1J2JA

Crystal structure of gga1 gat n-terminal region in complex with arf1 gtp form
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
165
structure length
165
Chain Sequence
GSMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords ADP-ribosylation factor 1
total genus 58
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2003-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j2jA00
2OBLA 4C7OB 4OL0A 3C41J 2WPDD 2OCYC 2B8WA 3CM0A 4QFMA 4TL7A 2F1IA 2Q9BA 2W83A 3KJIA 1R8QA 4KV9A 1FOEB 1DG3A 3QXHA 2O8FB 3QJYA 1U0HC 4QBIA 4ZCIA 2VA8A 3QF4A 1AGRA 4MGZR 3UXMA 2AWNA 4Q02A 2I4IA 2OM2A 1SKYB 1VYTA 2O8BA 2GRJA 3IPXA 3MUFA 3TAUA 3S1AB 3FVQA 3R9WA 2Q3MA 4TZ6A 3NEJA 1NIJA 4EQ6B 2WWIA 2EYQA 4LDJA 3NC1C 1FMLA 2FEMA 2E1RA 2DFKB 2V54A 4G1UC 3H1TA 3IBYA 3T35A 4PQYA 1Z22A 1E2PA 3U2QA 4RD3A 1UFQA 4JLNA 2BHRA 1MABB 2HYDA 3PFIA 4DUGA 4IFEA 4IVPA 2ZVQX 4BFVA 2D7CA 4F91B 3GLIE 3H84A 4M4SA 2XITA 5CITA 4TMKA 5B57C 3QY0A 3LXXA 5BXQC 5JLJA 3I61A 2G1KA 4EAQA 4EPYA 3MLEA 4V02A 3PJRA 1JB1A 1KJWA 3JZAA 3EIQA 5GJBA 3GJ5A 1N6LA 3KJHA 3ZS9A 5E95A 4EQ6A 1CP2A 1VCOA 3LX5A 1AQUA 2FPMA 1VG1A 2Z83A 3OZXA 3T1QA 2YOFA 4C0JA 1E2QA 2ZTSA 3QUSA 4ZIRA 1Z28A 1Q1BA 2O0KA 1WQ1R 2ZRMA 3CNOA 2JAQA 4LHXA 3TSZA 1EX7A 4JKIA 1NRJB 5FUYA 5JCPA 5FBLB 2AX4A 1YVDA 5FL3A 2DFTA 4M0LA 4NYIQ 4ON9A 2HYIC 1GKUB 1JEEA 4LOAA 1CBUA 3PITA 4C0LA 1XWIA 4RKEA 1EGAA 1KDRA 4MYUA 1T8TA 3F0TA 3LXRA 2AXNA 2CE2X 2IW3A 4NYMR 1G8HA 2B6HA 4ILEA 4B3FX 5C1BA 5TV2A 3FMFA 3WHLA 5JEDA 4TLBA 3TUZC 4KFUA 1MKYA 2GTPA 1XEWX 3KJEA 3OHMA 2BEKA 2MMCA 5JSZA 1P2UA 4A8JA 2QBYA 2UKDA 4Q9KA 2QPTA 3R8CA 1Z0AA 4IRUB 1FFHA 1W48A 1JNYA 1KMQA 1Z5ZA 3LV8A 3A1TA 1CS4C 3B9PA 3T15A 5B2ZA 4FW9A 4EDHA 3THOA 2QENA 3DL0A 4X8MA 1N6OA 1OF1A 3UATA 4DEYA 2F1RA 4HAWA 2Q6TA 1CEEA 2HJVA 1N6KA 5TB5A 1KY2A 1Z83A 2ZSAA 2WOOA 3LBIA 4TTQA 4TQAA 1MRSA 4UJ3A 5IDVA 2JLQA 4XSHA 1S0UA 2G1JA 1EFUA 3FOZA 1I4LD 3REFA 4URUR 4Q4HA 4DLUA 3RDPA 1US8B 1MO4A 4TMWA 1ZBDA 2PL3A 4V0NA 3U61B 2QTFA 2AN9A 3LBHA 4YLGA 3W8RA 1OHHD 4BLTA 1U8YA 3VR5A 2J3EA 3TQFA 1ESNA 3AKCA 4ACBA 3THYB 4IJMA 2BMEA 2OHFA 4MGIR 4JBXA 2CL6X 1PLJA 2REXB 4CRWB 2AHOA 4DLXA 1NG9A 2OBNA 3AVVA 3ZVMA 3TVTA 1MV5A 1LS1A 2BV3A 4DT1A 1TAGA 1LFDB 4BFTA 5E7IA 4E03A 5F9HA 2RGBA 2NMVA 3AVUA 3RLFA 1SVIA 1GRNA 3RRZA 1BMFA 2NO1A 3NBZC 2B21A 1P75A 1GL9B 1OXXK 4EPRA 5FPHA 1TX4B 1NVXQ 2ZUDA 1H8HA 2BKEA 3W9YA 1C4OA 4F7WA 5DYGA 5DE3A 2GKSA 5EE9A 4DCTA 1CR0A 1JAHA 5CB6A 1Q44A 2XJ9A 3K70B 3HDTA 3CRVA 1XTSA 1U0LA 2PCJA 2GA8A 3H4MA 5JRZA 3AF3A 2XGJA 1GM5A 1XNJA 1TF5A 2YHSA 4W5WA 3TIFA 1ZUIA 2ZE6A 3RNLA 3GJXC 3TR5A 3O47A 1XTKA 1QVRA 4S35A 2FDCA 2O0JA 4DB2A 2IEYA 4OJQA 3GLFB 4O3MA 5J40A 1GG2A 4PHGA 1U0JA 2IUSA 4PZYA 2X8AA 4ZCMA 4CF7A 4P0TA 3BH6A 4M9ZA 2XZOA 1E2FA 2K5UA 3T06B 1NSFA 5EUQB 3AP3A 2OESA 2AWOA 1AS3A 4DC9A 3HPRA 3EX7C 2IUUA 1RW4A 3KFVA 4IOMA 1CTQA 3LBNA 3UMRA 2WSSA 3LRPA 3A4LA 4A82A 1E9AA 2C9CA 1F2TA 2ODBA 3HU2A 3ZD7A 3OFNA 3P20A 3AKYA 4KLNA 2ANBA 4LSGA 5KO2A 4IEIA 2D06A 4I1SA 4KJZA 1JQJC 3L0SA 4TLCA 5AWFC 2FU5C 1F6BA 4OYHA 3ZQ6A 1S9DA 3VKWA 5L3QA 4TN1A 4Q4JB 4XJXA 4F93B 4NBSA 1OW3B 2CCJA 3D3QA 1U8AA 3A1SA 4M8NE 4GNKA 2J87A 2O5VA 2OG2A 3BRWD 4DCSA 1OB2A 5BN3A 5H68A 3TJZA 1UADA 2JDIA 2VP2A 4OK6A 3MJHA 1EESA 3PG5A 4GOXA 1ESMA 2IYQA 4D4MA 1IONA 1PLLA 1X8KA 3THWA 5D3QA 4Q9IA 1LS6A 1OV4A 1Z6TA 4MRPA 2ZYWX 3P32A 3WRYC 2FEOA 1JEDA 5AJVB 3PUYA 4QXAA 3V4FA 4B48A 3IHWA 5K8TA 1QRAA 2OBMA 3V00A 2YVUA 3LNCA 1TNDA 2R9VA 1Y63A 2XTNA 5GADl 3WYAA 4V0ME 3W5JA 1DO0A 3GP8A 2V7QD 2VP4A 4Q7LA 4C3ZA 3EPLA 4A36A 4KFSA 3UANA 2VPPA 2H5EA 1KIMA 1ZNXA 2PBRA 2PX3A 1D2MA 4GOKA 2VP6A 5JMTA 5CDFE 2NTYC 2HF9A 1E4VA 1YU9A 3DKVA 5GVSA 1ELOA 3QPUA 3Q3JB 3ZZ0A 1FQKA 2CNWA 2GCOA 1FX0A 3B5JA 1TUIA 4IFBA 4NYJR 4OI4A 2F9MA 4NDZA 1XJCA 3O8CA 1ZUHA 4HLDA 1IY1A 2WWHA 1WP9A 1CJTC 1F60A 1E9DA 2HLDD 3EC1A 4NMMA 1W4BA 1XXHE 4NYMQ 2YWEA 3OE7D 1E6CA 2P6NA 1AS2A 1Q57A 2XTZA 3SFZA 1G5PA 4G5QA 3M1IA 4HAYA 4NYIR 2QMOA 2RGAA 4RFSB 4B6FA 1EK0A 1XCPA 2CCGA 2ZPTX 4I81A 5K8LA 3BERA 4M21A 4EPWA 2FJUA 4MRNA 3GLGE 4W7SA 2VH5R 5CYOA 4BZQA 2IA5A 1QHSA 4GL2A 2QQEA 4WXPA 3KTAB 2V1XA 2XZLA 2ZJYA 5FTMA 2RGNC 1IM2A 3KXIA 3OAAD 3NH6A 1U90A 4II7A 4PPNA 3EAQA 1XRJA 2GJ9A 2LWIA 3EWSA 1E2MA 3LX8A 2GESA 1W46A 4Q00A 3WNCA 4DVGA 1K8RA 1OLOA 1GKIA 3KXLA 2WSSD 1E69A 2WJVA 1EFRD 4M1KA 3HR8A 4PQRA 2J1LA 3UWKA 5D3MB 3R7WA 4AG5A 1ZIOA 4LYAA 1V5WA 4US0R 1HE1C 3U6BA 2ZITA 1G8YA 1NP6A 2AR7A 2J0SA 3B2EA 3NG1A 3SU8A 3QF4B 3WNDA 3A1WA 4BZPA 2HUPA 5DISB 1U9IC 1R4AA 1E94E 3TBKA 4JLAA 3GFOA 4TMTA 4E07A 2ZI4A 4D26A 4DSTA 4JVNA 4PPQA 4OQMA 4AKIA 1ETUA 4ARZB 2ZRNA 1QHXA 1MO3A 1N0WA 5JS8A 1RVDA 4JLDA 4DCUA 5KSYA 3A1UA 4G5OA 3EIEA 2CCKA 3TSOA 5CK5A 3IIMA 4LC1A 1QBKC 221PA 1FTNA 1G20E 3ZJYA 1G8PA 5J5CA 2IYWA 2FH5B 2C2HA 3G5UA 1P2SA 2C04A 3LFUA 1GDDA 1GL6A 2QRNA 1SXJC 2F7SA 2JIZD 4KSBA 3FFAA 3CX6A 2WOJA 1Z6AA 4Y0VA 4A0HA 1X6VA 3LQQA 2VP0A 4B32A 1IY0A 2R44A 1Z06A 4KFTA 2J45A 2JEOA 3SS8A 1OXTA 1S3SA 3ONWA 4MITA 1E99A 3NDPA 2IYZA 1OH8A 4M1OA 4QGGA 3OESA 5FPKA 3GEIA 1P2VA 1Z29A 4Q7MB 