1J5CA

Solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first solution structure of a paramagnetic copper(II) protein: the case of oxidized plastocyanin from the cyanobacterium Synechocystis PCC6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j5cA00
4YSSA 2HZHA 3UAAA 3QJVB 3ZDWA 4BXVA 3S3CB 4E9XA 1ETJA 5I6LA 1T5KA 3FU7A 1ZDSA 2CBPA 1ET7A 4Q8BA 4M3HA 4GYBA 5B1JC 1BXAA 2XV2A 1OCOB 1E5YA 2WO2B 2DWTA 2QPDB 2H5UA 3AW5A 1CUOA 2FJSA 2IWEA 2N0MA 4YSEA 3FU9A 1BQ5A 3OD3A 4DP5X 1W8EA 2XXFA 4KO9A 3FQYA 4M4RB 2VMJA 3KW7A 1AG6A 4GP8B 4BXSV 4RH4A 3OQRA 5B7FA 4Q89A 5FC9A 2IDFA 2NRDA 3JT2A 2DV6A 3NJFA 2DY2A 2PP9A 4ZK8A 7PCYA 1KCBA 1OOWA 2HX7A 2MTAA 1L9TA 1NDTA 4A67A 1OE3A 4KOBA 3TBCA 1SDDA 9PCYA 2OV0A 1SF5A 4YSQA 1KBWA 3PAZA 1GS6X 3JTBA 5PAZA 1ID2A 3FSVA 1ILUA 5IY5B 4GXFA 3ASOB 2Q5BA 4E9RA 1GY2A 1IC0A 3WIAA 3IN2A 1GS8A 1PMYA 1L9QA 1AANA 1ZIAA 3AG1B 2IDSA 3OM3B 1HAWA 1KDIA 3SBPA 1M57B 2VM3A 3S3DB 3ABMB 3H4HA 3PAVA 4E9QA 2AZUA 2PPDA 5B1BB 3TBBA 1V55B 4FA7B 4YSCA 3D12B 1PZBA 2GSMB 1X9RA 2BW5A 3MX0B 2I85A 2R7EB 1DZ0A 2IH9A 5F7AA 2XXGA 1A3ZA 2FQDA 2YAFA 2HRGA 2DWSA 5I5JA 1ET8A 4YVUA 4DP8X 3NJHA 3CDZA 4KNUA 4UF7C 5D4JA 5D4HA 3OMAB 2ZWNA 1SF3A 1WS7A 3DKHA 4DPCX 4A2GA 3T6WA 3X2QB 3GYRA 1J9QA 1A4BA 2FT6A 3SBRA 5A7EA 1E30A 4UAHA 2J55A 4KO6A 6PCYA 1M56B 2UXGA 3C75A 3IBOA 1NTDA 2VW6A 5B1JA 2UXVA 4AKPA 5ANHA 1AS8A 2B08A 3IN0A 1KCWA 1BXVA 1EHKB 1QLEB 1SHWA 3FQ1A 3S3BB 3V9EA 2XWZA 4DP6X 2UXTA 3WG7B 2XX1A 2MRYA 2BP8A 5AFAA 1NPJA 1IBYA 1SDDB 4G7RB 3AY2A 2QDVA 2UXFA 5I6NA 2YQBA 2EIMB 3FT0A 1JVLA 4A2HA 1YLBB 2IDTA 2XVBA 3CZUB 1I53A 4E9SA 3KW8A 3OMIB 4DP7X 2R7EA 3WKPA 1WA1X 1J9RA 1ADWA 5I6OA 3T9WA 1CC3A 1NIBA 1JOIA 1SJMA 1KDJA 2CALA 2GIMA 2PCYA 3WKQA 1GW0A 1XB8A 1GSKA 2PLTA 4P5RA 1EZLA 7PAZA 2FT8A 3NJJA 2FQEA 2BWDA 3T6ZA 5D4IA 4GY4A 2VW7A 3ZIYA 3NJLA 2IDQA 3ABLB 3N55A 2BW4A 1ASQA 2TSAA 2OCCB 3BQVA 1KYAA 4HCGA 3NP4A 3EH4B 3MBWB 4PCYA 1IUZA 2TSBA 2XYBA 4HZ1A 4YSRA 1A8ZA 2A3TA 3FPYA 1NIDA 1FWXA 2EIJB 1BYOA 1NWOA 4E9TA 2HLEB 1URIA 2BO0A 3CVBA 4HHWA 4NERA 3TU6A 1B3IA 1SFHA 8PAZA 4W9ZA 4GP5B 2W88A 2X87A 5I26A 1AS6A 1MG2C 4PAZA 2W8CA 2BP8B 3T6XA 2BWIA 2QDWA 1NPNA 1PLAA 1PNCA 1OF0A 1WAEA 4NAJA 5I6PA 2BP0A 2ZOOA 4KO5A 4HALA 4KNSA 4QLWA 2YAMA 4AX3A 3PAUA 1OE2A 3S8FB 2VW4A 1L9SA 4WTQA 1IKOP 4JHVA 1GYCA 1JXFA 2XV3A 3FSZA 1KV7A 2EILB 2QPEB 3WI9A 1A4CA 1OV8A 1W6LA 1PY0A 1BYPA 1WA0X 2BHFA 4DPAX 4HHGA 6PAZA 4A2FA 4HAKA 3S8GB 3CVCA 3FYEB 2YARA 2FT7A 3PXLA 1CYXA 2DYRB 1ASPA 1F56A 1XB6A 1FFTB 5E9NA 1OCRB 3TA4D 5AKRA 1J5CA 3NJKA 5I28A 1SNRA 3UACA 1AACA 1XB3A 1N70A 1A65A 2YAPA 4NB7A 1J5DA 1PAZA 2XU9A 4G72B 4A2EA 1L9PA 1OCZB 3AG4B 4EF3A 5TK2A 2IWFA 5B7EA 1JVOA 3SQRA 3NJMA 1SHXA 4KNTA 1PCSA 3NSFA 2H47C 1MZZA 3QQXA 2FQFA 2P80D 3EH5B 3ABKB 4YSOA 3TASA 4E9WA 1AAJA 2H3XC 2I7SA 2FQGA 2DYSB 3H56A 3FQ2A 1TKWA 3X1NA 4YSUA 3FSWA 2FWLB 4G70B 2JXMA 5AZUA 1NWPA 3HEIB 1W6WA 2AVFA 5I5MA 3CDZB 3QJTB 3QJQB 2AFNA 2VN3A 2UX7A 1WA2X 1PLBA 1PZAA 1SFDA 1PNDA 2HRHA 4JHUA 1TEFA 1NIEA 1KGYE 2P80A 1GS7A 5B7MA 4KO7A 4BWUA 1NINA 2ZONA 1NICA 4F2FA 1JERA 3DIVA 3IE9A 4TXVB 1ET5A 2YAEA 2YXVA 2WSDA 1JZIA 3NSYA 1JZEA 3GDCA 3NJGA 3AG2B 3V9CA 4YVNA 1BEXA 1E67A 1E65A 4DP9X 1R1CA 5B1AB 2J56A 2YAHA 1FA4A 4A68A 3DTUB 2LLNA 3QJRB 3FU8A 4YSDA 3OMNB 2EIKB 1MDAA 2GHZA 3X1EA 1AZCA 3QJSB 2CCWA 1NIAA 1V10A 4MFHA 1KBVA 2PCFA 3AZUA 4F2EA 5I6KA 1AOZA 3ERXA 1A4AA 1ZV2A 4DP1X 3PLYA 3GXUB 1AZNA 1ZDQA 3EHBB 3FSAA 3CG8A 2VSMB 1AG0A 3AG3B 1MZYA 4AKQA 4BDVB 1AR1B 3T71A 3EF4A 2VM4A 1NZRA 4GP4B 5B1KA 4BK5C 1RZQA 2JKWA 4AI7A 1BAWA 1TEGA 4QKTA 4DP2X 2VSKB 3WNIA 5B3SB 2HXAA 2B3IA 1GY1A 3RYMA 4E9YA 4AKOA 1HAUA 1X9UA 1JZGA 4YL4A 2BZCA 1M9WA 3ASNB 3CVDA 4UANA 1DYZA 3HB3B 4A66A 3FPXA 1WS8A 4CSZA 4YSAA 5TK4A 2X88A 1MG3C 4X4KA 2PPFA 1JZFA 3NSCA 2HX8A 3U25A 1PLCA 1OCCB 2IWKA 2EINB 3ZBMA 4HCFA 2AZAA 1CYWA 2UX6A 2XV0A 2PPCA 3T6VA 1VLXA 2GBAA 3PPSA 1JXGA 1GR7A 3X1BA 4G7QB 2J57A 2PP8A 1IBZA 3H4FA 3UGEA 2BP0B 4BDVA 2PPAA 1AZRA 3EH3B 1CURA 2Y69B 1RCYA 3UADA 1N68A 4CSPA 2J5WA 4FAAB 1PF3A 4P5SA 3IEAA 3BVDB 1JZHA 3UAEA 4G71B 2YAOA 4N8UA 1RKRA 1AS7A 5I5IA 1ASOA 2RACA 3FU7B 4YSTA 4AZUA 4YSPA 3ABGA 2GC4C 5F7BA 4HIPA 3X1GA 2GI0A 4KOCA 1RZPA 1ZPUA 4JKNA 1AQ8A 2IAAC 1HFUA 2BZ7A 3NT0A 4N4YB 1ZIBA 2CUAA 4DP4X 2IH8A 2E86A 2XUWA 1QHQA 4L0PB 5I6MA 3N2JA 1AZBA 1BXUA 1PZCA 3NJIA 1AZUA 1J9TA 4DPBX 1L9RA 3PCYA 3QPKA 5LDUA 3L45A 3WNJA 4HCIA 4WKXA 4BWWA 1BQRA 1NIFA 3ZX1A 3FS9A 2PP7A 1JXDA 1ILSA 3G5WA 4ENZA 1E5ZA 1BQKA 3NSDA 4G7SB 4DP0X 3NJNA 1UATA 2IDUA 3FYIB 2CAKA 1V54B 2YAQA 1XMEB 1L9OA 2AANA 2FTAA 5EHFA 1TU2A 2PPEA 1AIZA 5PCYA 2Q9OA 1QNIA 1JZJA 2QT6A 3NP3A 3NYKA 2HX9A 2JFCA 4E9VA 2XX0A 3QJUB 1OE1A 4F7KA 2YXWA 2I7OA 2XLLA 3UABA 2GC7C 4W1TA 2FNWA 1J9SA 3SBQA 3X1FA 2GB2A 4K9JA 2Y1AA 2OJ1A 2CJ3A 2WO3B 4BWTA 4A2DA 2ZXWB
chains in the Genus database with same CATH superfamily
2HZHA 4NS0A 3H9SB 3FO2B 4B9JA 8FABA 4IGBA 5IG7A 3JUZA 5D7KE 2R9HC 3C60A 4IOFC 4FTDA 4WV1C 2Q76B 2W60A 4FZEH 3DJSA 1REIA 5DZOA 4AQZA 5KUMA 4U3XA 2ZJSL 3PWNB 3RX7A 1T89A 1RZ7L 1XHHA 4L8SB 5BUPA 4KVNH 5LXGL 5HYJB 4JN2B 4MXQC 4HUUB 1A4KA 1IJNA 1N5AA 1X7QA 1MCWM 3UTOA 1MQ8A 4AV5A 4P48A 1ZA6A 2V8LA 4RGND 3T4AB 4ZFQA 3RL1B 3GMNB 2L3BA 4PRPA 3E8UH 3OF6A 1MIMH 3L4VA 3EF7A 4H8PA 4PLKC 1FVDA 2MCG1 1L6ZA 5AVVB 4D0DA 2FO8A 1LDPL 1NDTA 4A67A 1XZ0A 4YE4H 1S3KH 4KPHL 1X9LA 4UINL 2YGOA 3HBGA 3HE7C 4P4KA 4O4YL 4WK0B 2AHIA 2IPUG 5PAZA 1RIUH 3WEXB 2EXYD 3MJ7B 2WXQA 4N0UB 2K1MA 5K39A 1D5MB 1GKOA 4GXFA 5I30H 2V7NA 5KBPA 3C8KB 3BH8B 5LUMA 1WT5A 4PJ5A 2AXWA 1WC7B 4YN3A 1A7OL 3IFPB 3MRMA 4LRNL 3V4UH 3POCA 5TF0A 2WAHA 3SE8H 2W38A 1GIGL 2XN9E 2ZKXA 3D33A 4J4PC 3DX2A 4QRRD 3RQ3A 5E8EB 3P2TA 4HFWA 1QVOB 2KH2B 3ESNA 1CE1H 3BFOA 2IDSA 3BP7B 4U33A 4HCRA 3SDDA 4FFZH 5FFGA 4DN4L 2H1LM 2RR3A 1LK2B 2OR8A 3PJNA 5FUZL 4MZIA 4FQLL 4J8RB 4XXDA 1LQBC 3ALPA 3N43F 3CCHB 5DD0H 3OC5A 1GOFA 4BELD 2R1YA 2XZQL 4B50A 1BJ8A 3KLAA 4OQTH 1BPLB 2W60B 3MLTA 1UFUA 1VA9A 3UTTA 1P4UA 4NZUL 1LE5B 3NIGB 4XH2A 5IGXH 3TEXA 3LKQB 2DQCH 4AQOA 3NN8A 4DPCX 4G9DA 5EU3A 2EP6A 5F0PB 3VXSB 3GYRA 5IMOB 3PE9A 5GGSY 3ZY7A 3QIBA 3VA2C 4KO6A 3KJ4C 2W0FA 4RISL 1I9EA 3IBOA 3MRNA 3BMVA 4GSXA 2VW6A 4U1NA 2NR6A 2KZ1B 1UZGA 1AGEB 2X4SB 3HAEA 4G1MB 3QDMD 2VXUL 3I6GA 5JPMA 3D0VB 3UJTH 2XWZA 4YL9A 3PWLA 1A7RH 4TNWF 1NCBH 3ZTCC 5EG6C 3FOLB 1IBYA 2MFNA 3ZL4H 3KLDA 4NNXA 1CICA 4P2OC 3P0GB 5LBSH 3S8WA 3Q06A 1GGUA 3BZ4B 1HEZB 2VZ1A 3GEFA 4PJXF 3VXMD 5KJRL 3ARFD 4FQ1H 4PJ8D 4OVVA 4HAFA 3HLAA 4FTVB 3TEYA 5JMRA 3I3BA 4C83B 4LRIC 4HUKB 1EHAA 1SXCA 4LMQE 4RRPM 5KVGL 2X2HA 3RTQB 1P4IH 2NPLX 3C5JB 2I25N 4AXWA 5G4MA 3U30C 1RFDL 5DJDA 1JZ7A 2BSDA 4A7UA 1AY1L 1M71B 3EW3B 3ULVD 3GMRA 1CXHA 1A0QH 2VDML 5C0CE 1A9EA 2R69L 3BO8A 2YKKA 2MHAB 4U6HA 2Z0UA 3G5XB 5JPNB 4UBDC 5EEXA 3CCHA 1OPGL 2GEEA 1MXDA 1QPXA 1HSBA 2VLLA 2X41A 3Q7JA 2V8MA 1IU1A 4KVCL 4M4PA 3SDAA 2OCCB 4XNUH 3REWA 5KSBE 3TT3H 4KV5E 1CVSC 4GRWE 5E56A 1S7WB 3FRPG 5JORA 3MRCA 2LLLA 2A74A 4ZT1A 2XYBA 2NSMA 5DURD 5I1JH 4H20L 4YSRA 1IGJB 4JUSA 1JF1A 4WHTB 2ZKHH 1MCJA 3LH9A 1NBVL 2HLEB 1URIA 4KV5F 2B59A 1DVYA 2OTWB 3UERA 5HHQB 1SFHA 1YSOA 4GP5B 5GZND 4LOFA 4PYGA 2PW2B 1UVQB 2K7PA 2G5UA 5F9JB 4PAZA 1RURH 2D7PA 1IV8A 4PS8A 3SKMA 2ADFL 4UQEA 1MLBB 3ZE1F 3MNWB 5T3XD 4OCLC 4LL1A 5B4MD 1LLAA 1BVNP 3EJZC 3BZ4A 2X40A 3CHRA 2YEQA 4GFXA 5EN2B 1G7HB 1WAAF 2CQVA 2DMCA 2XY1A 5DZAA 4A39A 1OE2A 1BWMA 1DBBH 4I0PC 1C5BL 5GRYA 2DLGA 3PP4L 3MBXL 5ICYA 2A6JA 3B9KC 3W9EA 3CFKA 4JJOA 5A1AA 4YHML 1PL3A 3ZU8A 2BDNL 3TYGH 2HLAB 2H26A 4F7CB 2IH1B 1LD9A 4KFZC 2YPLE 3OX8A 3MLRL 3QDGE 2XWJA 2BHFA 2GITB 1UA3A 3WHXA 1OP3H 4M7ZC 3S8GB 1KCUL 2XTLA 1TZAA 4FYQA 2VN7A 1R17A 2F74B 1QUPA 3UC2A 3FQRA 2FT7A 3BDXA 3KLSA 3WTXA 3C6SA 3W9DA 2I5YL 1N67A 1DQTA 1HSBB 4W9JC 5FUCC 2F7RA 4U6VL 4YDZA 5F3HA 5BQ7A 3KWWB 5EZLA 4L8SC 1U21A 1J5DA 2E7MA 1S7WA 4G72B 1HI6A 1L9PA 4RAVA 1D5BA 3BN9D 3QFDB 4OQTA 4Z5RA 1PW3A 2J1YA 3BX7C 4PEEA 3T77B 4XGZB 2W07B 3TA3C 1T83C 4MRBA 5TE6L 4EI0A 4OR1A 3FT2B 3LQZA 4HETA 3NSXA 4NQCE 1BAGA 1RU9L 5IHHA 3MOAL 3ABKB 3ZTNL 5CEXA 3KPRB 5D5ME 1X5KA 4FFZA 3V6BR 4EXKA 5GS0L 2I7SA 2MOGA 4DOHB 2EYTA 1MF2L 1N10A 4MJJA 4XWGL 3UDWC 3V52L 2BSBA 4HCRH 4IGBC 4C59B 1GGTA 4KY1L 1NFKA 1G7QB 1MCDA 4JUTA 3TV3L 1AJ7H 3F01A 3LPPA 4AITA 1KYFA 4QRRB 3IDGA 3AMKA 4Y4KB 2NYYD 4RA0C 3N0PB 1SHMA 3QJTB 4PS4H 5T3ZE 1F3JA 1JWMB 4S1QL 1KIUB 1E5AA 4EZKA 2BRRH 1KTJA 2Y4SA 2O5YL 1G9MH 3CE1A 5DD6B 5CF3A 1O7DC 3ZO9A 5LGJA 2CIKA 5JW4R 3A23A 4I3SH 3MRBB 4GUCA 4F7PA 3W37A 3MOQA 1OP5H 4GOSA 4F7CA 2EYSA 3VI4A 1JERA 3NCWA 3DX6A 1GC1L 3IE9A 3LKSB 3I9GL 1G9NH 2CDFA 3DHMA 1HHIA 1G6RL 3O2DH 5AW8B 3KZ8A 1GOHA 1UT2A 2OYLA 5EU6A 2VN5A 5KVGE 1A6UH 25C8L 1TETH 2HJLB 4QOKD 4OGYH 1MFCH 2K7QA 2DQUL 1OT2A 1XV8A 4J1UA 4J6RL 5KOMC 5MEND 4P23A 5B1AB 3S37L 3DOSA 4HVBA 4YSDA 1I1YA 4L23A 1N5AB 2GHZA 2XKNB 1JNNH 1V10A 1DVSA 5D7JB 3WSQL 1MAKA 3G6JB 4BV1A 4IMLB 2E3VA 5DJXB 1RH8A 4NT6B 4V11A 4DP1X 1F5WA 1MQKH 2RD0A 3QEQD 3UBXB 1CMOA 2NY7L 4OAWA 4Y9EA 3QDJD 3AY4C 4Z0BL 3FQTB 3QA3B 4NX0A 1EO5A 1XCTB 3EJCA 3GI8H 3UYPA 5DQJB 3AG3B 4AKQA 5DFVC 2O5ZL 2XZAH 3DX9B 3JVFC 4PRBA 4JRLA 4DGIH 3U9WA 3S5LG 3WEXA 3VE0B 4EDXA 1ZJBA 5BRZB 2FJUB 3QG7L 3KGRA 2VZUA 5KG9A 1SLUA 4JO2L 3H53A 4TUOA 1OK0A 1YDPB 1F90H 1JZGA 4YL4A 3WXVL 3QRGH 3MXWH 4HFWB 2X88A 1IFRA 1QWNA 3HG1E 2ZOLB 3N50A 1WZ1H 4HLZG 5ADOL 5FYJE 3VFGH 1GZQA 2TRYA 4PJCF 5IQ9A 3BVNA 4PJCB 2PF6A 2XV0A 2LU5A 1GR7A 2UZIH 5KYXA 4AL8C 2CM6A 2XN2A 2J57A 1UCTA 4LVNB 4HISA 3QQ3A 4PHXA 4BZ1H 4EN2A 5BS0E 2G0LA 3CX5K 3OKLA 3TN0C 2PPAA 3P11L 4EZJA 5IB2B 1AZRA 4YQXH 4B9KC 1S9WB 3FJTA 4LCIH 4QOKB 5C6WH 1N68A 1OCWH 4AV4A 1T22B 3MNZA 3O6LH 2AQNA 5D7IE 3LKNA 5E6YA 1KG0A 1XL6A 4P5TC 4KROC 4PS7A 5DFWH 5GGSB 5E99L 2H6OA 4YDJA 4RFEA 2XKNA 4AZUA 2BSTB 2FIRT 3BD3A 3EJSA 1OAKH 4JFYA 4U1IA 5D55A 3AWFA 3X1GA 4MNGE 4S1RL 1IM9D 2NY4C 1RZPA 2PCPB 1ZVNA 3BP4B 2JCCB 3OAUH 4M6OH 1RHHB 3B34A 1D6VH 2F9BT 3PWPA 4NKOB 5C0NC 2ZSWA 4OV5A 3BE1H 4K94C 2APBA 3W2DH 4HU8A 4N2NA 2YOAA 3CVHH 4OFKA 2BNUB 1JSYA 1PG7W 2CGRL 4O5LL 3BWSA 3SKNA 3FU0A 2BNRB 1YEJL 5HHPA 3GMNA 5KTEH 5AYUH 2JKIS 2JLLA 1PLGH 3MC0A 