4HK0A 4O58H 1WBXB 3DVNB 3EJJX 2UZYB 1RJYA 5C2UB 2GHWB 5DSCA 5IMOA 5GJSL 1EBAA 4IRJC 1I1AD 1J1PL 3B6SB 3KXFE 1V3MA 2UWEF 1AE6H 4YPGB 4KK6D 1ZT4A 4PP1D 1JMXA 2FX8H 1D9KA 3NFNA 5ADPH 3K3QA 4QRSB 5IJKC 2NY6C 4X9GA 5GSRA 2HLFD 1T7VA 4J8RA 3ARRA 4GO6B 1BZ9A 4QHLB 1JWMB 2D7OA 1QNZH 4PJIE 3ILPA 3FRPG 1FFPB 1I1AA 2BVQA 1CTNA 2W60A 3T8XB 1MQ8A 5F7FA 4MJ5A 3U0TB 4NN7C 4LSUH 4JFDE 5BS0A 4U31A 4KK9D 1D9KC 3Q6FB 3PWLA 5E7BA 3QIUC 4RMRA 1HXMA 3WD5H 3VGDA 2CH8A 3ZTJG 1LO0H 5B4MD 4YIQB 1UB6A 1T1YB 2NR6C 5HDQL 2GSIB 4G43B 1G7QB 5I8OH 1WFTA 3HPJA 5L88L 4HT1H 4KK6C 3TNNA 1NDMB 4RZCB 1OHQA 2FB4H 4RA3A 4JM4L 1Z3GH 4WU5B 3MODL 3RZCB 5I2IB 1G9MH 1GIGL 2W0FA 4PRPE 4PV8A 3HG1B 4X4XA 3TJEL 5TF1H 3GSUB 1A6WH 1ZVSA 5KSVB 3HUJA 5F70A 4WHTB 5TE4H 3KGRA 1N7ML 3Q1SH 5A2FA 3ZYJA 3DX9B 3IKCB 1ZA6B 1JGVL 4LLQB 1BWMA 3GKWL 4JGMA 3WFBL 3IFPA 4PJCF 2BHYA 5BVJA 4GW5B 2JJUA 5EUOB 3EOAA 3TPKA 2IALB 4AG4L 4PJIB 2FNBA 5CLWA 2EEAA 1CD1B 4FQHB 2OXGA 4HZLA 4R0LC 1JK8A 3GK8H 2UY7A 1SYSA 4DOHE 4JFDB 1NCDL 3VE0A 5HDBE 5C08E 4YFDB 2D7TL 2MCPL 3BZDA 2X70B 3L3KA 3VJ6B 3D9AL 4CVUA 1FVCA 2C26A 3KJ6L 3G9AB 4B0MM 3NOIA 2CDEA 1IZKA 5GJTL 4IDJL 4YXKL 4HULB 15C8H 3VXMA 5FV2A 1D7FA 1TCRB 3P73A 3ZSTA 4I48A 2QHRL 3L3JA 5ALBL 4L5FH 4LP5A 4PRPB 4C83B 4Z7UF 2I07A 1MFEL 4XMKL 4TUJB 3GJFA 3REWB 2Z4QA 4UIKH 2W38A 1MHPL 2QBWA 4LP4A 3ZDYF 2QQLL 1A0QL 1OP9A 2MWCA 1HCVA 1ZT7A 2DLFH 3UTQB 5C0RH 6FABL 1FJ1B 2F15A 4HUVA 3NFPB 2R0WL 3TBTB 1JGUL 1T20A 3V5KB 1HI6A 3RNKA 5ETUB 2HJLA 2Q3ZA 2V9RA 4WGVB 2NW2A 4J23A 4K7FA 4DOHB 3I02B 1V7ML 5KG9B 4OV5B 3KPRE 4X8JB 1MCWM 5CUSH 4L9DA 5C08B 4ZS7H 4D0CA 2EH7H 1J0KA 3QIWB 4KJPC 1A9BB 1C8PA 5C0JB 3HLAB 3VFNB 3MLXL 1G7JA 1FNFA 1T21A 2JJSA 1QO3B 1MRDL 4OZGA 2ATKA 4X6DB 1FGNL 2ICCA 4X6BA 1DQJB 5HHXL 3VGFA 1UWGL 1OLLA 2EYRA 3E6HB 4L9LC 4DTGH 4G7YH 1B6DA 1R3KA 3IU4L 2PYFB 5F9DC 4YC2B 3RVVD 5C1MB 3SKOB 1XH3A 5ITBH 3MV7E 2ZOKA 4BFIB 1IGJA 5INDA 3SDXA 3I6KA 3D48R 4MCZB 3BQUB 3RTQC 1DSFH 4H20L 5I0DA 4J3XA 4TVPE 3MA7A 2JJSC 1F6AB 3SBWC 2X7LA 1G1YA 2XQYG 3U6RA 4AMKL 3DRTA 2A0LC 2AJXH 4JY5L 1U8MB 5ANME 3QA3B 1CE1H 4HX1A 4OCRL 5I1JL 4MZ3A 3ROOB 2VL4A 3HPLB 4Z76B 3CUPA 4OLZL 3PP4H 3CU7A 1NC4D 3LQMA 2WMPA 3OXRA 1L9NA 1C5BL 2I60H 3EYSL 4G8GA 3ZE1F 