4RD4A 5AK0A 4P3YA 4PTLA 2ZR0A 2ZRKA 2MSDB 3TSWA 4DIEA 3V4RA 4IVQA 2ZJ5A 2JATA 2A78A 1A4RA 5DHFA 2H1LA 1B23P 1UKVY 4EPXA 1U9IA 3BBPA 4TQ9A 4D4LA 5FOVA 1NMYA 3GLHA 3QVUA 2D62A 3I5XA 2V1UA 2WSMA 5KNCA 3PV0A 3IILA 1WXQA 1Z2AA 2Z4RA 4IDPA 5EXXA 2NOAA 4P4UA 1IBRA 5H70A 3KXKA 4YXWD 1ODFA 5EE1A 1ZJ6A 3RABA 1R7RA 1TU3A 1HTWA 1WF3A 3TGPA 4GMXA 4NZYA 3BH0A 2R6CA 1NVVR 1T5IA 2BM0A 2WPDA 2H16A 3K70D 3T5GA 4V03A 3FMPB 1KSFX 4RKFA 3THWB 4AKGA 2XSZD 2YOGA 3ZVNA 4JLOA 3FMOB 1OIWA 2J0UB 4RZXA 2J59A 5DI9A 1FW6A 4Q4LA 5M04A 1E2DA 2ZS7A 2BCJQ 2ZJZA 1IN5A 2OFOA 5G53C 1E98A 3A37A 3TUIC 2WM9B 3IBGA 4IOLA 4OK3A 4LWZA 1E2HA 1Q21A 421PA 3WP1B 2DFLA 3MG9A 2UVQA 4MKFA 3PEYA 3A36A 1VG0B 1IN4A 1G19A 5L3SA 5ELXA 4KYUA 4D25A 1UF9A 5AJYA 2GEUA 5FOUA 2IEZA 1O87A 3VNVA 1AZSC 5FTNA 3WMFA 2XZPA 2V3CC 5F3WB 1ZD8A 1J70A 1Z0IA 1T0JB 2YC2C 4OHVA 1P61B 2AFHE 4MDFA 4Q21A 5A5GA 3GEHA 1YHNA 4L5BA 1YR7A 3SHFA 1SHZA 4ZIRB 4URYR 3BB4A 3CR7A 1E2KA 4AWXA 4A2PA 2GBLA 3EC2A 4I1UA 2NPIA 3EZ7A 4KAXA 4YXWA 5EZ5A 3B78A 2GDJA 4DSOA 2ORWA 4UXJA 1NG1A 1ZM4A 5GJCA 2IYLD 1ZAKA 4B3CA 4IDHA 2IXGA 4A2QA 2ZYUX 4L4UA 5EP1A 5DYIA 2ZVPX 2FFBA 4CGZA 5JWRA 4QHYA 4ZDJA 4BLPA 4ZI3A 3OIWA 2CHGA 2W58A 1UKEA 1CJKC 1JR3D 3EWAA 5KDLA 2O8DA 2OXCA 3LVRE 4M1WA 4Q4AA 4BWYA 3GJ4A 4HYYA 3ZIAA 4DBLC 3HU3A 3TUJC 5FUVA 4DHEA 1CRQA 3QKTA 4D2IA 1SVWA 3VR1A 4Q9JA 3P4YA 3QEJA 2RGGA 4LJAA 5IHPA 1IHUA 2VTKA 4UNPA 3SJAA 4DCVA 2ZRFA 3IUYA 4L9SA 5FPSA 4C30A 4A15A 4LJ4A 3DEFA 1V43A 1EX6A 4AC9A 1XBTA 4FWIB 1ZC4A 1VIYA 4FCTA 1G3UA 4JMPA 1NLYA 4JLPA 1VIAA 4TYYA 4LX0A 4UJ5A 3CX7A 1FPMA 2F3RA 2OEPA 3U7EB 2R6FA 2FNAA 1Z0KA 3I72A 3DOEA 4HDCA 1XEFA 1ZCBA 2XEXA 3CLVA 3KKMA 3MWKA 4DB4A 4LJ7A 5TXGA 3K0AA 3ZQJA 5HKKD 1AIPA 3KKQA 1E0JA 2DCUA 1HQYE 4DKXA 1GOTA 1WDTA 2RAPA 4C0HA 1G291 1F5NA 2OE2A 3CH5A 3EZ2A 5AUQA 4C0KA 1QF9A 3K53A 2B8TA 1NY6A 2GJSA 4I1VA 3EPHA 5KPJA 4LHYA 1KI2A 5EP3A 4EFMA 1KSHA 1Q1QA 4DRZA 1W4AA 3CONA 4G5GA 1LW7A 1TEVA 3ETLA 2GAOA 1N6HA 1FP7A 5AUPB 2HCBA 4G01B 2AK3A 4K46A 1W36C 1I4TD 1TUEA 3O8BA 3MJRA 4PC7A 4JL6A 5EP2A 4Q1AA 1OH7A 1OH6A 3TVDA 1M74A 3NTUA 3FE2A 4EPTA 1AA9A 1P73A 1LF0A 4TYNA 3WRXC 3QI2A 4M53A 2EFDB 4RD0A 4NH0A 4Q9HA 1G8GA 4MDEA 4MRRA 5HZHA 3OEHD 2JLUA 5JEEA 1E79D 4MUBA 2WJIA 1S2MA 4NTZA 4FMDF 3SJCA 2O8CB 2HF8A 2ZREA 3NXSA 2D4HA 4PSKA 5DN6A 2GXSA 4YQFA 3PR1A 5HCNA 2MSCB 4YDSA 5UKDA 1IQPA 2V55B 4LV8B 3GLGB 1HE8B 3W6NA 5DIFA 2W6JA 2ZSDA 1R8SA 2XOKA 5B58C 3DMDA 2CLDX 4UNQA 1N2CE 3W90A 1KO1A 4BASA 1GIAA 1UBCA 4EIWA 1WCV1 2J9RA 4UNSA 2D3WA 3PUZA 1W49A 1X8JA 4RD6A 4GP6A 3IEVA 4JSTA 3RYTC 4BE7B 4QM7A 2QPAA 3FGNA 4PPFA 5AJXA 5LD2B 4RFVA 1IAQA 1CU1A 3A1VA 4PQFA 1EWRA 4LPSA 4MYCA 2CLCX 3DZ8A 3ICQB 3AVTA 4PANA 2VHTA 1GNRA 2N42A 3BE4A 3AV0B 4MA4A 1FUKA 3CIOA 4G5SA 4Q66C 3AGQA 1UDWA 1G5RA 2GJAA 3DM5A 4G5RA 1XB2A 3CF0A 3PEVA 3TMKA 1J8MF 2D2FA 4QGFA 3D6TB 3B6EA 4QBGB 4ERNA 1E9EA 1UPTA 1N6NA 5K8UA 1NNEA 4YMSA 2GF9A 2NO7A 4WZAE 2AD1A 1XP8A 2W6IA 4G3XA 4PX9A 4AYWA 1PVOA 4NCNA 4IVRA 1CR4A 1X86B 1DOAA 2P2LA 2VHCA 3CF2A 4HLCA 3WBJA 3GLIA 2ZEJA 2VYFA 3AF2A 5CLLA 4LHWA 5C4GB 1FUUA 3C7KA 1M8PA 5FTLA 1M2OB 1GILA 4PSAA 2FSHA 5FBQB 3O8DA 1KTVA 3SR0A 2OCPA 4MYTA 4Z8YA 1RJ9A 2QSYA 4DSUA 2F9LA 3U3OA 3VU9A 4JIMA 3FHTA 2V8OA 4JL5A 2ZJBA 1KI1A 1T8UA 1W0JD 4GRAA 1W7AA 2G9NA 3DMNA 1KKLA 3C8UA 1AS0A 3IDQA 4JYBA 4M1SA 1OIXA 3KQLA 3BK7A 2Q0HA 1ZINA 2AK2A 2Z6VA 1DE0A 3K0CA 3W6PA 3W3ZB 1G1MA 3FTQA 4BUJA 2P67A 1LTQA 5JWHA 4URVR 3EPKA 3C5CA 2FG5A 1QHYA 1II8A 3EZ6A 3GLFA 1NMXA 1OXSC 4M1YA 3CNNA 2IS2A 5ANRB 4HB3A 1BYUA 2WIBA 2RGCA 2Q9AA 3IQXA 1NLFA 3L8ZA 4L8GA 3AEZA 1HYQA 4UXHA 1ZVQA 2JASA 1M1YE 1KI3A 2P3SA 1E1RD 2FN4A 5IK2A 3AF1A 1W1WA 3K0FA 3IIJA 3U44B 4XVUA 2QMUA 1GITA 4HAVA 2QT0A 2X77A 2A5DA 4PO9A 3GFTA 3WMEA 5AUNB 2ZE5A 3VX4A 1ZCAA 5FBWB 5CDFA 2E9SA 5L3SB 4ASUA 4XIGS 5B64A 1ZUNB 2I3BA 1S9HA 1ZIPA 1D8TA 1U99A 2FFHA 3D31A 3RANA 5E4FA 4PAQA 4M9SA 4KFRA 4A0FA 5JSZB 1E1RA 1W0KA 4P4SB 2R65A 1SVOA 2MSEB 2H57A 4URXR 4IKEA 1XXHA 5AJZA 1OFHA 5DH9A 2ZYVX 1DAFA 5EE5B 5JZVA 4C2TA 2QAGB 1ZNZA 2GVDC 3VR2A 1GWNA 1R6BX 5LDDC 4LJ9A 3B1YA 1G41A 3C4JA 4D6PA 1EFHA 3VU9B 3UK6A 1E9FA 1KI4A 1AN0A 1XMVA 1IN6A 4NCIA 3PEWA 1AKYA 4RD2A 5F2EA 2ZJ2A 4GT1A 3C16C 4IW3B 3AVPA 4Q01A 4QKQA 2IC5A 3PCRB 1Q0UA 4F4IA 1BH2A 1XF9A 4DXAA 1DAKA 3ASYA 2GF0A 5IK2D 4PZZA 3GEEA 2B92A 4PHTA 4A9AA 3VMFA 2UZ3A 4CEIB 2EQBA 2I1VB 4I1OA 1TTTA 2IWHA 3UMSA 3K0SA 4QNMA 4B71A 4LYHA 4ZKDA 1D6JA 1KO7A 2O8CA 4DIDA 3X1YA 3IHLA 1FX0B 4PHHA 3QQ5A 2WZQA 2BKUA 1YQTA 4TSFA 1X1SA 5JFGA 4MKHA 1G7SA 4NCJA 5KHOC 4EJSC 3RWMB 3TW8B 2GVZC 2YKGA 4DSNA 4D82A 3BFKA 1JJVA 5TARA 3HP1A 1JR3E 3KQUA 1VDZA 2RGNA 2WWGA 5FOSA 1Q22A 2HLDA 1VTKA 1W2GA 3UIEA 1OT3A 3LW8A 3DVLA 1GNPA 2A5YB 3GJ3A 5FL7A 3THXB 2C8VA 3OF5A 2AKAB 4D0NA 2FSFA 2HT1A 3ZVRA 4FMCF 2QSZA 1VHTA 2WAXA 2P0EA 4WOPA 5DO9A 2CJWB 2PJRA 1VCMA 3W34A 3AVWA 2JJ1D 2EFCB 4XVQA 2EFEB 5KSZA 1R0ZA 5BYJA 4TTPA 2JJ2A 4E5UA 2GZDA 2QU8A 3THYA 1DS6A 2HT6A 4E09A 4YMTA 2QZ4A 1CKEA 4S2EA 4TLEA 1FP6A 3K9NA 1M34E 1SXJE 1ZM9A 2QGZA 1TU4A 5BWMA 3AKEA 3GLFE 2XOKD 3GD7A 4MGKR 