1J5CA

Solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title The first solution structure of a paramagnetic copper(II) protein: the case of oxidized plastocyanin from the cyanobacterium Synechocystis PCC6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j5cA00
2EILB 4EF3A 4F7KA 3FS9A 5AKRA 2PPAA 4YSSA 3NJFA 1L9TA 1RZQA 3S3DB 1NIAA 3PAZA 3KW8A 4BWUA 4DPBX 1BEXA 3OMAB 1XB3A 1PZAA 4HALA 4DP8X 1SJMA 3T9WA 2GSMB 2DWTA 1CUOA 1JZJA 1JZIA 3PPSA 1ET7A 2I85A 1KCWA 2UX7A 1ZDSA 2AZUA 2XLLA 1AIZA 1OF0A 4X4KA 4YSTA 3ZIYA 4A2FA 1A4BA 3NP3A 4PCYA 2GB2A 1A4AA 3JT2A 4KOCA 3UACA 1A8ZA 1PCSA 1PLBA 4HIPA 2BWDA 3NSCA 2BO0A 5B7EA 2XXGA 3GXUB 3OQRA 4DP0X 1TEFA 2PPFA 2XV0A 3QJUB 4AKQA 2IAAC 4K9JA 5I6NA 2QT6A 2YAFA 3NJIA 4A68A 1AS7A 4JHVA 4HCGA 3CZUB 4G71B 2GI0A 1PMYA 2XVBA 2AVFA 4DP2X 2XV2A 4DPCX 1TU2A 1JZGA 3U25A 3ABMB 4F2EA 2OV0A 1A4CA 1J9QA 4NB7A 2P80D 4E9WA 1W6LA 2N0MA 3D12B 4ENZA 3PCYA 4L0PB 3SBPA 5PCYA 3NJLA 5I6PA 3KW7A 1BXVA 2VW7A 3AG1B 3PAVA 3UAAA 3CVDA 3GDCA 1X9RA 3WG7B 2YARA 1JERA 2MTAA 1E5ZA 3X1NA 4DP4X 5TK4A 2PP9A 2IH8A 2PP8A 1ZDQA 1PLAA 2VW6A 1SFDA 3BVDB 2H5UA 2DYRB 3G5WA 1E65A 1HFUA 5FC9A 2PPCA 4G7QB 4Q89A 4YSEA 1YLBB 5D4HA 4GYBA 4DP6X 2HX9A 2P80A 3EH4B 4TXVB 1IUZA 1PNDA 2I7SA 1ETJA 3SBQA 3BQVA 2EINB 4AI7A 2BP0B 2WO3B 1KDJA 2VMJA 3N2JA 2PLTA 2UXTA 7PCYA 4DP9X 4YSPA 3IBOA 2HRHA 1SDDB 3AG3B 3NJHA 1BXUA 4Q8BA 3QPKA 4KOBA 1NPNA 1TKWA 2XV3A 4YSOA 1KDIA 3OM3B 1NIFA 1BXAA 5B1AB 3S8GB 3CDZB 1J9RA 2B08A 1IBYA 2ZWNA 1A3ZA 4AKOA 2J56A 1KGYE 1J5DA 3HEIB 1GY2A 2YAHA 1AS8A 2XXFA 3QJQB 2TSBA 1JVLA 2J57A 5AZUA 2FTAA 4DP5X 1OE2A 4DP7X 2E86A 1AR1B 1GYCA 1PAZA 5I5MA 1VLXA 1NIEA 4BXVA 3ABKB 3DIVA 4YVNA 8PAZA 2W88A 2XUWA 3AG4B 3T6WA 3S8FB 1SF3A 2YXWA 1V10A 1DYZA 2PPEA 4QLWA 2BW4A 5B3SB 2DV6A 4N8UA 1EHKB 3NT0A 1OOWA 4G72B 1GW0A 2BZ7A 2UX6A 3CG8A 3NSYA 4MFHA 2IWFA 4KNSA 1NDTA 2YAOA 1ET8A 1GS7A 3FSVA 2CJ3A 1AG0A 4HZ1A 2IDFA 2XYBA 3FU9A 4AKPA 1KBVA 1M57B 2CALA 3ZDWA 2ZXWB 1MG2C 1WAEA 2BHFA 3TA4D 2J55A 5I28A 2IDQA 1PZCA 2EIKB 2Y1AA 4M3HA 1PY0A 1V55B 2YAPA 5F7BA 2XX0A 4HCIA 3S3CB 3HB3B 3T71A 2DWSA 1FWXA 1UATA 4KO7A 1EZLA 1E5YA 3EHBB 3N55A 2X87A 1CC3A 3QQXA 2CAKA 2R7EB 2FT8A 1SFHA 1X9UA 5B1KA 1KYAA 1AAJA 1E67A 1AQ8A 3ZBMA 1MDAA 3FQ2A 2EIJB 1DZ0A 1OV8A 1NWOA 2AFNA 2CUAA 1JVOA 3NJKA 2AANA 4G70B 2J5WA 3H56A 4DPAX 5F7AA 1OCOB 1KBWA 3FYEB 2HX7A 2DY2A 4N4YB 4NAJA 1GY1A 2UXFA 4E9VA 2YAQA 1JZFA 3FQ1A 2GBAA 1PNCA 3JTBA 4KO9A 3SQRA 3FPXA 2BP8B 1L9QA 1XB6A 1ADWA 4WKXA 3WKQA 4A2EA 9PCYA 3X1GA 3PXLA 1R1CA 2Q9OA 4FA7B 1GS8A 1GR7A 1QHQA 1JZEA 3NJJA 2JFCA 4BDVB 2IWEA 4YL4A 2FQDA 3T6XA 3NSFA 3V9CA 1F56A 1M9WA 2CCWA 3H4HA 2PP7A 4BWWA 3OMIB 4NERA 3FU7B 1OCZB 3EH3B 5B7FA 1PZBA 1ZIBA 1MZYA 3GYRA 4HHGA 1SF5A 1RZPA 3T6VA 1GS6X 3ERXA 1N70A 3FSAA 1W6WA 5E9NA 2HRGA 2VM3A 1AZUA 4A66A 4DP1X 2BW5A 2FT6A 2W8CA 2HZHA 1NINA 1JXGA 4KNUA 3H4FA 1SHWA 1NPJA 5IY5B 5D4IA 3QJTB 2H3XC 2RACA 4PAZA 1BAWA 2LLNA 3AZUA 4JHUA 1AZBA 1FFTB 4YSQA 4YVUA 5A7EA 4E9YA 1J9SA 4E9QA 4KNTA 2IDSA 4KO6A 3IEAA 3TBCA 5B1JA 3AY2A 1AZRA 2VSMB 1OE1A 2FQEA 4FAAB 1URIA 4M4RB 2QDWA 1SHXA 4UAHA 1AZCA 3MX0B 6PCYA 3T6ZA 1HAWA 1PLCA 3IE9A 1ASQA 3WIAA 1AS6A 5I5IA 3RYMA 1AOZA 4CSPA 1OCRB 3S3BB 1J9TA 1I53A 1WA1X 2YAEA 3PLYA 2YXVA 3QJSB 4YSUA 2YAMA 2GC7C 1NIDA 3DKHA 3UAEA 3X2QB 2XU9A 4W9ZA 4YSCA 2FQFA 1SDDA 5EHFA 1KV7A 4E9SA 2FWLB 4UF7C 2PCFA 3WKPA 7PAZA 2X88A 4A2DA 1GSKA 1ZPUA 1ZV2A 5AFAA 3EF4A 3EH5B 1NICA 3CDZA 3NJNA 2ZOOA 3IN0A 3FQYA 3TBBA 2CBPA 2TSAA 3WI9A 3X1EA 1WS7A 4HCFA 5I6OA 5LDUA 3WNJA 3UGEA 5D4JA 4QKTA 4GY4A 2YQBA 1BYPA 1QNIA 5ANHA 4E9XA 2GC4C 2VM4A 1WA2X 2WSDA 2JKWA 4G7SB 3X1BA 4G7RB 1V54B 2IDUA 1L9OA 1RCYA 2EIMB 3ASNB 3NJMA 4BWTA 3OMNB 2A3TA 4GP5B 4WTQA 3UADA 2JXMA 2QDVA 1BQ5A 2FNWA 4GP4B 2FT7A 3FSWA 1TEGA 2XWZA 2OCCB 4GXFA 1MZZA 2HX8A 3MBWB 2VN3A 1L9SA 1IBZA 5I6MA 2FQGA 1J5CA 3NP4A 1ASOA 1CYXA 3AG2B 2UXVA 4A2GA 2IH9A 1A65A 3FYIB 4YSDA 1PF3A 2I7OA 2OJ1A 2FJSA 3ZX1A 4AZUA 2GIMA 3TASA 3TU6A 3C75A 3NSDA 2QPEB 1L9PA 1JOIA 3UABA 3V9EA 1OCCB 1E30A 1L9RA 1XB8A 1BYOA 2IDTA 2Q5BA 2H47C 2DYSB 1NIBA 1ASPA 2IWKA 1ID2A 5PAZA 4CSZA 6PAZA 3QJVB 1B3IA 5I26A 1WA0X 4F2FA 3ABLB 4YSAA 3DTUB 3L45A 4A67A 5I6KA 1QLEB 2R7EA 4E9TA 4RH4A 2BZCA 3IN2A 4HAKA 5I6LA 1JXFA 4A2HA 1IC0A 1NTDA 4BXSV 4HHWA 2HXAA 2PCYA 3FU8A 1BQRA 1AZNA 4YSRA 1IKOP 2MRYA 4E9RA 2NRDA 1ZIAA 1ILUA 5B1JC 3NJGA 1N68A 1BQKA 4W1TA 2B3IA 1SNRA 4AX3A 2ZONA 1AG6A 3FPYA 3FT0A 1RKRA 1HAUA 1AACA 1AANA 2WO2B 1W8EA 3AW5A 5B7MA 3NYKA 3WNIA 1FA4A 1CURA 4UANA 2XX1A 2Y69B 2HLEB 1XMEB 2AZAA 2BP8A 4ZK8A 3CVBA 4BK5C 1JXDA 3OD3A 1T5KA 4JKNA 5I5JA 2UXGA 4GP8B 4P5RA 1JZHA 3FSZA 3ASOB 2VSKB 4KO5A 2BWIA 3SBRA 3X1FA 1OE3A 1M56B 4BDVA 3QJRB 1NWPA 1WS8A 4P5SA 1NZRA 2VW4A 2QPDB 5B1BB 1CYWA 1ET5A 3CVCA 2BP0A 2GHZA 3FU7A 5TK2A 1MG3C 3PAUA 1KCBA 2PPDA 1ILSA 3ABGA
chains in the Genus database with same CATH superfamily