2F54B 1J9CT 3IFLL 3SGEH 5KZCD 4WUKL 1F45A 3MJ8B 4LL9A 2XZCH 1NC4A 5AD0B 1U8HB 1QRKA 3ULVC 1LK2A 2VDPH 4TOYL 1FVDA 4M6NH 4C56B 2C3WA 2C3XA 5HVHB 4M1CC 4LSQL 2UUDK 3IFNH 1MFAH 1T22B 4NZJA 4UOW0 4JQXA 3PDGA 1SJHA 4O51A 5DK0B 3MV7B 3W11D 4JO1H 2P5EB 1RUQH 5KW9L 4UIMA 4BA8A 1DL7L 2IQ9L 5D7SL 3G08B 3MV8A 4RBPH 4F8QA 4LKXA 2OJEA 3KPOB 5JOPD 1DVFA 4NHCH 1N5AB 5A1AA 3CMOL 3LEXA 4P2RB 1S8DB 5DJXB 2Y6SD 4IRZH 4MDIB 4IBLT 1TTGA 4BZ2L 1K3IA 2VH5L 5I1AB 1QEWB 2P8LA 5TDOA 3FOLB 4DEPC 4S1SH 4N8VA 4NQUA 5B3JF 5F1IB 1OARH 1A1OB 3ETBF 2WINA 1TVHA 3CFCL 3QEUA 4FQXB 4RGOH 2R0ZL 3B2VL 1YMHB 1DVFC 4NQCE 4U4BA 4CUCA 5GS1B 4NRXB 5BRZD 1KTRL 3VD3A 4JVUA 1VACB 1G7PB 3MBED 1WAAF 4PGCB 2MCG1 3K4ZA 3QG6B 3KYMB 3EGSB 1KT2A 4RAVB 5JQ6L 4LOUD 1ACYL 5HGBB 5BRZA 2YXMA 1T83C 1HINH 5EA0H 3TN0D 1DTUA 2R4SL 5HVWA 3VXSA 1HNGA 3BISA 2C1PB 2HMIC 4Y0GA 5CHNA 1MVUB 4DFHA 5J1SC 3CIQA 5DGQA 3WFZA 1DE4B 1PVHA 1WAAE 4KHXH 5ABDE 1KPRA 4DKDC 1RJLA 4OF8A 4GSDL 3JV6B 1RIUH 1M6OB 2OM5A 4LASL 5AWNH 3OMZA 1KUMA 3TN0A 1EZVY 1V05A 5DHVA 2IC2A 1FH5H 2ZP0T 2VLLB 4FQLH 2QADD 5ICXB 1D5XA 3H9YA 1FFNA 1S5HB 1BD2B 4GW4B 1ZEAL 2YXFA 1BPVA 4GKSB 4HGWA 2G5BA 3I50L 4JN2A 4F7CB 5FECB 3FO0L 3MLVH 3CZJA 2AK1L 3ULSA 1QQDA 4FRWA 4LDLB 2ERJC 4GBXC 4FZ8L 4LRIC 5DRNB 2Y25A 4DZ8B 2FH8A 3FQWB 1J1OH 1TETL 5AUMB 4LSRH 1BECA 3S3SA 3L5JA 4K94L 2ED8A 5IQ9B 4BH7A 5SWSD 1I7UB 3BESR 4LAQL 5FOJA 1CD0A 3U1SL 1J86A 5HHVL 5BZWB 5JOEA 1GYAA 3NA9L 3EYFA 4MD0B 3SQOL 2O61A 2HG5B 1MEXL 4ZD3L 3EUUA 2OSLB 4ELKA 4YO0A 4M6OH 4NN6B 2V2XB 5HY9B 3KS0J 1OAZH 2D3VA 1AGDB 2BMKA 5SWSA 1OAXL 4Y4FC 4PJ8A 3DO7B 4HKXA 4X98B 3BPCB 6CGTA 1SHMA 5C0BD 1BJ1J 4TSCH 3WO3B 4PJ7E 1XGUA 4KDTA 1KPVB 5ESQB 1YC7A 1JPTH 3EOYG 2EECA 2NY7H 5C0ND 1PBYA 2DQDH 5L9DH 3LEVL 4PJ8C 1I9EA 2PO6A 1S7TB 4XCNA 2GY7B 2R2EB 5C0BA 4CN1A 1X7QA 4E42A 1VFAA 4L4TE 4U6HA 4OKVB 4GXVH 3JWDL 3AMLA 1ZOXA 3OKLA 5EIIB 5JHDB 3SKJH 3BKJH 1X4ZA 5D70L 5IW1A 3SGDI 2DI9A 1QTYT 3TFKD 4KZDH 1E28B 3MCG1 3IJSB 5I18L 3BWAA 1I9RL 2PO6C 3PG2A 3S37X 2HVKB 1GGTA 2KUTA 4XP5L 1NQBA 3QRGL 5FM5M 1KB5B 2WSKA 4HIJB 2AEQL 1AGEA 1RD6A 4P57B 1CGYA 4Z7NF 3GM8A 4I4WA 5F7KC 2AEIT 3WIHL 1GPOH 2BVUA 4LLMA 3MGOA 5E56A 5C09B 4HXBH 4J1UA 4CNIB 3U30B 1MRCL 2NTFA 5EUKB 2AJ3B 