1J4WA

Complex of the kh3 and kh4 domains of fbp with a single_stranded 29mer dna oligonucleotide from the fuse element of the c-myc oncogene
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
145
Chain Sequence
GSHMIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPPDRAQHAAEIITDLLRSVQQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*TP*A*TP*AP*TP*TP*CP*CP*CP*TP*CP*GP*GP*G*AP*TP*
publication title Structure and dynamics of KH domains from FBP bound to single-stranded DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 38
structure length 145
sequence length 174
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1j4wA01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1j4wA02
2DGRA 1EC6A 2PQUA 2CTKA 2E3UA 1K1GA 2ANNA 1TUAA 2MJHA 4BA2I 1WE8A 1J5KA 4LIJA 2BA0A 1X4MA 1X4NA 2HH3A 2CTFA 2OPVA 4WALA 3VKEA 5JEAG 2AXYA 1J4WA 1DT4A 1VIHA 2NN6G 4AIMA 1ZZIA 2BL5A 2JE6I 1ZZJA 2CPQA 1ZTGA 2CTLA 1DTJA 3AEVB 2ANRA 4JVHA 4WANA 2HH2A 3U1KA 4BA1I 5C0XG 2CTEA 2P2RA 2JEAI 3L7ZC 2OPUA 4JVYA 4AM3A 2YQRA 4OO1G 5K36G 2JVZA 2JEBI 1KHMA 2FMRA 2Z0SA 2JA9A 2CTMA 1WVNA 2QNDA 4QMFB 1ZZKA 2CTJA 2JZXA 2PY9A 4IFDG 3V69A 1VIGA 4NBQA 4B8TA
chains in the Genus database with same CATH superfamily
2DGRA 4GKKH 4H8AA 1HNZH 1F0XA 3KDKA 2UXBH 4E9JA 1XMQH 2ANNA 4NZTM 4LIJA 2OPVA 1X4NA 1X4MA 3VKEA 4DUZH 1J4WA 4X64H 1IBLH 1IBMH 1J5EH 5K36G 4AIMA 4LF5H 2JE6I 1MSZA 4BA1I 4DV4H 4NZRM 5LMNH 2JEAI 4JI7H 4PDBA 1WTJA 2CWHA 2M6QA 1XNRH 4OO1G 2JVZA 4B3SH 2FMRA 1WVNA 4JI0H 1V8CA 3OETA 2ZQEA 4LF6H 2LF0A 3OSSD 4GKJH 2JZXA 4YY3H 4IFDG 4DV6H 3I0PA 4OCHA 4NBQA 4DV1H 4DR1H 4AQYH 4DV0H 2PT7G 4B8TA 2HHHH 4LF8H 4DR7H 1AN7A 4LFAH 2CTKA 4YHHH 1K1GA 2CPMA 1TUAA 4BA2I 1WE8A 3KDGA 4DUYH 2BA0A 2HH3A 2LTMA 3GR5A 2CTFA 3QD7X 2AXYA 4KHPH 1VIHA 1ZZJA 1NXUA 4X66H 1ZZIA 4JVYA 2CTLA 1DTJA 2O4CA 4WANA 3SB1A 3T1HH 1SEIA 3RF2A 2K1HA 1I6UA 4FJUA 2UUBH 2JEBI 1S20A 2Z0SA 1I94H 2QNDA 2UUAH 4LF4H 2ZM6H 4DR2H 3V69A 4LF7H 2Y3MA 1ODHA 1ZTGA 4JVHA 4DR3H 4NXMH 2G8YA 3FAUA 4X65H 4X62H 5BR8H 3GKUA 1EC6A 2E3UA 4DV2H 4JI2H 5IT9W 3EZJA 2MJHA 3JAMW 1Z2IA 3T1YH 5DT9A 2UUCH 1FJGH 3OTOH 2UXCH 2BL5A 3UOEA 4B3TH 4OD6A 1V9NA 5IWAH 4JI4H 2HH2A 3U1KA 2FFMA 1HNWH 2VQEH 4JI3H 4JYAH 5FLXW 2P2RA 1UG8A 2D9IA 1XMOH 4B3RH 4AM3A 3GABA 2YQRA 5A2QW 3J81W 4LFCH 4DR4H 2UXDH 4LFBH 4JI8H 4G08A 2LTLA 4B8CD 5LL6b 4K0KH 4QMFB 1ZZKA 5LMUH 4DV7H 1XRHA 