3QRLA 1CB4A 3DO7A 4QD2E 3SDCB 3KPRD 3IETA 3SO5A 3NJNA 1PKQB 2E75C 5D8JL 3HHSB 5IB1A 5D7SH 3JV4A 1A6WL 2AQRA 3Q1EA 2AQTA 2ED8A 3AC0A 2EDYA 3M8OL 4DCQB 3LEXB 2HX9A 2MHAA 2BZDA 4U6HB 1CPUA 4UTAL 3QDGD 1RLBA 3ZT7A 4Q9QL 1QG3A 3OKLB 2RQ8A 5IM7B 2MOVA 5BZWB 2RMNA 2ARJA 2OJ1A 2IAMC 2FGZA 4X98A 3SB3A 4HOWA 1YPZE 2ODIA 1OLLA 1EHLH 2HKFL 4IYKA 3W39B 1X6LA 5LWYH 1HHJA 2IPUK 2CLZB 2KUTA 1E7VA 2XQYA 4XPAL 3IRPX 4Y16B 4KJWC 3MKGA 1KB9K 2ZCLH 2NXZC 4M3HA 5IEHB 2R59A 2FYVA 3GMLA 3TXAA 2BOCA 3U2SB 3QHFL 2CUHA 1AXIB 3QC5X 1EWHA 4L05A 5JZ7D 5JUEL 5L88L 4JANA 5FWRA 4CKQA 2YEZB 1PZ2A 1S7UA 3FQYA 4HDIB 1A8JH 3LPWA 4KROD 1ZWIB 4BSVB 5B7FA 2ADGB 5HDBB 2HJKA 5EO1A 1YUHA 1ZTXE 3BJLA 3QI9A 4FNQA 2NZ1A 2E7HA 1MHHA 2JIXB 2PP9A 3HE7B 3NJFA 3VMPA 2YEVB 43CAA 3K6SB 3PNWB 3G6AA 4KOBA 1TVBA 2JV6A 2WZPD 1XF1A 3K46A 1NCJA 3MRGB 3PAZA 3HAEB 3KPPA 4GKNA 2OAAA 2R23B 4XMUA 4CVZA 3DVGB 1I7TB 1LD9B 4CRPA 3QUXD 2YIHA 3VD1A 2A74C 4NQDD 2FNBA 2I60H 3PWVA 1GY2A 4BFEA 3WE6B 5HHOE 3MROA 5KS9F 5DC4B 5K69A 1BPVA 1PMYA 4EUPB 5AW5B 1ZSDA 4R4FL 1HWWA 3EJUA 4L1BA 3U6XA 5JHAA 1CDCA 5ANMA 5I1EL 2X2JA 1Z32X 2YUVA 1YYMH 3DV4B 4XNZB 2Y5TB 3DTXA 5CU9A 4BH8A 4NC1C 3W11C 5JIIA 2VR8A 3DBXA 2R1WB 2XTJB 2PPDA 5L2KB 4XN5A 1R3LB 4PJ8A 4OQ1A 1BD2A 3ZE1B 4PG9A 3ARBC 4XVSL 3UZEC 5FV2A 1X9RA 2CU9A 2GCYA 4IK7A 1B0GB 4XP6H 3KWTA 3L3KB 1XTLA 2XXGA 1N0XH 2WK2A 1FVCA 2KQNA 4A63A 1NMAH 2FWSA 5E23A 2J8UF 4LSTH 2KI6A 2V9RA 2CJSA 1QBAA 3SJVB 4EDWL 4KJWD 4Q2ZA 1CDYA 3VFPA 3F5WA 4IBTA 2F1BA 1OSZA 5EF2A 2ZX7A 1YEFH 2M26A 3UPCA 5B4MC 2R4SL 1SDAB 3C9NA 4JK0D 5AW1B 2J55A 1BDYA 4HH9B 2ZSVA 3C75A 5CR8A 5HHNA 1ZWIA 4D94A 2N7BA 2YQ2A 4KX9A 5FHBL 1MJUH 3IN0A 5I1DA 1S9XA 5JOEA 2ED6A 4WI8A 2GYSA 1JGUL 4MQ7A 2K3TA 4YXKL 3BAWA 2CGZA 5ICZA 2N59A 3Q6FB 2C4FT 4ZD3L 1CT8B 2ICWA 1L0PA 1V3KA 4A6YL 4JREC 1OGAB 1B0IA 2ARJQ 3U0TA 4F7MB 3C5ZD 1A3RL 4UQ9A 4A2HA 2ETWA 2R69A 1G7PA 1N19A 3DX6B 3INOA 1KB5L 3GZPA 3WE6A 4I18C 2E9BA 4M8QB 1DQJB 1LMKA 3HG1D 4HW6A 5K59E 4KI5D 4F37K 4JY4B 3H3KA 5F88A 1AZZC 3ULSA 4DUXA 3P4MA 3RVVD 3SE3A 3DVIA 1U8MB 2Y7QA 4U1HB 3THML 1FIEA 2Q86A 6FABL 5JIDA 1D6EB 4X5XB 4WUKH 5C07A 4HKBA 4P23B 3ZE2F 1W0VA 5CIPB 4JVUA 5CFHA 1T20B 3BXNA 1NMBL 5I18L 1DHKA 1F6AA 2BC4B 3T0BA 3ZT5A 4HOXA 1ZE3C 1OP4A 5CJBA 3NJLA 4NWTL 3QZWG 5D93C 3VFVB 4PY7B 8FABB 1NLDH 1VZHA 1WGVA 5ITFB 5HJGA 1IE5A 2GBTA 1RUMH 3QZOA 3V6OE 1WBXB 4LIQE 4DK3A 5CD3B 3MBWB 1IUZA 2RGSA 4JMXA 4UOZA 3NACL 4OKVB 4GIAA 3NIFB 4ZMWA 4S1SL 1EAQA 1IEBA 1KEGL 5DRWB 4Q74A 3D4CA 4YBQD 3F6IA 3EHBD 3MGTA 4KDWA 1DFBH 3O6KL 1H8LA 5FOBA 1I9IH 5HHNB 1HCZA 5HHME 4OCNC 1QPPA 3RL1A 1CLZL 3JYBA 4K23L 1XIWC 3CU1A 3OL2A 4X9IA 2I9TB 1MVYA 1UWXH 4G1EA 3VFSB 3HB3C 5CLZA 2QDWA 1GGCL 2FEEI 1FNEB 5AAMC 1PNCA 1OF0A 3GHPA 4PJFB 3VXUD 1P9MC 5TE7H 2ZOTA 4IBSA 3QULA 2W91A 4IJTA 3C5ZB 5A16A 5IVXA 4O9HL 1GL4B 2BIIA 4WI9A 3VTTA 2VW4A 1D5MA 1KNOA 4BSJA 3L4CA 1IQWH 4D0BA 4HS3A 4H1LH 1T04B 1I3GH 1KV7A 1ZS8A 5EBGA 2EILB 5DXWA 5BNXD 3WI9A 3P0YH 4PD4J 4LPUA 4I0PD 2FLBT 3T8XA 3Q05A 5AYUL 3IXTA 4FP8H 3TJEH 3L5XH 4UOJA 2YRLA 3H9SE 4J3TA 2YARA 3MI6A 5C0RH 3E9UA 2BC4A 4N2LA 3T0EC 4YHYC 4V1DA 1ZT4A 4AQAA 4XI5C 2R8SH 4RESB 1RPQA 2UYLA 3BLBA 3PF2A 1J5CA 3S36H 1R3JB 3QZNA 3EGSA 1SNRA 4CMMA 4G8IB 2WPGA 1NKRA 2JCCA 1TJXA 4O2FA 1A64A 2HJFA 4Z18A 2WZPA 15C8L 1WBZA 4G7VL 5FAAA 5B7EA 1JV5A 1OAYL 3ARGB 5FYJU 4MD5B 3MBEB 3D18B 3OXRA 4IRZL 4PJBB 5BVPL 3AT9A 5DYFA 4RFOL 5C3LD 1SLXA 1KTDB 2LAAA 3QIWC 3K1KC 1J05A 4PTTB 3PABA 3GQFA 3QO1A 5CP3A 3VXSA 5EU6D 1WH0A 4JHAL 2CBTA 5E99H 3B9VA 2MQ0A 4H25A 1VJSA 4POYA 4FQXA 5IMMB 4GAJL 5D2LF 2JMRA 4IMLA 2CXKA 5EZJB 3VB8A 5HPOA 4YSUA 1L7IL 3HS0A 3TNMB 2X4SA 5GGQL 1QNZH 2J1ZA 3I6GB 3OHXB 1H5BC 5KSUA 2P8PA 4WEUD 4ZSOE 1KEGH 1TO5A 4PRHE 5HGGS 3RE0A 3QUZD 3ARRA 5GQBA 3FC8A 3IE4A 2VN3A 4KQ4L 1WA2X 3CWGA 1AIFA 3LB6D 5KSAB 3D25A 5CSGA 2YPKB 4JS7A 5HJBA 1LL1A 1P5UB 2LOEA 4Y1AA 4M43L 1NIEA 5EPMB 3DWTA 4F27A 3PIQA 3IU3B 2J43A 4G8EA 5CJOL 2HN7A 4UIMB 5KBDA 1NCDH 1HOEA 1U2YA 5HGAB 5E4EB 3T8XB 5IB5A 4R7LA 4IRJB 1NFIB 3BEVB 2NW3A 3RGVC 4FQJH 2F54B 1HHJB 2X4UA 2YAEA 3MACH 4LFHD 2CDEB 4NGHL 5CO1A 4JY6A 5AWNH 3IB4A 1KN2H 3TH3T 1CU4L 3HFMH 1QQDB 2XZAL 2UYLB 1KB5H 1PIFA 4NDMA 4ELMF 2GAZA 4HFUL 5DHVH 2AJUL 4A68A 3AABA 3ULVF 5AVTB 4OJCA 4JANB 3NFPB 3GXTA 3WIHH 5CP7B 4IU3A 4JKKA 4NSKB 4RZKA 4D8OA 3TTSA 4X2UA 1IGJA 4A7GF 5D7IF 2BY3A 4EIGB 4YUEH 5D1ZI 3BW9A 2J6EH 2G9HB 3ULUE 1I85A 3CG8A 1V8HA 4ZMNA 3T4AA 3NCEB 3RWJA 4Z7UB 4PGDB 3HS0B 1TETL 4Z7UF 1PYWA 2HLFC 3FUMA 2PXYC 1U3YA 5I0YA 3ZKMC 4DP2X 1TEGA 3KYNB 4TOYL 3VYOA 3SPIA 4L3EA 2Z35A 1G9NL 1GGBL 2APVA 4LLMA 1IB5A 5DVPA 1FCCA 1M9WA 3CDCA 3L5IA 1U30A 4KBPA 4O51B 1MLCB 2OJZH 4U0RB 4BHUA 3PXJA 4Z7NB 4B3EA 4XBPB 1S5HA 2CJUH 4HU2A 2ICEA 2IWKA 2A0LD 3FUIA 4R97B 3EJZD 2JQAA 4KI5E 3SDAC 4Z7OE 3RVWD 4FABL 1A3QA 3O11A 1OIOA 2J4WL 2BIPA 5D6CA 4ZW5A 1VCBC 3RWDA 1S7TB 5EIVA 5AUMA 1L4IA 4X4XB 2HG5B 1JZ2A 3BKML 3JQOB 4L4VA 2HUHA 5HYSB 3ZKXB 1JL8A 1AXSB 4ONGH 4XXDB 4CSPA 4XOCA 4E41D 3HE6B 2I60L 4XWGH 1Q0EA 3BVDB 1J1OL 3SDAD 2DQTL 3PWUA 1E9OA 