1J4PA

Nmr structure of the fha1 domain of rad53 in complex with a rad9-derived phosphothreonine (at t155) peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
151
structure length
151
Chain Sequence
ATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISRLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of two FHA1-phosphothreonine peptide complexes provide insight into the structural basis of the ligand specificity of FHA1 from yeast Rad53.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/cell cycle
molecule keywords PROTEIN KINASE SPK1
total genus 23
structure length 151
sequence length 151
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 1j4pA00
1R21A 1J4PA 3I6WA 3FM8A 5DJOA 4A0EA 3VA1A 1FHRA 3UNMA 3VPYA 1UHTA 1QU5A 2JQIA 2KFUA 3I0NA 1YJMA 3MDBA 2KKLA 3POAA 2KB4A 3HUEA 1J4LA 4EGXA 2JPEA 3GQSA 1MZKA 3HX1A 2G1LA 2PIEA 1LGPA 3ELVA 5A8IA 1WV3A 2JQJA 2KB3A 1K2NA 3HUFA 1LGQA 3UV0A 2LC1A 1K3NA 2EH0A 2BRFA 2FF4A 3UN0A 1J4KA 1G6GA 5E50A 2XT9B 2CSWA 3I0MA 3OUNA 4H87A 4G2SA 1J4QA 1K3JA 1DMZA 3ELSA 1J4OA 2A0TA 4JONA 1GXCA 2FEZA 3I6UA 3UNNA 1K3QA 2AFFA 2JQLA 3PO8A 4D9VA 3VA4A 2JKDA 1WLNA 2W3OA 3KT9A 3UMZA 4EJQA 1FHQA 3UOTA 1G3GA 1YJ5C 1K2MA 4QCJA 1UJXA
chains in the Genus database with same CATH superfamily
3DITA 5DHTA 5DJOA 1QU5A 3MDBA 1YJMA 1YT5A 2KKLA 1KHUA 1ZOQA 1K3NA 1U0RA 3HX1A 3V7WA 1WV3A 3HUFA 1Z0UA 3UN0A 2BRFA 4WRRA 2I2AA 1U7VB 3OUNA 5EJIA 4JIVD 2I2FA 2I2BA 3ELSA 3GMJA 4KU0D 1U0TA 2JQLA 5DHUA 3V8QA 3KT9A 1MJSA 3UMZA 1MK2A 2I1WA 2Q5FA 1G88A 1KHXA 3UOTA 1G3GA 5C4VA 1R21A 3VZCA 3I6WA 3FM8A 4A0EA 1MR1A 5EJGA 5DHSA 2QV7A 5JEOA 2PIEA 1LGPA 1Y3HA 3ELVA 3PFNA 1K2NA 1Y3IA 1DD1A 1LGQA 3UV0A 3V7UA 3V8MA 2I29A 4H87A 4G2SA 1J4QA 2AN1A 3V8NA 5JEJA 1DMZA 4R9PA 5DHPA 2FEZA 3I6UA 3UNNA 1K3QA 3A77A 4HAOA 4D9VA 1FHQA 1UJXA 4V24A 1K3JA 3UNMA 4WERA 3VPYA 1DEVA 2JQIA 5EJFA 2JGRA 2KB4A 2JPEA 3GQSA 5DHRA 3AFOA 3V8RA 5JERA 1G6GA 5E50A 2XT9B 2CSWA 4A4YA 1QWTA 2QVLA 5JEMA 2P1RA 3DSHA 4JONA 1GXCA 3PO8A 2BONA 1WLNA 2JKDA 4EJQA 4L02A 2XXSA 3VA1A 5DHQA 1J4PA 4JIWD 3V8PA 1UHTA 2I2DA 5JELA 2KFUA 3I0NA 3POAA 3HUEA 4DY6A 1J4LA 4EGXA 1FHRA 5A8IA 1MZKA 2G1LA 1J2FA 1U7FA 2JQJA 2KB3A 1U7FB 3S40A 2LC1A 2FF4A 1SUWA 1J4KA 3I0MA 3T5PA 1U7VA 5JEKA 3V80A 5BVIA 1J4OA 1YGSA 2A0TA 2I2CA 2AFFA 1Z0SA 3VA4A 1Z0ZA 2W3OA 5EJHA 3V7YA 1K2MA 3VZBA 1YJ5C 4QCJA 3VZDA 2EH0A