3LV3A 1FHGA 1NC2D 1GZPA 1N59B 1SEBB 4LEOB 3TYGL 5ID1A 4XPTL 1JRHL 2XRAH 1IVLA 4HWBH 4WIQA 5H94A 2AXGB 5IROA 4HLZG 5DJZA 4MS8D 2L7JA 1EHXA 1WF5A 1JVKA 1MPAH 1KFAH 1GRWA 4X99A 1G0YR 2L0DA 2XA8L 4L4TB 5DJYB 4XP6L 4GXUN 4DGVH 4I3SH 1NC2A 4DKEH 3GSRA 3LRSA 5T3ZL 3NCJL 3NPSB 2VKWA 3RUGE 3CSYA 1NBQA 1UG9A 2Z8VC 3QBTB 5IROC 1JNNL 1H5BC 3Q0HA 4TTDC 3U4BL 3M45A 3K8LA 1MI5B 3PIQA 5D93C 4P2QD 2AGJH 2W1NA 5MI0C 1BBDL 1ETZB 4U1NB 1LHZA 2CUHA 4NT6B 3RWGB 2NY0D 3TT3H 3U0WL 1QR1B 1MHCA 1W72L 2X5PA 5F3HB 1XGRA 3QPXH 4K9EL 3D2UA 2E6JA 4MQXC 2NLJA 2DF3A 4MAUH 4XVUD 5I19H 3RX5A 5D1ZD 4XCYA 4DW2H 1RZFL 4R97B 1XGQA 3CD4A 5GRZA 4KI1A 3M1BB 3AM8A 3GDBA 3KYAA 4GAFB 5J9PB 4MX7A 2RFXA 2HKHL 4HLJA 4TUKL 5GGRB 3E2HB 5JOFB 5I6XB 4P59H 4XMLH 4YHKL 3VG9B 3ZHLA 3A6OA 4HFWB 5IB4A 3HNSL 4JFPA 2VDMH 5D1ZA 4OGXL 1U3ZA 5AAWA 3HR6A 3EW3B 3DMMA 3AM8C 3RWCB 1T2JA 2R2CA 1J18A 5EO0A 2Z92B 4OUUA 3LQZA 4HWNA 3ZKQD 4EUPH 1HWHB 1A64A 1IT9L 4R2GB 1F4YH 3O2DA 5B39A 1NAMB 1FO0A 3QXUA 3IVKA 2UVEA 4HJJL 2BNRD 2J3SA 1OCWL 4RGMC 3TCLA 4FQJL 1WWBX 4GG6E 4MA1B 5F1KC 3DMMC 2EE3A 1AY1H 5JW5B 1U2HA 1M71B 1P4IH 4QYOA 2R0KH 2UZXB 3HE6C 1DP0A 1LDPL 4BSVA 3U46A 3MQIA 2J1KA 1SVCP 3NIGE 3LKQA 1TJGL 3LKPA 4MXWL 2BY1A 1SY6L 5KOMC 5KSAD 2DQHL 2VAAA 4OLUL 2BNRA 5HYFA 3HMWL 3BHBB 2XWTB 4TNWF 4ZO9A 4OFIA 3GHEH 3CZFB 2ZCKH 4PRID 4HQQL 3CLEH 1SM3L 3B3IA 5FIEA 3I75A 3BDBA 2V17H 3T77A 3J7HA 5EH1A 1CBVH 1IAMA 1A7NH 4P5MA 2A1WH 1KJVB 1PW3A 2AJSH 2CRIA 4M7JH 1K6QH 1T3FA 4XB8A 3WNNA 1FPTH 1TVBA 5DO2C 5J3HD 4U1GC 5D7IB 5C6TL 5IBUG 1E6JL 3MJ9H 1E4WL 3STZA 1F6FB 3ZKNC 1D6EA 1OY3B 3UTPE 4APQD 2LU4A 4K23L 4RGNE 1DQDL 4XC3H 4MNHB 3HMXL 5K33A 2DYPD 3U36A 1I8MB 1RUKL 2QQNH 5DUML 4GG6B 3LHPH 3DGCR 3TJHC 4E9LA 4RIRB 1LEIA 2JJTA 3V6FA 5GS0D 1KLGB 5GRJL 2OXHA 3PP3K 1C7TA 4TSAL 4Q9RL 1HHJB 4APQA 2EC9U 1FZKA 4R4FL 3OX8A 4J3UA 1N6VA 3EYQC 2DYPA 5D7LA 3IDMB 1CICB 2B5IB 2K7PA 2XACC 3DIFA 3HAEH 2ZG3A 2GCYB 5C0AE 1WFOA 4P99A 4E41D 2NXZB 3KAAA 5EFIB 4KGJA 1T5WA 5JIHA 4LU5H 2F53B 5FYJE 4X9FA 5ACZB 5BV7B 4JPKH 5DXWA 5F97E 4LCCA 3UO1L 1VADB 2XZZA 3PQYB 5C07D 4E41A 1PSKL 3K1KC 3QSKB 3X12A 3FN3A 1NUGA 1EFXA 4WENB 2CK2A 4WW2F 4ODHL 4RGNB 5GGVH 4PB0L 4PJHF 1IAOB 3UAJD 1NMBL 5EWIH 2LFGA 3CX2A 5GGSA 1JZ8A 