5JJKA 2E87A 2GZHA 2G83A 2ASEA 3QIAA 3C5HA 2VHQA 3U3JA 1WA5A 5JI2E 4KITB 3MWLA 3E5HA 5J47A 3WYFA 2OFXA 5KU1A 4PAOA 1GVNB 3K0EA 4LI0A 1OPXA 5F9FA 4GDFA 1NLZA 2BWJA 2AD5A 4LUCA 2ZRBA 4TL9A 1KHTA 2BBTA 3NHAA 4MKIA 5C46F 3GLHE 3ZZTA 4JVSB 1GZSA 3VX3A 1E2EA 5H1YA 1R2QA 4YONB 1EFCA 3D7MA 3K0CC 2KB0A 3KTAA 3NHBA 3L8YA 3QXXA 3DZDA 4B76A 4HZUA 2GILA 4XTCS 1L4YA 2NZ8A 1R0WA 2FSGA 4KVGA 4AI6A 3R9IA 1AM4D 2QGNA 1JQLB 1E4YA 3WP0A 3X1DA 4Z8XA 1ZU4A 2ATVA 3CBQA 1CIPA 3K9HA 1LV7A 3FB4A 1KKMA 1Z6GA 4EFNA 4DZZA 2BMDA 1II9A 4PC2A 1OB5A 2EW1A 4GOJA 4PR0A 1DPFA 3K0AB 5FPYA 1SQ5A 4HUTA 1K6MA 5DSZA 2A7QA 3Q72A 4IHQA 3ADKA 1XEXA 721PA 3VKHA 3AVYA 3RS0A 1Z47A 1KI7A 2GJKA 4IOJA 3ZGXA 5BW8A 3HJNA 4QBHA 4D0GA 5J4HA 1M6NA 2CE7A 3GLHB 4TTRA 3ND8A 1DAHA 4NONA 1ZMXA 1XJQA 1OJLA 4MRSA 4TT3D 5FBVB 3Q5DA 2QTHA 4D81A 1KI9A 4HAXA 5B30A 1P5ZB 5KTYA 1TQ2A 1RC8A 4XTRA 5HPYB 2YV5A 3K9GA 4H1VA 1KMHB 3AVOA 2X2FA 4Q1CA 4LBVA 4B73A 4FCWA 4DLYA 2C03A 2R62A 3FKSA 4A6XA 1G3RA 1U98A 2ZS8A 4CYMA 3QEOA 2IF2A 3AH8A 4J0QA 1DELA 4RZ2A 2WMNB 4FCVA 3EIHA 1JBKA 3AP1A 1OFTA 1R0XA 2DYKA 3H86A 3QKUA 3RVBA 1AJEA 1E9RA 3E70C 2CMKA 4PC3A 2Q3FA 4B33A 2EWVA 1P3JA 4WAUA 3NBXX 3S1AA 4CEIA 3OAAA 5JI3E 1MRNA 5TVKA 1LF5A 1VECA 2IYVA 1E2LA 1VG8A 3AKDA 4I99A 4O25A 1Q20A 2QQ0A 2QT1A 1OIVA 3CRMA 4DDTA 4ESVA 1LY1A 3AM1A 3B82A 1PV4A 2VF8A 2P5SA 4V0OA 5F98A 1RFLA 2J0VA 4CEJB 3T1VA 2JJ1A 4R98A 3LH5A 1KAOA 2C77A 1KI6B 1NBME 2ZM5A 4B3XA 4B35A 1QHGA 5A4JA 4IXMA 1J2JA 3C15C 1RKBA 3I8XA 2ZJ8A 4PO1A 3T1OA 2IF0A 1H8EA 2D74A 5FUXA 5DNYB 1A2KC 2XAUA 3SNHA 4BEBA 3W6OA 4G0NA 2QNRA 2ZSEA 2C78A 4KODA 4EUNA 4IXNA 4K8OA 2X19A 2KWIA 2PZFA 1G3QA 1H8HD 5KUTA 1N5JA 4F4CA 1A1VA 3NBYC 1W36B 2W2TA 2RHMA 3ZH9B 3FHCB 2ECKA 1KDOA 1XCMA 1Z08A 3NEYA 1YZLA 2O8DB 1Q12A 4OI2A 1SXJB 3K1JA 1MOZA 4BPBA 5HCIA 3WY9A 2EVWX 3DHWC 2ZUCA 3Q5EA 3M0EA 4XWKA 3CZPA 3H0KA 4FMCB 4C9BA 5JHHB 1QHHB 1ZM3A 2ZAOA 3VKGA 1ZD1A 2GXQA 4TLDA 5CIWA 2ZIAA 1D5CA 1KK2A 5AUOB 4QJ5A 1DAMA 2QMEA 6Q21A 1YR6A 2ZQ5A 3I62A 5J4YA 5P21A 3BWDD 5KSOA 3N5CA 1MH1A 2ODEA 2VBCA 2O0HA 5GJWC 621PA 4M1MA 1M7BA 2GJ8A 5KDOA 4OHZA 3R8FA 1E96A 2O8BB 2HEIA 3LD9A 4LJ8A 2FGJA 1FNMA 2KBEA 3NVAA 4Q47A 1E0KA 4A8JC 4R2HA 3VAAA 3GLGA 2F43B 1UJ2A 1RZ3A 4AK9A 2REOA 1A7JA 3Q7PA 5LD2C 2CLSA 4XOIA 2IS6A 4XD7D 1M7HA 1R5BA 1RYHA 3CRW1 2ZUBA 3JZMA 1CJUC 1S1CA 2BJVA 4ASUD 2DHRA 1JXMA 1G17A 4C0QC 2IL1A 3F5FA 2QL6A 3CR8A 1UM8A 5CIQA 3UG6A 1MABA 3X1XA 2IX3A 4DDUA 1W5TA 2FZLA 3A4NA 4D4KA 3B1WA 5C18A 521PA 2AL7A 4URZR 5D3MA 3R7WB 1TF7A 4CEHB 1XMIA 3H2YA 4JVMA 2DPXA 4UKDA 3RSLA 4DUGD 4PC6A 1E9CA 1G8FA 3BH7A 4IDOA 5JBQA 2OCBA 3KUCA 1NBMD 4M9QA 3ADBA 1X8LA 3BB3A 4EKDA 1KOFA 2ERYA 5SZKB 4LV6A 4OQLA 4TMXA 2DBYA 1PUIA 1CLUA 2GEDA 2XB4A 4Q1EA 5EQTA 4C7OA 2W00A 3NKVA 2RH5A 2XNDA 2NPFA 3NBFA 1YZUA 3MWJA 1E0AA 3AGPA 3CX8A 3KL4A 1QHIA 2G0NA 2VEDA 2IS1A 2VRWA 3GJ7A 4HATA 2EWWA 5CK4A 5TDHA 2YC4C 1GTVA 1OXUA 1E2GA 3N2EA 1SVLA 2VF7A 1NN1A 3RS7A 4LBWA 1W2HA 3CH4B 2IHBA 2A2ZA 2BC9A 1VCIA 1ZNWA 5DHAA 2FPLA 2JLRA 5EUMA 1GAJA 1VPLA 2RGEA 1OH5A 2NO6A 1P6XA 4YMUA 3WYGA 2ZRLA 4PC1A 2ZAMA 4I4LA 1KO8A 1WE2A 1X1RA 1KJZA 1RRPA 1N5LA 4Q03A 4DDVA 4TMVA 4U5XA 1CR1A 4D80A 3JVVA 1SVMA 2BM1A 2A30A 2YWHA 1VYUA 2WV9A 2R6AA 1E79A 3C14C 4WZ6A 2R8RA 2H92A 4C0SA 1PLKA 4GFDA 3BS4A 3ECCA 1Z8FA 2CJWA 4QM6A 1Z6YA 1KO5A 3CNLA 4LPKA 3RSOA 1NVUQ 2IYRA 1G7CA 2NG1A 4LJ6A 2PLFA 1Z3IX 2AFIE 4PFSA 3QF7A 3DKPA 3P27A 4OBEA 5L3RA 2C95A 4R9UC 1S3GA 4ZDIA 4N1AA 3OIUA 2IYSA 4CT4B 1RE0A 3GLIB 2J0UA 1QHNA 4LV5B 2IXFA 1FTSA 2DR3A 3CPJB 2C9OA 4KCGA 4B47A 2PT5A 3BXZA 3AVXA 3LWNA 1S96A 4B6EA 1IOZA 1B0UA 4OHXA 1R5OA 2IUTA 1D2NA 5G3ZA 3AUYA 1RJ9B 4DWJA 3KB1A 3TQCA 3T12A 1COWD 2MMGA 1DAGA 1ZYUA 1L4UA 2ONKA 1HH4A 4Q19A 3RS4A 3L0OA 2CHQA 3A4MA 5E7MA 3RHFA 4LGMA 5KPDA 3Q8XB 3FWYA 5J4VA 2BBSA 1YRAA 4A8JB 2QBYB 4HB2A 1U8ZA 5KNBA 3DPUA 2FPKA 2PZGA 3X1WA 3VTKA 1DARA 3BFVA 5KYKA 5BYKA 1T3SA 2QI9C 3IO5A 3CRQA 3LVQE 1T3LA 4KLZA 2ZJOA 2RB4A 3MD0A 5CYPA 1RYFA 1N0UA 3QKSB 2ZROA 2XXAB 4FMDB 3U7HB 2ZR9A 3F8TA 5E7JA 3SQXA 2BBOA 4FI3C 4NE2A 2C98A 1UAAA 1G4AE 1TL7C 4RY2A 4UQOA 1Q1ZA 3LY5A 3KKNA 3BD9A 5AR1A 2HV8A 4QJ3A 4GP7A 2GHIA 4Q1DA 1XU4A 3R9XA 4ACAA 4JVLA 4F38A 4LYFA 2FGKA 1WRBA 1D9XA 4AY2A 4CZ2A 4R2IA 4FWTA 1JALA 2WHXA 2QA5A 3B85A 2VP5A 4JLVA 2QP3A 3HU1A 4BQSA 4HUQA 1BIFA 2YOHA 1MT0A 4LY6A 1JI0A 5TMPA 4CT5A 2EU8A 2ZETA 2HCJB 3KKOA 3BB1A 4ZPXA 4X8HA 1R0YA 4PZLA 4N0DA 3I32A 4AIIA 1XMSA 4A6PA 3ADDA 1TPZA 1MO5A 1P7CA 2XNDD 3TLXA 4ZCLA 1YZQA 3B8HA 4YC7A 4DLRA 3UKDA 2VSFA 4H9GA 4HZIA 3B1XA 1VMAA 2OILA 3U6KA 5FI0B 2JLXA 2NQ2C 3VNUA 2NO9A 2HJGA 4HAZA 4Q4AB 2VHUA 5DLQC 5FOXA 3SDZA 4BRUA 2VSOA 4JLBA 3TH5A 4MUAA 3KX2A 2ZRGA 2QM7A 3U44A 2R2AA 3MRSA 2XX3A 2O8FA 2DWQA 4P4TA 4GPTA 1CULC 2OT3B 5JJIA 4OJKA 4EPVA 4Q18A 3VHXA 1FMJA 1DO2A 4Y0AA 1AQYA 4BFXA 1BMFD 4N3NA 2XB2A 4NP6A 2DFNA 3QNUA 2HXYA 1VG9B 1KAGA 2ZRHA 5BN5A 2RMKA 5HZKA 2W6ID 2UZIR 1SXJA 1YE8A 4QHTA 3VR3A 2W2XA 4B43A 4JBWA 1N3BA 2ZRPA 1BS1A 5H8WA 1E32A 2V7QA 1HT1E 2H17A 2WJYA 1IY2A 2VIIA 1KGDA 2A3RA 1WMSA 2YWGA 2ZRAA 5DGXA 4YMWA 