2J20A 1L4IA 3Q06A 1MQKL 1HEJC 4HFWB 2V5RA 4PRID 2FBRA 1G7QA 3L3JB 3SDCD 2CK0L 2WNWA 3AU1A 3MRFB 2UZXB 4HXAL 2R27A 4PJBB 3RWGB 5ABZA 3F85A 5FIEA 3A6OA 3KW8A 1FIGL 3VI4F 3DI3B 3QZWA 4J3OG 3L5WA 1KCRH 1RULH 3PHQB 4YJZL 3UZVA 4FQCH 1WTLA 5E6ID 1IC5H 5IB2A 4KK6C 2I85A 4NQCE 4NXSA 3UTSB 2EXWD 3FQ4A 4RMWA 1FCCA 1A6WL 4Y2NA 3V55A 4DQOL 4OFQA 1LDPH 1NC2A 3ARFC 3FTUA 4JPIA 2VR8A 4R7DB 3POHA 1MPAL 2WLMA 4PCYA 4DESA 4I3RH 3Q01A 3LS5H 4WWID 2VL5A 1A8ZA 2AXFB 4MB4A 4UT6A 4OF6A 3KLSA 2H1PH 3ZDYF 1A7BA 3KNBA 5CS7A 2V6HA 3BGAA 4H1LA 3PNWB 2Y7LA 4NZJA 4JZJA 5A2IH 4YHKL 3TCXA 3VACA 2ZYRA 1E4HA 2PCXA 3QUGA 3OGCB 2BS9A 4EKXA 2D03L 5IR1A 4CDGC 4HCGA 2D7MA 2XXMB 1SXBA 2NDFA 3PQYD 5FB8A 4P59H 2AI0H 4I77L 3QDGA 4BSVA 1DN0B 1GA2A 3VWJA 2OZNA 2GEQA 5J6GA 5M7QA 3B5TA 3E8UH 2OV0A 4HUUB 4TVPD 5EZJA 2O6CA 2OMUA 3NFSL 1ZT7A 1IM9D 2W94A 3WIFA 3L5HA 1IKFL 3UJTL 3KW7A 5DZPA 5JLZA 4G6AD 3R4DA 3K81A 3R7RA 5HJ3B 4QCIB 4X6DB 3L4XA 2D0HA 3WG7B 1RUKL 3JVGA 3R06A 4EVNB 1KZQA 4UTCA 2JE8A 3CSPA 3Q6GL 2AJUH 3OAWA 3LZPA 1DJIA 3KH4A 4W4OA 3IETA 3UMTA 1BF2A 4DUVA 2DYRB 4MMXA 2EYSA 4MB1A 4CW1A 4MJ6A 4IIZA 3QDJE 4KRPD 4OM0L 1KLFA 1FRGL 2ROYA 5E6YA 1AKPA 4FEIA 1DVFD 2WWOA 5E6RB 3KPPA 2HTLC 5D7LB 3ZKMD 5EBWA 3RVUC 2YGQA 2EINB 4YH6A 1FC2D 1TF4A 5GJTH 3FO1B 4YBQC 2YPLA 3NZ8B 5C3TA 2B0SH 5FYKL 3JWOH 3DURA 4XOEA 2VDPH 2WXQA 3D18B 2EDFA 1OW0C 1NCWH 2YRBA 3SE9L 3AG3B 1NCBH 5KSVA 4ANUA 2WZPD 3W3BA 1O7DE 2OK0H 3PG2A 1AJ7L 1BJ8A 1YEIL 3N42B 4BQ6A 3ZTNH 4KZEH 3S8GB 2FR4A 2AJXH 2WXOA 4WTZA 3W0WB 5EWIH 1FLTX 2HKAA 4PHZA 3RY6A 3UC0L 3QUXC 4OIFA 4M6ML 1BZOA 1AS8A 1WEJL 2XXFA 2XHNA 4IIQB 1DDHB 4HCRL 3NQKA 4MNHA 1FG2A 5KBKA 1E2VA 2XWXA 3PL6B 4ICXA 5IV2A 3WS6C 4DP7X 2Q86B 5C0BA 2QGBA 1J05B 2C9PA 3MV9A 5T8IA 3MRNB 1RZ8A 2XCMC 2XPZA 5IBUB 1GC1C 2VRQA 1F2XK 5HVWA 4P9MH 2NW3B 1G1YA 3B43A 4YGVB 1AKJA 3VSVA 3MLUL 3T6WA 3UX9B 5DEJA 4JRLA 1NUDA 1N6VA 2ZAIA 3GS0A 4FNPA 4JZNA 1ZJAA 1VEPA 3TS8A 5JW4M 1IL1A 1NLDH 1E3ZA 5CIPA 3UBFA 4NFBA 5GS2D 5I0VA 1FFNB 1V7ML 5IIEB 2F2HA 3MGTB 3H6JA 2EDRA 4R90L 2MPAL 1EEZA 2NSQA 2ZD0A 1JDCA 1G4MA 1JS4A 4MZ2A 4BFKA 2CLRB 5HYJB 2DDQH 4JFFB 5FV1L 5I30L 4PRHD 4RZCA 2ZXWB 1OAKL 4J4PC 1I9JH 2LLGA 5KW9L 2EIKB 3I50H 2XC8A 5DK0B 1M53A 3MOBL 3VXUB 3FB5B 2A4EA 2OAAA 2A73A 4K8RD 2QLVB 3CMOH 4P5MA 3MZGB 5B3JE 1VA9A 5GGTL 3WN5B 3TEWA 4MJIB 3WL9B 5HGDB 1M3IA 4X6BA 4U7SA 4FFZA 3A0OA 4ICWA 2ZSVB 2EIJB 5C8JA 1N0XH 4IYKA 1ED3B 3C6EA 3Q6FA 4IBSA 2CK2A 1TZIA 3QRBA 4P2CG 2AJYL 1MRCH 2ARJQ 5CCJA 4J1UB 4M5ZH 1RURH 2ZCKL 1MNUH 3C6LA 4AT6B 3MO1A 2EDBA 4MMZC 1AXSB 3ZZSA 1K5NA 4UOZA 2ZUSA 1NDMA 1JV5A 5BO0D 1G9MH 1OXYA 2WUCL 4XNXH 3X17A 4BZ2L 5A2AA 1U8OB 2CO6B 3O8XD 4WWPA 5L9DL 4IEFA 4JFSA 5C0CE 1I8LA 4GSUA 4RQQA 5HDWA 4DZ8A 3PGFH 5E5UB 3WKQA 1EO7A 1R24A 1A6AB 3SDXE 3WHXA 4JG5A 4QTHA 2K9UA 4H0GA 3HAEH 4NQCB 4NN6C 3S36L 4WW2A 3IDJA 3FQTA 3V8OA 3MKKA 1FO0L 5D2LF 1Q9WB 3MPCA 3VA6A 3TN0B 3MXVL 3JWNC 4O5LH 3K6DA 3I9PA 2WXNA 4DKTA 2ROXA 2VLJE 2PP7A 2GVYA 3NQIA 2VWEC 3FU7B 2ZE0A 3A4AA 4NAMA 3QXDA 2PWDA 2YBRA 4A6YH 4AYDC 1FSKC 5CGYD 1MOEA 3G08A 5DD6B 3AMKA 1MRFL 3GPEA 1SDYA 3LEXA 3QIBA 2JIXB 3NUKA 6FABL 4PJDE 1GHFL 5IKCB 4ZW5A 4QRBA 4TULH 1G7LB 3APFA 4X9HA 3AM8A 3VXOB 1BBJA 3H4FA 4AC2A 2E9WA 5IY5B 1HHGA 1G6RA 4NRZB 4MD0A 4OIAA 3U30C 2EXYC 3WUZA 2Y6SC 4Y19E 2EEFA 4KMTL 4P5TC 1CZ8H 1DSYA 5AW5B 2B4CH 2GJRA 2DQTH 4QXWA 5B1JA 3BKCL 4HUWB 3S35H 4U1JB 3GUTB 1SHXA 3VFMB 3WIIH 2EDXA 4JZOA 5I1JH 1FO0B 2GY7B 1YEHH 5C0IB 3ZO9A 5JNYB 4GBXC 5GRVL 4DGVH 4JFPB 1UOKA 3R8QA 4PP1D 3WDHA 3ARDC 4JQIH 4ODHH 4RDQG 5D1ZB 4C8XA 3HW7A 1Z9SA 2VXSL 1BVZA 5KN5A 2ZPKH 3ARFB 1RI8A 3JWNE 3ESUF 4FHJA 3VH8G 3QDJB 4HBQA 4JO2L 3IRCA 5I0XA 5K9OA 1GZHC 4FQLH 2VWEE 1TU2B 3O3BB 1XHHA 5IGXH 4GRWF 1YHPA 2HH0H 3E0GA 2VTFA 2QHLA 5D1QC 4OZFG 5H8DA 1MCOH 1JZ2A 5I2IA 1OARH 3FFCD 3X1EA 1WS7A 3OF6D 4GAAA 4HLJA 3ARRA 4BFNA 1JZ7A 1QNIA 4QPEA 1WD9A 1KYDA 3HN5A 3D50A 3KGRA 4JPWH 4I2XA 1DBMH 1IM3D 1RZIB 3HOGA 3Q8BA 4L8BB 4PTUB 4LNRB 4QT5B 3J8F7 4LCUA 1MFAL 2DQUH 4X7DC 1QKZL 3LPPA 4MBRA 1BQ5A 2FNWA 1QRNE 3L4VA 4AOFA 4BUQA 2Q2LA 1QZNA 1T1ZA 5F1OB 4FXTA 1NQBA 4PCKA 3LKSA 5H4ZA 1QWUA 3ARBC 4ZS6D 4N28A 4TUUA 1IBZA 1KOAA 2XQBH 5IFAL 3HI5L 1LHZA 1OGAD 3FUDA 1C8PA 1VADB 2AP2A 1I8KA 1BM7A 4OKVB 1QBBA 4U1SB 2W0LA 4PRNA 2K6ZA 4YOKA 1XCQA 1BVKA 5E8NB 4PY7A 5GS1C 4BJLA 1FVCB 1PF3A 2XIDA 5C09A 2C9XA 1AGCA 5INDA 4XX5A 4HETA 2X53A 3DX9A 4E41A 1JNJA 4XAWH 5BQDA 5ICYB 4JNXA 5IVOA 4QRUB 4XP6H 5TQ0L 1PD6A 3FO0L 1NLBH 2CJUL 2KYIA 1MF2H 4LDEB 3VDAA 4I0KA 3ZL2A 2P24A 2I60H 1T6VN 4N8PA 4XP1L 5ICXA 4UT7H 4RAVB 5FAAA 1GC1L 3IU3B 2VLKE 3CIAA 4O4YL 4OLVH 4Y2LA 1HZKA 3VG9C 4OF5A 5D71H 4R84A 1N26A 3D9AH 1CK0H 1E6JL 1HQ4A 3CJJA 3ZMEA 4YUEL 4I9WD 1FUNA 3DSFL 1I3GL 4O2FB 4BXSV 1A7RL 2J8UF 3UO1L 4K2UL 2MKWA 2G2RB 5EU4B 1MHEA 4L4TD 2HWZL 3KYMA 5MEND 2WXJA 5FFOA 1DSWA 1C7TA 2RFXB 4WHCA 4YFDB 5EULV 3VXRD 1AO7D 1U8IA 1UYWL 2P5WA 3LRMA 4TTDC 1ACZA 3P4MA 4FNLH 2HMID 3MYZA 3GHBL 4PBDA 2MHAB 3JV4B 4HGMA 3GM0A 1W72A 4YBHA 1V3MA 2A0LD 3L6FB 2WXHA 3QUXB 5HGAB 1AG6A 4QNPF 1IGCL 3EJZC 2HFEA 2FB4L 2V3EA 4D2NA 1KBGH 1JN6A 4L0ZA 5DGRA 4Z5RB 1IC7L 1OB0A 1CE1H 5JORB 1T4WA 2HLEB 1XSKA 4QHPA 1JPFA 2AZAA 3CLFL 3O3AA 3S3SA 3LTVA 4FCHA 2X05A 1J18A 