5H35A 5EZIH 1R5VA 4FQ1L 1IKNA 3O8XA 5E8DL 2MPAH 4JKPH 3MRNB 2AI0L 1QBLH 2X4SB 2R1XA 5C07A 3NPZB 2BERA 3UJJL 1U92B 4LIQE 2YD8A 2XQBH 4LRNH 3GIZL 3GSNA 2Y1VA 3W9EA 1C5DA 2NZ9C 1KEGL 1F11A 5C6PB 3BN9C 2WLYA 4QRPA 1I7TB 1EEYB 1LD9A 4PJHE 1IJ9A 1OL0A 2ED9A 4PGEA 4N8PA 5L7XL 4WI4A 5HI4C 3C6SB 1DLFH 1LO5A 5HYJD 1IKNC 3O8XC 3S37L 1ORSB 3PWNA 4LVHC 3N85H 1G9NL 1GCFA 5DJDB 4QHNA 5MEND 5D2LF 3VFMA 4QTHB 4EN3A 4HXAH 3FB7B 4XP1L 3W82A 3DX7A 5J11B 3S96B 3QDJE 5IB1A 3T0EE 4XI5C 3E6FA 3CC5A 5HYJA 4HHAA 3ROLB 1C5CH 2H32B 1WBYB 4F7PA 5MENA 3MV9D 4E5XB 4HDIB 4QY8A 4JQVA 4EN3C 1NANI 1AQDA 1LO2L 4OBRA 4M4PA 3LN5B 3GUTB 1PY4A 3L6FB 3QEQE 4G6KL 4NSKB 4ZAKA 1YQVL 2APTA 4ESKA 4R4ND 1CDCA 3E8UL 1RZ8B 4WFFE 1AO7D 1OT1A 5F72S 5KS9F 3MV9A 1UZ6E 4PGBB 4JEGB 4I2XB 5F9JA 4OLEA 4XBPA 2IGFH 5IW6B 1WFNA 1U36A 4Z7WA 3AXLA 5IQ7H 4LLVB 1QHPA 3CFIC 4N1HB 3VWKB 1NBVL 3VWJD 2C3HA 4TRPH 4ZAKC 1Z9SA 1JPSL 4MD4B 3UJTL 3PDOA 1AO7A 4K7PL 1MSPA 3DXAE 4KTDH 2C1OA 3O3DB 5D1XD 5I8EB 5LCVH 2DLHA 5CEYA 3BP4A 4KJYB 2IFFH 5F93C 1ED3A 5CP7A 1PQZA 4PLOB 3T2NH 1R3JB 2R0LL 3QPQD 5I66B 4OD2A 1YEDB 2D7QA 3WFHA 3QDGE 4QRTA 4WFEE 1CF8H 4QNPE 1IAIM 1IZJA 1CZ8H 5JIIA 1C12A 1MHHB 3BH8B 3MNZA 1FIGH 5FYKU 1GSMA 4XXCA 5D1XA 3SE9L 2X4PA 5FUOH 3GSWB 2CK0H 4L8SB 3QEQB 1EXUA 3FQXB 2X4UA 2DBJA 5E08L 3NCMA 4JR9L 4M43L 3GRWH 1BIHA 4TN9A 3QFDB 1SQ2N 1EEUA 3UC0H 3K2UH 1IGFL 3V95A 4X7FC 1AXTH 4HPYH 5D1XC 3NCYP 5SX5K 4GRWB 4P2YA 1CE6B 3LPGA 4CVWA 1Q9OA 4HS3B 3FT4B 1PG7W 1OVZA 2NNAB 3GJFH 3WHE0 1C7SA 2WW8A 3HI5H 2DQEH 1Y6MR 4HIHB 3TT1H 4KQ4L 2QQKH 2FJGB 1BQLL 4RNRA 5DRZB 4BSWA 4JFFA 2E6PA 1PJ9A 5TE7H 5ADOL 2WWMD 1FDLL 3DSFH 5ERWA 3PXHA 3MOBL 4FA8A 2DL9A 2E9WA 1MFDL 4POZD 3KXFD 3BPLC 1AIFB 2AV1A 3LCYA 4YZFE 3IGAA 5FDWA 3GSQA 3DBXB 4QWWC 1OTTD 2LTQB 1T1ZA 4L3EB 4UT7L 1QRNB 1L0YA 1PEZA 1YEHH 4GH7B 1ZT1B 4N0UB 3VFSB 2ATPB 5EU5B 1RK1B 4RA0C 4PYGA 3LKSA 3MUHL 1PKQA 2QEJA 2HT3C 2DLGA 5DD6A 4HCRA 4XPBH 4GKZA 1RZ7L 2EO9A 3U79A 3QHZH 4JFDD 2ORBL 3FN0H 4LCYB 5KAQG 2JIXA 5GS3A 1TQBB 4Y16A 3FL7A 3HZMA 1JRHI 5TQ2L 3QUZC 2Z9TA 3I9GL 3QH3A 4LHUA 4PY7B 4OT1L 4XCFL 1J5OH 3F7PC 3VXNB 5ID0B 1J1XL 3CFEA 2OP4L 4JO4H 4WHYH 1HILA 2BNQE 3RWHA 5ITFB 1UB5B 3O3BB 2E9IA 2F9BT 3LS4H 4G42A 1TZIA 4PRHE 