3I8SA 1SKQA 4RD1A 2O8EB 5CJPA 1R10A 1HY3A 1TADA 4QNRA 1OKKA 1H8ED 4ZV4A 5CJ2A 1T91A 2BIFA 1KSJA 4Q4JA 3CUEF 1CJMA 2WMOB 2ZU6A 4DLTA 1DVRA 1XX6A 4QJ4A 1L8QA 4UXIA 2O8EA 3IEUA 2QG6A 3QKRA 3KQNA 4GZMA 4HLUA 2F55A 4JS0A 3RRNA 1JR6A 4PSVA 3QG1A 1PZNA 5EXPA 3DO6A 1KSGA 2WKPA 1YR9A 4AURA 2BEJA 1Z0JA 1OSNA 4M1TA 4X8OA 1KK0A 1AZTA 1NL3A 1T0HB 1BYIA 1W44A 2FV8A 3SBEA 4HUQB 4JYCA 1QDEA 5LBIA 2A9KA 4NL4H 5SZHB 2WWFA 1UBFA 2ZRIA 4LC0A 3EG5A 2JJ8A 2GK7A 1G64A 4U00A 4Z1MD 3OFND 3I1FA 3GJ8A 5CLQA 3B9QA 2ODWA 3U3RA 2CK3A 3QBVA 3LAWA 1U2RA 5K8IA 1HQCA 2IYTA 4KU4A 4NYJQ 4TQUS 1NN3A 4JJKA 2F3TA 2L0XA 1RPZA 5EXTA 2IHYA 1CJVC 3IO3A 3RS3A 4FMBB 1NJGA 4NCKA 2GCOB 2ZI7A 4PHFA 2PMKA 2Y8EA 4C0BA 2CEAA 1KMHA 2F1JA 3AQ4A 2F6RA 3X2SA 2OO7A 4CIDA 3B60A 4HDQB 5JWOA 4MQBA 1XD9A 2CHVA 3P26A 5GVRA 2GETA 4URWR 5HTKA 2WJGA 3I5YA 1GL7A 3LA6A 3IPYA 2OSBA 4ARZA 1FL9A 4A2WA 5L8VA 1OE0A 5FUWA 4XD7A 2I1QA 4ABYA 4PAMA 3CF6R 1EWQA 2YWFA 1I4DD 2OAQ1 1Q3TA 2V6JA 4TMZA 4W5HA 1HA3A 2J7KA 1XMJA 5JJLA 1LVGA 4MRVA 3TW4A 1WBBA 4HSEA 4JT4A 4BFUA 4JL8A 1Z0DA 1W0JA 4Q4HB 1JAIA 3WHKA 1Y3AA 2G6BA 2IXEA 4IEEA 4Z1MA 1K5DA 4KBGA 4KBFA 5HE9A 1JR3A 1W47A 3QVVA 1Q3HA 3U4QA 2ZI5A 4HLUC 4QC2A 1P72A 3HYTA 2QP9X 2P6RA 3BGWA 1DADA 1U81A 1SVKA 2IBMA 2WICA 2QORA 4P4SA 4V0LA 4MKGA 1MO6A 2WIAA 1NBMA 3LO5A 1FZQA 2PCLA 1JECA 2O52A 3EZ9A 3GCGA 4QGHA 2GNOA 5G40A 2WVJA 1RRGA 2QPOA 3AF0A 1ZW6A 2P6UA 3QOFA 4LK2A 3IIKA 1JJ7A 1IJEA 3LLMA 2JLZA 4TYWA 1MR3F 3PQCA 4XWOA 1DAEA 5IF9A 1ZD9A 4BFWA 2FFQA 1ZP6A 2GEVA 2FA9A 1EG7A 1U94A 4B3GA 4TLAA 2BCGY 5CM8B 4Q48A 5FH9A 1Z6XA 4US2R 4OI0A 1RRCA 3CPEA 3P4XA 4JLKA 1DEKA 2ODNA 3BAFA 1N5IA 4TL6A 2ONJA 2WJJA 1OYWA 3AB3A 3OEEA 4BEJA 2BBWA 4OQNA 4BFZA 1BO6A 4ZDKA 3MFYA 4D4JA 2W2VA 1XTQA 1XEWY 1HV8A 1JPJA 3RRMA 3SOPA 4B44A 1YZTA 2GWHA 5CB8A 1YZNA 4NHOA 3ZYCA 4D0LB 1NMZA 2D2EA 1YR8A 2RGXA 5LB4A 4B2PA 4TYPA 1XPRA 3QE0A 2ZR7A 3FKSD 4LJ5A 4NU0A 1TEXA 3HWSA 3RC3A 5CM9C 1E2JA 1D9ZA 3VHLB 4P32A 3SQWA 4E22A 5FOWA 1BOFA 1JXOA 4LYJA 1TQ4A 2P5TB 4KI0A 1XJ0A 4ZDWA 3BJIC 2VLIA 3MAAC 3K70C 4LRWA 5EJEA 2AXPA 3QENA 1K5GA 4DLWA 1L7VC 1ZC3A 1NVWQ 2OXRA 2X2EA 3CWZA 2VP9A 4HAUA 2CVHA 5BN4A 3KUDA 4TWZA 3SBDA 2D7DA 2C5LA 4OQFA 2NZJA 1M7GA 3I92A 3KFXA 2PX0A 1G9XA 4GI7A 3SYLA 3MMPA 3AVQA 4DCNA 2QMHA 1HT2E 4HDOB 4YDHB 2JIZA 3T61A 3P1JA 4RZUA 3SFVA 2IWRA 3I73A 2CDNA 1XD8A 2H18A 3PUVA 4B3DA 3E1SA 1IN8A 2KE5A 1KYIA 2ATXA 2Z5FA 3SYNA 4KXFB 4Q1FA 2VL7A 3UG7A 4OK5A 3D8BA 4BLQA 2AKYA 4Z51A 3X1ZA 5KDDA 1OYYA 1J99A 1F2TB 1UBGA 2LCFA 2OV2A 3QXSA 4NCHA 3SEAA 4L16A 1ZNYA 2J41A 1HURA 3O8RA 1XPOA 3QKSA 3RWOA 3UWOA 4QBFA 1TMKA 5J4KA 1GUAA 5L3VA 2A5GA 2C96A 4CVNA 4DLSA 3CPHA 4M22A 3ZLJA 3TAHA 3U3MA 2ORVA 5DI3B 2W6JD 3CWQA 4C2UA 2F43A 1J8YF 2XNSA 5FOTA 4W5JA 1LNZA 1KI6A 3DOFA 4OQXA 2QN6A 1KI8A 3EPJA 1G5TA 1I2MA 1W5SA 1NIPA 1XXHB 4WA7A 3KQKA 4DLVA 4LJYA 1FQJA 2ZE8A 3EA5A 2Z0MA 1E2NA 3PIRA 5EXSA 1G3IA 3CZQA 3SHWA 1HUQA 2C99A 3U3KA 4DJTA 2FF7A 3DDCA 3L2OB 4DEXA 1OHHA 2ZRJA 1F48A 3AUXA 4OI1A 3IKJA 2GK6A 5E3HA 2QTVB 3ASZA 5IT5A 3KZ1E 2BMFA 1ZU5A 2N1BA 4LBYA 1E0SA 1QHHA 4HB4A 5G3YA 3LLUA 1KY3A 4GSYA 1ZM7A 1KDPA 2FOLA 1AGPA 2BOVA 5A0FA 3KKPA 4FN5A 2PEZA 3RRYA 4W9MC 2BMJA 2XXAA 2R6GA 5DI3A 1KZGB 1KJYA 4MYHA 2QRZA 1N0VC 3ZZUA 3T5DA 1YRBA 3NH9A 5HR5A 1P60A 2WJHA 1UEIA 2RHDA 3EARA 1UKZA 3GQBA 3WXMA 1D2EA 1UEJA 4AYTA 4KO8A 4ZI2A 2KBFA 5KOYA 1KNXA 3OE7A 1GRQA 3L82B 2NO0A 4QOSA 3SN6A 3Q7QA 4ESHA 1CRPA 1NF3A 5KNDA 4C0AC 3B1ZA 1UDXA 2FWRA 2VQSA 2OCAA 1Q1EA 2YINC 4Q7JB 4BECA 3G0HA 4FIDA 2ZI6A 4BRWA 3EA0A 1G21E 1GNQA 1DAIA 4F4JA 4IDNA 4HB0A 1X3SA 3VQTA 3LQRA 3BC1A 5EP4A 1P9NA 2B7BA 4L15A 5J4LA 3OEED 4PPGA 2Q9CA 3B13B 2H8KA 2YNMA 4XH9B 3OEHA 3TK1A 8OHMA 3L0PA 1J7KA 4CW7A 1W36D 4P31A 1W4RA 3SYKA 4IOKA 2BDTA 4KSCA 1T3HA 1LB1B 2QEQA 3RC8A 2DWPA 2WKQA 1US8A 3MCAA 4WIAA 3WMGA 4NKRA 4BGDA 1OKKD 4DLZA 1Z63A 2KI5A 3QPVA 1SHKA 4RVCA 1S8FA 4M2LA 3TRFA 2VSXA 2QE7D 2QAJA 4ITRC 1G4UR 1W0KD 3QKRB 2HXSA 4R71A 2CL0X 2N46A 5JECA 3HR7A 1CR2A 4N0EA 3K9LA 1TF2A 2WKRA 3CB4A 3KDSE 3SI7A 5C4MA 3BFXA 3T34A 1DG1G 2GBLC 1IJFA 2JA1A 5JCZA 2DB3A 2PLRA 2TMKA 2YYZA 3K0FB 1GSIA 2QP4A 1P62B 5LB2A 2EYUA 4M9XA 4TYQA 2SHKA 1DBSA 3GJ0A 4WZBE 3EXAA 2WTUA 3THXA 4RJLA 3L43A 1QVAA 4KVAA 1EFTA 2B7CA 1QZXA 3SC3A 1XZPA 1XTIA 3ZS8A 2GZAA 1N6IA 2JJ2D 3V9PA 3LW7A 2JLSA 1F2UB 3Q85A 2PH1A 1N25A 1QG2A 4BLSA 3W3AA 4UNNA 2IYUA 3VR4A 4LHVA 3BOSA 4PO8A 1S1MA 1YZKA 3IQWA 4GBMA 1F2UA 4Z54A 3QBTA 3ND9A 1G6HA 1RRFA 4Q5IA 1KK3A 1P9WA 2JCSA 2R6DA 1A2BA 4HLQB 2G77B 4KYIB 3PXGA 2BJWA 4BLRA 3PUWA 1G7TA 3HPQA 1G16A 2EFHB 4Q9LA 4JSYA 2BVNA 1N6PA 3K09A 1N6RA 1T6NA 3GFPA 1Z07A 2FX3A 3MWYW 3FKQA 3UMFA 4EFLA 2A5JA 3PVSA 3N2IA 2ZRDA 1F3OA 2OFWA 3E2IA 4LBZA 3ZIAD 1G6OA 1EXMA 1KDTA 1TQDA 3QXJA 5DN6D 3SJZA 2GXUA 2FMXA 1HEIA 5LPNA 1S4QA 2ORIA 5C2JB 1VKJA 4HEJA 3WBKA 3SJBA 1KK1A 2Q21A 1P4SA 2JLVA 4EJSB 4NPHA 1IXSB 4Q7KA 2C9YA 1GFIA 3RAPR 4TT3A 3ICEA 3G82C 4AD8A 5FPTA 4AYXA 3U60B 1II0A 1E9SA 2OLJA 4GZLA 4RFSA 3M4YA 4A4DA 5EE0A 2IT1A 2H7VA 2GAAA 3FYHA 1RIFA 2XSZA 4O2RA 3KB2A 2WAYA 2ZSBA 5EZ6B 5FTKA 