1J4WA

Complex of the kh3 and kh4 domains of fbp with a single_stranded 29mer dna oligonucleotide from the fuse element of the c-myc oncogene
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
145
Chain Sequence
GSHMIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPPDRAQHAAEIITDLLRSVQQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*TP*A*TP*AP*TP*TP*CP*CP*CP*TP*CP*GP*GP*G*AP*TP*
publication title Structure and dynamics of KH domains from FBP bound to single-stranded DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 38
structure length 145
sequence length 174
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1j4wA01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1j4wA02
2JA9A 3L7ZC 1ZZKA 4IFDG 4B8TA 2HH2A 1TUAA 1WVNA 2JVZA 2CTLA 4NBQA 1DTJA 2AXYA 2CTEA 5K36G 1K1GA 2PY9A 4JVYA 2MJHA 2PQUA 1KHMA 1DT4A 1X4MA 2BA0A 2OPUA 1VIHA 3AEVB 5C0XG 1ZZJA 2JEAI 2BL5A 3U1KA 1X4NA 2ANRA 2CTMA 1J5KA 2JEBI 2OPVA 4LIJA 1ZZIA 1EC6A 2CTKA 2QNDA 4AIMA 1J4WA 2Z0SA 2NN6G 3V69A 2CPQA 2DGRA 1VIGA 4BA1I 5JEAG 4BA2I 2E3UA 2P2RA 2ANNA 4WANA 2JE6I 1WE8A 4QMFB 3VKEA 2JZXA 2YQRA 4OO1G 4JVHA 4WALA 2CTJA 1ZTGA 4AM3A 2FMRA 2HH3A 2CTFA
chains in the Genus database with same CATH superfamily
3L7ZC 1V8CA 1ZZKA 4DR3H 4B8TA 5DT9A 4OCHA 1N32H 4X65H 1N36H 3OETA 5FLXW 1VBIA 4FJSA 2UXBH 1AN7A 2X06A 4DR7H 1J5EH 4JV5H 2UXDH 5K36G 1KHMA 1SEIA 2D9IA 2PT7G 2PQUA 2OPUA 2VKCA 2UUAH 5LL6b 4DR5H 2A1SA 1J5KA 1HR0H 3QD7X 2JEBI 2OPVA 3GR5A 2Z0SA 2NN6G 3V69A 1UG8A 2DGRA 1S03G 4OX9H 2JE6I 1WE8A 4NZRM 4X64H 4NXNH 4B3TH 4JI4H 4WALA 3UOEA 2FMRA 2JA9A 5LMUH 4DV0H 2FFMA 2ZQEA 4DR1H 2HH2A 4K0KH 2E5LH 4DR2H 1HNXH 2CTEA 1IBKH 3OSSD 2M8WA 2MJHA 2UUCH 4E9JA 1X0AA 4DV3H 2CWHA 4DV1H 1S20A 3J81W 1N33H 3RF2A 1IBMH 4JI2H 5LMNH 2JEAI 2Y3MA 3SB1A 2CTMA 1EC6A 2CTKA 1PQXA 2G8YA 2CPQA 2VQFH 4JI7H 2E3UA 2K1HA 4H8AA 2LRRA 2UU9H 2JZXA 4PDBA 4OO1G 1HNWH 1ZTGA 2CTJA 2YQRA 2HH3A 3GABA 3JAMW 1IBLH 4IFDG 2CWFA 4JI1H 2LF0A 1XNRH 3GKUA 1WTJA 1WVNA 2JVZA 3T1HH 2HHHH 4KHPH 4DV2H 2M6QA 4DV4H 1XNQH 4NBQA 1DTJA 3I0PA 1HNZH 4JI5H 1K1GA 4G08A 4NZTM 1XRHA 4X62H 2BA0A 4OD6A 1VIHA 3NCVA 5C0XG 4DV6H 3AEVB 4LFBH 5A2QW 3FAUA 3T1YH 1NXUA 2BL5A 2ANRA 4EC5A 4LIJA 2QNDA 4AIMA 1N34H 5IWAH 5IT9W 2FPHX 1F0XA 1VIGA 5JEAG 4AQYH 1XMOH 1I94H 4GKKH 1XMQH 1V9NA 4FJUA 4DV7H 4JI3H 2CPMA 4LFAH 2ANNA 2O4CA 4WANA 2F4VH 4JVHA 1Z2IA 1X9ZA 3KDKA 