3OD3A 1IX2A 1EFXD 1EPFA 4AGQA 2MQ0A 3UDWA 3T8XA 3NIGF 2BFVL 3MRBB 1T80A 4UZGA 4GG6E 5H94B 2NX5D 2V37A 3PE9A 1K4DA 1Z5YD 4C4KT 2OL3H 2QEJA 2Z31A 3QJRB 1TTGA 3QXVA 4QRTA 1H15A 2XRAH 3HVDA 3LZLA 3QJXA 2F54B 4X98A 3V52L 4GXUN 3V4UH 1Q0YH 3O11B 5J1SC 5C08D 4PJCA 5T5FH 5C0CB 1FGNL 1DEEB 4AVHA 2GBTA 1Q72L 3MUJA 1E9PB 1KTKE 3BVTA 4H40A 3SDXB 3N44B 2AXGA 4N6QA 4ZPVA 4R5VA 5EUOA 3TPUA 2PMZA 1Z9PA 4PGCB 4PMFA 3BRFA 3NCEB 4P06A 1IGYA 3PGCA 5CJOL 3TURA 2VLJB 5DCCA 1R0AH 1YEFL 3D2UD 2B5IC 4Y16D 1U8CA 4OT1H 5K93A 1QFWI 3OB8A 4PJ5D 2NXYC 2XLLA 3MNWA 4HUVB 3FU0A 1AIZA 3VD1A 1U92A 5GRZA 4PJDB 1Y1DA 4H25B 1QLEL 4HKBA 4DK5A 1WE5A 4MXWL 4P2OD 4U1HA 1CFQB 1YYLH 1PKOA 1YEGL 3SDAA 4NUMA 5BVJB 4OZIE 3DIDA 1CWVA 4ZX6A 3FAXA 2MMXA 4Y19B 4NNPL 4QRRE 4JQVC 2VLME 15C8H 2XXCB 4N1CA 1KBKA 5K9JH 5IBLD 3Q2VA 3ETBJ 4HC1H 1YEJL 4KPHL 4DQAA 1TPXC 2GITB 2G60L 2GSIA 2PXYC 3HR5A 2N1KA 3HZVB 4F7MB 3RL2B 2V2WB 3V5DB 3V6BR 3MTRA 1O5DT 3RWDB 1NMCC 1ZSHA 2V7NB 4DPCX 1X44A 2XQYA 2OA9A 3GXFA 4H0HB 2Y5QA 5C86A 4X7SH 1U0QA 1C5DB 3AU0A 1MLBB 4ZYKB 1CN4A 1TTAA 1WGVA 4ODUB 3O9WC 4U6HA 5JIKA 3UC2A 3IDNA 4NN6B 3KR3H 4X8JA 1KCVH 4KI1A 3FFDB 1XZWA 4OCRH 1R3IL 4S1DC 4N2CA 3VQMA 5C3LD 3DUSB 3NJLA 2GSGB 4P3CL 1VACB 2H32H 5IJVB 1MUJA 4QRQA 3CN4A 1U8JA 1SM3H 2DL9A 2GCYA 3V0VB 1I8AA 3DMMA 3KBHE 4Y4KA 3ZTCC 1JERA 3WD5H 4IRZH 2L4OA 3DXAA 2JELL 4XB8A 3SKNB 3U2SA 3DETC 4NQDE 3I6GB 1Z6JT 2K4AA 2YD0A 1FNEA 2FYYB 3OJ2C 4YHLH 1OAUH 2EAEA 3C5JA 5CN1A 1AQDB 4XWOD 1F90H 2IFFL 3GMOA 2DQFA 4NRYB 3V0HA 5J6HA 5JZ7D 3MV7D 5GRVK 4BA8A 1FPTL 2QJDA 2CXGA 1BPLB 4G2AA 2COVD 3LZOA 2MOGA 3FBQA 5L2KE 5BCAA 2NLJA 3U30B 4JJHA 4L4VD 4JN1L 4G80B 3HG1A 2EKSB 1XXDC 1QRNB 3QJHB 2L7JA 3ULVF 2AF2A 1ZV9A 4JGNA 3QO1A 1QSVA 4F15C 3ZKND 5FX3A 1R4XA 2PR4H 4N0CD 2V4LA 3NH7H 1TEYA 2DIAA 4GSXA 3L3DB 4DP9X 2HYMA 2F68X 1OAXH 3SOBH 3K6SB 4JM4L 2GTZB 3QPKA 1AP2A 4PS4L 1TLKA 2AJZB 1WBYB 2QR0A 4S0SD 5CN3A 2CO4A 2VITA 2R56H 2FO4A 2XV3A 5AZEH 4EDWH 1NBVL 5J89A 3OM3B 1T2QL 2ZXQA 1LO0L 3OJMB 4DVBB 1Q8MA 3QYMA 3A47A 1U8HB 1UEMA 2BMKB 2HLAB 2CA3A 1XGTA 3ILEA 3VD7A 2BRQA 2PO6D 4ODXB 1ETZA 1NCCL 2V0AA 3BP7B 3QJQB 3MRQB 2C3HA 1CICC 3O2WH 4ZS7L 2Y3NA 3IJ9A 3KCPA 1MJUH 2H2SC 4XVJL 3SY0B 4AJVA 4HS3B 3TCTA 2ZP0T 2VLKB 1LD9B 1YN7A 1DVZA 1N5AA 3NRPA 2FZ3A 4I0PD 1DTUA 2HPTA 4UQBA 3LN4A 3UYPB 1REIA 2CIKA 2W60B 2HVKB 4XHJC 1LWJA 1NEZG 5IMOA 4YPGA 5JA8B 1QA9B 5J1AA 5SX4H 4JG0H 2YXWA 3TFKC 4F7PB 5JR1L 1RJZB 2XI9A 1JI1A 4DFHA 4O51B 2PPEA 2Q87A 5B3SB 1JMZA 5CO1A 1BQSA 1FNGA 4UQ3B 5CWSA 2ZX6A 2R9HD 1AHMA 2FJHB 3VFSA 2WTPA 1NKGA 4C56E 1P6WA 1C12A 3ARBB 3P11L 5KG9A 2D7TH 5I28A 3BXNB 3IJYB 1AHWA 2ZX7A 3UGXA 1VZHA 4WUKL 5TFSL 3RJDA 3TIEA 1UEYA 3UTSD 1FZJA 4LP5A 1K85A 1V55B 4PTTB 5DFVC 4Y9CA 5FYKU 2N56A 5HGHB 1I1AA 2RH0A 4J3OF 4JO1H 4BINA 2ITDA 2IFGA 2XSKA 4PJ7A 2ALWA 3SE6A 2W0FA 1CC3A 2MIZA 2X1PA 3KLKA 3EO0B 3P30L 2R7EB 4W4NA 1JPTL 2GTWB 4FMVA 4GG6B 4GIAA 5C0FB 2E4TA 4Y1AA 2J5LB 4M1DL 1AAJA 1HH6B 3O6KH 4IRSA 5FFLA 4DTGH 4NAQA 4AMWA 4KDTA 1KGUA 3F7KA 3BVUA 3VTTA 2D4FA 4J6RL 3F04A 3HZYA 2QSCH 1MI5D 3QEQA 4LCCC 1YDPB 4YDKH 2PYEE 1IGJB 1Y18A 2AAAA 3NG5A 4LLAA 4PJ9A 4X4XB 3RILA 3ZJAA 2K4WA 3US1A 4YAQA 4HDIB 2H3KA 4TNWF 4PR5B 4OZGA 4JO5A 1XO8A 4G43A 1I7RA 3D85B 3MUZ1 3GM8A 2E0PA 3P0YH 2W65A 1TJGL 3WFCH 3WTWA 3FU6A 3ESVF 2VZ3A 1KJVB 2P8MB 2VQUA 1CL7L 1XB6A 3AACA 2VDOL 5AOKA 4Z3GA 2CR6A 4Z3TA 4HCRA 2MPVA 2E47A 2JB6A 5J56B 2F9BT 3Q8FA 4Z7NF 4OCMC 2Q9OA 3ZGHA 4F2MA 3QQNA 3A24A 4K3HA 2VISA 3MJ7B 4D0DB 3QUMA 4TLUA 1BAFL 1YN6A 1XDTT 5I15H 3KPSE 4HPOL 3IPFA 3OZKA 1R5WB 1WH0A 4OZIB 1UM4L 4TKWA 5JIHA 5EBMA 1T0NA 1I9IL 2AQ2A 2FUTA 1QO3B 4M7JH 3EYOA 4OLEA 3EBGA 1ZIBA 4U6VL 1CTMA 3TVMA 4GINA 4QRRB 1NAMH 3QFDB 5D7LD 4E2OA 2X0UA 1ZSDA 5ILTL 4XNZB 5E2JA 5DHVB 3RVWD 3VSUA 1X5YA 4FLHA 1TTRA 4AYFA 5MEPA 1FFPA 4JFQA 1QRKA 3CVHL 3CHPA 5TH2A 3PREA 1BIIB 3MV8A 1WZKA 4S1RL 2ZUVA 1U95A 4YNYA 3UCQA 2QGEA 1J9SA 5AW7B 3UOAB 1F13A 1BD2D 4WO4A 3AQZA 3LEYL 2KMWA 2H0FA 3EW3B 4MNQE 4K7PX 3H7BA 3W0WD 2VDOB 2OMZA 1EO8L 3K6IA 1OE1A 2X2YA 2OSLA 2A77L 1L6XA 4AM0Q 1N7ML 3VQ2C 4U7KA 3VMPA 2UY7B 3L7EA 1XF2B 5DYOB 4M1CC 1PLCA 4MZRA 2NNAA 1DANT 1T89A 4R96B 5DQ9A 1IBGL 2WKOF 5CEYA 2B5IB 2E27L 4LHUA 4X80L 3L3IB 4NQDB 2O1AA 4O02H 2MFNA 1IBDA 4WZ9A 1LTXA 2NXYB 1J11A 2ZCHH 3VQ1C 4OCXL 2F58L 3B56A 4NQSA 4O58L 5AW3B 4OCYH 3BDXA 1T0MA 1AI1H 3IRZA 4ODTH 5I76A 1CBVL 2FWOA 4X4ZA 5L2KB 2Y4SA 5I73B 3BP6B 3F7QA 3QIWC 5FYKD 3NJNA 4LL9A 5SV3A 1FYTE 2B9BA 5AKVA 2PW1B 2NMSA 3CVHB 5IF0A 4ZFGH 5SX5K 4AG4H 1FJ1B 1P9MA 2TSAA 2WGXA 3SQOH 5BUGA 5IEHA 5FM5O 3CCHB 1E4KC 1ZAGA 4HEMA 4QWWD 3CC5A 4BZ2A 4GY4A 5DRNB 1RY7B 1TPXB 2B20A 2PXYB 4JFFD 4MA8H 1F4XH 3UBXA 3AAZA 4G5AA 4JHWL 5E24E 1NMCB 1LVEA 3BPCA 4HKJA 1I3RA 1ZK5A 2UUDK 2EDOA 4YHOH 3VXUD 1JWSB 1I8UA 1TETH 1PJWA 3ISRA 4FG6D 5CLWA 1N5YL 1RZJC 1URLA 2ZF8A 2E7CA 3EYFA 3O9WB 1QFHA 4OUUA 3MJ9H 2ZUWA 3LS4L 4F33A 1YEWA 4GO8A 4OJDH 1NUGA 3SKOA 1WPCA 1KJMB 2HFFB 4BGDA 1S7RA 3LN9A 1CF8L 4G8GA 3LQAL 2PN5A 3T3PF 5HVFB 4N1EA 2IPKB 3FYIB 3ML9A 3WFZA 3AMLA 3HC4H 4Y9GA 