4LHZA 2ZI9A 3TR0A 4K81B 4V0MA 4AKHA 1CXZA 2YJTD 5SZJA 3W8NA 1UKYA 4BFYA 3HYRA 4ZKEA 1GKYA 4JKYA 4POAA 2LKCA 3ZVLA 1ONBA 1L2TA 3RS2A 3SZRA 1XZQA 3TE6A 3W5IA 2G3YA 4WW0A 1T9HA 1SZPA 5EE3A 1NKTA 2QAGC 3AP2A 4QL3A 4JLMA 1E1QD 4JJZA 2CNWD 4ZO4A 5FR1A 2VO1A 3FHOA 5JS7A 4X8LA 3CKLA 3AF4A 2QM8A 2RKOA 5FFMA 3NC0C 3EASA 5IRCD 1AK2A 3QSYA 2J7PA 2NIPA 1P2TA 1R5NA 1G18A 2ZANA 2XJ4A 2QE7A 1VHLA 1A82A 3Q9LA 1P9RA 4DT1B 3KJGA 3RS5A 3L0IB 3VFDA 1E2IA 4B75A 5JHGB 4R7ZA 2ZI3A 1E3MA 3GPLA 2Z4SA 3T1TA 2JLWA 1E9BA 3MGCA 4L9WA 4A1FA 2ANCA 2ZE7A 4IDQA 1KZ7B 2IYYA 4AKEA 4GMDA 4RSGA 4RCYA 2PJZA 4U02A 2QUZA 5AJWA 2WWXA 3EZFA 2ZYTX 3K8YA 1NI3A 5BQ5A 2HDNB 3EW9A 2J46A 121PA 4OHWA 4JBYA 1PUJA 3CRRA 2KJQA 2JDID 1XPUA 1EFRA 1COWA 2FFAA 1J90A 4QRHA 4EJSA 1YJ5A 2V4ZA 1I2DA 2PMDA 3IGFA 2W0MA 1SULA 4RZ3A 821PA 2WWYA 2QROA 4JT2A 1SKYE 4CEJA 1SVSA 4TZ0A 2GCNA 2CVFA 3REGA 1G7RA 4CDGA 1E1QA 4JZKA 2IYXA 1XFAA 3BIFA 2ERXA 3NIBA 2XTMA 2P65A 4QGAA 2ZJAA 3PENA 1YKSA 4MGYR 4TL8A 4XSGA 1DTSA 3CW2A 5HKKA 3OIYA 1XEXB 2J7PD 5FBRB 3NDBB 4BLOA 4AG6A 1NN5A 5SZIA 2YZ2A 4B2IA 1G3MA 4QG7A 2DWOA 2QAGA 1A5TA 3OIVA 1KO4A 2PZEA 1BKDR 1NKSA 2FE4A 5L3QB 3J81k 3KQHA 2F1HA 1ZM2A 5JRJA 4KHZA 3U4QB 1XTJA 4B34A 1ANKA 1O3YA 3FDIA 1W4CA 4O2LA 5KSPA 2CBZA 2CK3D 3M6AA 2QY9A 5HE8A 4F92B 4HZUB 1H65A 2V6IA 3WNBA 4O0MA 3TNFA 2PEYA 1YZGA 2CL7X 3CO5A 1VCNA 2GCPA 3B7GA 1NY5A 4BFSA 3GMTA 2W0SA 3I3SR 1XDBA 1AKEA 1JPNA 2G88A 1WB9A 4V0KA 4BZXA 2IS4A 1CF4A 2RCNA 3NWJA 4TSFD 2WWWA 4XWAA 5FTJA 3DM9B 3MSXA 2V9PA 1NSTA 2LKDA 4MH0R 4P33A 3LDAA 4CEHA 2Z43A 3A6PC 1Z0FA 3QG5A 1NN0A 5GJVC 4FD2A 1KNQA 3QXCA 4FXPA 4XVRA 2EFGA 4U7DA 4OHYA 1ZRHA 3R20A 4JLJA 5G41A 3FMIA 1IXRC 5FR2A 1XD2A 2ZRCA 4US1R 4WVFA 1IXZA 2IK8A 4FINA 1GP2A 1T4GA 3A8TA 3B1VA 5FI1B 4A0RA 1PJRA 2OZEA 4C4PA 1FNNA 1NVVQ 1N5KA 1OFIA 4LZZA 4YMVA 1VYVA 1XD2B 2REBA 2JLYA 2GXAA 1Z2CA 1QG4A 3K09C 3VR6A 3A58B 4QHSA 4A92A 3TKLA 3U7FB 3ZDQA 1TQ6A 3N70A 2Q3HA 3BORA 3FPAA 2J5XA 4B3BA 4DDWA 1WBDA 2KSQA 2WBLC 3SE0A 1OFUX 2ZXUA 2CXXA 1C1YA 1SXJD 3U5ZB 2FSIA 1II8B 2PT7A 5TY0A 3U7GA 2OAP1 3ZD6A 4OKSA 2OUKA 2VHJA 2FZ4A 4UNRA 3F3YA 1C9KA 1XCGB 2OLKA 1UBEA 4PXAA 2DY1A 2ZSFA 3I4LA 4LCBA 4RCZA 1IN7A 1OXVA 4B74A 3PUXA 3ADCA 2ZS9A 3PEUA 1GRRA 1XTRA 2A5FA 3JVUA 2NGRA 4WBSA 4WXRA 5FL7D 4HI0E 2G0TA 3UPUA 2ZU0C 2X1VA 3FFBA 2J0QA 1T5LA 2RGDA 1SGWA 4A0GA 3QPWA 2JGNA 4Q1BA 4H1UA 4B2LA 1NJFA 3GJ6A
chains in the Genus database with same CATH superfamily
4P92A 2QD2A 2PLAA 3S2FA 3PT9A 3C48A 3C41J 2P75A 2FX2A 4TV8A 3V1NA 1SHLA 2NO4A 1U02A 4M99A 4R1OA 4X6UA 3V8RA 4F45A 5LN1A 5G0UA 1T3GA 1Y4SA 4TLMB 4ZCIA 3A9WA 3QF4A 4MGZR 2W43A 4YCSA 2AWNA 5DB4A 1CIVA 1X7WA 2R96A 5BRJA 2ZWAA 3BCSA 1RM4A 2GRJA 4U2BA 2BRUA 3TTWA 3OX1A 4KNVA 4LMAA 3TECE 3D4NA 3MUFA 5REQA 4ALNA 4DJAA 3AIMA 3FVQA 2Q3MA 1IN1A 2EL7A 4LDJA 3TLKA 1PJBA 5A4MS 4B3RB 2E1RA 2VHEA 1EKXA 2DFKB 4Y6LA 4JUCA 1YL5A 4JI3B 4O4IF 2OHGA 3T35A 4UHJA 1NP7A 3I45A 4PQYA 3UV7A 1POXA 4JH0A 1E2PA 1I7PA 5FQNA 4E31A 1UXOA 3QMPA 2HYDA 1MABB 1NRIA 3ETEA 1U0NA 4RK1A 4DUGA 1F8GA 4IFEA 4K9RA 4J1TA 5PNTA 1YMUA 2AG5A 3H11A 2ZVQX 1OYOA 3QW4B 4FC7A 4IVPA 3OM1A 2XF8A 1SU7A 3C3KA 3P0HA 4F91B 3H84A 1SH7A 5K99A 2BH9A 4DLKA 4TMKA 2BZ1A 4D6YA 3LXXA 2VTBB 5I9LA 5EIAA 2OHXA 2QLMA 3ZW7A 5JLJA 5JC1A 1QGOA 3PQ2A 3HO1A 4EPYA 3OLQA 4V02A 3DEAA 1ZVJA 4DJFC 1UJNA 3F46A 4GX5A 3JZAA 3LHIA 3HG7A 3SYMA 3GJ5A 3MGBA 5F21A 3ZS9A 4L3OA 1CP2A 4U7PB 4UCWA 2FPMA 3BGSA 1GGFA 2J48A 1P7PA 3N2ZB 4L73A 4EO9A 1DRVA 3JD3A 4OLJA 4ZIRA 1JKJA 4J0EA 2DQZA 1Q1BA 1GAWA 1SELA 5YASA 2O0KA 2ZRMA 3CNOA 3TEFA 4MOWA 1FP2A 1TGYA 1ZSYA 3DTTA 5EJMA 3BJRA 5C8YB 4YMGA 4JYMA 5FBLB 2FZKA 4RDHA 4TWJA 4XM1A 1DZ3A 3WGUA 3T5PA 3TVYA 1YBFA 4NYIQ 3QBJA 1GKUB 3S2SA 3FKJA 1DKOA 3AFIA 1U8XX 2A88A 4KQFA 5AHWA 3FTPA 4C0LA 4RTSA 3BMOA 1WEHA 1T8TA 4MO9A 2JIQA 4UPEA 2CE2X 5LIPA 1RQGA 5EY5B 1GFWA 3DC2A 4NYMR 4EKEA 5B55A 2B6HA 4D9IA 4UFOA 1NSYA 3D9QX 4DXHA 4EMTA 3WAJA 2Q2OA 1EPUA 2JAHA 3HKBA 4EQZA 3AI1A 1MG5A 3A6HA 1X0VA 3TUZC 1I7NA 5LJIA 1DKQA 1J8VA 3CLUC 3EG9A 1F4PA 2HK8A 3C7AA 5AO9A 1XPJA 4MR9A 2H2AA 1U65A 1Q1AA 2PZJA 2QPTA 4XW2A 5EUCA 4IRUB 1FFHA 1JNYA 1YZYA 2DRIA 2C4KA 3FSJX 1ZJWA 1X94A 4UUMA 1T8RA 1ONOA 4JBLA 3P9ZA 5G1NA 3THOA 1BCRB 2PBZA 3JW8A 4NI5A 5K3AA 1N6OA 4EP1A 2GQ0A 4NK5A 4DEYA 5JATA 3JZDA 1DEHA 4GAEA 4K6HA 5K9ZA 2HJVA 1L5ZA 2VKTA 3D8UA 2WOOA 4A73A 1QYCA 4TQAA 5IDVA 4OREX 4XSHA 1LC0A 3V80A 3GFGA 5K0FA 4MJ7A 3RG2A 3V8MA 2OORA 4K9MA 3PTLA 2ZT5A 3NHMA 1UJ4A 3RTGA 1CDOA 5FWNA 4X1KB 4DLUA 3RDPA 1US8B 2Z2YA 5HQ3A 1SVUA 1QUFA 4GD3Q 5IT0A 3U61B 1VHJA 2NTJA 3LBHA 3FVRA 3W8RA 1OHHD 4BNZA 5IZ4A 1ZA2A 2VNHA 4CKWB 4ZXFA 3ONFA 3WWYA 1USVA 4ACBA 2YXLA 3QFTA 3TPFA 1PQYA 1UL1X 4HEA6 1V9LA 2XQKA 1TO6A 1GAEO 3PI7A 2REXB 4JBXA 4CRWB 2AHOA 3TSAA 4DLXA 1XHFA 3NHKA 3PD7A 2BI7A 4W82A 2PPLA 3T9AA 3ZVMA 3GLKA 4FSXA 2BV3A 4DT1A 1NNLA 2R8EA 3G7NA 3EFEA 1C1DB 1UBRS 1DWPA 1P1JA 1JZSA 1QCYA 3W3AD 2RGBA 1V3UA 3AVUA 1QORA 2R4QA 3KE8A 3NBZC 2BFAA 1H2EA 3EJWA 3L41A 1VHDA 1EJ2A 4KL8S 3K3PA 2Q6VA 4EPRA 1X80A 1Z6PA 4F7WA 1MA0A 5DYGA 5EE9A 3FDXA 