4JO3H 3RGVD 1TJIL 1N5YL 2APWA 3V6OA 2GAZB 2OTWB 3CCHA 4Y16C 1W2KT 3ULVH 2H41A 4PRPD 3VGAB 2BC4B 1VGKB 1L0XA 3RVXD 3RY6A 4P2OA 2MQCA 4D8PB 2NX5E 3CDCA 2CDFA 1VKXA 1B2WH 1I4FA 5HYSG 3IDIA 1RUMH 4R7DA 1P5VA 1J0IA 3TA3B 1CFQA 1JTPA 1OAKH 3KNBA 4JQIL 3O6FD 1RZIB 2VNCA 4OGZA 4XVTL 3L7FB 1CL7H 3RY6C 4P2OC 4UBDC 4NPYA 4UU9A 4Y88A 5IBUB 5BO1L 2GK2A 4PJAB 1ES0B 4IIQA 2HWZL 3H8NA 43CAB 1HOCA 3LH2H 3QIWD 1HN1A 3VCLA 2CUMA 2EKSB 4OLXL 3O6FA 4Y5VC 3G5VB 1BM3L 1I3GL 3ARXA 3Q3GB 1FL6A 3RVXC 2PR4L 1MREH 4ISVA 3DHMA 3OJMB 4H25A 2VIRB 3GZKA 4Q97A 3GFUA 1Q38A 4PJFE 4WEUD 1PYWA 1T0MB 1U93B 4JFYA 4YWGL 3J8F7 2Y5TB 5ALCL 2WIMA 4R4BA 5CFHA 1KENH 1CGSH 4UV4H 2YD4A 1VA9A 5EB9A 1A7OL 3ECBB 2NX5B 4NO0A 5F7HA 1H0DA 3TIEB 1OD7A 5F7LB 5KSBE 4MA3B 4NRZB 3PHOA 4F9LA 3L9RA 4OI9A 1H3VA 4JFQB 1E4KC 1AFVH 3SDAB 1UCBL 2PCPA 4PGZA 3TH4T 3MROA 4NZTH 4YDLC 1IM9B 3O9WC 1P4LA 1KBGH 2GUOB 3DRQA 4IRSA 4NQVA 4HK3J 3FFCE 1CU4L 3KPRD 3WUWB 1QFWL 5EUOF 5EBWA 4R90H 4DKFL 2Z93B 1YEFH 2HTKC 3KJ4C 1QBMH 1U3HD 4HUNB 4WV1B 2NY5L 5GZNC 3FZUC 4U1LA 3F12A 1EH9A 3SE8L 2R69L 3MACL 1FSKB 4IRSC 4WW1A 2NY1B 3KPRA 4PJFB 2XKUA 1QPPA 1UM6H 4LVEA 1KIRA 3ARWA 4M5YH 4AT6A 2CIIB 3MRJA 4X6CF 2FJHB 4JFHE 1KGCE 3LD8B 1A14H 2V7NA 1U3HA 5DHVH 4WI6A 43C9A 5EBGA 3MLRH 5GISL 4TVPD 5KSBB 1S3KH 4O5LL 1U6AL 4WGWB 2DKUA 2YOCA 2BOBA 4LBEA 1JNHA 3WIIL 1BJMA 1JF5A 2GJ6E 3VI3E 5DVOA 3H42L 3VFPA 5JPMB 4M6AA 2EIBA 3BKML 5C0GA 1HEZB 2E7MA 4XPAL 1FLTX 2VSDA 4Y4KD 5FO8B 1JZ6A 2A6IB 4PUBH 1URLA 1NDGB 3G6AB 2D2OA 3ULUC 1JGEA 1BLNA 1I8LC 1IGTA 1T5XA 5I76A 1JZ2A 5ANMA 2NZIA 3GJEB 5C0CB 4H1LA 1G0XA 4GG8B 1NMAH 2ARJA 4P0DA 4XNZC 2XWBB 3ARGA 5EC2A 4Y4KA 4P46C 3HTLX 5IVZB 4LCIL 3ZE0F 3PNWA 2JB6A 2E7LA 2GSGB 4Z0XB 1S7SB 3WXWL 1X5IA 5DK2A 2BJMH 2DTML 3EDKA 1GGCH 5ISZE 5E0QA 5EBMB 4YHML 1MLCA 4KKBD 1HQ4B 1YY9C 4X6DF 2ADJB 1JWUB 2Q8AL 3ARGC 1A6ZA 1WT5A 2HFTA 3EO9L 3OB0H 1JF1B 2NY4C 3O6ML 5IFAH 3X3FH 4WI7A 1QFWM 2EDQA 3KG5A 3CPLB 5GSVA 1ZE3C 5DEZA 3ZKXC 4UNVA 4AIXA 3HA0A 4OZ4A 1LK3L 1ZLSH 3IJYB 2VDRH 2ZSVA 2BRRH 2J6EA 2D31A 1MWAA 2JJVA 3QUMA 3WNKA 2J88L 1WT5C 2CMRL 2EKJA 4X9IA 1NCNA 3BEVA 4A2LA 3S35L 1AHWA 1J8HE 4UT6L 4I5BA 3QJHB 4NQCD 3LIZH 5IB3B 1AGBA 3RQ3A 1UACL 5DVLA 3PGCB 1KB5L 2FATL 1HKFA 