4LF7H 3EZJA 5BR8H 1FJGH 4JI0H 4JI6H 4JI8H 1TUAA 2CTLA 4YHHH 4B3RH 4LF4H 1I6UA 4LF9H 2AXYA 4YY3H 3J7AK 2UXCH 2PY9A 4JVYA 2LTLA 1DT4A 1X4MA 4B8CD 4DUZH 4LF6H 1MSZA 4DR6H 1ZZJA 1WHRA 2VQEH 1FKAH 4DR4H 2LTMA 3U1KA 1X4NA 2UUBH 1ZZIA 4B3MH 4DUYH 1J4WA 4LFCH 4BA1I 4LF8H 4BA2I 4DV5H 2P2RA 4NXMH 4QMFB 3J80W 4GKJH 3VKEA 1ODHA 4B3SH 4X66H 3KDGA 3OTOH 2ZM6H 4AM3A 4LF5H 4JYAH 2CTFA
chains in the Genus database with same CATH topology
2JA9A 3L7ZC 1ZZKA 4IFDG 4B8TA 2HH2A 1TUAA 1WVNA 2JVZA 2CTLA 4NBQA 1DTJA 2AXYA 2CTEA 5K36G 1K1GA 2PY9A 4JVYA 2MJHA 2PQUA 1KHMA 1DT4A 1X4MA 2BA0A 2OPUA 1VIHA 3AEVB 5C0XG 1ZZJA 2JEAI 2BL5A 3U1KA 1X4NA 2ANRA 2CTMA 1J5KA 2JEBI 2OPVA 4LIJA 1ZZIA 1EC6A 2CTKA 2QNDA 4AIMA 1J4WA 2Z0SA 2NN6G 3V69A 2CPQA 2DGRA 1VIGA 4BA1I 5JEAG 4BA2I 2E3UA 2P2RA 2ANNA 4WANA 2JE6I 1WE8A 4QMFB 3VKEA 2JZXA 2YQRA 4OO1G 4JVHA 4WALA 2CTJA 1ZTGA 4AM3A 2FMRA 2HH3A 2CTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA9 A;  3L7Z C;  1ZZK A;  4IFD G;  4B8T A;  2HH2 A;  1TUA A;  1WVN A;  2JVZ A;  2CTL A;  4NBQ A;  1DTJ A;  2AXY A;  2CTE A;  5K36 G;  1K1G A;  2PY9 A;  4JVY A;  2MJH A;  2PQU A;  1KHM A;  1DT4 A;  1X4M A;  2BA0 A;  2OPU A;  1VIH A;  3AEV B;  5C0X G;  1ZZJ A;  2JEA I;  2BL5 A;  3U1K A;  1X4N A;  2ANR A;  2CTM A;  1J5K A;  2JEB I;  2OPV A;  4LIJ A;  1ZZI A;  1EC6 A;  2CTK A;  2QND A;  4AIM A;  1J4W A;  2Z0S A;  2NN6 G;  3V69 A;  2CPQ A;  2DGR A;  1VIG A;  4BA1 I;  5JEA G;  4BA2 I;  2E3U A;  2P2R A;  2ANN A;  4WAN A;  2JE6 I;  1WE8 A;  4QMF B;  3VKE A;  2JZX A;  2YQR A;  4OO1 G;  4JVH A;  4WAL A;  2CTJ A;  1ZTG A;  4AM3 A;  2FMR A;  2HH3 A;  2CTF A; 
#chains in the Genus database with same CATH topology
 3L7Z C;  1V8C A;  1ZZK A;  4DR3 H;  4B8T A;  5DT9 A;  4OCH A;  1N32 H;  4X65 H;  1N36 H;  3OET A;  5FLX W;  1VBI A;  4FJS A;  2UXB H;  1AN7 A;  2X06 A;  4DR7 H;  1J5E H;  4JV5 H;  2UXD H;  5K36 G;  1KHM A;  1SEI A;  2D9I A;  2PT7 G;  2PQU A;  2OPU A;  2VKC A;  2UUA H;  5LL6 b;  4DR5 H;  2A1S A;  1J5K A;  1HR0 H;  3QD7 X;  2JEB I;  2OPV A;  3GR5 A;  2Z0S A;  2NN6 G;  3V69 A;  1UG8 A;  2DGR A;  1S03 G;  4OX9 H;  2JE6 I;  1WE8 A;  4NZR M;  4X64 H;  4NXN H;  4B3T H;  4JI4 H;  4WAL A;  3UOE A;  2FMR A;  2JA9 A;  5LMU H;  4DV0 H;  2FFM A;  2ZQE A;  4DR1 H;  2HH2 A;  4K0K H;  2E5L H;  4DR2 H;  1HNX H;  2CTE A;  1IBK H;  3OSS D;  2M8W A;  2MJH A;  2UUC H;  4E9J A;  