2X4OA 2AJXL 5BZWA 3QFJE 1C8PA 1MVFA 1HSAA 1RU9H 2CHDA 1LE5A 3BKCL 5IKCB 3LHPH 4M00A 3ABZA 1T89C 2AJZB 4G6AC 4MD4B 2R4RL 3SO3B 3TO4C 5I1DB 3K8KA 4N4YB 1ZIBA 2OZNA 4Z7VA 4NKDB 2NY3C 1I1AC 1T80A 4PWEA 4EI6A 1ZJAA 3AREC 5ICZB 3E6FB 2OR7A 5BV7H 3NIDB 3QWQB 1PDKA 4N2GA 4TVPD 3P4NB 2OULB 4N2FA 5CSZB 3LIZL 2X6MA 1L9RA 4DO4A 5LDUA 3U6RA 3QXDA 2UVFA 3GMQB 4X9GA 2HJKB 4R84A 4WKXA 5DFTA 1BQRA 3VI3E 2ZCLL 2O26U 4XN8A 3HE7A 1VF5C 1IGMH 1JGIA 2IDUA 4LHUG 5JOPD 5JPMC 4MQXD 4IOIB 3U9UA 2AANA 2RHEA 1TU2A 5C07B 4H8WH 5T8IA 2ZWSA 1I82A 4UAOB 4OJAA 1EV2E 2P26A 1BG1A 3RWDB 1E4KC 1JZDC 1J1XL 1TQBB 2NR6D 2XXMB 5EA0L 3H9ZA 3ZTEA 3KPMB 2Y6SD 5ITFA 3FQUB 2EVGA 4X8XA 3M8OH 1DSWA 5ESQA 4K9JA 1QSFB 2Z92B 2EDOA 3AXLB 4LCYA 4DIXA 3NDYE 3WL9A 3U2JA 3STZA 2XN0A 5F6IB 4F91B 2P8LB 5L2KA 3MRFA 2AJYH 3X3FL 5ELIA 5GJSH 3LS5H 1JHTB 5F7MC 3FTSA 3QHZH 1CD1B 2VDQB 4GLRI 4OGXH 3KWXA 5B1JC 5LHDA 3N1MC 1SN0A 1I7UA 1JG9A 2X10A 3GTVA 4JO4L 4JZJC 3LJ3A 2BNQD 4QXGH 4K5NA 3LZRA 4P46D 5CEZD 3VXNB 3GSVB 2P45B 4DGWC 1G0XA 1H0DB 3LRSB 4G1EB 3VFSA 1U95B 4NXSA 5I1HH 4GRMA 2VR6A 2GK0B 2FHCA 3I84A 1INEL 1YMME 2IADA 5FYLH 4K71B 5TH2A 4DEUA 1YC8A 3UC0L 2OXGA 1JRHI 2DV6A 3MV7B 1T0PB 4Z7WA 1KCBA 4HH9A 1PAMA 4KH2A 3WMPA 2HFFB 3UJIH 3Q5YA 2O61A 2DQHL 2CR6A 2X12A 1SF5A 2QJDA 2CGYA 5KYYB 3A47A 1G7HA 3NBNA 4DZ8B 4AEHL 1P4IL 4NRXA 4ANUA 4JPIA 5IROA 3L5WA 7TAAA 2NY5L 4HULB 3BGMB 1Y6NR 4B5EA 2G0KA 5I15L 3LDBB 2F53A 1GZQB 5H4ZA 3KYOA 3H3BC 5FW8A 4AG4L 1L9QA 1RSYA 4FQ1L 3IDYB 3JT0A 5E6IB 1FC1A 4OD1H 4KGJA 4IRSB 2GJ6E 4P05A 3SKOA 4G5ZL 1KB3A 4ZZKA 2P3YA 5AKTA 3RVVC 4P3CL 2XIDA 3I50L 4BE6A 5T1DL 3P54A 4XMXA 3L3IB 1V55B 2Z91A 3GFUA 3AXLA 4LCYB 5AAMA 1S78D 1DDTA 4GI6A 5LN4A 2BW5A 2VXSH 3MX0B 2P8LA 4YMPA 3PGDB 4PMEA 3FFCE 3MXWL 1NFDE 5F6IC 1HE8A 2AXHA 1Y7VA 5E2UH 1N8OE 5DWUL 4GI9A 5ILTL 4BYHA 3AQXA 4PJXA 43C9B 1X7QB 1OEZW 3ETTA 3IMUA 4YJZL 3QG7H 5EDSA 2JJSC 3F7KA 3NJHA 3NJXA 2P5PA 3GPSA 4R83A 5D4HA 5FCUH 5CN1A 5LNGA 4PV8A 4KK6C 4YLQT 3K6FA 2BINA 5EEZA 3B8SA 4FQHA 5C0IB 3VXRA 3MLXL 2Q2EB 3LRSA 4TRPL 1FF5A 4ECNA 4NC2B 4NKOA 3FSOA 4NZRH 1HKLH 3ULUD 4OI7A 3SCMD 4X6CB 1I3VA 3K6DA 1EEZB 2B08A 2WWKT 3L9BA 4M7KH 3HNTL 4YR6B 2Y07L 3OPUA 4OCWH 3SKJH 4BJLA 4U1MA 2MQCA 2QGEA 2QADD 4UQ2A 2OI9B 4IIZA 3C6EA 4NLHA 4APQD 1UUSA 4KZCA 3BEWA 3T1FA 2WB1A 2UXFA 1L0XA 1CLYL 4NRXB 3VQMA 4P9MH 2CMRL 4M8VA 4WTWA 4R26L 1A6UL 4NENA 3C87A 3G6DH 1H3PL 1IBGH 2QVFB 5CGYC 3GGWA 4F9LC 1OAZH 3ZL2A 4ERSH 2W0LA 1HL9A 1N59B 4Y89A 4YX2L 2YD1A 1KCRL 1OSEA 2G2NA 4O4YH 5CILH 3FT4A 1S3KL 3G04B 1KTCA 2NY6B 4QRPA 4YE4L 2EJ1A 2G60H 2VLRE 1AH1A 1M4KA 7PAZA 1N6QL 3NJJA 2WXFA 5E0QA 1JGDB 4OH2A 4N85A 2B9AA 3L1OL 4XNDA 5J3HD 3UTPD 2ZNXA 3W0WA 4RAUA 4XP5H 4FFYL 4BQ6A 3B9KA 2NNCA 4XAKE 3H7LA 3BQVA 3WFZA 3NP4A 3CFDA 4N2MA 4XRCA 1XH3B 2CO3A 5BJTA 2TSBA 5K9KB 3F85A 5IFAH 5L7XH 3VFRB 3KDPB 4CU6A 3NRPA 4EI5C 4WKZA 3PWJA 3CSPA 4I3RH 3STLB 3GB7B 3V0HA 3Q1SH 2O5XH 4QXTB 4FZEL 3UG4A 4APQC 3WUZA 4L8DA 2D2OA 5E5UB 2YEZA 4FFTA 4HDIA 3UYPB 1I8LC 1HHHA 1U8OB 5GRUL 1CL7I 4PGEB 3AADB 4Q6IA 3VXMA 1UM5L 3KE0A 3EDJA 2XJLA 5DUML 3MCYA 1SZNA 2DM2A 4UQ2B 2BS8A 2C7UB 4AGNA 4FQXB 5IMMA 3BRFA 5B39A 1NDGA 3OKYA 4MNQA 4Q6YA 4M1DL 1JD9A 1G6VK 4AVJA 3QDGB 3SPHA 3MRGA 4AMXA 1QBBA 4OGZA 3TO4A 4E0RA 2D0GA 3PAUA 3DVGA 3H0TB 3AU1A 1YY9C 3RTQA 1J11A 4YOKA 5F71A 3E8VA 1ROWA 5M95B 3F6LA 4Z77A 5AD0B 1UH2A 2DLFH 3MROB 2XV3A 5AUMB 2XYCA 5M94B 4YEEA 5E8OB 1CGWA 1F11B 5DEFB 2AGJL 4M4RA 4JFED 3T8MA 1UB6B 3GHEL 2ZTBA 4PVNA 1U91A 4JG0L 3F7YB 4JCMA 4DZBB 4NQCD 2WXPA 2DYRB 1U8HB 5CZXD 1F56A 3OV6A 1NC2B 1W15A 1WPCA 2DPKA 1T22A 4KKZA 3NFSH 4BFRA 1BM3L 4RAUB 3RWHA 2X4UB 3DPBA 1ND0A 2AK4D 4QT5B 4JRXE 4BQ8A 1A66A 2OZ4A 3PGCA 2DL2A 2F19L 3JWDC 1PAZA 3GPEA 3K0YA 4IQHA 2V2WB 1P6WA 2OP4L 4OIAA 5D1XD 4PJHE 5HJ3A 3VFRA 3TLRA 1AO7E 5T3ZD 3QQXA 5IR1A 4ANWA 1NJ9A 2ZAHA 4GT0A 2Z34A 4ZODA 1TZHA 5F9OL 2FQFA 1COBA 3P4NA 4KMTL 1UYWL 3ARBD 5DK0A 4ZUUA 5ID1B 3K72B 2YA0A 5GRUH 1VHPA 1ZSHA 4IRSD 1NGQL 1OGTA 3R7QA 1DJWA 5DI8A 2FWLB 4JFHE 2IGLA 3GRWH 3KLHC 1QBMH 1KZYA 4TPRL 2JXMA 3CX5J 3O8XC 3Q1SL 4N68A 5D70H 2NTSP 4N0CC 5AZUA 3VCLB 3LEVH 1TO4A 2PTVA 3GZQA 6TAAA 5F7HA 1KGCD 4LL9A 2NTFA 3UJJH 4GXVH 5I5MA 4KZEL 4D8PA 5H37A 4WAFA 4JRYD 2NSXA 2GI7A 2AI0L 3BMWA 1BZOA 3TBWB 2YSSB 4HS8L 1M2VA 4N0FA 1BA9A 3MLUL 1IE4A 1A6PA 1QRNA 2CPCA 1HKFA 4NCDA 1JNHA 1NICA 3UTQB 1NBZB 2HFGL 3U0PB 5C9KA 5BVJA 1S5HB 4AEIL 1KCRH 2GJ6D 3UBGA 1RSFA 1TXKA 3EUDA 5CIPA 4NBXB 4RDBA 3QUYA 4WO0A 4XO9A 3NJGA 1CD1A 3DX1A 1B2YA 4R26H 4W9FC 1NOFA 2QFPA 1R1CA 4NHCH 1X9QA 4G9FB 5JZ7C 1UEYA 4QT5A 3LDBC 1ZHNA 5FKPB 1A02N 1UEMA 2CKNA 2YO3A 3BVUA 3DTUB 3FFCD 4U7MA 5I24A 4KKBC 1M53A 5D1ZD 3TJHD 3N5AA 4M48L 4F2EA 3QJFA 3R06B 4FCAA 2NXYD 3ERXA 5DEGB 3QUMB 5IFJA 2LV4A 4PLOB 3UJTL 5J6GB 5KBKA 2RIKA 1E9PB 4IDJL 1FBIL 4KUZL 4UUJA 4YHPA 3RG1C 3RVUD 4RNRB 1TTRA 4NQXA 4JKMA 2CKBH 3BKYH 4BSVA 5B8CC 4RISH 4HXBL 4FXLA 5IFHH 4BDVB 4WU7B 2P5WA 1P7HL 2GSGB 3HUJF 3ARDD 1F3JB 1JWMA 5EULV 3ARED 1HZKA 2GHWB 1JNJA 2VXTL 1FH2A 1T4KB 2XA8H 4AL8H 3VFMA 2OXHB 4E9YA 