1IFHH 5TF0A 1JWSA 4NCC2 3WXVL 2ZG1A 3PWJB 5CGMA 3RX7A 5DRXB 5H37H 5FGCE 2BOCA 5ISZB 4NQCA 4HKZB 2C4XA 5DURB 4JY4A 3UX9B 4CDGC 4YHLL 2QR0A 5EOTA 5ICZB 3FQRA 1QLRB 3STLA 1ZHBB 3MREA 3KYOB 5J0BA 5HD8C 1BZ7A 2DQIH 4LK4A 5F88A 1ZMYA 3ILQD 5CSGA 1UKSA 4JVWA 1YDPB 1FAKT 2MFNA 1DJSA 1OLZA 2VLKB 2VDNH 3FB5A 3L5IA 3S5LG 2ADGA 1KCKA 5FK9B 2CSPA 4UAOB 4M7ZC 5INCA 3MLUH 5CIPA 1WAAA 3BKCL 2GT9B 1J8HB 4NQEE 3CVHA 2W07A 1CT8B 3SGJC 4NC2B 1UXSA 2Q87A 5I1IH 3GMNA 4RAUB 5AYQA 5J12C 2XZAH 1MJ7H 1NPUA 3FB8B 5L0QC 5F7DB 4WO4B 5KVDL 5BJTB 4MLSA 2YRZA 3WN5A 1U8OA 2AJVH 3FT3B 4GRMA 3TO2B 2EH8H 1F8TL 1U8LB 5FGCB 2WBJC 3MFFB 1KOAA 5FCSH 3LQAC 5FUCE 1CN4A 4KK8C 2O5XL 1DN0A 4C58B 1FNGA 5E2WL 3Q5TA 3I6GB 3S36X 4P3CL 1KIQA 4FXKB 1AD9B 3WN5C 2ESVA 3HI1A 1AXSA 1ADQH 2AVGA 1GGYA 3VW3H 3B9KD 4WWKA 4P23D 4JG0H 3DUUB 3BRFA 1KIPA 4R8WL 1OGAD 1K2DB 4XHJC 1O7VA 3CVIL 4QCIB 2H2PC 1II4E 1XZ0A 3BGFC 3EFDH 2YUWA 2ZCLH 1R0AL 3HNTL 3RGHA 4MWFA 1HH9B 1M7IB 2F74A 2OTPA 5GRUH 1NAML 4UTAH 2PXYC 4G9DB 4L3CA 1G1CA 3O2DH 5CJXA 1INEH 2AQ1A 3P4NA 4OJFL 3B9KA 5HYSB 3GMRA 4P23A 4WWKC 3CXDH 1FFOA 2H3NA 3VH8G 1OGAA 4L4TD 3MRLA 5MEPA 4PJ7A 2P24B 3TBWB 1LEGA 2LV4A 5JUEH 1NBZA 4PJEE 4PREA 3ZLQC 1UM4L 1YPZB 1N6QH 1XAUA 2BHZA 4K71B 5E9DE 3HB3D 1OTSC 5CS7A 4KI5E 3UTTA 4CN4A 3RVUC 3OXSB 1T0PB 4FZEH 2C3VB 3R0MA 2DQUL 3V6ZB 4RFEA 1FORH 3PWPE 4OFYA 1YN6B 5T33H 5SWQB 4WU7B 5CKGA 5HGDA 3SN6N 4DGIL 3DYMA 1NLBL 1KXVC 3VXRD 1OD9A 4TSBL 5IMMA 1JYXA 4GQ9L 2EXYC 4XH2A 5HHPB 4Z18A 4ZYKB 2VDQH 2AKRB 1UEMA 1MAML 1OF2A 2IPKB 1XEDA 4NZRH 4N9GA 1R5IA 3Q6GL 3AAZA 1Y6KR 5E4EC 3TO4C 5DEFA 5T1MA 4FQIH 1DLHB 2DWEB 3GI8L 4B7LA 3VXRA 1F3JA 1HYSD 2ICWA 5D2NE 3DX6A 3QQ3A 2MNUA 1NL0L 5I1HH 3U7AA 4Z7VF 3U0PB 4U1IA 4PLKD 1HH6B 4PTTB 3HZKB 3TWCL 3OJDA 2EDNA 4QRUA 1M05A 1ZHNB 4ZO8A 3N1PC 1S7UB 3ARDD 3KPSE 4XXDB 32C2A 3RRQA 1JHLL 1G7MA 5E9DB 3V5DB 12E8H 2ITCB 3QAZC 4UV7H 5ILTH 3TVMC 2CLZA 3D0LA 2Y06H 4PG2A 5FV1L 3WDHA 1T4KB 4K07A 2Q8BL 5GS0H 2IADA 4UZGA 4OI8A 2X4QA 5CZVL 1A5FL 5BV7L 2OCFD 5E2VL 1EEZA 4I0PB 3ARDA 3SDDB 3SKNB 1MIEL 3MRRB 3RUGA 1UFUA 3UTSD 4MQ7A 4L8BB 4LF3A 2Z91A 3G5ZA 3NFSL 4M3JA 1OAQH 2AJYL 3JXAA 3RP1A 2HJFA 3RWJA 4Y19D 4B53A 3QNYB 4ZTPH 3UJIL 4F7MB 1BFVL 4LARL 2G2RA 2EYTA 