4JI6H 2CTJA 1N36H 1N34H 3J7AK 1XNQH 4EC5A 1VIGA 2E5LH 4DR5H 4NXNH 1N33H 2PQUA 4OX9H 2F4VH 2UU9H 1HNXH 4JV5H 1J5KA 4JI1H 1IBKH 4WALA 1S03G 5JEAG 1DT4A 2NN6G 1PQXA 2M8WA 3AEVB 4DV3H 2CPQA 1N32H 2ANRA 2FPHX 5C0XG 4DV5H 1HR0H 4FJSA 2CTEA 2LRRA 2CWFA 3L7ZC 2OPUA 1VBIA 2VKCA 4LF9H 1X9ZA 4B3MH 1WHRA 1X0AA 2X06A 2A1SA 1KHMA 2JA9A 2CTMA 2VQFH 4DR6H 1FKAH 3NCVA 2PY9A 4JI5H 3J80W
chains in the Genus database with same CATH topology
2DGRA 1EC6A 2PQUA 2CTKA 2E3UA 1K1GA 2ANNA 1TUAA 2MJHA 4BA2I 1WE8A 1J5KA 4LIJA 2BA0A 1X4MA 1X4NA 2HH3A 2CTFA 2OPVA 4WALA 3VKEA 5JEAG 2AXYA 1J4WA 1DT4A 1VIHA 2NN6G 4AIMA 1ZZIA 2BL5A 2JE6I 1ZZJA 2CPQA 1ZTGA 2CTLA 1DTJA 3AEVB 2ANRA 4JVHA 4WANA 2HH2A 3U1KA 4BA1I 5C0XG 2CTEA 2P2RA 2JEAI 3L7ZC 2OPUA 4JVYA 4AM3A 2YQRA 4OO1G 5K36G 2JVZA 2JEBI 1KHMA 2FMRA 2Z0SA 2JA9A 2CTMA 1WVNA 2QNDA 4QMFB 1ZZKA 2CTJA 2JZXA 2PY9A 4IFDG 3V69A 1VIGA 4NBQA 4B8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGR A;  1EC6 A;  2PQU A;  2CTK A;  2E3U A;  1K1G A;  2ANN A;  1TUA A;  2MJH A;  4BA2 I;  1WE8 A;  1J5K A;  4LIJ A;  2BA0 A;  1X4M A;  1X4N A;  2HH3 A;  2CTF A;  2OPV A;  4WAL A;  3VKE A;  5JEA G;  2AXY A;  1J4W A;  1DT4 A;  1VIH A;  2NN6 G;  4AIM A;  1ZZI A;  2BL5 A;  2JE6 I;  1ZZJ A;  2CPQ A;  1ZTG A;  2CTL A;  1DTJ A;  3AEV B;  2ANR A;  4JVH A;  4WAN A;  2HH2 A;  3U1K A;  4BA1 I;  5C0X G;  2CTE A;  2P2R A;  2JEA I;  3L7Z C;  2OPU A;  4JVY A;  4AM3 A;  2YQR A;  4OO1 G;  5K36 G;  2JVZ A;  2JEB I;  1KHM A;  2FMR A;  2Z0S A;  2JA9 A;  2CTM A;  1WVN A;  2QND A;  4QMF B;  1ZZK A;  2CTJ A;  2JZX A;  2PY9 A;  4IFD G;  3V69 A;  1VIG A;  4NBQ A;  4B8T A; 
#chains in the Genus database with same CATH topology
 2DGR A;  4GKK H;  4H8A A;  1HNZ H;  1F0X A;  3KDK A;  2UXB H;  4E9J A;  1XMQ H;  2ANN A;  4NZT M;  4LIJ A;  2OPV A;  1X4N A;  1X4M A;  3VKE A;  4DUZ H;  1J4W A;  4X64 H;  1IBL H;  1IBM H;  1J5E H;  5K36 G;  4AIM A;  4LF5 H;  2JE6 I;  1MSZ A;  4BA1 I;  4DV4 H;  4NZR M;  5LMN H;  2JEA I;  4JI7 H;  4PDB A;  1WTJ A;  2CWH A;  2M6Q A;  1XNR H;  4OO1 G;  2JVZ A;  4B3S H;  2FMR A;  1WVN A;  4JI0 H;  1V8C A;  3OET A;  2ZQE A;  4LF6 H;  2LF0 A;  3OSS D;  4GKJ H;  2JZX A;  4YY3 H;  4IFD G;  4DV6 H;  3I0P A;  4OCH A;  4NBQ A;  4DV1 H;  4DR1 H;  4AQY H;  4DV0 H;  2PT7 G;  4B8T A;  2HHH H;  4LF8 H;  4DR7 H;  1AN7 A;  4LFA H;  2CTK A;  4YHH H;  1K1G A;  2CPM A;  1TUA A;  