1PDKB 4NZDA 1X9UA 2Q7YA 4Z7QE 4NC1E 3G3LA 2HFGH 4JO1L 2CBOA 2EZ0D 4L5FH 2YK1L 3JV0A 4JZJA 2VXQH 1ZLEA 3HVNA 2NLJA 3K5RA 4YE0A 3U1SH 4NKIL 3U25A 4R2GB 3SKOB 3WNKA 5JXAL 4D0BB 4ENED 2EDRA 4MMYA 4LZKA 4APQB 5FM5O 5T1DH 1BBDH 1I7RA 1VPOL 5JO5B 3UH8A 5ISZE 4HS8H 4NJ9H 3US0A 5BVJB 4G7QB 2BJMH 2F08A 4HUXA 3KH3A 2JB6A 1H8SA 2H2SD 3MX0A 3PS6A 4WK4B 5ISZB 5C3IA 4UOQA 2VSCA 3KEDA 5GS2D 1GIGH 2ITCB 3GRWA 3GJEB 5TQ2H 4NM4H 3GXFA 1DBKH 5HD8C 3GSNL 4HPOH 4JFQB 5H37G 3UAEA 2YGPA 5TTRA 2WAQA 4F9LA 4J3XA 1ZVYA 1Z7JA 2Z4TA 1A1NA 3FU7B 3QUXA 2MCPL 4TVPH 1K8IA 3ARGA 5DEGA 4M7JH 2IMNA 2J5LC 2OPCA 4YHLH 4AT6B 1UWFA 1SXSA 1E4XL 4AV0A 2VLKB 4I5BA 1Q9KA 3OAZK 2HLFD 3DJTA 1WFIA 3UGXA 4OCYL 1KFGA 2Y24A 4KXBA 1E9QB 3IFOB 2V5RA 5AVWB 3L95B 1BQLH 3DX8B 5I66A 4HLEA 4M6ML 5ESVA 5CZVL 4LQ1A 4N9GA 3V5DA 3VH8A 1KPUA 5E8PB 3L2NA 1CT8A 3UXFA 3VFUB 4K8RD 1NL0H 5BZZA 3ML9A 3ZX1A 1DZBA 3C12A 1FV1A 3IRCA 1UOLA 1P7QD 4YDIH 5CGMA 4I89A 1UD5A 3ULVH 2PO6A 1SJXA 4PJIE 3CFEA 3QQ4A 2Q9OA 3O6FD 3L5WB 2K9FB 2X4QB 3LZLA 1HC1A 4DEPC 5IB2A 4J2XA 3MR9B 5EA0H 4L0ZA 3CC5A 4HWZB 1TQUA 4JGNA 2NUTA 2YXWA 4QYAA 4GAYA 5DD5H 4ZXBB 3W1ZA 4C54A 1AGFB 4AZ8B 1QFUL 1OL0A 4XVTL 2ITCA 1KXVA 4H8WL 4DWHA 2GB2A 1F8TH 3QJHA 3TP4A 4OFDA 4R0LC 3ZTNH 1OWWA 5GGVH 1XH3A 4A7GA 2ZXWB 4OF7A 4PY7A 1UM5H 3WCYA 4WUUD 4BXVA 1GTNA 4ODUA 2NY0C 3D34A 3SE3C 3MV8E 1H3TA 5I6LA 3HW7A 1WBXA 4LOVA 2R83A 5ID0A 3O3DB 4PD4K 4HSQA 1NL0L 2OMWA 5DD1L 4CAGA 1FLRH 5HHXH 2BNRD 3NIFE 3TBTA 3NDZE 1WICA 1RJZB 5IFAL 4OGQC 1TZGH 1P1ZB 1BQ5A 3UEZA 1JUFA 1Y18A 2R0WH 4KO9A 4OF3A 3QWOA 4TUJA 3SKNB 2XY2A 3QIUC 2DH3A 1YEEH 1AE6L 4U3HA 3RRQA 3DHUA 4UILL 2WTOA 4G8FB 4GW4B 2R4RH 3FRUB 4F1ZA 5IBUB 3SGDH 1F45A 4ZSOA 1S6NA 2DQFB 4M7JL 1TTUA 3V5DB 3VH8B 2W80C 2IANE 1U41A 2Y7SA 4GIPD 3LQAC 1E3ZA 2BSCA 3QGVA 3BZEB 2H1XA 3TBSA 4RSYA 5E9DA 1F11A 2G4EA 1NC4B 1WT5C 3K71B 2ZG1A 4OZIE 2VITA 4QF1B 1QYGH 3Q44A 4AVKA 3RHWK 5A2LH 1GS8A 1L6XA 4R5VA 4ZMVA 2N0KA 1OTUD 1JPEA 1F3RB 1U8HA 1ESOA 1T1YA 5F9AC 2OA9A 2CRYA 1IZJA 1WFTA 4J4PA 1SJEB 4EZLA 4JCWA 4NQDB 5KVEL 5EIIG 1XIWB 3C5XA 3S3DB 3UYOD 2QKIB 3B2UD 5I1GL 3B37A 2ORBH 4LLAA 4L4VB 4LNVA 4BQCA 1INQA 1JE6A 2NT1A 1HQRB 1J8HE 3TM6A 2Z93A 2KLSA 3DIFB 1M2OA 3BFQG 3IJ7A 1AD9B 4NQSB 1A3ZA 5HGBA 1K6QL 2FQDA 1VESA 3RKPA 2RB8A 1JHLH 4X9YA 5KSAC 1UTDA 3NCFB 5F7EL 2QBWA 5L8LB 1U8IB 2QQLH 3Q48A 5D4JA 5DQDL 3W0WB 2ZWNA 4AMKH 1RJZA 2YWZA 2ADGA 1XMWA 1SOQA 4KJYA 3Q8FA 4OLYH 3RVXC 5GGRA 3MRKA 3CFDB 2FGWH 3SBRA 4P2QD 1WG3A 1M56B 4Y2NA 4NKDA 4XCCH 2JQMA 2NTFB 2UXVA 3PWJB 4TVSa 3QAZB 5I2IA 2XZCL 2WHVA 5DZ9A 2X5PA 3QUGA 1BECA 3BUDA 4X6FA 1KCWA 2R27A 1QLEB 1G6RB 4OF0A 4BD4A 4CVZB 5A6IA 5E2WH 2F5AH 5EWIH 3V7MA 3WOVA 2KBGA 4XODA 4LESA 3RTQD 3DX0A 3WMQA 3EO0B 3GC3A 3PWVB 3QXDB 1I8AA 4ZS7H 2VDKH 4FL4B 5L6YL 1P9MA 3V6FB 4PBVC 4NQEB 3SDDD 3K2IA 5I8KH 2WIIB 4UDUB 1EXUB 4J23A 1GTFA 4J5VA 3G5ZA 2OMYB 1I53A 4QF1A 1Q9OA 3BGAA 4ZS6C 5DMKA 1IQDB 3SO3C 1G1YA 3DBXB 3TO4B 3UAJD 4WU5B 4E0RB 1G1OA 3MACL 4HOZA 3NCYP 3T0EB 1JD7A 2C26A 3BISA 5AD0A 2BIQA 4Y4KD 2A9ML 3TPUB 2NW3B 3BEVA 2ERJC 1LO2H 3OJDA 4JO3L 4KK5C 4IBZA 4LOUC 4PWIA 4U3CA 2QLVB 2EKJA 4JB9H 1ZHNB 4TNWK 4NN7C 5DEFA 3APFA 5FKPA 2LU3A 1KYOK 5KN5B 5HYQB 4MS6A 1WISA 2MPAL 4ODTL 2IDQA 1ZANH 1INEH 3A4AA 4YC2B 3POHA 2AQPA 2GTZB 3TFKC 4GFTB 1MRCL 2EDJA 1UXLA 2ZF9A 3FO0H 5J1AA 3NQIA 5JW4M 1VACA 4GXVL 4X5WB 4KZEH 1BWWA 3C5ZC 4HKXA 4ZXBD 5IVZA 4PLJD 5SV3A 3CJJA 3GIVA 4RCAA 3FAXA 1OGAD 3QIWA 2P9RA 3EH2A 2DIEA 3M7OA 2EC9T 4ELKB 3TPKA 2AJYL 3X3FH 4ATWA 4FGMA 2P5EB 4AYSA 1MCEA 3V8CA 1B3IA 3LHAA 4ADGA 2W9EL 2GKIA 35C8H 4JHAH 1WFNA 2A73A 1TPXB 2IGTA 4JRFA 1F4WH 3FB7A 5J5EA 3H8NA 4R4BA 4N26A 1M1SA 2ALWA 3EFFB 5E1HB 5MP6L 1MOEA 4FLSA 1YEDB 1K4CB 1LILA 1J1XH 1A9BA 5DEJA 4C8XA 5DI8B 3QCUH 3ISYA 1E8YA 1I85C 3NH7L 2X1PA 2VDOL 4YK4B 2VLME 3VJ6B 4HZLA 3IU4L 4JPKL 1AQMA 3HLAB 4FTVA 4GBXD 4KKPA 5GISH 2OTUA 5C08A 4F58L 3F8UB 5D93B 4PB9L 2YQGA 3QP3A 1PY0A 1MHCA 3K8MA 4JQIH 5EORL 3O11B 4N3TA 1FZJA 1KZQA 4UDTA 5C0GB 5BPPA 4POUB 4OZFG 3VXUE 4L8CB 3MLPA 3ME0B 4XHJC 5D7JC 4S1DC 2C3VA 2OMUA 2MQ3A 3RU8H 1QLEH 3HNVL 3LKPB 1KELL 3D8MA 1LQSR 3CLWA 4PP1C 1Q9WA 2O93L 2AXGB 4O9HH 1N70A 3FAWA 5J1AB 4PJDB 5GRWA 3MRCB 4RIRA 3GIVB 4D0CB 1IC4L 2BNRE 1DJYA 5D2NA 3TA3A 3H9SD 1BGXL 5E8DL 2P80D 2J3SA 3L95A 3DXAD 2HRPH 1U93A 8CGTA 3KMDA 3FQNB 2DQTH 1ACXA 3QORA 2VXVH 4ANKA 3R0NA 3ZYJA 5CUSH 3FONA 4PJFA 4FXGA 1HILA 5FK9A 3V10A 2A77H 3CXDL 2MNJB 4I3RL 4Z7WE 4DGYH 5LGHL 4S1SH 2EYRB 1OP9A 3MNWA 4QXVA 1K4CA 3L9EA 4WWKB 5D5MF 4PQXA 5LNEA 5CBEB 3ZHNA 1IVLA 1HHGA 2J4WH 3OHXC 4Y4KC 4FABH 2CNZA 3AU0A 1SFDA 5F7WC 2OSLB 4OD3H 3ZGIA 5ACZB 3LIZA 2D7MA 1TEFA 5SX5H 2OTUB 4IGBB 3PJSB 2CJUL 3WHE1 1KEML 2VDRH 4M5YL 2JVUA 1YZZA 3HPJB 4ZMLA 3D4YA 1CLVA 2V9QA 1QLFA 1YQVL 1NGXB 2LAGB 2HWZL 3DRQA 5CKGA 5C0GA 2J21A 1VAHA 3MODL 3KVPA 1HYSC 3LSOA 5SWSA 3T2OA 5JO5A 4PP2B 4G8IA 2MEJB 1JGDA 2F61A 2JB6B 3FQXA 1KXQA 4QAMB 1GZHC 2P7TB 1AI1L 2J6EA 5DHDA 2K4WA 4PCSA 4KWUA 1QLRB 3RIFF 5IWLC 2Y7LA 1MI5E 3SDYH 1R5WA 1RI8A 3C09B 4JN2A 4D7BA 3QDAA 3KDMB 4J3OC 