2CDEA 5JHDE 1BF8A 5IVZB 2CU9A 1XF4B 3U0WL 3VI4E 3ZKSD 4LEEA 3B9VA 1X5ZA 2OMVA 3P9LA 2TRHA 2FGWH 1I31A 2YS4A 3Q3GB 2DKUA 5TE6L 4X4YB 4XP5L 5I17A 4A7TA 2K7PA 1A7OL 3UAJC 2Z7WA 4OGQC 2N7BA 2H47C 2DLIA 5CBEA 1NIBA 5G4OA 2HPOA 2DYPA 4EQ2A 1EJ6A 2WXRA 4J3SA 4YK4B 1EGJL 1WA0X 4NENA 2EP6A 2YSTA 3US9A 4XAKE 4HIJB 1BWWA 2RCSH 4OZ4B 2BZCA 2IGLA 4F15B 3ZDYE 4C56B 4F8QA 2NY3C 5AVQB 4RFEA 2AQPA 4P23C 2YD4A 5E94A 2VDQH 4LSUH 4S1SL 3IJHA 3TN0D 1CXEA 1JFQH 3QQDA 5CNHA 1ILUA 1KNOA 5L6YL 4BV1A 2W91A 4J3VA 2VXTH 4XVUC 5L88L 2L3BA 4X9IA 1EQWA 4LASH 4NKDB 3D1MC 3GI9H 3PDOA 4KZDL 1EJOL 3IKCB 4KJYB 5DR5H 1ZKAA 3PWLA 1XH2A 4UTBA 1F11A 3DVNB 2NY0C 3JV6A 3Q8EA 2JIXD 3MREB 1MCFA 1A1OA 4OFDA 3WNIA 4FQIH 1FA4A 1O0VA 4RWYH 5E8DL 4UT9L 4ZW3A 1VEOA 4PJIA 4FLOA 1TTFA 3D06A 4TF4A 4ZMLA 1QLRA 3WCYA 2V7HB 1ZTXH 1F4AA 2W95A 4X5XB 1E7UA 1HL8A 2JKRM 5DJDB 1TJHL 3FAWA 3QZWG 4FKHA 2BWIA 3GSVB 2D9CA 5IJKA 2UVFA 1AGFA 1NWPA 2BY0A 5FHAL 4Y2OB 3VVWA 3BGMA 3TF7C 1G5AA 1JWMB 1U3HB 3VRJB 1E4WH 3OR7A 1UJTA 3B9KB 1OW0A 3S5LA 1VFUA 4NO0A 1XX9C 5FHBH 4M43L 1FV1A 4F20A 2C9RA 4DPRA 1GAFH 2A74C 5DWUH 5EU6A 5AD0B 4Q0XL 2F18A 3KPSB 5D1ZD 3C08L 1Q90A 1BZEA 4H1LG 1T66C 5E2VH 3ARFD 2V9UA 5ICZB 3WTXA 5LNGA 2VO5A 1N19A 1P4BH 3QDJD 4BSWA 4DP8X 2ZG1A 3T9WA 1KSRA 3MCKB 2WNKA 2NUPB 1MCJA 4BQCA 3WS6A 4Y8DC 3N9GL 5JXEC 1MIMH 1QR1A 1NL0H 1ZDSA 2AZUA 4A2FA 2AV7B 4YSTA 2DQIL 2QQLL 4ZMAT 4RDQF 3G7TA 1CFBA 2C26A 1LEIB 4PM1A 2AJ3B 4ZX4A 3U7AA 3DVFA 1J0ZA 2R2CA 2APSA 4ODSH 3TF4A 2BIIA 4G3YH 2BO0A 1VB9A 1SY6H 2AABL 3MGAA 4LCCB 4Q2ZA 1MNNA 5F89B 2VE6B 3RGVD 4RIRA 4HIIA 5DMKA 5KVEH 2Y6TE 3DGGA 4MNQB 3OR6B 2R23B 1IEAA 3CFBB 3QUYC 3VO0A 4KJWC 2ZP8A 3BVNA 3CSGA 1IAKB 5FUCC 1R17A 3QQ4A 3C60C 1S3KH 1EAPB 4ZMPA 1WZ1L 1GTFA 4R7NB 4NB7A 4Z7QF 4G6KL 3VXPA 4YX2L 4QAMB 3VD4A 3QWOB 1YRKA 4NO3A 1HT6A 4Z6AT 1F3JB 1DJYA 3I9IA 3GMRB 3K2KA 1QBLL 2ARJB 3HFMH 5I1LB 1INDL 2DM7A 3TO4D 5IG7A 5DU7A 3SGEI 1K2DB 1KG0B 5DUPH 3TBYA 1ADQL 3D3VA 1FYTB 1U2YA 2Y23A 5TK4A 2IAMC 2UZIH 3P4OB 3Q9PA 5IWLC 5AAMC 3HI1A 3N6YA 4MQTB 3ZR5A 4P49A 3RVUD 1RVFL 4X4ME 2DQEL 1N64H 1E65A 5F3HA 2EEBA 4WTZG 5JQ6L 2WXMA 1F4WH 4QXTA 3CH1B 4S11A 4C4UA 5DJ6A 3LNGA 4FQQB 1N2RB 4XPFH 3ZUNC 2XJKA 1ZHLA 5I82A 3D0VB 2HLFD 5LCVL 5I1CL 1AVAA 2BK8A 5BO1H 3DK2A 2CMRH 3IDIA 4K94C 2I07A 1MLCB 3IXTA 1ZGLB 3HHRB 4K3DH 4GJTB 5LAPA 3CPUA 2J2ZB 4Y2DA 3TT3H 1T4KB 2H8PA 3BP4A 3NJHA 2Z9TA 4HJGB 1VPOL 1U3JA 3PWUB 5HGBB 3CBJB 4JDEB 1DBKH 2ITEA 4GQRA 1M9SA 4OGXH 2DWDB 1F8TH 1XSJA 1I7ZB 1RZJL 2DWEA 4V33A 1PG7H 3H2PA 4FFTA 1MELA 1XR9B 1NM9A 4HJ0C 5MEOB 1MJ7H 2ZWNA 4LEOA 2JSFA 3LMJL 3VI4B 1H6FA 4D8PB 4FP8H 1OIOA 1DO5A 1P1ZB 3KAAA 4QHNB 4E0RB 2IADA 4AC4A 1CBJA 3GSNH 1UH4A 1OAQH 3PJNA 4CMMA 3J07A 5CEZE 4ZUUB 1U93A 1KUMA 2HT2C 2Z8SA 3SPHA 2FTAA 3UZEA 4TV3A 2OYPA 3WMSA 2CHNA 2F54D 3OJDA 5D2LE 2W81C 4ODVL 5A2FA 5AVWB 5LGJA 1RJLB 2FEDD 1R3LA 2A5UA 4U1IB 4CSTA 1ZGLM 1F41A 3EJPA 2YOCA 3DHJA 4UUJA 1YMHB 1L9NA 1AGBB 5E2TL 5CJQL 3ZDYB 1EWHA 1KB3A 1TUPA 4OUOA 4OFIA 4P5TA 2V2XB 3NRFA 4RETB 5G4MA 2CBTA 3KM2A 4LBAA 1FQ9C 4J4PD 4C4KO 2OYLA 4IRJC 5MERB 2VZVA 2X9YA 3UTTE 5ID1B 3T4AC 1P2CA 1TQVA 4LGRB 5B22A 1KTDB 4MDJB 4FA8A 5J0BA 3VMOA 2EO1A 4L3EA 4RGNE 3FSVA 2VLJD 2B39A 3F2LA 4LQ1A 1YA5A 1QSEE 4GBXA 1V7NL 5DD5H 1M2VA 5E8OB 3GKWH 3PXJA 3FMGH 1HHJA 4D94A 2FO1A 3NCFB 3WNOA 5BS0A 1WG3A 2QPFA 2I9LB 3SDCA 5ALBH 5F9AC 2Y7QA 4ZTOL 2GJ6E 2WINA 1BFVL 5LGYA 4QHKJ 1IMHC 4ZQKA 2ZOTA 3F64A 3MLRL 4FLQA 3PWNA 4HX1B 2CLZB 5LKNA 4ETQB 1DSFH 3AABA 2ESVA 4FULA 5D1QA 5LAXB 5B8CA 3UJIH 5KSAB 4JM0A 4OV5B 1AQ8A 3CGTA 3OAZK 3C12A 4RBPK 2E6PA 3MACH 3T2PA 1J8HA 3TM6A 4DKEL 4IBZA 2IQ9L 4OJAA 3FRUB 4HLZG 2NY6B 4UB0L 3NCYP 4YR6A 1P7KB 4JRXD 4KQ4H 3KLDA 3DX6A 4XNQB 4A7GF 1X5GA 3IDXH 1A3LL 3FONA 4WFHE 3QYNA 1JRHI 1OSPH 2BVEA 4XWGH 5IMMA 1Y0LA 4Z95L 4PP2B 4GKOA 4NAJA 1KJ3L 2O5YH 2QVTA 4GRWE 1WAPA 4XTRC 4P23B 4DOHE 2BHZA 4K23L 3WE1A 5I0WA 4PGJA 4RAUA 1JYVA 1YUHB 3B3BA 3GI8H 5F7DA 2GIXA 1ADWA 4A2EA 5DUBB 4PI2A 2DTML 3WO3B 1Z3RA 3B8SA 4LCIL 3H1ZA 5GS1A 1UENA 1OAYH 4QJ4B 4HPYH 1QHQA 3ARQA 3FO9B 3MUY1 3K6FA 1UWXK 3RPKA 2JI3A 2CO2A 2NY0B 4GO9A 3CZFB 1IM9A 1TYJA 1S9YB 3FRPA 3H4HA 3K5RA 4QXUL 4PH8A 2HG5B 4BWWA 4IBTA 1RIUL 1LO3L 2OJEA 2WO4A 2C9VA 1INQA 3LZQA 4PS7A 3O3EB 3BUQA 4TQ8A 3T65B 4NOFA 1SF5A 1RZPA 2OX5A 4P8QA 4CN4A 2YEZA 4CVZA 1CD1B 1QRND 1AR2A 2F5BL 5IFHL 1QFOA 3GBEA 1TJIH 2VM3A 2VLRE 5LG1A 4A66A 3GIZL 4YDNA 4OI9A 1MEXH 2QFPA 4JHAH 4ANXA 5IHWA 4PGDB 1FBIH 3QPQD 1QHOA 3N85L 4LP4A 4E5XA 3H53A 1AY1L 3KBEA 4UINL 3LH8A 4ONGH 1KB5A 4YMPA 4JHUA 4N2FA 4H1LH 4IKIA 1G7PA 3RVXC 1H5BA 3C5SB 4CA4A 3INOA 5ADPH 1NCDL 1WAAA 3H55A 4KNTA 3WNLA 3ROOB 3IEAA 3BZDA 4IHOB 3DHPA 4ZW7A 3M1CA 2YUVA 4KKQA 5D2NC 1AZRA 2E9BA 4OH2A 2A74B 4BRJA 3X3FH 5K59F 5GIRA 1IVTA 1JPEA 4P2YA 3QXTA 4Z7UA 2J8UE 1ASQA 4X6CA 1HYSC 4M5SA 1AS6A 3R18A 3ZT6A 2VLKD 5HI3C 1RH8A 4AV5A 4I1PA 3CPLA 5FO2A 3RYMA 5IESL 1AOZA 2XY1A 1G84A 2ICWA 1BX2B 1UKQA 3FN3A 5LB1A 3UH8A 2W9EL 4ZOCA 5CEZL 3ZR6A 4YSUA 1A6VL 3FH7A 5F88B 1GYWA 3FW6A 3K6OA 4PBXA 3O4LD 5KVFE 1A66A 3TV8A 