5TPWH 2WUCL 5K9KB 4NWUL 4E0RA 3QQ9C 4ZNEA 1IEAB 5TE6H 4XWGL 2Z31B 3UTSA 1U58A 4Y8AA 2H2SD 3HKFA 1JN6A 2YKLH 5HVGB 4NC1E 4XC1H 5CWSA 1YYML 3T3PE 5D1QB 1BVKA 4U05A 4Y19A 4HS6A 4G5ZL 2FO4A 5KVGL 2IBGA 3VA6A 4QXTA 1KCSH 1Y18B 4Q74A 4OKDA 5F71A 5IF0B 3C60B 5DJCB 4YDVA 4WDIA 1I85A 5MERB 4CVZB 4BFBD 5EZLB 4O2EA 1RU9L 4F3FB 4YLQT 4M48H 5JLZA 1CK0L 5D96C 3RWEA 5DVKA 3MNVA 4BQ9A 5HYQA 5DMIH 3EOTH 5DMKA 5L2KB 1FRGH 3QUYB 4NNXA 1MJJA 2OR9L 3UYRH 5F7EH 1F3RB 1ZTXL 2EYSB 1QFWI 4YPJA 5BVPL 1S7RB 4YFEA 1XCTB 4S1RH 3K4DA 1N4XH 1KYOJ 3A6CH 4GAGL 1QLFA 2HFFB 2GQHA 4ODVL 2YD6A 5F7NC 4Y4HD 5FYLL 4PGJA 5C9JA 2F19H 2Q6WA 1PZ5A 5DMYA 1EHLH 3WL9A 3WCYA 4LKCB 5IMKB 2M2DA 1ZGLM 2Q86A 4M8QB 1I75A 1IC7L 1U8QA 3I85A 4LPVA 3ALPA 3DYPA 4GFTB 2I9LA 5JA9A 2QSVA 4X80L 4D2NA 4Y4HA 3SEPA 1QKZL 1S7QA 4FHBD 5DYOB 4YHYB 1ZSDB 2IMMA 3RVWD 3QCTL 3PL6D 1FAIH 1DBBL 3UTPD 2YR3A 4J4PA 3QJFB 2IG2H 4WJ5B 4RGND 3VXUE 2G9HA 4LQFH 3GGWB 1KNOA 2A6DA 1YNKL 1LEKA 5EO9B 1QYGL 4NQSB 3MR9A 3K1DA 1RFDL 5E8PA 2VUOA 4LVNC 3GHBH 3HNVH 4PIRF 5DC9B 2DMBA 4XNXL 4OQTA 4GMTH 4QXGH 3DSNA 4URTB 4Q58C 1OP5H 3PL6A 1IC4H 3S4SA 4J4PC 4OLVH 2FDBP 5DVNA 4KAQL 2ZCHH 3WHXB 1A8JH 2FBJL 2HTLD 3C8HA 3JTTA 2O5ZL 2I9TA 1S7VA 5E99L 4X6EB 5C0AD 1U0QA 3PXJA 3F5WA 3QCVH 5GGTL 3CLFL 3QIBB 3O0RH 4KV5F 3KYNB 5FYJD 1REIA 4MAYB 2B0SL 3HR5B 3MSPA 5IOPB 4ENED 1RHFA 1NSNH 4K94C 3TBVB 5C9KA 3BH9B 5FM4A 4DUWA 5FGSA 3BMVA 1NJ9A 4JFXA 1RIVH 3ARED 3GMQA 5C0DA 1Q9WA 2MHAB 5M95B 4YDJB 1YUHB 3S5LB 1GAFH 5D7JC 4KJWD 3H9SE 3SY0A 3VXUB 4DVBB 2F8OA 4KVCH 1VFUA 2YSSA 5DJAA 5D7IF 1A21A 5H2BA 2XWJB 2KQMA 4BYHA 1IC1A 1MAJA 1UXWA 1VFBA 1IL1B 4M9OA 4U1HB 3GB7A 3BD4A 2YA2A 5JXAL 4O4YH 3AREA 2VXQL 5E2TH 1S7WA 4YBQC 4X7EC 3B9AA 3MRGA 2IH3B 3K2MC 3AFLA 3PGFH 4UTBH 5L6YL 4EI5D 3PABB 5D5ME 5BQ7A 5I1GL 3BE1H 3VDCA 4CDHA 5JTWA 3T65B 4U6VH 2V5MA 5CD5C 3L3OB 4YFLF 1JHTB 1F58H 3WLBA 2VE6B 3RKDC 1Q1JH 1A4JB 4KROB 2FJFB 1Z2KA 3QCUH 4OLYL 1FYTA 5IMLA 2X4OB 2A6JA 5LBSH 3JWDC 3IRZA 4EI5A 4DCQB 2DI7A 2BDNL 3QDJD 1YMMA 3DV6A 3IRPX 4JY6A 4PJHA 3TBYB 4XNYL 3T0ED 4Z0BH 3B5GA 1V3LA 3P11H 5I71B 4PY8I 4HUWB 3QO0A 1K5NB 4OCXL 5CJBA 4KY1L 4CADA 4K8RD 4NKQB 1A3LL 3RAJH 4BZ1H 1JIBA 4ETQB 5AAMA 3UPRB 1MCKA 3KDMB 5DJ6B 1A1MB 2O26U 3IJHA 