1X0A A;  4DV3 H;  2CWH A;  4DV1 H;  1S20 A;  3J81 W;  1N33 H;  3RF2 A;  1IBM H;  4JI2 H;  5LMN H;  2JEA I;  2Y3M A;  3SB1 A;  2CTM A;  1EC6 A;  2CTK A;  1PQX A;  2G8Y A;  2CPQ A;  2VQF H;  4JI7 H;  2E3U A;  2K1H A;  4H8A A;  2LRR A;  2UU9 H;  2JZX A;  4PDB A;  4OO1 G;  1HNW H;  1ZTG A;  2CTJ A;  2YQR A;  2HH3 A;  3GAB A;  3JAM W;  1IBL H;  4IFD G;  2CWF A;  4JI1 H;  2LF0 A;  1XNR H;  3GKU A;  1WTJ A;  1WVN A;  2JVZ A;  3T1H H;  2HHH H;  4KHP H;  4DV2 H;  2M6Q A;  4DV4 H;  1XNQ H;  4NBQ A;  1DTJ A;  3I0P A;  1HNZ H;  4JI5 H;  1K1G A;  4G08 A;  4NZT M;  1XRH A;  4X62 H;  2BA0 A;  4OD6 A;  1VIH A;  3NCV A;  5C0X G;  4DV6 H;  3AEV B;  4LFB H;  5A2Q W;  3FAU A;  3T1Y H;  1NXU A;  2BL5 A;  2ANR A;  4EC5 A;  4LIJ A;  2QND A;  4AIM A;  1N34 H;  5IWA H;  5IT9 W;  2FPH X;  1F0X A;  1VIG A;  5JEA G;  4AQY H;  1XMO H;  1I94 H;  4GKK H;  1XMQ H;  1V9N A;  4FJU A;  4DV7 H;  4JI3 H;  2CPM A;  4LFA H;  2ANN A;  2O4C A;  4WAN A;  2F4V H;  4JVH A;  1Z2I A;  1X9Z A;  3KDK A;  4LF7 H;  3EZJ A;  5BR8 H;  1FJG H;  4JI0 H;  4JI6 H;  4JI8 H;  1TUA A;  2CTL A;  4YHH H;  4B3R H;  4LF4 H;  1I6U A;  4LF9 H;  2AXY A;  4YY3 H;  3J7A K;  2UXC H;  2PY9 A;  4JVY A;  2LTL A;  1DT4 A;  1X4M A;  4B8C D;  4DUZ H;  4LF6 H;  1MSZ A;  4DR6 H;  1ZZJ A;  1WHR A;  2VQE H;  1FKA H;  4DR4 H;  2LTM A;  3U1K A;  1X4N A;  2UUB H;  1ZZI A;  4B3M H;  4DUY H;  1J4W A;  4LFC H;  4BA1 I;  4LF8 H;  4BA2 I;  4DV5 H;  2P2R A;  4NXM H;  4QMF B;  3J80 W;  4GKJ H;  3VKE A;  1ODH A;  4B3S H;  4X66 H;  3KDG A;  3OTO H;  2ZM6 H;  4AM3 A;  4LF5 H;  4JYA H;  2CTF A; 
#chains in the Genus database with same CATH homology
 2JA9 A;  3L7Z C;  1ZZK A;  4IFD G;  4B8T A;  2HH2 A;  1TUA A;  1WVN A;  2JVZ A;  2CTL A;  4NBQ A;  1DTJ A;  2AXY A;  2CTE A;  5K36 G;  1K1G A;  2PY9 A;  4JVY A;  2MJH A;  2PQU A;  1KHM A;  1DT4 A;  1X4M A;  2BA0 A;  2OPU A;  1VIH A;  3AEV B;  5C0X G;  1ZZJ A;  2JEA I;  2BL5 A;  3U1K A;  1X4N A;  2ANR A;  2CTM A;  1J5K A;  2JEB I;  2OPV A;  4LIJ A;  1ZZI A;  1EC6 A;  2CTK A;  2QND A;  4AIM A;  1J4W A;  2Z0S A;  2NN6 G;  3V69 A;  2CPQ A;  2DGR A;  1VIG A;  4BA1 I;  5JEA G;  4BA2 I;  2E3U A;  2P2R A;  2ANN A;  4WAN A;  2JE6 I;  1WE8 A;  4QMF B;  3VKE A;  2JZX A;  2YQR A;  4OO1 G;  4JVH A;  4WAL A;  2CTJ A;  1ZTG A;  4AM3 A;  2FMR A;  2HH3 A;  2CTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...