3JWOC 1I7TA 1PX3A 4XOAA 1B4TA 3TOPA 4U1LA 4QNPE 4A2DA 1GSKA 2D3VA 3E9TA 5GSRA 1MHHB 1AR1C 1XGZA 2BSTA 1CLOH 4JDVA 1UWGL 5DD3H 5MHSE 1NOLA 3RU8L 1PQZB 1WVZA 2Q76A 1MH5A 1XF3B 4N2DA 4XCCL 5EPMB 3CXDH 3LIUA 1EZVY 2OMWA 4LSTH 4ZNCD 4E9XA 1ZLWK 3TCLB 4UDUA 3NIGE 3QUYB 3LRKA 1N6UA 4CADB 1ZHBA 1L9OA 3FCTA 4MJ5A 3UBHA 3CQQA 3FQRA 2QADD 4J23A 4F9LA 1M6OB 4K94L 3FHQA 1U6AL 3BUPA 4WENB 3OX8A 2FT7A 5E9AA 3MLYL 3ZPDA 1Z3GH 4OCSL 4RSVA 5I19H 2A6IB 2R2BB 2Y7OA 1R3HB 5D2NE 5LDSA 1J0IA 1HH9A 1MIEL 2F53E 3BEVA 3GSWB 2FQGA 4DT2A 5I1HH 3W11D 2FD6H 4HWEL 3UTZA 4PRHA 3O4OC 5CILL 5JHLL 5ADOH 2F74A 4N2EA 3B2XA 4NUGH 3JTTB 5D2LB 5H35B 2QVKA 2FJSA 1O6SA 2Y1ZA 2IAMB 3BHBB 5DJ2B 4BKLA 3ZSSA 4OLUH 1JVKA 4PVLA 2IGFH 2R8SH 1A7NH 5A6MA 4FABH 1EXGA 2AJVH 1S5HA 5CR8A 1R9FA 1QI4A 4MD4A 3GNML 3ULUH 1ONQA 1ID2A 4CSZA 4RMQA 2Y7SA 3V7MA 1B3IA 1P7QB 3LPWA 4FX5A 4FFWC 1KBBA 3IDYC 3UTTB 5IQMA 3O6LL 3D85D 1ZLVK 3ZDZF 4FF9A 1I9RH 1LWHA 3QZNA 3ABLB 5KBNC 4RGNB 3RNKA 1RUML 3PUCA 1XD1A 1QSEB 4B5EA 3N0AA 3FQUA 4FG2A 3U7WH 3EJZD 3OKLA 3ULVC 1QNZH 1JV2B 4L3CB 4M61B 1D5ZB 3CFJB 1PZ3A 1UXLA 2UZPA 5C0AB 2HRPH 2WTOA 3ZQ9A 2ADIB 4RRPA 5CHNA 3O8XA 2E7BA 3BUBA 1RIHH 4X42A 4B6ZA 1ZT1A 5J13B 4D3CH 2O5XL 3NA9H 35C8H 4QRRD 3LCYA 1AANA 2VLMD 5B7MA 4Y0GA 3FT3B 1D5IL 1TVHA 1OQXA 1CTOA 1CFTA 3W81A 4UANA 3B2VL 1G9MC 1T21A 2XN9E 5EIIA 4EIUA 8FABB 4RFOH 4TOYL 1J1XL 2LW3A 1AMXA 1T7XA 3LN5B 1A9BB 4FHKA 4AIEA 3U4EB 3W9EB 2X4TA 3BMWA 4P5RA 5K9KB 1EEYB 4FFZH 3SBRA 1M56B 4GRWB 4ZTPL 1RULL 1UD5A 4IK6A 1XAKA 4DOHB 5I23A 4GW1A 4Y89A 4F7CA 1ET5A 1RFDL 2P48B 3BSGA 1IC5L 3EJRA 4G6JH 4BYHA 3R0NA 1RUPH 4ZMNA 3HN3A 1ODUA 1B9ZA 4TLKA 2X4QB 2P52A 3ZT7A 3WBDA 4YSSA 5GGVY 4WV1C 4MDIB 4NQDD 4WNSA 1NC4B 5GZOD 5F9JB 2NXYD 3GIVA 4JLRA 4Z76A 1N3NB 3X3GH 5HHQA 3WJLA 3ULVE 1DL7L 3F5WA 1YNLL 1IC1A 3HHSB 4CSSA 1CICA 1BEXA 1QFUH 2MNUA 5J06A 3STLA 2X4SA 2ZCZA 3QS3A 4ZSOE 2OW6A 4EI5C 5L2KD 1DLHB 4OKDA 4UCFA 2G75A 1Z2KA 2YSSB 5C0RL 5KVFL 5EZOH 4J3OC 3AB0C 4MZIA 3ESOA 4W9DC 4X4KA 4UV7H 2FDBP 3H8NA 4YDLC 5DVOA 2B4CC 5F0LB 3KD4A 1PD1A 2A4ZA 3DV4B 2VR4A 2VLRB 5HHVL 2WLZA 4GMSH 4RMBA 4U6YB 2PXYD 5DSCA 3UACA 3IVKB 2UYLA 3E8UL 2G5RA 4JBSA 4KITB 4LZKA 5BZZA 3SE4C 1SYVA 1KJ2H 2XKNB 1LO2H 1TEFA 3BN9D 4AY0A 3SE3C 4E42A 5B39B 2PCPB 3N40P 5DEGA 2MCAA 5CCKL 5I6NA 3APMA 2QT6A 3O9WD 4JHVA 1MVUA 3HS0A 3FFCA 2XIIA 1G6RH 1B6UA 5KVGE 2Z0BA 1SPDA 2AVFA 5JPMB 3SGKA 2F6AA 1HKFA 3ORJA 4L3AA 2IGTA 2J8UB 2AJUL 2ZWYA 2Q7YA 3G6JF 3I3DA 4GLRH 5DUMH 3ZY7A 3II1A 1F86A 2GFBB 1W15A 4XC1H 3GT6A 3SGDH 4LVNC 4R4FH 4AMKH 3KWXA 4ZUWB 3MCG1 2D31B 4N8CH 3FOMB 4BE6A 3THMH 4HPHA 2VW7A 3J27A 3PAVA 1SOQA 4RDBA 3QISA 2N7SA 3O3DB 3SODB 5T3XE 3V4VA 1JZ4A 3D39E 1OGAA 1YQVL 2I69A 1M4KA 4JE4B 1E5ZA 5GJTL 5IB4B 4XXDB 7FABL 4NNXB 2VUYA 2B0SL 2P7TB 3M88A 5AZ2H 3JWOL 5ERWB 3HIZA 5IJCC 2VDPL 5HYQB 2OMYA 1NCWL 3BJLA 3D69B 1NCBL 1KFGA 5FO9A 3LOWA 4P57B 4YSEA 1I1YA 1TCRA 1IGMH 3NIGB 4YGAB 4KZEL 5DJZB 4FZ8L 5DTFA 3TH3T 4DW2H 1J1OL 1TNMA 4LDOB 3QNYA 1PNDA 1IFRA 4EN2A 5C2BH 3S34H 2YN3A 3LRHA 5EC2A 4XMZA 5D2NB 2AQQA 3B2PA 2F53B 1YPZF 4JRYE 4PJEF 3EDFA 2HRHA 3IDMA 4TM9A 1RZ7L 3QRGH 1AIFA 5IQ9B 3BPNB 4P9ML 2HCZX 1M7DB 1NIFA 3PAYA 4L4TA 4L9LC 5D1ZI 2O26U 5IB5B 1EHLL 5MENA 4KXZI 3CLEL 2O61B 4H5SA 4KZCA 3VXRA 5CBAB 3TO2B 2OYMA 2Y0SA 4MA3A 1JL8A 3HEIB 4AXWA 3CV5A 4Z8FL 5DS8B 3GSXB 1NLDL 2K70A 1ZVHA 2NYYC 3RPBA 1OM9A 1X4XA 3LB6C 4YLCA 2VDPB 1KCUL 4Z7NE 1A02N 1CS6A 3FUHA 4FL4C 4QF1B 3PYCA 3FH5A 1CGXA 3WENA 1DBJH 1YECL 1AR1B 1U3HD 1ZT4A 4AM0B 1ZTMA 1W80A 4QRAA 3C5ZD 4EDXA 2DDQL 3B9KD 4Z0BH 5KYYA 4YVNA 3OB0H 5D70L 1SF3A 4TSBH 1GGUA 2I9TB 1F42A 2C1PA 4XMLL 1EFXA 1LMIA 3MRLB 3BRGC 4JJ5A 5DHYA 1GYUA 5CZVH 1R75A 4OFVA 5HHPB 3CMOL 3EOAA 3KPSD 4UNVA 4FNSA 5DFVD 1WZLA 3CXHJ 4QO1A 1W0VB 1AG0A 4IDJL 4M4RA 4IGBC 2MQGA 4FLSA 2JI1A 3BIKA 1JNLH 2WW8A 2WLLA 4W9FC 3ULVL 3FCSB 4LKXB 3X14A 3ZL1A 1OF2A 1LEKB 5EOQH 5JQIB 1SQMA 4HS8H 4ZAKC 5B1CA 3O4OB 5IQ7H 1MY7A 3U82B 1KIPA 5ACZB 2XN9B 4M5ZL 1DQLH 4UTAA 4XCNB 4EE2A 5J11C 3KLQA 4FLRA 5KSUA 3E7JA 4U0QB 1SN5A 1X5JA 5FYJH 3QIWA 2CJTA 2WPGA 4N25A 3B2UD 3JUYA 3MXWH 4JPKH 4AQ1C 2EUWA 1L3WA 1W16A 1G9ML 4XNXL 5B1KA 1MCNA 3D2TA 4MNQD 2Z4QB 1ESOA 1BQHB 1E4KA 5KBMA 4EPSA 1DLFH 3CFMA 2VZUA 2CUAA 2VZOA 4L8DA 4GPVA 5IW3A 3IDYB 4P2OA 1Z7JA 3EO9L 3H9SE 3L9BA 3BRDA 3REVB 4Q6IA 3T0EC 2B7DT 4ORGB 1BYNA 4HLEA 1OCOB 3FYEB 1S8DB 3ZXAC 1BF5A 3FHAA 1IAOB 1GY1A 3D4GA 5KVGL 2J6EH 2UXFA 3BH8B 3LKPB 3G04B 2VJ8A 4X7TA 3LIZL 4JVWA 4PWFA 4XO9A 3VRLF 4RLDA 1T1YA 5FUZL 4X9GA 4F8TA 2Z92B 1NFAA 5HGGS 3NSXA 4ZSOB 4UI2A 1QLFA 4OJEH 2VC2L 3QEGH 3STZB 1TYEB 12E8H 4B7LA 2VXQA 3GZOA 4IW4C 1FYTD 1HWGB 4TULL 2IANA 1JZEA 3NJJA 5I16B 3EKCA 2V17L 5T3XL 2W1NA 3WHE1 4Z1PA 2FQDA 4M7ZC 3T6XA 1CFNA 1D2OA 4PB9L 3A67L 4IS6B 1QQDB 3ES6A 4LFHG 2NR6D 3OMIB 1WHPA 1CZ8L 1FL6A 4UM8B 2B4CL 1MZYA 2DQTL 3T3PE 4I48A 1MFBL 3S37X 3CHXA 3T6VA 3S35L 3SPJA 1RXLA 3GLAA 4K3GA 4QRSB 2PYFB 3HAEB 1J48A 1H3XA 4LMQE 5I66B 4LHUG 1A6UL 3A6CH 3F6JA 4CVXA 1O5PA 2Y06H 1HDMB 1RV6X 2BC4A 3MRMB 4Y5VB 3AT8A 1T7VA 2IDSA 