5KQRA 1JAHA 3A1EA 4J4BA 1QIEA 3B12A 2XJ9A 1KJNA 1OXBB 3Q6MA 5JRZA 2EZ8A 3CRVA 3NCHA 3AF3A 3DP7A 2RBEA 1K3TA 1XNJA 2PNJA 3RNLA 1RYNA 3KZCA 4QASA 1R4NA 1YCFA 2FDCA 4S05A 3N39C 2Y2VA 3PSHA 3BKXA 5IVPA 1S2NA 4U7FA 1AQJA 5J40A 2E0IA 1GG2A 4QE3A 5LNK6 4JUAA 3RFUA 4XKJA 1CUSA 4ZCMA 4BKQA 4CF7A 4RXMA 1M54A 3EEBA 5KVQA 1E2FA 1YULA 3GRPA 3ANNA 4LDPA 2IIBA 4DC9A 4AZSA 3FNRA 2QSJA 5TLSA 4CIVA 2EHDA 3COWA 1GTL1 3K9QO 3KCNA 1ODCA 4WCDA 5IMSA 2WIDA 4KK4A 3DDHA 1CTQA 2X2PA 3LBNA 1D1SA 1H05A 1KIAA 4IOMA 2J6IA 5J2UB 3GVHA 2CLHB 2HPAA 5CVTA 4YAKA 3UAWA 3EDYA 1F2TA 2Z3ZA 4PCVA 1GGKA 4XQGA 2Q4DA 3AKYA 1T2DA 4L8FA 4KLNA 5CMLA 4Z86A 1E3DA 4LSGA 3VNRA 1A9QA 2F64A 4AJNA 2OCKA 5KO2A 4BXOB 2IKSA 4CL2A 4I1SA 3L0SA 2O0LA 5AWFC 3P9SA 1WDLA 3TZLA 1F6BA 4XUDA 4CUJA 1S9DA 3ZCTA 1AN9A 5ENDA 4C4YA 2PUFA 3OQ6A 3KAKA 2RHJA 1N1DA 2P4SA 3KTFA 4NBSA 2JCYA 1OW3B 2HA7A 5CTAA 3OUTA 4A91A 3B7WA 3D3QA 1RI4A 4P4LA 4OGGA 1U8AA 4W8GA 1Y1SA 3BRWD 3CKYA 3UAZA 2AG6A 2PT9A 5H68A 1M0TA 1KVUA 1F8FA 4TKLA 1R1DA 4OK6A 1P4RA 3OCYA 3MJHA 2DULA 3FPFA 3PG5A 4OU4A 7MDHA 5L7TA 3EA4A 1PLLA 2W6NA 3OOEA 4AMGA 2WDZA 2XLBA 3HDJA 5HBGA 1FU4A 1C1DA 1OV4A 1Z6TA 2VJAA 4JX8A 3NX4A 4MRPA 3EQZA 4NJMB 1SB9A 1Y9DA 4PRLA 1R15A 1ULTA 1E0DA 5AJVB 2QR5A 4YJ2B 3PUYA 1L7EA 4RSRA 5H7XA 4DJ5X 3V4FA 3IHWA 3WHPA 1BRTA 2LXNA 2NVBA 3OA0A 2YVUA 1Y63A 2XTNA 4N5IX 2GYUA 4V0ME 5J63A 3GP8A 5AIAA 1M0WA 1XIVA 4REOA 3NBQA 2O14A 4ZU6X 4A36A 3UANA 4L6AA 1KIMA 1D2MA 1I2BA 2R7AA 5JO9A 4TROA 1PFUA 4GOKA 4BBAA 3V8BA 4RZSA 4F4UA 1QE5A 3QPUA 3A6DA 2A35A 4BTLA 1AK1A 1GGVA 2JGJA 3R3JA 4GPBA 2Z6UA 4BNVA 2GCOA 2JA2A 1JQDA 2Q27A 4IFBA 2BFDB 3QOWA 4OHRA 4OI4A 4C1NA 2P3QA 2Y1EA 1IUOA 3F74A 1AV6A 5TPZA 4EVSA 4HLDA 1WP9A 3OZSA 4A8TA 1GR0A 4XZ3A 1K8YB 3AFMA 4NHEA 4NMMA 4NYMQ 4PBSA 3RIMA 4DFDA 2XDAA 3OE7D 1E6CA 3SFZA 2WJ3A 3MF4A 3U48A 5BNFA 4KLAA 4HAYA 4EGAA 2HPVA 4YV2A 4G5FA 2H11A 2IU0A 4KGXA 4JMLA 4RACA 2WTAA 2AV6A 4NC9A 1N77A 1IHOA 4NYIR 2QMOA 3H7AA 1MDBA 2RGAA 3GRFA 1YRYE 4RFSB 5A2GA 5AESA 1EK0A 2IHZA 3WAKA 1XCPA 3M81A 3MLBA 3PPIA 2ZPTX 4I81A 4CJXA 3SX2A 1IY8A 3CJRA 1WCWA 3D5TA 2OG1A 3TLYA 4LF5B 2JRLA 4IZ6A 3OJCA 3QZUA 5CYOA 1WXXA 5CFLA 1RSZA 2PH7A 3LP6A 2QQEA 1AHIA 1AQNA 4CIXA 2V1XA 3FA2A 3HYLA 4HPJB 2XZLA 2X9VA 1ADFA 3LT2A 4XAQA 3IDZA 2GA9A 1IM2A 2PD6A 3OAAD 1C14A 1E7YA 3GBVA 3RSHA 3QU5A 3VH2A 4PPNA 4AO6A 2GJ9A 3HU5A 4EFDA 1E2MA 4Q00A 4GSLA 4OQYA 2WMYA 1K8RA 1OLOA 2UVPB 2BGTA 4YECA 3SYRA 4LKRA 3I04M 4AJIA 3DQPA 3NHRA 3HDHA 4KKXB 4KLRA 4AG5A 5D8DA 1MX9A 5DYYA 3ECSA 3R5TA 3VU0A 3U6BA 2AR7A 3BQMB 1P4HA 3B2EA 4OXQA 4L5YA 4CF5A 1KTIA 2J0SA 4QO7A 3A1WA 3WNDA 1TECE 4BZPA 4E5KA 2HB6A 2PA3A 4EM6A 1DIHA 1SD2A 2HUPA 3HCDA 3DMPA 4YTEA 1FUIA 2ZUVA 3ZCRA 1JKXA 1SD1A 3RJZA 4N0QA 1NBAA 1E94E 2XB8A 3TBKA 1PNRA 2IP1A 2YY6A 2JHFA 3OT1B 1T2FA 2VDQB 4XDHA 5HF8A 1ATIA 4K6MA 4D9EA 2H59A 4LOKA 4E07A 1N2HA 1G5HA 2WUGA 3D6AA 2ZGVA 4D26A 4TUYB 2OYCA 4JVNA 1SCQA 4OQMA 2C58A 4AKIA 1C9NA 1ZLXA 1JHZA 4B82A 1RXIA 1MO3A 1N0WA 1O6ZA 1SNYA 1YDEA 1ZXLA 2P9HA 3E5RA 4P84A 2H6EA 4G89A 4JLDA 5AH0A 5K0NA 5TS2A 3MGGA 4CMCA 2W8BA 5KSYA 3EIEA 4ZYUA 4C0KA 1QG0A 3R5XA 3RROA 1QBKC 1TO2E 1E1NA 3U39A 1P77A 1ODSA 1TJYA 2FW6A 2IYWA 1L7XA 3LFUA 2C04A 1HSOA 5CX4A 1PR1A 1TRHA 2QRNA 1K08A 2F7SA 2JIZD 2X9NA 3MCUA 2WOJA 5KVSA 4P86A 1Z6AA 2NUTA 3L8CA 1Q7BA 2B9EA 5D6OA 1TU0A 5ELMA 2PUAA 1DCKA 3TYXA 2DH5A 1DPGA 4ARAA 4ZJYA 2JEOA 4I8IA 5JASA 1IVNA 2QWXA 1CY1A 1SKMA 3EULA 3KXPA 3NYIA 4OAQA 1RHMA 1MMFB 3NDPA 1P45A 1PFYA 1SY7A 2D2VA 5KYWB 1Z8NA 4RD4A 2EGHA 3O4VA 3ID6C 5KNLA 4B0PA 2HMVA 2ZRKA 4B4DA 3QWBA 3TSWA 4CM5A 2A78A 3WKAA 2GRUA 4V0SA 3TR6A 3ZWVA 3VR5H 1JR4A 1U9IA 1V6AA 3BZWA 4RWZA 3JQCA 4L4SA 3BIXA 3QVUA 3ZQKA 2D62A 4JB2A 3BE6A 2BEVA 1ZHFA 1MHTA 4INZA 4A26A 1KEZA 4YUXA 2RHHA 2Y3IA 1UR5A 3IILA 3IR5A 5BR4A 2VVTA 4KXUA 1U04A 1MTOA 4GZ3A 2PSJA 5DGHA 3IXQA 5H70A 4YXWD 2BHNA 1ZKMA 1ZJJA 4M76B 5EE1A 3DMRA 3COZA 3GUCA 3RABA 1MAHA 1HTWA 1R6TA 2C3MA 3PGKA 4W6ZA 3OKCA 3OZUA 4D7AA 1IBSA 1C50A 4MS4B 2WPDA 1RR6A 3AIIA 3K70D 2GFQA 5KOIA 1WSDA 3FMPB 1KSFX 4D9HA 3LK6A 4HC4A 3THWB 1KJQA 1D09A 2PGAA 2YFYA 4FR5A 3OM0A 1NU6A 2J0UB 4YR7A 4LSWA 3DZCA 3EQ9A 3N1UA 5CLFA 4HBGA 5MGNA 1O9GA 3OZEA 2ZJZA 1OX5A 1IN5A 3SQNA 3EQ8A 3LC0A 1JDZA 5T64A 2RGRA 5AVKA 3T4XA 4FFBA 3IBGA 4K86A 5BYAA 1UC5B 4OK3A 4LC9A 1N1MA 4J6EA 4M6WB 4IINA 3WP1B 1UAYA 5IVIA 3HYCA 1V37A 2X7HA 3A36A 1VG0B 4PZ0A 5ELXA 2C4MA 5ETJA 5IN4A 4L95C 3KHTA 3G2QA 5FOUA 3V3TA 6LDHA 4JROA 3L7DA 1O87A 3N8KA 5I9TA 2OSVA 3TWOA 1V5EA 3VNVA 4ZJZA 4B17A 2HSEA 1FTQA 2XZPA 2YC2C 4KDFA 1T0JB 3ESZA 2J3DA 2E89A 1PZXA 2O3TA 2AFHE 2QX9A 2ZIUB 2DJIA 3QFHA 2JGLA 4JP2A 3AW8A 2XEDA 4H1HA 4BBJA 3E8MA 2G67A 4L5BA 1YR7A 4BV3A 4ZIRB 1L5HB 3BB4A 3NOVA 3WB1A 4PG7A 5KYWA 3IERA 2B3DA 1Z4LA 2HQBA 5JPDA 3TLAA 3EMDA 1Y5NA 3LXMA 4RS4A 2O2IA 2ORWA 3JARB 3AIKA 3X44A 5BW5A 4C4RA 4MVJE 1NMQA 2FFBA 5JCJA 4LTDA 4F6RA 2H3EA 2OBFA 4JU9A 4ZDJA 4Y8VA 2FZEA 3OIWA 2CHGA 1UKEA 1WU7A 5JH7B 1CJKC 1JLKA 5KDLA 5HJ2A 1VQ1A 4M1WA 3G2HA 5F51A 2RAFA 3ZIAA 5BV1A 3HU3A 3SXJA 1QO0A 3UJHA 2JF0A 4X1YB 1TUBA 