3QDJA 2PN5A 1H3XA 4WW2C 3DHJA 3T0EA 3GIVA 1TMCB 3U7WL 3QEQD 1BX2A 3EHBD 5CINL 4ZNCD 4LLYA 4PJ9C 4TPRL 4EI6A 5GHWH 5CEZL 2XG4A 3AS1A 3DV4B 1A2YA 1MHEB 1AP2A 5DVMA 5GRYA 3C5SA 4OCYH 3IKKA 5I1DA 1EGJH 2EDJA 5TDPA 1RHHA 5D5MB 5D2LA 1IGCL 1RZGA 8CGTA 4JZJA 4ZTOH 4FP8L 3P4MA 5EIVA 4AH2B 3BIKA 3FFDB 1UT9A 2OYPA 1CLZH 2X9XA 5JR1L 3SCMA 1Q0XH 5AZ2H 1CFSB 5FKAA 3DXAD 5HYEA 2JB5L 3C09C 1GC1C 1MLBA 3X17A 2CJUH 3QZWB 4NCC1 4C54A 5DEGB 1I1FA 3OKOB 4LSPH 4POYA 1CGTA 3OWEA 1INDL 1NCWH 1VHPA 4QF1A 5EU6B 3HZVA 2CGRH 3GKZA 2BCKA 5IP4A 3MOAH 3QDGD 4WFED 3SCMC 5F21B 4NBXB 5T1KD 2G75A 3DXAA 2JELH 2DQTL 3ZTNH 3BXNB 5DJ0B 4XP9H 4YHOL 2J2ZA 5KS9A 5I16B 3T4AA 1UJ3C 3LPWA 2OQJB 3RVTD 5TGBB 1U9KA 4I77H 1BBJA 1OB1A 2AV7B 3PJSA 4WI9A 4K9EC 4ZSOE 4DVRH 1UQSB 3ARFC 3QDGA 3P0YL 3PE9A 4G6MH 4BQCA 5T1KA 1ND0A 1FZMA 2LVEA 1R24B 1S9KC 1B0RB 5SWZE 1GGIL 3BKYH 3R06B 2CLVA 2HH0H 1N0LA 1TFHA 1HSAB 5CZKA 1PY9A 4OM1L 3FT2A 5IHUL 3GBNH 4A6YB 3QUXB 5IGXH 5F7YC 1DBKH 1WBZA 3GBLA 3NGBC 4LSTL 3NCYS 3D18A 4RFNB 4PFEA 1AJ7H 1YNLH 1KN4H 5BMFH 3RBSA 4UINH 4LSVH 4ODXB 5CSZA 1FL5B 1G7LA 5IM7A 1LWRA 3WS6A 4CJ1A 3MRHB 5DS8B 5J6HA 4R96A 4GW1A 5E8OB 5MP6L 4X4YA 3U9PL 4BFEA 4GOSA 4IHOA 3L5HA 3DLQR 4HK3N 1E6OH 1T0NA 4PG9A 1WCBA 4I18A 3P0VL 5DDHA 4QRRE 2PW2A 3HFML 3NH7L 5EOCH 5EO1B 3F65A 3DX8A 2X4TA 3WS6C 5GRVK 1S78C 1SMOA 3TA3D 2H45A 4ZSOB 1IGYA 3KWWA 4MXQC 2E27H 4WHCA 5GRWA 3V8CA 3RHWK 4GAJH 3OL2A 2XTJB 3T1FA 2NY3D 2X4NB 4X9BA 3WLWC 1LE5A 4KRPC 4JO2H 4IDLA 1GZQB 5BS0E 4KPHL 1L7TL 1ZS8B 3NIFF 3UCRA 4GRLD 2H26A 4F9PA 1EO8H 3SHSA 1EAPB 2X4RB 3OPZL 5EDXA 2DM3A 3KLDA 3ULUH 2BNQD 3MLZL 4D0BA 2OBGA 4H88L 1BEYH 5F1OB 1H8OA 3OKDA 3CDGB 4GRWF 4PRHD 2W9EH 4GRLA 2P5WD 4HK0B 1RIHH 4F9PC 5KBNC 4J6RH 2EDLA 4ONGH 1V3KA 2R2BA 4MMZC 1RJYB 3HC3H 1AE6L 5DSCB 5IMOB 2GIYA 2BNQA 1K8IA 4XNQA 4EDXA 2FX8L 1MCRA 3PV6A 4NN7B 2CO7B 3IDXH 2VAJA 5DD5H 1ZT4B 1NCTA 3HUJE 3UBXA 3NFNB 4QHUA 4PRHA 3C5ZB 3MCKA 5GSRB 1FBIH 2P5WA 3G9VA 3SDAD 4J8RB 4PJDF 1Y0LA 1QNZL 1BZ9B 3BZ4A 4K3EH 2R15A 3ILPB 3B5TA 5E6YA 4KDWA 1I1AB 4LSUL 2BVQB 4O00A 1KJ2A 2ID5A 2W60B 5J06A 3VFGH 5D6CA 3OR6A 3MRIA 3DYOA 5BS0B 4GQPH 3CGTA 2ZUTA 2NYYC 1FE8L 5MHSE 2ZSWA 2GY5A 3PWLB 1HXMB 2AQ3A 4LHQB 3JV4A 5KJRH 2DM2A 5I8OL