3TBCA 5HHNA 2ZG2A 1Z9NA 3AY2A 4WV1B 4OJFL 1RPQA 2VC2B 43CAA 1W0WB 4MRBA 5SWSE 2IV8A 1P4IH 3KPLB 4JFED 1WC7B 2VERN 1X5KA 4JHBA 3IE9A 3QW9A 3FUFA 3D39B 5E08H 1MCOL 4FQ2H 3D8MA 1OCRB 1UB6B 2L04A 1HI6B 5CINH 2HKFH 3UBXG 3SJVE 2YXVA 4PREB 5DVLA 1WITA 4YDLB 4E36A 3HE6D 2G2PA 4ZNEA 4WQOA 2ITCA 1UB5B 3BKYH 3CX5K 2PO6A 4OCWL 1CTNA 4YEEA 3FOLA 4NO5A 5ISZE 2DQUL 2WXGA 3KYAA 1KWKA 4JMNA 5AFAA 1JK8B 2R1WA 1I85C 1ND0A 2WP3T 4OF7A 3IF1B 1B4LA 3TYGL 1BVLA 3FXIC 3FN9A 4I0PA 2V9RA 2XQBL 1F6AB 4Z3JA 2FECL 2F1AA 1HSAB 1NFDA 4JRYB 3DTXA 4G7SB 3SKUD 1XV8A 5DRZB 1WV7T 5LXGL 2EIMB 5DZAA 3ASNB 1MWAA 2GQHA 3JTSA 3ISYA 4RA0C 4L29B 2JXMA 4RCAA 1OD7A 4XP6L 1UQSB 3D4ZA 3K5SA 5GRXG 1MCCA 1KN4H 3BPOC 4XN7A 4W9HC 2X3CA 5I6MA 2F19H 2B3RA 1C8QA 4BHUA 4OLVL 4UU9A 1HSBA 3T2NL 2XZQH 1BCIA 5KSAD 4Z7NB 3WDIA 1KLUA 1BFOB 4HSAC 3QNXA 4W9GC 3BLBA 3UAJD 1TQBB 4QJ3B 4J6IA 3D9AL 4NSKA 1L3NA 3GJEB 2I7OA 1NCJA 2W07B 4IKKA 3GMMB 3WS3A 1T04B 1FG9C 3OKDA 4R7DA 2NY6D 1ORQB 4RISH 2WZ0A 4QKXB 4EIZC 3IDGA 1X7SA 2UWEA 3BZFB 3MRJB 4XNBA 3HG4A 4GB9A 2B1AL 4B9CA 4XVOA 5C0DA 1Q9KA 1BYOA 1UWEH 3QG7H 4R0LC 3FQWA 4P23D 4HWBA 2D8KA 4CNIB 4JPQA 4WW2F 2QELA 1T20A 1HWWA 2WYTA 4HBCH 4DO4A 2EYRA 1XMWA 1E5UI 1ORSB 3C60A 3MQIA 1KYUA 1VJSA 3B7RL 5JMRA 1MI5A 3QJFA 3WAKA 5GRUH 5E8EA 1BOGB 2QVFB 4KKZA 5KYXB 4WKZA 1JCKA 1AZNA 1IKOP 4ADIA 3P3TA 3VYPA 4N5EC 3TNNA 4KK8D 1E9QA 2NRDA 2WIIB 3D0LA 4L9LB 1JGIA 2WAQA 4JFOB 5FKAA 5BRZA 3RIAF 4YE0A 3TA3B 5EU7C 2OFQA 4Y5YC 2OL3L 1IILE 5HJ3A 1KIQA 1MCPH 4A7UA 5IK3B 1UCBL 1OKEA 3UJJL 3AW5A 4MZ3A 5AAMA 4Z7QE 3V4UL 3DO4A 3NYKA 3W2DH 1DCEA 1CURA 4AGLA 1MXGA 3RRQA 3B7SA 3SYPA 3CSYA 4HUMB 1JHTA 3FBKA 4FL4B 1BSIA 5CKAA 1UM6H 1HWHB 5DYFA 3CNKA 1JP5A 3HS8A 4NBZB 5F1NA 4JKNA 3H9SB 4WI0B 5L8KB 2OSWA 2UXGA 1HXMB 3G5VA 3VJ6A 3U9UB 4QIRA 3BWUF 1PIFA 4RESB 1BQLH 3PP4H 1AGDB 2XZCL 4RGMC 1DP0A 1T83C 1ZVSA 2WNGA 5EOTB 2VW4A 3BSZH 3HE7A 1S7UB 3MA9H 3ROLB 3N5AA 4OFKA 2GHZA 3NZ8A 5DF0A 5CZRA 3RKDD 4L8CB 1ETA1 4G9FD 1ILSA 2OBGA 4J28A 2FUQA 1M7UA 3PDGA 4IGBB 2PPAA 1FAIH 2BS71 5JXED 1YYLL 5LLIC 1BD2A 4KVNL 3K0YA 2OL3B 5CP7B 2A6DB 2A9NH 4ZAKB 4OBSA 5I0ZA 3GMNB 4LVOC 4K9EH 1DBAH 4XP4L 2HFGH 3A4DA 4QUOA 5KEZA 2O4EA 4NZDA 1SJMA 3BKJL 1LO5A 1BPVA 3LKOA 3EAKA 3GMPA 5JDSA 5J11B 4YL9A 1IQWL 1JZJA 3T3PB 2JKTM 1URZA 4HC1L 5CGMA 1DE4B 1KCSL 3L2MA 3BGFC 2FJFB 4AQ1B 3CXHK 4YDJA 3ZIYA 3FU5A 5D5MA 1KEGH 3T8MA 1KTCA 2VCOA 3PV6A 2RQEA 4PUBH 3I3BA 3ECWA 2VJXA 5DRXA 1CO1A 4X7SL 1PCSA 5DC0A 3QUYD 4ONHB 2Z4TA 3S4SB 1KTRL 2Z35A 1AGEB 5I1GH 3VFVA 2VH5H 4IRJA 4N9GA 3MUGB 2XV0A 1T5WB 3L3KA 1INEH 3T4AA 5C6TL 1WBXB 3TZVC 1KLGB 2A6JA 4QHUB 1AS7A 2MNJB 1SM3L 4A2MA 2G3NA 5E1AA 3PWVA 5C07E 3WD5L 4IRZL 2G5UA 1CFSA 4XO4A 2V5MA 4YHLL 1JF5A 1ZXQA 3GXMA 2VDRL 3U0PB 2ADGB 4V1DE 1HOCB 3WJMA 4P5KB 4PJXA 5E1IA 4PLNC 3SJVB 1XIWB 5CD3A 2IAMD 2HVJB 2H0PA 3IAQA 4G5ZL 5HD8D 2I26N 4NPYB 3EADA 4P4RB 5I6PA 4TNEA 3T1FA 4M7ZB 3AG1B 1RUAH 3WN5A 1WYJA 3FTXA 5ISZB 2EE3A 1NOAA 4NIKB 1XR8A 3RWEB 3RFZB 2MTAA 1JWUA 4MB5A 1QABA 4ZRGA 5GGQH 2ODIA 1B9KA 1XF5A 1ZDQA 3FZUC 5DLML 3UTTD 4A2LA 4TNWK 4UOJA 3KS0J 4GRLD 2EUXA 2DJMA 4GFTB 4XE0A 4X5QA 4OGZA 1U8QA 3LRSB 4RGND 3BD3A 1HFUA 1SXSA 2R56L 1D5XB 1N12A 2X4OB 2CE6A 3Q8AA 4EDWL 2DEXX 3DPDA 2G3MA 2HKHH 2H32B 2OQJB 2P80A 5DEFB 3S35X 1CL7I 2YZ8A 4O9HL 3V79C 2R15A 3D4YA 2X2HA 1FNSH 2I7SA 2WOBA 2X4RA 1Q0XH 3PXHA 5C0AD 4XMKL 3O2WL 1H19A 4JHZA 1MJUL 2LAGB 3MRIA 4PBWD 1X7QA 5F96H 1OT2A 1A4KA 5ESVA 2E6QA 3UXFA 2VDRB 2VLLB 4Q6YA 3BDYH 3VGBA 2VN5A 1FC1A 4NKMB 3DUUB 3U36A 5GS0H 1NPNA 2CUHA 1TQWA 2R69L 3HC0B 3MU3A 3R19A 1S9WB 4G1EA 4I3GA 3UG3A 1C9SA 2F7RA 2HJLB 3MBEB 5F1IB 3OXRA 3MRDA 1P5VB 5CZXC 2H9GA 1SXCA 4ONOA 3VW3H 3IB4A 4DVRH 2YOAA 3OWRA 5E5LA 2VYRE 3PWJB 3FHEA 3EOBA 4PJCF 4XH2A 4Q97A 5KVDH 2Q7NA 4WFHD 1G9EA 1GOGA 2H0EA 2E86A 5BVPH 4KUCD 2EE0A 2MTPA 3GS7A 4P46C 3S5ZA 4W70A 1D7FA 5EUOF 3QWRA 4JO4H 1G7LA 5C9JA 1XCTB 3MVSA 3VH8B 5EOCL 4G8IA 2XUWA 3HPLA 3CFNA 2R1XA 2VIRB 3GJFB 3S8FB 4R8WH 2HJFA 5D72H 4APXB 1V10A 2VMCA 4N0RA 1B0WA 5EU3B 4HGWA 4AGPA 2XG5A 3BE1H 4IKNA 4OZFB 4WWNA 1NC4D 3N1MC 3HC2A 3U4BH 3LNEA 1LE5A 4KY1H 2DW5A 2FGZA 3NSYA 1FF5A 2NPLX 2X6CA 4NQEE 1GKEA 3TXAA 1GS7A 2BIOA 4BZ1H 1JGUH 1TZHB 4QI3A 5T3ZD 2XYBA 1CE6A 1YNTA 3NCJH 3BPOB 4WFFE 4ZUSA 4DTGL 1QASA 1YY8A 1A9EB 4UILH 4Z7QB 2Y1AA 4AUUA 4BFIA 1QEXA 1X5MA 2ORBL 5A2CA 2VLRD 1X6LA 2OMBA 4HCIA 2QSCL 5F9DC 1K5WA 2R4RL 5K59E 1E5YA 3R8BB 3ILQD 5FA3A 4MMYB 3Q5TA 4GAYB 3L7FB 4WWKD 1UWYA 2VABA 4FYSA 4UTBH 4IBVA 1XGQA 3KYNA 3P54A 1D7BA 4NKIL 1OGPA 4YN3A 3TJEL 5GSVB 1IGTA 4R0LB 3X12B 4XN8A 2O6FA 3Q2WA 2MCPH 1VGKB 5CGBA 5J9PB 1EBAA 5FO7B 4XXWA 4QRPE 5I18H 1A6TB 1KBWA 2JJTC 3H3PH 3HZMB 3FRPG 5LXVA 1CR9H 1THAA 4ONFH 4QT5A 4LNRA 5CKGA 2EEDA 4NKOB 2VDMH 4PJAA 3RGVA 3PHOA 3KXFE 3EFDH 4KO9A 5DMGC 2Y5TB 4AJ0A 3BO8B 1NFIA 5DK2B 1N6QH 4TPRH 2BP8B 4HOXA 4WKXA 1NAML 2IBGA 4UIMA 5ENWB 3X1GA 4LOVA 3QO0B 2UZYB 2FE0A 3DV6B 1EXHA 4XPGL 1TR7A 4N0FB 4FQXB 3OHXA 5MHSD 5TJWK 4E5XG 3WE6B 2MJWA 3DRQB 1M1XA 2JFCA 3RP1A 3SQBB 3L9RA 2GUOB 4R4BB 5D1XC 2VAAB 