2EP8A 4GUAA 1CK4A 5CLHA 4D2IA 1J8DA 3H8JA 4TXNA 4Q9JA 5B7GA 2PAFA 4V2UA 3C0KA 2JIRA 1NAHA 4IDGA 3SSNA 4D3DA 3K0KA 5IHPA 1NYRA 4RSHA 1M3SA 3IUYA 4J8PA 4N5HX 1J5EB 1XR3A 4PX3A 4LJ4A 3DEFA 3OX4A 1EX6A 2N47A 3WIOA 1XBTA 2WB4A 3G02A 4G4SP 2W2PA 5DSTA 1L7NA 1M2OA 1T9AA 4R1UA 4MMXB 4PN7A 3ENKA 4XGRA 1UM9A 1PWYE 3ZEAA 1NLYA 1WCYA 3DF7A 3ICWA 1X2BA 5C1OA 3LX4A 1FPMA 1JZQA 1L7OA 4PLZA 4QU5A 4XSVA 5AQEA 5D01A 4ZN6A 4LF6B 1N78A 2CNNA 1HT3A 1PAUA 1XEFA 4AFNA 4HVCA 2XEXA 1NC3A 2EBHX 4CM9D 4X7MA 4HDMA 3I09A 3P9CA 3KKQA 4PG6A 3OX2A 2DCUA 1R0SA 4O29A 3ROPA 4KX3A 2PUDA 1JF8A 3U1BA 3D7KA 4NCBA 1UT8A 2HHJA 2RGYA 4DNFA 1NWCA 1ZCJA 4W5NA 1G291 2OE2A 2UVPA 2Y1FA 3EZ2A 4FYVA 1QF9A 2J9FA 2B8TA 2GJSA 1GTSA 3EPHA 1RNLA 4A10A 5BQ3A 3FSEA 4TXMA 5KPJA 3GPCA 3PC8C 2FWPA 4LHYA 4TWRA 1KI2A 2OKGA 2VJQA 4J1SA 3VR0A 4EFMA 1H5NA 1DCMA 3E3NA 3OTGA 4HWGA 3GUYA 1T2UA 4PNZA 1HKHA 1RAGA 1SCJA 4G5GA 4RVGA 5LUAA 3WL5A 5F3RA 2GAOA 2GBIA 3L4BA 5IUJC 1QE0A 3DZHA 1YIOA 3OTOB 5B3JC 2HCBA 2G5GX 1E4EB 3PTAA 3E2PA 2IV7A 3CT6A 2C9DA 1ND6A 1RHRA 3F6EX 4C4ZA 5GQSA 4ERXA 4JL6A 5EP2A 3QVXA 4Q1AA 4BCDA 1E8MA 1N57A 1I32A 4JGGA 4X66B 1ZNQO 4IIBA 4CKEA 1OH6A 3W5BA 1M74A 1PTJC 2ID9A 2QZZA 2G08A 1PTJA 5IYZB 5A03A 1UPCA 1AA9A 1JSXA 1A88A 1P73A 2I3GA 2VUTA 2Z2ZA 4ZOEA 1F12A 1LI5A 1IVYA 3VC2A 3W9BA 4RVSA 3WNQA 1U2PA 4K2HA 4NH0A 1XG5A 2G9VA 1QWOA 2YHIA 3DE0X 1QTQA 4HNGA 2MYPA 4G6ZA 3K30A 5JEEA 4RH0A 1A8QA 2D8AA 5LIRA 1PL6A 3CLTC 3ZI0A 4D8YA 1P3DA 3DBVO 4UDOA 3UJBA 3RS8A 4PSKA 5M2QA 1FJGB 2GXSA 3OJFA 1JLHA 2FMKA 1CUGA 3G9ZA 2YMLA 1JL3A 3OBBA 3BD8A 5TMEA 3ZIDA 4MEAA 4C88A 1IQPA 3L1UA 4F84A 4RXTA 3C1OA 2QTRA 5DIFA 4BIMA 1IJKA 2X0NA 1E3WA 1GCIA 4LWOA 4IFTA 4EX7A 1KZ9A 1R8SA 3I4CA 4DV1B 1X7ZA 3EVZA 3LVBA 3H1EA 3E4DA 2HK9A 4F0JA 2BFMA 2I4LA 4I1PA 2FUG1 4WX2B 2JD2A 2GYWA 4JOCA 4UNQA 1KO1A 2OBYA 3W90A 1GIAA 1TM4E 5BN3B 3EZXA 5AXCA 4URFA 1WCV1 2O2JA 4R9RA 4K1LA 1X8JA 4MS1B 1EVJA 2QPAA 2VSNA 5ALHA 1PV1A 1QMPA 1QV9A 2P6PA 2H4XA 1KWKA 1AK9A 2I8CA 2O1WA 2UYQA 5LMCA 1TD1A 4PQFA 1SHJA 2E55A 2QL5A 2YXBA 1WUTA 1T29A 2HNBA 3WJAA 2GHRA 3STUA 3DZ8A 1I0ZA 2MYTA 3AVTA 2VAXA 3FNEA 2ESRA 4KUHA 4MA4A 2JS7A 4J0GA 5BVGB 4XIIA 2K6GA 3GZNA 2GM4A 1DL5A 2GJAA 2PIDA 3DM5A 4G5RA 4QLOA 3PEVA 3S5JA 2I03A 3H16A 3KG2A 4MJ3A 4TUYF 5H3HA 3TMKA 2ZSUA 3D6TB 5SY9A 4IUCS 2AI3A 2FPUA 3QVWA 1E9EA 2I62A 1UPTA 2PWYA 2WV7A 4ZYZA 1G21B 1MGPA 2NO7A 3S6JA 4ZZIA 2C5BA 3GA0A 3P2KA 3FDZB 4TYMA 4NCAA 1JKFA 2W6IA 4YASA 1QK4A 4MI9A 1KP3A 1RCUA 3CVWA 1RCTE 1ISPA 3I39X 1DOAA 4GF5A 2JZCA 2P2LA 2RSLA 3TTTA 4HLCA 3ZDBA 2I2XB 3U09A 1G8JA 4M1ZA 3GLIA 4M54A 2DPGA 1KQFA 5A4AA 3JYLA 1Q0QA 1NUSA 3NHSA 1EP1B 1CZOA 5FBQB 2WZBA 3O8DA 1KTVA 5LA6B 7ABPA 2OCPA 1TZBA 4N12A 3S99A 2QSYA 1DFIA 3O2JA 4XX1A 3AETA 2QQGA 5AW8A 2XKKA 1I2ZA 1W0JD 1OR8A 2B1RA 3F4BA 1R9GA 2VK4A 3A7DA 5IULC 4H7DA 4GRAA 1M72A 2A92A 3RO7A 2JFNA 4GVLA 1E5TA 1FP1D 3IALA 1AS0A 1WVMA 4JYBA 4YO8A 4WXEA 4YJHB 1T8PA 2WSLA 4Z99A 3KQLA 4DV2B 2VPIA 2E3JA 1ZINA 3GEGA 1GTJ1 2AK2A 2Z6VA 3W6PA 3MOGA 2YDYA 3W3ZB 1AX9A 3C3PA 5JWHA 3STXA 4DCGA 4URVR 1WO8A 3SXUA 3C5CA 3EPKA 1Q0SA 2I0FA 1T10A 2YL2A 3A3NA 2FG5A 4OQPA 3SS9X 4NH4A 2Z6QA 1II8A 1W5AA 3EZ6A 3GLFA 1GG5A 1NMXA 1OXSC 4RH1A 1XDDA 4HB3A 5KMGA 5JALA 1NLFA 4IV0A 4R1SA 5BPFA 1QOPB 4B6PA 4UXHA 1WU8A 3RSZA 1FFEA 2TRSB 3CCFA 5IDXA 1EWYA 1KI3A 1YO6A 3F90A 2X5OA 4RHEA 4WACA 1PT6A 5ILGA 4AULA 5IK2A 3N0TA 3PKZA 4ZVOA 3P2IA 1L5VA 2ZTVA 3K0FA 2I65A 3PU6A 4J2OA 4ECEA 3U44B 5HRCA 2AVDA 3V4VB 4DRXA 4XVUA 1N2BA 4HWOA 2BY4A 3OZWA 2B4AA 4PO9A 1KP2A 3INNA 4R7TA 4ZQCB 2UXDB 4F9TA 2O8NA 1GCOA 2NLOA 4WE3A 3UOGA 4BC1A 3WV5A 4Q4CA 4MUIA 1JLMA 1V8BA 3RHZA 2PGJA 1GGNA 1UIRA 4ZA2A 1P5HA 1HGXA 1SWVA 4XIGS 1ZIPA 3EVFA 4KK3A 1EXNA 2LUOA 2FFHA 3D31A 4BFLA 4E08A 4QJIA 5JAZA 4EG6A 2GYVA 2GFHA 4ZCPA 4PAQA 2X0KA 4KN8A 4M9SA 1YS7A 2ZYSA 3RFXA 3ABOB 3PR2B 4C08A 1W0KA 3GARA 1OI3A 4D6XA 2GZMA 3KR9A 4UQLA 2QX7A 3KPJA 1VJ1A 2H57A 1BXRB 2A9OA 3HE3A 3OICA 4FB4A 3DE6X 4FNAA 4HFRA 3WISA 2DERA 1RJDA 1ZNZA 1AMOA 1R6BX 3NTQA 1JS1X 4ZVTA 3B1YA 1G41A 3C4JA 1HLFA 1HG1A 1TEHA 5KQPA 1RJWA 5K3OA 3ETGA 1ULBA 3HUUA 3HB9A 1N4DA 4ZC8A 3COJA 4DKJA 1XMVA 1KYXA 5F76A 1MD9A 3KLNA 4NATA 1KORA 3IOCA 4B9AA 4GT1A 4MVYA 4CDNA 5KYXA 4QKQA 3FCYA 1UJBA 2NU8B 3C6ZA 4J29A 1BH2A 4DXAA 4A0QA 4PZ9A 1UPUA 2RAUA 2B92A 2PQ0A 3OU7A 1U2DA 2ZBUA 1X39A 2WNSA 4MWDA 4PHTA 3VMFA 5AVYA 3IRVA 2KMLA 2BGUA 3GRZA 3HKEB 2EQBA 4WADA 4L9AA 3ESXA 2BFCA 1UBNA 3QUTA 4I1OA 4Y9TA 5D51S 1TTTA 3L6OO 2IWHA 3UMSA 1W35A 3ICPA 2GRAA 4QNMA 3R77A 4J91A 4ZKDA 3IIEA 1V2GA 1WEKA 2O2SA 2OK8A 4FZ3A 4JJ7A 4R3NA 1FX0B 3X1YA 3QQ5A 4TSFA 1E7SA 3BGIA 3CE6A 3PPYA 4NCJA 2ZBEA 3C1UA 4W1SA 4WZAA 4EJSC 1WQ3A 1UPFA 4G85A 3DXFA 1K4KA 4KE9A 1X9HA 3D1JA 4QYIA 4R3WA 3RWMB 1FYXA 4XIFA 5IANA 1HDOA 2PMWB 4D82A 1JJVA 3QVTA 5TARA 3SX0A 5I7HA 1JR3E 1LFAA 3UNXA 3OCVA 5JDIC 1YR2A 3KQUA 4ROSA 3C7TA 3F7OA 3PYXA 4I4TA 1Q22A 1RRVA 1XLVA 4ZAZA 3ZW8A 5KQMA 1SU4A 1O4VA 3LUAA 1FDUA 1OT3A 3DVLA 1GZHB 4RABA 3UIEA 3VKVA 2YFKA 1OWNA 1ZJZA 3Q41A 1M73E 3H7IA 2C8VA 3OF5A 4CDMA 4D0NA 1NKVA 1QXSA 