1PKOA 4PJXE 5L4FA 1AZCA 3OR7A 3QJSB 2APXA 1W9XA 4LHUA 2A6KB 2DWEA 1A4AA 1CICD 1O6TA 3VMNA 1CDIA 1CL7H 2VKWA 3ARDC 3DJ9A 1MCQA 3WTVA 3IDJA 3M1CA 2C5DC 3FQNA 4P5MB 3C8KA 1ZEAH 4Z0XA 2CH8A 2JJVA 4PI2A 2D0HA 1PGRB 1XZ0B 4WNJA 4AW7A 2IPTH 3WN6A 2R0ZL 1KJ3L 4QHPA 3B7UX 1GMEA 1YHPA 3MGOB 4R9HA 5B1KA 3II3A 5KSAA 2C7UA 4MZ2A 4EDWH 4HUWB 5CBEA 1S3RA 4QO1B 4ZO9A 4OZGB 1NCDL 4QHMB 4IKLA 1HHKB 2GFBB 3DVNB 3BD5A 1TF4A 3HJEA 5TK4A 4BRJA 3BGMA 2CIKB 1RPUA 1M6UA 3NSCA 1F1DA 3GKWL 4OZGE 2NW2A 4LVHB 2PYFA 2FWOA 1SBSL 3FL7A 5C09B 2IAMB 3N1QC 3VI4B 1SMOA 4HJ1A 1B9ZA 2GBAA 5AOJA 2B1HL 3HI1B 5CAYB 5IIEB 1DQIA 4JDVB 5SX5K 4G8GA 4ISVA 2WXHA 4J8RA 1S9KC 1QWUA 3P02A 3ZHFA 2WZ5A 4G9DB 5EU3B 2HSIA 2BP0B 3WV0A 1IO4C 2WXJA 5DVMA 5JW3H 1H8NA 5KSVA 2KDYA 1RMFL 5IJVB 1AD9A 4NQSA 3O2VH 1UJ3C 4RA3A 3L54A 3N44F 1FPTL 2W0FB 1EVTC 1WO2A 3HAEG 5F3FA 4FAAB 2QQNH 3EHBC 4MJID 3TWYA 4PWGA 2MCAA 4NRYB 2VXVL 5L9DL 3SJVD 1S7VA 4QHKJ 5HVGB 1BW8A 4TVPE 2UUDH 3WDIA 4X8CA 3OR7B 1GZPA 1A47A 3HJ0A 2DWEB 4RDQG 1S9VA 2DH2A 4MAYC 4AQ1C 5E95B 2WTPA 4G7VH 4HG4K 3NPZB 1F6FB 2AQSA 3O3DA 1FO0L 1AMXA 3U0WH 4P99A 3L4XA 2EH8H 3OZ9L 1IAOB 4U1LB 4DP4X 1XCTA 1QHQA 3TBTB 1XGQB 3OR6B 3EO0A 3UBHA 5F89A 5IV2B 3GMPB 4MXWH 3NJVA 2VM9A 2I07B 4NXKA 1IX2A 3PV7A 4WHYH 4NQEA 3OZKA 2FLMA 3RU8L 1DP0A 4JN1L 1NAKL 3QPKA 2XN9B 2VDPL 2V4LA 3GMOA 1MFEH 3GSOB 4BGDA 1YDPA 3L81A 5I1AA 3MRRA 2EO1A 3ENEA 3LKRA 1C5CH 4JM2D 5JPNA 3ILPB 3P0YL 1L0YA 2OZ4H 1QTYT 4D9LL 2BX5A 1IKNA 3EYOA 4F58H 3ZDZE 5I8CB 3T0DA 2E47A 1L9OA 1IQWL 1BFSA 2XWRA 2COVD 4TL4A 3CGTA 1ICTA 3IU4H 4JPKH 5G5DA 3KJ4B 1VEPA 2I27N 2Z8RA 5B1CA 1BMZA 3SCMB 3NP3A 4X6EB 5HYQA 1YECH 2VITB 3NESA 1AXSA 1OE1A 2CBQA 1FZMB 5BRPA 4M1GL 5IESH 4GO9A 3SPJA 3OXSB 3FUDA 2ESVD 4W9GC 5KSVB 5IJVA 1JPGA 1KJVA 5C9JB 4IBWA 3BUBA 1PG7X 1L3NA 3E9TA 5TF1H 2Q10A 1CLZH 1CDUA 2X38A 4JCLA 4Y0GA 3UAAA 1XEUA 4PJ6A 4QPEA 4E9XA 1OM9A 1OB1A 3UTZB 3O0RH 4Q7DA 1A14L 5FYLD 3VWKD 2CBPA 4ZUWB 1DDHB 4Z7VB 4XO3A 1BIIA 1O7DE 3X3GH 4MJHA 3OKMA 1MIEL 2QPDB 2PCPA 2VMEA 1INDL 4JRWA 4M62L 3RNQA 5LDSA 2ZE0A 1T3FA 3FU9A 2PW2A 4FNUA 4WCYH 1WIPA 3HZYA 3UYRH 2HUEA 5FM4A 4R4BB 4B9PA 4QUOA 3SPVB 1NMCB 3CFKB 3GZOA 5GHWL 1AG6A 4PJ7B 4MVBC 5FGBA 1Q0XH 3DLQR 4XNQA 3EZJB 5EEWA 4NPJA 2KLRA 4KJQD 2YXMA 3I2CH 2DRUA 1RXLA 3VJ6A 1ORSB 4AH2A 1JJUA 1XBDA 5INDA 4XPTH 2VC2L 1RLWA 2BNQE 4AYGA 1ZHLB 4NO5B 4JFUA 2P52A 4A2MA 3D08A 2WLMA 1ID2A 2XWXA 4HJGA 2Z31C 4ODWA 4ZYKB 3QORD 1IC5L 4LNRB 1H8OA 4M5ZH 3TZVA 1YJDC 4ODXB 1WK0A 4GS7B 3MV9A 5F3HB 1TJGL 3VFWA 3GSQA 4PFEA 4HBCH 3TCLB 3Q43A 1ZVSA 4CILA 2W81C 1D5BB 3L8QA 5GGUB 1E4HA 2NNAA 1OXYA 2ZOKA 1PZUB 1KXTB 3TOPA 5BMFL 2KQMA 4YWGH 2Q7NA 3GKWH 3O4LD 1ZA3A 5AVSB 2I85A 4Z95L 4UI2A 2OJZL 1U0QA 1XF4B 1MWAA 1QTPA 2CLZA 3CZNA 3LQZB 1J0IA 2PWEA 3MV7D 3WXVH 1JN6A 3CAFA 1QW9A 3BVTA 5DWPA 1H0DA 3MJGX 4PRIE 3RVUC 3T65A 4ZNEA 2WQUA 3LMJH 1VB9A 3RNQB 1DE4A 5GRJH 3K6IA 1YUKB 1KJ3H 1KTBA 1K6QH 1RHFA 4JZNB 5D1ZC 2D7OA 3UZQB 4YPJA 6PCYA 4PGCA 3ESMA 4C58B 5HI5C 3GI8L 1G1CA 5AB0A 2BIMA 3MRBA 2CLRA 1L6PA 4NI6A 3KCWA 4GO6B 4PWKA 3S3BB 3RWCA 1WWBX 2NY1D 5EOTA 2BP8A 3I85A 3SY6A 3O0LA 3QXUA 3WIHL 4NIKB 2JI3A 2X89A 5J12B 1J0YA 1QW8A 2VLRD 1VGEH 2FECL 2VUKA 2YQBA 2AJVL 2F7QA 3MCG1 4GAGL 4K7FB 3ZE0B 3GKZA 3MOBL 4KJPD 3LD8B 2IDTA 5HYIA 2WOYA 2ZICA 5I71B 1E4JA 5JHDD 5DCCA 1UA7A 1NPUA 4EOWH 4LVOC 5D2NC 2WMPA 1YYLH 3GF8A 4UNVA 5CD5C 4WW2B 4XMPH 4FXKB 4CSSA 1U8CB 4I18A 3ZR6A 4K9EL 3IXAA 2A1WL 4UU9A 1SJHA 1P1VA 1T5WA 4PSRA 1XAUA 3BESR 3G6JA 5MEQB 3IJHB 1GC1H 2DN7A 4BH8B 1NBCA 2XJKA 5E6UB 1AGFA 2DIJA 3KPQA 5DVNA 4NPYB 4OCRL 3QUYB 3QDJB 1KEMH 4I3SL 2W95A 2MWCA 1LEKA 5AB2A 3DK0A 4M43H 4YHZL 3S5LA 3CBKB 4W4NA 3ABLB 2WJ7A 4ODUB 1CO1A 5HXMA 3L08A 3VG0H 1SVCP 4LLDA 5BXFA 4PJ8C 1O5DT 3LKOB 4XN4A 5JHLA 3OJVC 1E6OL 4Z0XB 2EKSB 2NX5D 3WNOA 3ILEA 4XXCC 4HLZH 2N56A 2E27H 1G9EA 3D2UA 1A8ZA 3HZKA 4QRRE 4C56D 4MJ2A 3FHQA 3CFCL 2B16A 1NWOA 3VWKC 1UJ3A 4W9HC 5SWQB 3RY6C 1JUFB 1Y18B 2VR4A 1N3NB 5EZOH 3BH9B 3HS8A 4NNYB 3KJ6H 5KYWB 1C8QA 4X9BA 4PJCA 4OLEA 4JL1A 3V0IA 2CBMA 3VYNA 1F8TL 5J7CC 2BP8B 2Z8WC 1PQZB 1E28B 5DJ8A 2YPLA 3IDMA 4GSUA 1KIQA 3H2WA 2Z1PA 1HILB 5I8OH 2AKRB 4RMBA 4KO5A 4UTAH 1DLHB 4YXHL 1XAKA 3E80A 3OMZA 4TSCL 4I4WB 5A2KH 3VI3F 3CLFH 2VQTA 3ZT6A 1N59A 1L9SA 2Y1ZA 4KQ0A 1JXFA 3UO1L 5C86A 1PD0A 4F93B 1PEWA 4Z3HA 2G9KA 1MFAH 3V5HB 1OF2A 4WI3A 2EDTA 4Y8AA 5FIEA 3ULSB 3VGHA 5B3NA 4TUUA 1QSFE 2MNUA 2WLZA 3KG5A 5IMKB 2PUQT 2RFXB 1HNYA 3EOAB 3RP1A 5KTEL 3UMNA 12E8H 1Q0YL 3BP4A 1UH3A 1T20A 1CYXA 1LNUB 2Z9TA 3KPSA 4M6MH 5CZVH 3GZKA 4I2XA 4RFEB 1KBBA 1NMCC 4U1IB 1IKNC 4V2BA 1DR9A 3GM0A 3R4DA 5E1AA 5BZXA 2EH8L 3HZMA 3MRLA 3WKNA 3U0WL 4ZTOL 2IWFA 1MCSA 3HN5A 3ILDA 1XGQA 1KBGL 2GVYA 1RURL 2A2QT 1B3JA 5GZNC 5CS7A 4YSOA 4PJEF 1I1AD 5L9DH 4IBLT 3HOGA 3QHTC 5DVKA 3OLDA 3BI9X 3DNKA 1H5BA 1HIMH 3FSWA 3U4EB 2ZKHL 4ZW7A 4G6AD 5I1AB 4E5XG 1VFMA 2IXQA 4OIFA 4N6QA 5AOIA 3ILQC 4DVRL 4NQQA 1JZ5A 1KIQB 1BZEA 3QJQB 4LCCC 2UVEA 2DQGL 3FO0L 2C9RA 1NUDA 4XHQA 4OTXH 3TO2B 2WP3T 2Z1KA 4KVCH 1NLDL 3RI5K 1J8SA 1KNOB 2HRHA 