4BA2 I;  1WE8 A;  3KDG A;  4DUY H;  2BA0 A;  2HH3 A;  2LTM A;  3GR5 A;  2CTF A;  3QD7 X;  2AXY A;  4KHP H;  1VIH A;  1ZZJ A;  1NXU A;  4X66 H;  1ZZI A;  4JVY A;  2CTL A;  1DTJ A;  2O4C A;  4WAN A;  3SB1 A;  3T1H H;  1SEI A;  3RF2 A;  2K1H A;  1I6U A;  4FJU A;  2UUB H;  2JEB I;  1S20 A;  2Z0S A;  1I94 H;  2QND A;  2UUA H;  4LF4 H;  2ZM6 H;  4DR2 H;  3V69 A;  4LF7 H;  2Y3M A;  1ODH A;  1ZTG A;  4JVH A;  4DR3 H;  4NXM H;  2G8Y A;  3FAU A;  4X65 H;  4X62 H;  5BR8 H;  3GKU A;  1EC6 A;  2E3U A;  4DV2 H;  4JI2 H;  5IT9 W;  3EZJ A;  2MJH A;  3JAM W;  1Z2I A;  3T1Y H;  5DT9 A;  2UUC H;  1FJG H;  3OTO H;  2UXC H;  2BL5 A;  3UOE A;  4B3T H;  4OD6 A;  1V9N A;  5IWA H;  4JI4 H;  2HH2 A;  3U1K A;  2FFM A;  1HNW H;  2VQE H;  4JI3 H;  4JYA H;  5FLX W;  2P2R A;  1UG8 A;  2D9I A;  1XMO H;  4B3R H;  4AM3 A;  3GAB A;  2YQR A;  5A2Q W;  3J81 W;  4LFC H;  4DR4 H;  2UXD H;  4LFB H;  4JI8 H;  4G08 A;  2LTL A;  4B8C D;  5LL6 b;  4K0K H;  4QMF B;  1ZZK A;  5LMU H;  4DV7 H;  1XRH A;  4JI6 H;  2CTJ A;  1N36 H;  1N34 H;  3J7A K;  1XNQ H;  4EC5 A;  1VIG A;  2E5L H;  4DR5 H;  4NXN H;  1N33 H;  2PQU A;  4OX9 H;  2F4V H;  2UU9 H;  1HNX H;  4JV5 H;  1J5K A;  4JI1 H;  1IBK H;  4WAL A;  1S03 G;  5JEA G;  1DT4 A;  2NN6 G;  1PQX A;  2M8W A;  3AEV B;  4DV3 H;  2CPQ A;  1N32 H;  2ANR A;  2FPH X;  5C0X G;  4DV5 H;  1HR0 H;  4FJS A;  2CTE A;  2LRR A;  2CWF A;  3L7Z C;  2OPU A;  1VBI A;  2VKC A;  4LF9 H;  1X9Z A;  4B3M H;  1WHR A;  1X0A A;  2X06 A;  2A1S A;  1KHM A;  2JA9 A;  2CTM A;  2VQF H;  4DR6 H;  1FKA H;  3NCV A;  2PY9 A;  4JI5 H;  3J80 W; 
#chains in the Genus database with same CATH homology
 2DGR A;  1EC6 A;  2PQU A;  2CTK A;  2E3U A;  1K1G A;  2ANN A;  1TUA A;  2MJH A;  4BA2 I;  1WE8 A;  1J5K A;  4LIJ A;  2BA0 A;  1X4M A;  1X4N A;  2HH3 A;  2CTF A;  2OPV A;  4WAL A;  3VKE A;  5JEA G;  2AXY A;  1J4W A;  1DT4 A;  1VIH A;  2NN6 G;  4AIM A;  1ZZI A;  2BL5 A;  2JE6 I;  1ZZJ A;  2CPQ A;  1ZTG A;  2CTL A;  1DTJ A;  3AEV B;  2ANR A;  4JVH A;  4WAN A;  2HH2 A;  3U1K A;  4BA1 I;  5C0X G;  2CTE A;  2P2R A;  2JEA I;  3L7Z C;  2OPU A;  4JVY A;  4AM3 A;  2YQR A;  4OO1 G;  5K36 G;  2JVZ A;  2JEB I;  1KHM A;  2FMR A;  2Z0S A;  2JA9 A;  2CTM A;  1WVN A;  2QND A;  4QMF B;  1ZZK A;  2CTJ A;  2JZX A;  2PY9 A;  4IFD G;  3V69 A;  1VIG A;  4NBQ A;  4B8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...