1QKIA 2PTGA 3KQPA 1C7FA 3F6RA 1ZUWA 3I9OA 4E6PA 1C9YA 4WK2B 1VHQA 3O9MA 1Q7CA 5HJ7A 5DX1A 4CM6A 4YR9A 2UUAB 4PLFA 2PJRA 2ZB4A 4PYMA 1VCMA 1NUAA 4KPUB 5L51A 4DNQA 4YRAA 4XDGA 3P52A 5BYJA 4TTPA 1E3WB 1PFWA 2GZDA 3UWSA 1P80A 4MK4A 3VPXA 1XWFA 3THYA 3ROXA 3SP1A 3PFCA 4KMOA 5FNVA 4YMTA 3TPCA 5A5FA 1BVYF 4HNTA 3K32A 2WUVA 1P1CA 1GT91 2DWCA 3C6QA 4TLEA 3MJTA 3K9NA 1S2OA 1EK6A 1YWGO 2EZ4A 5TPWA 1ZM9A 2VQ6A 4UMVA 5GM1A 4X60A 1CUEA 1EVLA 1RHJA 1UBHS 1Z2NX 2LIVA 3E8SA 4U9HS 4AF7A 1XQXA 1P0CA 1PJ2A 2E87A 2PM8A 2GZHA 1LI7A 5JI2E 2VHQA 1PEYA 3KEOA 4JN6B 2DLNA 1S2IA 3OPXA 5B1EA 5J47A 5KU1A 2YWCA 4EUFA 1CY6A 2ZYAA 5IVHA 3I9KA 3JYNA 5CYFA 1M1UA 4ZI7A 1JYFA 5A9RA 4GDFA 2BWJA 4M8IA 1YUNA 5FA8A 1J0DA 1L7QA 2BBTA 3PXBA 4MKIA 1ZLYA 2HA4A 3ZZTA 3QE9Y 2OB1A 4JVSB 1K6EA 3H2IA 1U9YA 1E2EA 2EXXA 5H1YA 2I9PA 5C7OO 2O2GA 4PYOA 3H87A 5DYTA 2H9IA 5B12A 2C7RA 2KB0A 3QXXA 1IUPA 2NZYA 2UUOA 3UUWA 4MP8A 3KTOA 2FSGA 2W70A 1KAEA 1O0SA 2GAJA 1AM4D 2QGNA 2W2LD 2ZBPA 3E2MA 1PJSA 4MAAA 4YQZA 1BVHA 4LRXA 4MRMB 3WP0A 2Z9BA 1DRKA 4FX5A 4ZOLB 4HQNA 3CBQA 4RNDB 4D3XA 1CIPA 1TZJA 2IHJA 3O8NA 4MUJA 1PWZA 5HFNA 4GS5A 3RIEA 1YRWA 1V41E 1Z6GA 5E3JA 1XWWA 3DAFA 1QH1A 4QVKA 4BO6A 1HG0A 4G07A 2NYUA 2AUNA 4YRRA 1OB5A 1CHDA 4GOJA 3K0AB 4RTNA 1SQ5A 4RK4A 1K6MA 3W79A 4B7UA 2R84A 3Q72A 4FSHA 4Q9NA 3ADKA 3VKHA 1H2ZA 4W1PA 3AVYA 5JMOA 2D0IA 1CUYA 1KI7A 1VMIA 2P4HX 5HVNA 5FPQA 4KQ9A 2WD8A 3I2IA 3DTYA 1LD3A 1H2RS 1PEAA 3LKZA 3QRWA 2ZZNA 3FGOA 3EDQA 1YDFA 3WZ2A 5J4HA 4JEIA 3DKRA 2FWNA 3ND8A 1DAHA 2YDXA 3WKCA 4CF3A 2YH2A 3EWNA 3OTIA 1XTBA 4DL9A 2GD2A 2GM5A 4CI9A 4RV4A 5JPCA 1D2HA 4HAXA 5DNAA 4DMKA 4QQFA 4XFKA 1IFXA 4RQUA 1TQ8A 2E4YA 4KPUA 1N5OX 4CMEC 3GRYA 4I3GA 4OGFA 1ZXBA 1ODKA 4UHHA 2IZ1A 1E6LA 1ONSA 2BW0A 4H4CA 1GGJA 2NVOA 1FYVA 3N0VA 1P2FA 2XODA 2ZS8A 4HVTA 5AVTA 4DLPA 4G1EB 1K3UB 2D8MA 2ID4A 3HCPA 3NNNA 2IPMA 4FCVA 4QPJC 2FW9A 2OP0A 4P7JA 5KWIA 3PL1A 4H3KB 3EGVA 1T5TA 3A05A 2EIHA 2Q5HA 5AW2A 2WUWE 3H86A 4AZ3A 3E70C 3IOBA 2CMKA 3KVNA 1TKAA 2CY0A 4PC3A 5AI6A 5TX7A 2V8BA 4WAUA 5LR6A 4CEIA 2HPHA 3NBXX 2Y1DA 2ECPA 4BNKA 5JAUA 1VECA 2EBWA 3PHLA 1SUSA 3CRMA 1OIVA 3AM1A 1U8TA 1OGJA 3FI0A 4WOBA 3TOXA 3B82A 5JVDA 4HKTA 1DEAA 2ZJ6A 1TO1E 4YJFB 2J0VA 3GAFA 1YVEI 4M1QA 4ER6A 1J0CA 4FQ8A 4ZOLA 2JJ1A 4OG2A 1NWHA 4R98A 1N34B 1KAOA 2H00A 2C77A 1NBME 5AOVA 3W5UA 5JU6A 2VWPA 1QHGA 5A4JA 1Z7WA 1J2JA 1GFSA 3WL6A 4IMRA 2B4QA 5EFOA 3T1OA 3HBAA 2VDRB 3B6ZA 4GR5A 3V8VA 1R16A 1G20A 3WJ2A 5FUXA 4CMAA 2EFJA 1KBOA 1M2NA 3GZTB 3MJVA 1ENPA 1K63A 4MJXA 3OHPA 1W73A 5EESA 1O57A 3TMAA 3SNHA 3ORYA 1GAQA 3PDIB 4QEDA 2Q28A 2QRVA 4M0KA 4KODA 1N3IA 1SPBS 3WIVA 1FB5A 3PYMA 3B52X 3DR3A 3BG5A 1U3FA 1OFUA 1HEUA 3LWZA 5BQFA 3LF1A 3FUCA 2POCA 4IO0A 2VSYA 4F4CA 3NT5A 4Y2QA 2VDUE 1LSUA 1GYPA 2C4TA 2W2TA 3GA7A 3ZI4A 1U2QA 3MMZA 1CEXA 4D45A 5K4GA 3P94A 5EKUA 3FZGA 1Q12A 3ZDAA 4EHKA 1SXJB 4KWCA 2W6CX 1MOZA 3GJTA 4R3UC 1P31A 5EJ4A 4BO8A 2EVWX 3KPUA 3Q5EA 2PGLA 1VIVA 1ESZA 4S24A 4XWKA 2CJPA 4HO1X 1FUEA 4I50B 1U7ZA 1HF3A 3ZQ4A 1ZZEA 5JHHB 1ZITA 2OC4A 1QHHB 4R9NA 2ZAOA 3V34A 4L4ZA 4OUKX 4U2KA 2E18A 2GXQA 2J6BA 4R8SA 5B37A 4DYDA 3GAAA 4Y7DA 5CIWA 5CP8A 3NEAA 1KK2A 2H1IA 4LA4A 4UHCA 1H2YA 4FYYA 3D43A 2ZQ5A 4C01A 5J4YA 5HFJA 4HNSA 4F5ZA 3ZHXA 2O0HA 4NBNA 2WQ6A 1Y5MA 4Y2YA 2OQRA 3TFQA 621PA 3QEBZ 5KTSA 2XVAA 4R2MA 5FA5A 1V2HE 2YBDA 1H5UA 4DADA 1Q1NA 2QX8A 5IJ0A 2QU7A 2O8BB 2A1TS 3O4GA 2GZSA 2KBEA 1Q83A 1ZESA 1E0KA 2CFSA 4KRYA 3IJEB 4R2HA 2O59A 5F1OA 4LQ4A 1KXZA 2WA2A 3AT1A 4AK9A 4IH1A 4ZGBA 2MT9A 4UEKA 2JGDA 4R2JA 4XOIA 3TDMA 1Q0HA 3B2QA 4XD7D 3IVAA 4ENUA 1NW4A 5KSWB 1K2WA 2UYCA 1MCZA 1JXMA 4C0QC 5DW3A 3ET5A 1OXMA 1MABA 4LVUA 4E51A 4BNDB 5JNSA 3DGFC 2WILA 2F4VB 3H9GA 2IIVA 2ZTMA 4UMFA 3UXEA 4URZR 3Q8WA 2W2NA 4BNLA 5KMGB 5D3MA 5FWXA 1DJQA 2XW6A 2H08A 3H2YA 2X4LA 4JVMA 2DPXA 4UKDA 2EQ5A 2Q46A 2X1MA 1G8FA 5ITVA 4L72A 4OATA 1NBMD 2FHSA 3BB3A 3E9ZA 1Z13A 2YRXA 3DWIA 4Y67A 3N8GA 2DBYA 4N03A 3IESA 4BZZA 3QTTA 2Q0SA 4Q1EA 4MQEA 3V2HA 4OYRA 2I7CA 1O95D 1YDGA 1ULUA 2RH5A 5AW3A 3P45A 2XNDA 4PFKA 5AUQA 3OZBA 1QU3A 1YZUA 3R3WA 3MWJA 1GNTA 5EFZA 2P2DA 3A3KA 3KL4A 2G0NA 3TX2A 6PFKA 1OWMA 4TXHA 3EGXB 3OP1A 2VZ9A 1ITZA 5CK4A 2BGLA 2YC4C 1XZHA 3D6NB 3S5UA 4MVCA 3ZU2A 5BW6B 2DFDA 2H8GA 2VF7A 4R0NA 1JTVA 1W1IA 2PRJA 4QTXA 3CH4B 2IHBA 2G9UA 1IUNA 3HFSA 2COKA 4HGQA 3K5WA 5DHAA 3ZV3A 1N5DA 3DZBA 3PP8A 2JLRA 5I8ZA 4YIKA 5GOZA 4OV6B 3LPCA 3ZXUB 3ZY6A 3WYGA 2MJLA 4UDYX 5TQ0A 1XZNA 2ZRLA 5EZYF 4I4LA 1T1SA 2QLJA 3UCFA 4A23A 1RRPA 5HKOA 2I78A 3FIJA 3FYSA 3GJYA 4KXWA 4Q03A 1WB5A 4QYMA 2Q2NA 1GCUA 4YCBA 1Z56C 4TMVA 4F3YA 4IRXA 4D80A 5JZ9A 2DMRA 4OQQA 3H6HA 3TQIA 1F3LA 2BM1A 3WTBA 4CIAA 4HRXA 4JA2A 2YWHA 3DYBA 1N3LA 1KS9A 2MDTA 1WHSA 2BMWA 3C14C 3JVDA 4R8KA 3QP9A 2X6QA 2E5LB 4UCFA 1HE5A 4R84A 3MJFA 3KU4A 4IIEA 2IYRA 3OQIA 4WY2A 2NG1A 2P62A 1XNHA 3HLYA 2RD2A 3HRHA 2AFIE 2C7VA 3OJWA 1T25A 2C7BA 2CDBA 3HWWA 4X7BA 5L3RA 3Q88A 4K40A 2PFKA 3PJDA 4R9UC 3TI9A 5JROA 3QU4A 3ZD8A 4ZDIA 2VRCA 3KAQA 1UBKS 1IRIA 3EVTA 3BZBA 2J0UA 1QHNA 1DRWA 1XKLA 4S1NA 2XCQA 3FGPA 2DR3A 3Q1LA