3QS3A 4JHUA 4N2AA 3BDYH 1H6UA 4QRSA 3VFGL 1FFOA 5HBBA 4N8CH 3ARUA 3QQNA 2Y23A 3WO3B 4BWUA 3ESOA 2J88H 4XCYB 2OLDA 3MR9A 4XBMA 4OFPA 4UT9L 4ZOEA 1Z9LA 2ICWJ 3BKJL 1KGIA 4X83A 5C09A 1H15B 4NKMA 5KVGH 3CK0L 1E27A 3N6YA 3WEBA 5KN5A 4G8GB 3NA4A 2V2WA 1PX3A 4ISVB 3QUKB 2VDLL 2R0ZH 4YIQA 1OZUA 3O4LE 2ZXQA 5T1LA 4OF6A 1J8HA 5GSRA 4LPWA 3D30A 3B9AA 4GW1B 4Y1AD 3B5GA 4Y5XA 4O2FB 4FERA 1MQKL 5IW6B 3MV7E 4ZDHB 3OGCA 2B3RA 1RERA 5FECB 1BQHA 3IKCB 4OJFL 1FC2D 4GG6A 4LASL 2FCBA 2R2CA 5LAPA 5LG6A 3PLYA 3GXUB 2HTLD 2VE6B 3NEEA 3VD2A 4P2QA 3LRMA 2HTKC 3IGKA 2EAEA 1BVKB 3AAZA 3ECBB 4ORGA 2CO2A 2IOIA 5CGTA 4OZFH 4NHCL 3OSVA 2AJSH 5T3ZH 3U4EA 3T4AC 1OSPL 2DQJH 2RCSL 1U4EA 4WJG3 4LSUH 4ETQA 3ATFA 3V0VA 5L2JA 1LJMA 5IGXL 3FFDA 4WFFE 1AHWA 2XBZA 1JHLL 1SLVA 2R1WA 1HT6A 4YGVB 3OQ3B 1NAML 4LVHC 3LN5B 4W93A 3TCLA 5IW1A 5T1MB 2XRAL 1MG3C 4ZTPL 3WE1A 1OP3K 1OHQA 4G9FD 1JYXA 1KB5A 1OCCB 3FTUA 1QPKA 1CR9L 4LEEA 3ZIMA 2HN7B 4FFZL 3T6VA 1UD4A 2ZUQC 2WLIA 1CI3M 3O3UN 2AI0H 3NA9H 5F1OB 5DQ9B 3T08A 1YYML 3SOBL 1U8NB 2CDEA 2YBGA 2RQEA 1G7JA 3L3HA 3SE8L 4E5XA 3MMEB 5C0CD 1FL3B 3GRWL 3R06A 2GY5A 1Z9MA 5GSRB 2BFVH 2CHXA 5JA8B 3VW3H 2R2EA 1A4JA 4MNHB 1A5FH 1C16A 1T1WA 4Y4FB 5DLLA 3U30B 5H35B 3VXPA 4PGCB 4RIRB 1BQHB 1LDPH 3H9HB 2WZ0A 1MXGA 3F64A 1FGVH 5TE6H 1M42A 4QY8B 2GJPA 4Y8DC 4FXKC 4P2QB 3E8UL 1NEPA 4RGNC 4WI2A 1DBML 4HT1L 1OLZA 1GSMA 3Q8AA 3OKKB 3OKMB 1DQJA 5I71C 1LO0L 4XNAA 3CD4A 5ESAB 1JYVA 3NFSL 2EQDA 1NAMB 3P3RA 1PZCA 3DYMA 4I3GA 5J12C 3NJIA 2V6HA 4TTDD 3WNJA 1NKOA 5HHOA 2VJ8A 5FUOH 2P24A 4G5AA 5HY9B 4WI4A 3TESA 1JXDA 2WIIA 4HWBL 1E2WA 4X5PA 3TYFB 3I6KA 3FQWA 3SBWA 1IC7H 3NSDA 5E5RB 2GBVA 4KKAC 5CHNB 1DO5A 3VFVA 3HN3A 3MA7A 4E41A 3T2LA 2FTAA 4CN1A 2QGBA 1CWVA 2H45A 1KLFA 2D73A 3JTTB 2F7OA 1XGRB 2HMID 3TPUA 3WDHA 3QC6X 1T5XB 1M3IA 2OJEB 4TV3A 1BJ1J 2XPZA 5K1JA 2ICES 3SBQA 4EAEA 5JMOC 3NIDE 2Y1AA 2EDDA 3FTVA 3KYMA 2YS4A 4Y2LA 2X2YA 1FIGH 1CBJA 3K2UH 3ZDWA 1HL8A 1X6NA 5EC2A 3ZTJH 1XXFC 1JPST 3QH3B 2O5XL 1FNEA 1Q9KB 3D0LB 2CWRA 2WO2B 3M46A 4UWQB 5E4AA 5FCSH 3HB3D 3S4SG 3IK2A 1SOKA 4BKLB 4F7EA 3CUPB 4TTGA 2ZKMX 2WXIA 4BUHA 4BZYA 2A6DA 4JY5H 2CO7B 5DRZA 1MRCH 4F9PA 1DUYA 3DUUA 3E6FA 3MJ8B 5MEOB 1EAPB 2Z31B 1FQ9C 4LEXH 4Z7WF 4PVBA 4IBVA 5JW5B 2BRQA 4LLUB 2MPAH 4M7LL 2RBLA 4N90D 3C5ZA 3N85H 4YBLC 4I48B 3DGGB 3MGOA 5TE4L 3V4LA 1F86A 3CFIC 3NTCH 4WJKB 4JB9L 2VL4A 1U42A 4JPSA 4ZNCD 1AY1H 4GXUM 9PCYA 4B5ZA 3BAEL 1R34A 3MYJB 5DJZA 3TONA 2VR9A 3CFJA 3F65A 1FYTB 4PJAA 5J9PA 5MENA 3ASOB 4IU2B 3G6DL 4NFCA 3AJ7A 3ORJA 1I8MB 1EDHA 2NW2B 3BDBA 3CSTA 1OP5K 4DETA 3HE7D 3QUZB 2CMRH 3IJ8A 2ZKYA 4NIYE 1RK1A 5I8KL 3PDDA 1WBZB 2V5YA 1BBJB 3FTGA 1SQ2N 4OT1L 5KANG 2WVTA 1GOGA 4DGVH 1WZLA 5F97E 5MERB 1KLUB 2VDKL 1SPDA 4PLKD 3P4LA 3PHAA 4NJ9L 1J05B 4PTTA 3DOIA 3CHQA 5B38A 5BW7A 3L48A 4JFFA 3K2MC 4TUKH 2YWYA 4NKIH 3REVB 2GSMB 4WO4D 2VXQL 3R1GL 5C97A 1RK0B 1BREA 4XCCL 2EO7A 4EN3B 5IQOA 3KPRE 1WFOA 1NUNB 5D5MB 1JZ4A 7CGTA 4LHUD 5D96B 4JR9L 4JFDE 2MNWA 4P5TA 4OLYL 2WYHA 1BX2B 4YO0B 5FDYA 3CUPA 2FX7H 3K6NA 4D0CA 1DLFL 4RQQB 3VYPA 3OVUB 1U8QA 1A7QH 4GJTB 1PBYA 3NMEA 1EDQA 2FHBA 3UGUA 3PRZA 3S5YA 3S88L 1RJLB 4GRMB 3BH8A 4HJJH 4QWWC 2UXGA 3IS0X 3DUUB 5B1JA 3LXAA 4UMSA 1FJ1B 3VA6A 2EUVA 1M6OB 3X12A 5FR3A 3VD4A 2XWBA 3TBSB 2NNRA 2ERJB 2ADJA 5KW9H 5AFAA 2OL3H 4XVOA 5FA4A 1I7ZB 3B2UC 3M1BA 5H94B 4IRJA 2XN9A 3U1PA 1JNNL 3SQBB 4G5ZH 1QI5A 5FYKD 4DGVL 1CE1L 1ECZA 2EIMB 2OX5A 3IU3A 4G8EB 3KNBB 5F0JB 3AGVA 2UV3A 4HEME 2VUOA 3V4UL 5K5YA 4GG8B 3WKPA 2AK1L 1N64L 2UZPA 2K6YA 5I15H 3ZQXA 4XBEL 4OB5L 3N43B 3D3VE 5DS8A 4BFIB 1RK1B 2Y6TE 4LQFL 4R7NA 2DMKA 2QKIA 1JOIA 4FL4C 4WLCA 3TBVB 3IAQA 5FEBA 3RDTB 5F7UA 5CIPH 3N41B 3IJYB 3V6OA 4AYBA 2LW3A 4F80A 4B27A 2G2RA 4ZBJA 3QIBB 4K3EL 5C08D 5D4IA 3KCPA 3UC0H 4BZ2L 3T3MB 1NCCL 4H13C 3K80A 1E0OB 1ES0B 5DO2D 5KVDH 1NUGA 2BRRL 4ENEC 3GXDA 5FS5A 1PYWB 4IOSD 3Q3GB 4JKLA 43C9A 3RNKB 1MRDL 2PWDA 1KXHA 4UCFA 3BSZL 4LIQH 4KVNL 3QYCA 3IJEB 3ZDXB 3WELA 5SWZB 1UZ6E 3W57A 4JO4H 2IMMA 2ATPB 1MNUL 1QUNA 2B0SL 1OTSC 3FHAA 4PRHB 3C08H 2VR5A 1QR1A 2GABA 5DK2B 3JWNH 4HJEA 4HCRL 4F5CE 3MJ9A 4NKQB 2FHFA 2B2XH 1AHKA 5IK3B 2JKTM 1M6OA 2VERA 3X12B 4N5EC 5GGVL 5HYFA 4G59C 4XI5D 2WW8A 1BEYH 1T66C 3LN5A 1BM7A 4JFXA 1P84J 2FD6L 4Y7OC 1QFUH 3G5ZB 4HH8A 1PLAA 2ZWZA 4UV4L 3SE6A 4G80A 2B1OA 4BEIA 3QE5A 3BWUC 1IGFL 2QMKA 3UROR 3ES6B 3QNYB 4PG2A 5JHBA 1GMIA 2J20A 4XMLL 2V17H 3AB0B 5G2NA 2I5YH 3S2CA 2WQAA 3SD2A 4XPGH 4P5KA 2VLKD 2K6WA 3ARDB 4GKLA 4Y5VB 4DTGH 1G7JB 1G9HA 3JWNE 1ZVSB 4K8RH 4C4KO 1KCUH 1TUPA 2BOBB 4NN7B 1YYCA 3ZYOA 1Q4NX 3FUJA 4NAMA 3VWJA 2FR4B 2AJZA 2ZOKB 1MY5A 4K8RC 3WXWL 4B7LA 5IVOA 3C09C 3VD9A 2X9WA 4XVUC 1CCZA 1ERNA 1EEUA 3DXAE 3TYGL 4I8DA 3T0VA 4LSRL 1MJ7H 1OCRB 1YNKH 1LO0H 2R2BB 2VO5A 3NJKA 1SXZA 2VZ3A 1UVQA 3EYQD 5EUOF 2BSSB 1B0WA 2X09A 4L3CA 3QRBA 1AACA 3ZDYF 3E2HC 4QMEA 2AEQH 5EZPA 3EXJA 3GM8A 3V4VA 1PCXA 1N5YH 2ATPA 4OCXH 4ZO7A 4KGLA 3EYUH 3GB7A 4JFEA 1BEYL 3BKCH 3QDME 5DK2A 1SM3L 2H2PD 1T2QH 2NY0B 2OCFD 3EH5B 1KLGA 1ACCA 4XNXH 4PREB 1MSPA 5IBLC 4JAMA 