3ZE0F 1FZMA 4PY8J 1KXQA 2GK0B 4AQOA 2CCWA 1B2WH 2W59A 4LESA 3TO4A 4X8CA 1CLVA 4HH9A 1RZFH 4O00A 1X4YA 3FB7A 2J71A 1KTLB 3C2SA 1S9XA 2ZCLH 1FL3B 4RGMB 3C8KA 4F8LA 4A38A 1GRWA 3KEHA 4J2QA 4LVEA 3E2HC 2BSRB 1ZHNA 4IOFC 2F53D 4FRWA 3GRWH 5C07B 5F72S 1MHCA 3T0BA 2C9QA 1W8NA 1D9KD 1FNAA 4M00A 1BG9A 2LLNA 5LBSH 3LH2L 3KYKH 5EDSA 1VZIA 1F58L 1I4FA 4KQ3H 2CM6A 1QVOA 1OP3H 1I8IA 3KYOA 3WOVA 1ZK9A 5BZDB 3CZEA 3G9VA 1Q94B 2ZCHL 3V7AE 5LUMA 1ODAA 1NAMB 5DJ0A 5ID0A 2CKBL 4FZEH 4HYTB 5ELIA 3BDBA 3ZDZE 4D9RD 1KPVA 1Q38A 1PD0A 4FKEA 1KYOJ 2NY7H 5E5MB 4LCWA 4LVOB 4ALAL 2CRZA 1HAWA 2XPYA 3QXAB 4OM1L 2IQAA 3SQOL 2XWTA 4JDZA 3SBWC 4AEIH 4I89A 4Z5RA 3MRGB 4WTXA 4NNYB 1J9TA 2FSEB 2IOOA 2NNRA 4MX7A 1DANU 1AQKH 3ATEA 3BGFB 4MA8L 5KVEE 1JBJA 4Y4FC 3DKHA 3UAEA 3B5GA 3ZIMA 4Z18A 2ZXCA 1A2YB 5D1XE 3VFRA 5JW3L 4TNVF 2AEQH 2BIPA 4OGYH 4YHOL 2CHZA 1HXYA 2DQDH 2VR6A 5T1LA 1H3UA 1CQYA 1JK9A 4MB3A 3MJ9L 3EYSH 5SWZE 4G1MA 5EH1A 2F54A 4K7PH 4JVUA 5HP5A 3UGEA 3BISA 3EG9B 3TZVB 4A6YA 4M6OL 5K39B 2VM4A 2ATPB 3NCCB 4GKZB 5ECJE 3WFDL 1PFCA 3CDGA 4PJ7F 4UQ2B 2IDUA 1LE9A 2BOLA 3P4NA 2CKBB 4N5UA 5IROC 3KPMB 3PHSA 1DVXA 1ZWIA 2C9SA 5I8OL 3CUPB 3CU1A 5F70A 1C16B 4KDVA 2XN9D 3VQLA 3W39B 2FGWL 2HX8A 4HK0A 3M1BB 3CFTA 4EI5A 1JF1B 2ZOLB 3ASWA 4PV8A 5TF1L 3ARXA 4ZO9A 1RJYB 3RVVC 2VRKA 3VFWB 3GJFK 5AVZB 4WDIB 5AYTA 3HMXH 2YKLH 5IHZA 4YSDA 5T1KA 3F00A 4JFXA 4H25A 3MSPA 2RCSL 5ALCL 4ZDHB 4DGIH 4FFWD 1COBA 1NAKH 2Y72A 2CIIB 4OZGF 5TDPB 2AK4E 1FN4A 1UXSA 1BM3H 1U30A 1VFAB 1OP5H 2ZYIA 1OT4A 3ARGD 4P2RA 2YA0A 3LNFA 4LSUL 4O2EB 3SE3A 2YLHA 4FMKA 3UTPE 3KPNA 3U0TB 4RRPG 2XFGB 1ZLSL 2PWFA 3L1OH 1ASPA 2B2XH 4B9PA 4JQIA 3QJVB 2HT3D 2NY4B 5I26A 2X4UB 2QL1A 1OP4A 3AREC 2VXTL 3FT1A 3ULVD 5IFJA 1XL6A 5EEUA 3GI9L 4ZPTB 4NQEB 1FFOA 3PP3H 2BNQA 3QYCA 5DR5L 3VXNA 2CBQA 4ZOBA 5EIIG 5KJRH 4JRXA 4QYOB 2OMXB 4IJ3C 4FQIL 1GYVA 3VFPB 4MQXD 5DMIH 4PU2A 4URTB 1Z5HA 3NGBB 2KT6A 5IW6B 4YSRA 2B1OA 4F93B 3UYRH 3VD3A 3QZPA 3EGDA 1HOEA 4CAGA 1F4HA 4MWFA 3NJGA 1FZOB 4XVSH 4J2XA 2W80C 2LFEA 4W6XB 3OZLA 2XG4B 3G6JE 4U33A 3T09A 3SCMC 2VZ1A 3HBPA 4JO3H 5IW1B 1E4WL 3BH9B 1JPSH 4HXBL 3BMVA 2O5ZH 3NN8A 2OP4H 4GUPB 3MLWH 3ZQXA 5T1JA 5F9OH 2YC1B 1CQKA 3EFFB 3V4PH 4HZLA 4P4KD 1SUJA 4QRPB 4B96A 5T1MB 4QY8B 3P2DA 1GAFL 3F7PC 1JZHA 3FUKA 4LLMB 5E99H 2VSKB 2O93L 1IBBA 3RPIA 4X5WA 2OZ4H 2DIBA 2WVVB 4GKNB 1E27B 5CN2A 4P04A 5E2VL 4BDVA 4JG1L 1GZQB 3P77A 4H8WC 5IQLA 1KULA 3AGWA 2MQ3A 2QPDB 3KXFB 1P4BL 1XZ0A 5FECB 1NEZB 3K91A 2X4PB 2BY2A 3WFHB 1B3JA 1MIML 3QORB 3ZOAA 2ADJA 1NL0L 1PKQA 5T3XD 3D39D 4EF3A 5EA0L 1DFBH 2OSYA 3FS9A 4MCNA 3FQNA 3GSRB 1S7QB 4FNQA 3CH8A 1NIAA 3LH9A 4GW4B 4J3OD 5TQ2L 4XMWA 4HWZA 1KN2H 4ODSL 2QZ5A 1UA3A 4D9LH 4L9DA 4G3YL 1CLCA 1P53A 3BWZA 3D25B 2WXFA 1SY6L 4HHAA 1YPZE 5EC1B 4ODXA 3HI6H 4PJEE 5KVEL 5INCB 3NZHL 2IDCA 2FHFA 4JZJC 1HZLA 3ILPA 4Y9FA 4TVPH 3IJSA 2JWYA 3QUZA 3I02B 1V27A 1JZ8A 3WN6A 3HG0A 5CJBA 3Q13A 3VXTB 3VX1A 3VFUA 1WFOA 3QQ3A 2JVUA 4NT6A 1S3KL 3MROA 2B1HL 2V8MA 4MSWB 3DX4A 3O4LA 3GBMH 4HIPA 5DDHA 5LQBL 4L37B 4WAFA 5D7JB 4WF7A 1H6EA 3ISWA 1RJZA 1CD9B 1GSMA 1U58B 2J88L 3HFML 3PIQB 2M26A 1M1SA 3U6RB 5I8CB 3PUUA 2J1ZA 2WP3O 1SDAB 3ZDZB 5DUPL 5A6LA 4PV9B 2QKIC 1JPGB 2NZ9C 4L1BA 4NM4H 1WFIA 4FE9A 4KHTH 2O5NA 4KTDH 1KB5H 3ZZ1A 4XODA 4BCXA 3RZCA 1JZGA 3JVGC 5DVMA 2BVPA 3IJYA 1OQOA 3EH2A 4W4OC 4E9WA 4H8QA 2QMJA 4LL4A 3PCYA 1T22B 3OKKA 2AEIT 5T5FA 3SBPA 4YHZL 1F4WL 1Q1JH 2JB5H 4MMXC 4H26A 1YCSA 1JNNL 1FVEB 5D1XB 3PABB 3I9GH 3EGXB 4J8RB 4AQEB 3GS4A 1IGIH 2GTWA 4WW1B 2AKRB 4HJJL 5BO1L 3X1NA 2PP9A 1CFMA 3MBWA 3BYTA 2YJLA 4OFYD 1LYQA 4JJOA 2RR3A 4X99B 5SWZB 4HJIA 5FGBA 5KBPA 1WRFA 4LCYA 3HS9A 4JUSA 5DQJA 3TT3L 4HUKB 3T0EA 4LHJB 3O2VL 4G7QB 2R4SL 2CRMA 4OGXL 5D4HA 1QFWM 2ZUQC 2DQ6A 1PG7L 3QDGE 1G0XA 1MJ7L 4AITA 1KB9J 5DD1H 2NSXA 2AK1H 4PR5A 4AI7A 3U4AA 2XQ0A 3KBPA 3TA3D 4PJIF 1S7XA 5FYLE 4JUTA 1U8NB 1A1NA 4QHKI 1BXUA 1KPUA 3K1KC 3OPZL 2NYYD 1TZGL 5CJ5A 4EIGB 3ULUC 3LB6D 2OXGB 5GS2H 3BP5A 3CDZB 3SKMA 1R6VA 2J6WA 1HYRC 1IBYA 1BZ8A 5D9SA 1QEWB 4AKOA 3VRLE 1J5OH 2AK4B 3KWVA 3WFEH 5H2BB 1HL5A 4J3XA 5FM8A 1B0GA 2BVUA 2APTA 2HUEA 3EBAA 4GW5B 1MWOA 2IALA 3BCFA 1OE2A 3GXTA 1IC4H 4NYLA 1GYCA 2G9HB 4DIXA 1MFCL 1KYOK 1VLXA 2BH0A 1EJFA 2D4DA 2V8LA 1HHHB 3A6BH 4K5NA 4K8RH 1SVZA 4LF3B 5DI8B 3RWJB 2YPLE 1H3PH 1NGXA 3DSNB 1SJXA 1CGTA 3IU4H 4IRZA 2E9JA 4JG9A 4NN5B 1P5UA 1QUNB 1WZMA 4R83A 4WJ5B 3W9DB 4N8UA 1NDGA 1VCBC 4UIKH 4RX4A 4ZAKD 5HTSA 3VGFA 2WWNA 3MMEA 4NJAH 4KNSA 3RJQB 2Q8AL 4HVBA 4P3DA 1UKSA 1DSFL 2YRPA 1HQRA 1FZKB 4GG8A 3MRRB 3UJIL 1M57B 1MW2A 2HTKD 4Y88A 3VRIB 2BOCB 2VN6A 3AS3A 3G6JB 2G30A 2Q2EB 5D93C 1MCDA 3MRKB 2WANA 5I1EH 3CC1A 3MODH 3APNA 5E00B 4PD4J 5C0BE 1WK0A 1H8NA 1JTTA 2VMFA 1PVHA 3AQYA 3MV9E 3NK4A 4AQ8A 3GD1C 2WYHA 3IDXL 2R2EB 5E4AA 3WELA 1UKTA 1OSPL 2ICEB 2YUXA 3LRLA 1YYML 2SEBB 2ZWSA 3MLXH 1ZLUK 3F7YB 1JZ3A 3U9PH 4ODWB 1LEGB 5HJBA 1D5MA 3BQUC 3TIDB 3L95A 3ZBMA 1H9VA 1TXKA 3GI8L 1OV8A 4KVCH 2OJZL 1BLNB 1PYWB 2J3SA 1JVOA 2LABA 3AREB 3PJSA 3NJKA 3QSKB 1I8LC 3U9WA 2J5WA 4WCYH 4Y1TA 3MCYA 