chains in the Genus database with same CATH topology
3DITA 5DJOA 1QU5A 3MDBA 1YJMA 2KKLA 1KHUA 1ZOQA 1K3NA 3HX1A 1WV3A 3HUFA 3UN0A 2BRFA 4WRRA 1U7VB 3OUNA 4JIVD 3ELSA 3GMJA 4KU0D 2JQLA 3KT9A 1MJSA 3UMZA 1MK2A 3UOTA 1G88A 1KHXA 1G3GA 5C4VA 1R21A 3VZCA 3I6WA 3FM8A 4A0EA 1MR1A 2QV7A 5JEOA 2PIEA 1LGPA 3ELVA 1K2NA 1DD1A 1LGQA 3UV0A 4H87A 4G2SA 1J4QA 1DMZA 5JEJA 4R9PA 2FEZA 3I6UA 3UNNA 1K3QA 3A77A 4D9VA 1FHQA 1UJXA 4V24A 1K3JA 3UNMA 4WERA 3VPYA 1DEVA 2JQIA 2JGRA 2KB4A 2JPEA 3GQSA 5JERA 1G6GA 5E50A 2XT9B 2CSWA 4A4YA 1QWTA 2QVLA 5JEMA 2P1RA 3DSHA 4JONA 1GXCA 3PO8A 2BONA 1WLNA 2JKDA 4EJQA 4L02A 2XXSA 3VA1A 1J4PA 4JIWD 5JELA 1UHTA 2KFUA 3I0NA 3POAA 3HUEA 4EGXA 1J4LA 1FHRA 5A8IA 1MZKA 2G1LA 1J2FA 1U7FA 2JQJA 2KB3A 1U7FB 3S40A 2LC1A 2FF4A 1J4KA 3I0MA 3T5PA 1U7VA 5JEKA 5BVIA 1J4OA 1YGSA 2A0TA 2AFFA 3VA4A 2W3OA 1K2MA 3VZBA 1YJ5C 4QCJA 3VZDA 2EH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R21 A;  1J4P A;  3I6W A;  3FM8 A;  5DJO A;  4A0E A;  3VA1 A;  1FHR A;  3UNM A;  3VPY A;  1UHT A;  1QU5 A;  2JQI A;  2KFU A;  3I0N A;  1YJM A;  3MDB A;  2KKL A;  3POA A;  2KB4 A;  3HUE A;  1J4L A;  4EGX A;  2JPE A;  3GQS A;  1MZK A;  3HX1 A;  2G1L A;  2PIE A;  1LGP A;  3ELV A;  5A8I A;  1WV3 A;  2JQJ A;  2KB3 A;  1K2N A;  3HUF A;  1LGQ A;  3UV0 A;  2LC1 A;  1K3N A;  2EH0 A;  2BRF A;  2FF4 A;  3UN0 A;  1J4K A;  1G6G A;  5E50 A;  2XT9 B;  2CSW A;  3I0M A;  3OUN A;  4H87 A;  4G2S A;  1J4Q A;  1K3J A;  1DMZ A;  3ELS A;  1J4O A;  2A0T A;  4JON A;  1GXC A;  2FEZ A;  3I6U A;  3UNN A;  1K3Q A;  2AFF A;  2JQL A;  3PO8 A;  4D9V A;  3VA4 A;  2JKD A;  1WLN A;  2W3O A;  3KT9 A;  3UMZ A;  4EJQ A;  1FHQ A;  3UOT A;  1G3G A;  1YJ5 C;  1K2M A;  4QCJ A;  1UJX A; 
#chains in the Genus database with same CATH topology
 3DIT A;  5DHT A;  5DJO A;  1QU5 A;  3MDB A;  1YJM A;  1YT5 A;  2KKL A;  1KHU A;  1ZOQ A;  1K3N A;  1U0R A;  3HX1 A;  3V7W A;  1WV3 A;  3HUF A;  1Z0U A;  3UN0 A;  2BRF A;  4WRR A;  2I2A A;  1U7V B;  3OUN A;  5EJI A;  4JIV D;  2I2F A;  2I2B A;  3ELS A;  3GMJ A;  4KU0 D;  1U0T A;  2JQL A;  5DHU A;  3V8Q A;  3KT9 A;  1MJS A;  3UMZ A;  1MK2 A;  2I1W A;  2Q5F A;  1G88 A;  1KHX A;  3UOT A;  1G3G A;  5C4V A;  1R21 A;  3VZC A;  3I6W A;  3FM8 A;  4A0E A;  1MR1 A;  5EJG A;  5DHS A;  2QV7 A;  5JEO A;  2PIE A;  1LGP A;  1Y3H A;  3ELV A;  3PFN A;  1K2N A;  1Y3I A;  1DD1 A;  1LGQ A;  3UV0 A;  3V7U A;  3V8M A;  2I29 A;  4H87 A;  4G2S A;  1J4Q A;  2AN1 A;  3V8N A;  5JEJ A;  1DMZ A;  4R9P A;  5DHP A;  2FEZ A;  3I6U A;  3UNN A;  1K3Q A;  3A77 A;  4HAO A;  4D9V A;  1FHQ A;  1UJX A;  4V24 A;  1K3J A;  3UNM A;  4WER A;  3VPY A;  1DEV A;  2JQI A;  5EJF A;  2JGR A;  2KB4 A;  2JPE A;  3GQS A;  5DHR A;  3AFO A;  3V8R A;  5JER A;  1G6G A;  5E50 A;  2XT9 B;  2CSW A;  4A4Y A;  1QWT A;  2QVL A;  5JEM A;  2P1R A;  3DSH A;  4JON A;  1GXC A;  3PO8 A;  2BON A;  1WLN A;  2JKD A;  4EJQ A;  4L02 A;  2XXS A;  3VA1 A;  5DHQ A;  1J4P A;  4JIW D;  3V8P A;  1UHT A;  2I2D A;  5JEL A;  2KFU A;  3I0N A;  3POA A;  3HUE A;  4DY6 A;  1J4L A;  4EGX A;  1FHR A;  5A8I A;  1MZK A;  2G1L A;  1J2F A;  1U7F A;  2JQJ A;  2KB3 A;  1U7F B;  3S40 A;  2LC1 A;  2FF4 A;  1SUW A;  1J4K A;  3I0M A;  3T5P A;  1U7V A;  5JEK A;  3V80 A;  5BVI A;  1J4O A;  1YGS A;  2A0T A;  2I2C A;  2AFF A;  1Z0S A;  3VA4 A;  1Z0Z A;  2W3O A;  5EJH A;  3V7Y A;  1K2M A;  3VZB A;  1YJ5 C;  4QCJ A;  3VZD A;  2EH0 A; 
#chains in the Genus database with same CATH homology
 3DIT A;  5DJO A;  1QU5 A;  3MDB A;  1YJM A;  2KKL A;  1KHU A;  1ZOQ A;  1K3N A;  3HX1 A;  1WV3 A;  3HUF A;  3UN0 A;  2BRF A;  4WRR A;  1U7V B;  3OUN A;  4JIV D;  3ELS A;  3GMJ A;  4KU0 D;  2JQL A;  3KT9 A;  1MJS A;  3UMZ A;  1MK2 A;  3UOT A;  1G88 A;  1KHX A;  1G3G A;  5C4V A;  1R21 A;  3VZC A;  3I6W A;  3FM8 A;  4A0E A;  1MR1 A;  2QV7 A;  5JEO A;  2PIE A;  1LGP A;  3ELV A;  1K2N A;  1DD1 A;  1LGQ A;  3UV0 A;  4H87 A;  4G2S A;  1J4Q A;  1DMZ A;  5JEJ A;  4R9P A;  2FEZ A;  3I6U A;  3UNN A;  1K3Q A;  3A77 A;  4D9V A;  1FHQ A;  1UJX A;  4V24 A;  1K3J A;  3UNM A;  4WER A;  3VPY A;  1DEV A;  2JQI A;  2JGR A;  2KB4 A;  2JPE A;  3GQS A;  5JER A;  1G6G A;  5E50 A;  2XT9 B;  2CSW A;  4A4Y A;  1QWT A;  2QVL A;  5JEM A;  2P1R A;  3DSH A;  4JON A;  1GXC A;  3PO8 A;  2BON A;  1WLN A;  2JKD A;  4EJQ A;  4L02 A;  2XXS A;  3VA1 A;  1J4P A;  4JIW D;  5JEL A;  1UHT A;  2KFU A;  3I0N A;  3POA A;  3HUE A;  4EGX A;  1J4L A;  1FHR A;  5A8I A;  1MZK A;  2G1L A;  1J2F A;  1U7F A;  2JQJ A;  2KB3 A;  1U7F B;  3S40 A;  2LC1 A;  2FF4 A;  1J4K A;  3I0M A;  3T5P A;  1U7V A;  5JEK A;  5BVI A;  1J4O A;  1YGS A;  2A0T A;  2AFF A;  3VA4 A;  2W3O A;  1K2M A;  3VZB A;  1YJ5 C;  4QCJ A;  3VZD A;  2EH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...