4NYLA 9CGTA 2R1XA 4V1DD 2IANB 3RVTD 2VAAB 1WV7T 2OW6A 3SGEI 3MUGB 1MJJB 2QSVA 4G70B 3S3SA 4ANVA 4E9LA 4JHZA 1WBYA 1MNUH 1MAJA 2B0SH 4JG1L 4Z3IA 1DUZB 3OGOE 4PGBA 1DQDL 1NDGB 3NCJH 3LV3B 2LE9A 1UXWB 2B7DT 4MCYA 5I8EA 1FGNL 4LLYA 2H2SC 1OTUC 2EIBA 4UQAA 3X13A 3VNYA 2GJ6B 1FYTE 5T1JA 2V9TA 2Q76A 1UD6A 1SVBA 4EUPH 5HVWA 2R29L 3MV9D 4NQDE 3BIAX 4LOEA 5CD5D 2R69H 4FXKA 4Y5VA 2MKLC 1MI5D 3O3EA 2X4RB 4NEHB 3QFDA 5DJAB 1C5DA 4KDTA 5F7YC 2VQ1A 3V0FA 4MDRA 1IGIH 1WIUA 4TXVB 4N86A 1ET5A 2HB0A 2YXVA 4P57B 3KPQB 2VR3A 4KH9A 4LSDA 1J87A 3OJ2C 5FHAL 1CJYA 2RCSH 1SY6H 2DQJL 5E6ID 5B39G 5C7XH 1LO4L 5ALBH 1JTPA 1UXSB 2J56A 3BKYL 4DKAA 3U4BH 1P6FA 1QFHA 2Y3NA 3VSVA 4AGOA 1GPOL 3NABL 3TVMC 5J4MA 1FZOB 4ELMA 3VD5A 4UM9A 4IDJH 4YUEL 3V5KB 2CCWA 1NIAA 3LKOA 3WFCL 4KK9D 2NY1C 5J56B 3ATAA 2OL3L 3I3EA 5IR1B 1A7RL 1XF5A 4ONHB 3T3MF 5A40E 3D2UB 4FXGB 5J6HA 3BOVA 3E3QC 4H5SB 4JPIB 3D06A 1AZNA 2C34A 3L9YA 1KTLA 4RFNC 1UWXK 4P4RA 3BCDA 4U1SB 1EEYB 4MX7B 1E5CA 2E7BA 5IJBC 4HXAL 1N0LB 4HJJL 5G4NA 2VJ0A 4F15B 2DIAA 5EFIB 3UTSD 4XNQB 1HHGB 3JBG7 1KN2L 1N8ZB 2KLTA 5DUPH 1Z9SB 1LK3H 5KBNC 1ZVHA 2FX7L 3LV3A 4FFWC 2OSLA 4HMEA 3CSYB 2Q2LA 1QO3A 4D8PB 1NDMA 5AOLA 3BKJH 4LLYB 4AEIH 2IBBA 3P9WB 5DWUH 4OLXL 3FT9A 2Q6WA 1X5GA 3Q2VA 4OV6F 2GT9B 3JWDH 1ONQB 3QUYD 3FU6A 2XHNA 1D5ZA 2Q1EA 3DOSB 2CK0L 3LEYH 2AZAA 5DO2C 3QXTA 3V4PA 1UQSB 3MRJA 5DJAA 4XX1G 3RWGB 4QHUA 3TWCL 2RFXA 2QELA 3GBML 2DM4A 2WO4A 1JK8B 2ZX8A 1HDMA 3IAPA 4LDLB 5IOPA 1XF2B 4H8VA 3TIDB 3GSNA 3GBNH 3NSJA 1AZVA 1QBML 3ROOA 2H7WA 5DT1H 5JNYB 1PF3A 4PCTA 5EC1A 4ZMPA 1MCOH 1MWAB 3N04A 4N1CA 1V27A 4N9OB 1OW0C 4G71B 2JE8A 4HIJB 3HI5H 4L3FA 3RVTC 4FLRA 4W9IC 4AEHH 4EQ3A 1PFOA 5IBLD 4PJGA 3V5KA 4P07A 4YSPA 2GC4C 4G43B 4H1LB 3V6OC 1QATA 4MNQD 5C0JA 2E7LA 2WANA 2WTRB 3V0GA 4LKXB 4TUOB 3O41A 4ZPVB 1DE4B 3QUHA 4JKNA 4Z3EA 5DMYA 1SN2A 1HFUA 5FFOA 4M7LH 2BZ7A 4UQCA 2F19H 1VFUA 4F7TA 4ZOCA 2E86A 2XTJD 5DJDB 3WNPA 2P5WB 3H85A 4Z7VF 3WJJA 1FSKC 1WF5A 3DURB 5IROD 3LZFH 3QWNA 1U8JB 1A9EB 3BO8B 4QXGL 5C0RL 2F18A 1P5VA 2F8OA 2WB7A 2ZJSH 1SOXA 2A4ZA 4X7TA 1DVFC 4ZI8A 5LKNA 2J5LB 3SZKC 3HMXL 4GEJA 3IF1A 3APDA 1RUAL 3GHEH 3ZUCA 4GRLB 4XO8A 5IVNA 2FWOB 2EEAA 2J1KA 3NCXA 4ENZA 5IP4A 3ECVA 2ZX9A 1CD0A 1I3GL 4IM8A 4PIRF 1SYSB 4L1SA 1U3JA 2ITDB 1LO5A 4EZMA 3MSPA 5JXED 3GXPA 2NNFA 2P5ED 4Y4HC 3ALWA 2QT6A 2UZXA 2V2XA 5C0AA 4Y5YC 1TLMA 2FRGP 1KPVB 4MMZC 4UTCA 4F8OA 2OK0H 2XX0A 3BLPX 1TR7A 3RWEA 4F33A 1JAEA 4HWUA 5IOPB 1XF2A 4NRYA 4QI3A 5CCHE 3TIDA 3MFFA 1A6AA 5IF0B 4D9QE 1BVLB 3AFLA 5F7KC 5AW4B 2CJ3A 1U33A 4A2DA 3FBQA 3BT2H 3HA0A 1P4BH 3TT1L 3KR3H 4R0LA 2E9JA 3S3CB 1U3HA 4RAHA 3HI6H 1BQSA 2B8OT 3CQFA 1C7TA 2YD5A 2BNUA 2VLJE 1KFAL 3IMRA 1NCHA 1A1NB 3FU7A 4MA1B 1ZDSA 4MNQB 4GYBA 4U1LA 4PJDE 1BXAA 1D7CA 2H6PB 3MXVH 5CEYA 4ICXA 2ZP9A 3ARFB 3IKCA 2YC1B 4DT2A 1NA8A 4YSEA 3DUSB 2ZWKA 3GNMH 2YQ3A 5FF6B 5CU5A 1N3NA 2EDMA 2GITA 3T2NL 4GP8B 1P6AB 3A6BH 3SQOL 3WS3B 1FN4A 1JTTA 2PCXA 1KYOJ 3JT2A 5DZVA 1CS6A 1KBKA 4W9KC 4ABWA 2DY2A 5EMYA 5FYLE 3FT3B 1AYOA 5EH1A 1N6QH 3ILPA 3U9PH 2AV7A 5AZEL 4BZ1A 4HJUA 2UZYB 5E8PA 1GXEA 4TN9A 4XCNA 3TBCA 2B39A 3RKDD 4YSQA 1A5FL 3RY5A 3VNZA 3JTBA 1FZKA 2W0PA 3FSVA 1ULVA 1A6VH 2F68X 3KGTA 4L1TA 1M7IB 3U36B 4U4IA 4AYFA 5CCKL 4X6EA 4E9RA 4PRNB 3WIAA 2EDLA 1N2RB 4XTRC 1S5IL 4Y16A 5IHUH 2HT2C 1YPZA 4GMSH 1XSIA 2I9LB 1NC2A 1URLA 5CEXB 4EKXA 1VFAB 5DMGD 3FCUB 3SBPA 5AW6B 3AQDA 4E9QA 5AEAA 3UTSB 1CR9H 3MKKA 4MA1C 4WI0A 5B1BB 4E5XB 3AROA 3AY4A 3HCVA 1CXLA 4C4BA 2AC0A 1TQTA 4WY7L 5F70A 5L0QC 4A2LA 4R0LB 4OFVA 5I17A 2VTFA 4MWFB 2CM5A 4N25A 3KGSA 2HRGA 2DWSA 3LQAL 3MLXH 3G6AB 1KUMA 4U3SA 3ZHKA 5L2KD 1I8KB 3F7QA 4NYLB 2NNXA 4X6DB 1LYQA 4EEEA 4FHBD 3KPPB 3BUQA 4QY8A 5J89A 4LBEB 2QLYA 4UB0H 1NMAL 2OMXA 5DHYA 4UAOC 3QWOB 4EN3D 1DVUA 3HAEH 3IBEA 1NANH 3O8XB 3VWJC 4P2CG 1XGZA 1UXWA 2Y7OA 3R0MA 1AS8A 1KF9B 4G8FA 5I16A 3L7FB 4BIKA 1IGTA 1ECYA 2CR3A 4MJ5B 4LASH 5F7FA 2AEOA 3WG7B 3D2UD 3F2LA 3WGVB 4LCWB 3U0PA 4L8BB 4MZ3A 3S37X 4DUWA 3IMBA 1BVNT 5MI0B 4XMWA 2QV4A 4ODXA 3QCVL 4MA8H 2ZXBA 5CMAA 4YDLC 4FRWA 4HGKC 4ZFZA 3REWB 4DPRA 5CBAB 4RGOL 2VSDA 4KRNA 1CF8H 1I1YB 3WFEL 4KHXH 4HBCL 2DKSA 1ZV9A 2QVIA 2R7EA 3EGXA 3FUHA 4QRSB 4G9FA 3HFML 3WFHA 5CLWA 3LZPA 4PGJA 4J3BA 1ETA1 3O2WL 1T1XB 4A7QA 3BZ5A 4LSPL 1J0KA 5AW7B 4A7TA 3W0WE 4XCYA 2FEDD 3IPFA 1KDJA 1HZHL 2NX5E 4EO5A 4IKIA 1M05A 1YVLA 3VFPB 1G5GA 1AC6A 1CDGA 2ZOUA 4MTMA 4N8CL 4XB3A 3QXVA 4B6ZA 3EDFA 2BOBA 3W56A 3C2AL 3VWJB 4GUOA 5DHXB 2E4TA 4UQ3A 3QJZA 4BKSC 3OAYH 1EXGA 1RUKL 3GO1H 4ONHA 2TSAA 4X9FA 3HG0A 1DJXA 4EI5D 2ENJA 4PWHA 4YHPB 1LO3L 4OJYA 3UYRL 4UQDA 3FUEA 2JK5B 4MNQE 2XPGA 4QRPD 5IUSA 3ZE0E 2GSGA 4OGXL 4DJMA 3U7YH 2EICA 2JJUA 3EXLA 3AAZB 3C8HA 2EE2A 3ECBA 4HYTB 1RZKL 4OCSH 1UWGL 2AAVA 4WTZA 5FGCE 3S97C 2XVLA 1EAPA 5I16B 5AB9A 4MXQD 5TF1L 1MFBH 4JGUA 4NQVA 3T4YB 2C4XA 2F7IA 3C6SB 1FDLH 4RFOH 4XCFL 3CVHB 5CP3H 1ZLSL 2R1XB 2Q86B 1TMQA 1WEJL 5HHOD 1QRNE 1BLNB 1CFMA 4HKJA 4ZFZB 3DA0A 4HALA 3AWEA 4PJ9C 2P42B 3SYOA 1B4TA 3OAWA 4QRTA 1DUZA 1J0HA 4UU9B 1UQSA 1KULA 1VGKB