1Y7VA 5JOEA 3QIUB 4H8WL 1HHKA 1ZD6A 2HX7A 4XBPA 3IFPA 4G8EA 2VDNL 4WW2C 4N8VA 3GSOA 4WGWB 2XZAH 2LR4A 1G9HA 4IJ3B 2BLFA 3SJVD 4G11A 1XIWD 4UBDC 1OVZA 4UQEA 3IGKA 3N04A 3HVNA 4RNRB 1XWVA 3SQRA 5I1AA 2WLIB 5IJBC 4YIQB 2BY3A 2NTFB 3ATBA 2E59A 1YPZB 2TRYA 4N2IA 1X5HA 2X7LA 5ISZD 4PJEB 3ZTJH 3IFNL 2FCBA 4KK5D 3E6HB 4LLUB 3F6IA 2OI9C 3MNZA 1TJIL 1NKRA 1GR7A 1NBYB 3QIBC 2IPKA 4YLBA 1O7VA 4KJPC 4BFJA 3LSOB 2ATAA 1FBIL 2EDJA 2IWEA 3O6FA 4YL4A 3SCMB 5DD0L 3AM8C 4ONGL 2LOEA 4CBPA 5A16A 2WYZA 4E9LA 1YY9C 4S1QH 1YMMA 5DJXA 4NERA 3VFTA 2GT9A 5C0GA 3EH3B 4KRMB 4H20H 1SJVA 5KTEH 3D0AA 5M95B 3EXLA 1LO4H 3X3FL 4HG4K 2DAVA 3FTGA 1G7QB 3QZBA 5MP6L 5BUAA 3AU1B 2X3AA 4DP1X 1KIUA 4L5FH 2HZHA 1PZDA 3TT1L 1SHWA 2CDGA 2GEEA 2UY6A 2VDNB 3QZWB 4KFMA 2H3XC 3L5WB 3WFBH 3BWUC 2P47B 5I0DA 3UZVB 2R1YA 2X2IA 4L1SA 3M17A 2R0WH 5IB2B 3TYFA 3VWKC 2WLJA 3MBED 1I3UA 3FTVA 1F3DJ 4JN2A 2WQVA 3L1EA 1JI2A 2Z8RA 3QCTL 2CXKA 2ZUUA 3KGTA 1NC2B 2PTTA 2ZYSA 4JPIB 5E8PA 4FYTA 2R51A 1X6NA 1CLOL 3FB8A 2VL5B 4ZFFA 4KMQA 5EO0A 3KNBB 4DCQA 3KLAA 3CXDL 4KY2A 3GXNA 4H1LB 4JZJB 5L8LB 3ECBA 2YAMA 4JKKA 4YXHH 3JXAA 1WHOA 3RQ3A 5IR1B 1SDDA 2FWLB 5DJ8A 1K8DA 2X88A 4OLXL 4OLWH 3V4VH 5FB8B 7PAZA 3E6FA 3QDGB 4BSVB 2Y22A 3VWJB 1RQ5A 1WFJA 3SPCA 4FJZA 3MCLH 2B9AA 5J6GB 1Z3GL 3FQYA 5EZLA 5HI4C 5I19L 3F05A 3FTSA 3EF7A 5EZJB 2VZTA 2OMUB 1JGLH 3TH2T 3WI9A 25C8H 3RTLA 3TLRA 4ANVA 3C5ZA 1ZT7B 2OXHA 2QTVA 2FD6L 3ELAT 3R4RA 1FL5A 4NHCL 4PB0H 2EZ0C 4YHMH 3GB7B 3WIFB 2VXUH 1T7YA 1LDSA 2X44D 3NVQA 1ERNA 1XEDA 3RFRA 5JLZB 2VKXA 3T0WA 5AKTA 4NUGL 1B0RA 4TRPL 1XTMA 4GP5B 4U2YA 5CGTA 1YVLA 3MBXL 1D3CA 2EDMA 3R06B 2R0ZL 1JZ5A 2IGFL 2YR3A 1LK3H 1A7NL 2A1WH 2FATH 2YHGA 3IETB 2APXA 4G8AC 5IOKA 1U33A 3SOTA 4MMXB 1MN4A 2EYSB 4CW1B 5ES4B 4Z9KB 3HTLX 1TSRA 4MJ6B 1CU4H 2A99A 1W8OA 1KLFB 2X70A 1S7VA 4X6EA 2X10A 2IH9A 5DLLA 1I9RL 3KPPB 4KKLC 2YD6A 5TF0A 1X3DA 5EBWB 5LNEA 1I1FA 3V6OA 3F3HA 4H88H 1AD0A 3C09C 3VSTA 3TBSA 1MCIA 2YPLB 4YDZA 3U7WL 2P42B 1QNZL 3DURB 1XB8A 2DL2A 4UOW1 4XO8A 5E9DA 4O02A 3SPVA 1T0PB 1WIPA 5DJYA 5KSVB 1DJGA 4I2XE 2HRPL 1K4CA 4YWGL 4UV4L 3RX7A 4F8PA 4S0TD 4LRIC 2FR4B 5AB0A 1RIHL 5I6KA 1UGNA 3BW9A 3G5ZB 3SKJH 2GHWB 1S2EA 35C8L 2DQMA 3NA9L 1ZA3A 1R34A 4HAKA 5CUSL 1PG7X 2A4CA 3VGAC 2HXAA 1DJXA 4FQXD 2IBZY 4MNHB 2XDHA 4U3HA 3NIFF 1HHIA 3FULA 4NZFA 4PHXA 4RFOL 4WY7L 2MRYA 7CGTA 5IV2B 2A6KA 3EYVA 1VEMA 5C0BB 1S46A 1V3LA 3MV9B 1LILA 4PJFA 5EUKA 3OXSA 1RZ8B 3GMRA 5C09E 2BVTA 5K5YA 4UZSA 4YE4H 1BQKA 1IBFA 3QPXH 2FX8H 3D5OF 4FFZL 3MC0A 4WEEA 1AKJB 3UDWC 5KSBA 2DQJL 1Z0NA 2ITFA 3QDMA 1P0SE 2ZONA 3CMGA 4M62H 4PJ8C 4JKPH 5DHDA 5FUOH 1HAUA 1JHKL 1HE7A 2Z31C 4JZNB 4AUYA 3U4KA 1IL1B 4G6JL 5CIPB 1WAAF 4NKQB 3MJ9A 1RUPL 4FQ1H 5AOMA 4LK4A 3CQPA 3S48A 5HBBA 4UTAH 3CVBA 4B9YA 5C07D 2H7WA 1EEZB 5DC9B 4NS0A 3B5HA 4YFLI 5BNXD 4FI7A 3NDYE 3ZL4L 4KO5A 4Z7UF 3X3GL 4RZCB 4D7PA 2M2DA 1NMBH 4X6CF 1U8KA 1BEYH 4P5SA 2FIKA 4F7EA 1BWMA 1I1CA 2DI9A 3OV6A 2BCMA 3RDTD 1FDLH 3ZE2F 2P5WE 1ZGLA 3V6FA 1GOFA 2A73B 4OQTH 4P5MB 5EZOL 5IBUG 5FOBB 1BJ1H 1KCBA 3C8HA 4HUXA 1RIVH 3IFOA 4MAZA 3WU1A 4HIQA 1CXIA 3QCUL 3GTTA 3HNSL 4I18A 1D6EA 4PRPA 5HGBA 4X6BB 4JDEA 5D6CA 4D0CA 1JPST 1X5AA 1J87A 4GMSL 4Q4EA 3CDCA 4OLYH 4Y4HC 3BUYA 4NWUH 3SDAC 5D93B 4DH2A 4XN2A 5C8JB 4G7YH 2WWKT 3FT2A 2JF1A 1IAMA 3Q6FB 1KJ2L 1LO2L 1TZIB 2CLVA 2AGJH 2FHBA 2VXQH 5I74C 4BBWA 1ROWA 4HJSA 1FGVH 4JFEA 1HEHC 1TQUA 3C6LB 4P46A 1WT5A 3QE5A 3MO1B 5EEVA 1K5NB 3V0FA 1G6RL 3T08A 4BKSC 1A4BA 4N86A 5HYIA 1NDMB 1JV5B 1R3KA 3OHMB 1J10A 4M03A 4QDGA 1WD8A 3I6KA 4FYQA 3HE6A 1J0KA 5G55A 4PGBA 4AL8H 2L7EA 3E9UA 4IEFB 3DPBA 4PJCE 1VF5C 4RQQB 4W9EC 4DZ8B 4Z77A 4YHYB 4ZXBD 1R24B 3F7RA 4XC1L 1ZANL 4R4FL 3WHXB 5FW6A 4QTHB 1T6BX 1BZDA 1Z9MA 5I1IH 2K0RA 4WW2B 3THML 3IDJB 3WNKA 3S0PA 5EUOE 3FQTB 4X6FA 5AVSB 2VR7A 3CZUB 5JPNA 5EFIB 2PR9A 1OLZA 2OCFD 3GC3A 4RMSA 5F0PB 4RGOH 3DMMC 4Y4KC 4F2EA 3H85A 2YJQA 3HG2A 2NDGA 3WGVB 3RWFA 3QXDB 2YBRB 4IMLA 5D7KE 1JRHH 1FNLA 3G08B 3LEXB 3IYLW 3QIBB 3FZUD 5AVYB 4GKSA 4Z7WA 5DHEA 2OR9H 4PRBA 4WIQA 1WISA 5CLXA 4DW2L 3WEXA 4H8VA 1HHGB 2CLZA 1G6RB 3SPIA 4F37F 4MD0B 5F0MB 3OVUB 3S96A 5CZKA 2NY4D 1MCWW 3E1ZA 2AEPH 3JWDL 1I8MA 2ZXDA 1Q9LA 3F58H 2N3JA 2QHRH 4N2OA 1UD2A 3AS1A 2PPCA 1UUSA 4Q89A 4WFFD 5G4NA 1K6QH 1MAKA 3HRZC 2EDLA 5IEKA 1JFHA 1NUNB 1CI5A 2PTUA 3IMUA 1TQSA 4K73A 3WMPA 1UZ8A 1LK2A 3ZRFC 3T0VA 5FR3A 4UAOC 3IK2A 4KZ0A 4LOUC 2H1XA 4XPBH 1YUHA 1Z9SB 5KN5B 4XPTH 3DTDA 2NZ1A 5GHWH 4Q8BA 4KOBA 2KDGA 1GIGH 2D0GA 4OB5L 1DBJL 3LVTA 5GISH 1TKWA 1KDIA 3DLQR 5K9OB 1CG9A 3HCVA 3NFPA 32C2A 3DXAE 3P9MA 1CFVL 3L4CA 2H41A 3CDFA 5EBGA 1L7TL 4KXDA 1A3ZA 2R2HB 3LXUX 4TSBL 5CSZA 1YNKH 5DVNA 5CLZA 5I2IB 3RVTC 4QHMA 3VD5A 5CZVL 5F7FA 4KH9A 5IBTL 1H3WM 4QOKA 1A14H 2Y7MA 4AYEC 4I2XB 1PAMA 3DOSA 3HUJA 5DGQA 3GBNH 3KXFD 4LCUB 5CM1A 3EXJA 4PW3A 2BS8A 4Y7MA 3HG1E 4XC3H 3RTQC 2COQA 3ZE0E 1QI5A 4BXVA 3EDKA 1E4XL 1T1ZB 3QORD 3LKRA 2XFXA 2XPGA 2D9QB 2CD0A 3LKSB 1RK1A 5EOQL 2P1YA 2Z64C 4HS8L 1AHWC 5IQ7L 1WCQA 1DQMH 1SBBA 5A2KH 5DJAA 3HPJA 1I8KB 1SGKA 3RI5F 4M5YH