1J5CA

Solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
b'ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title The first solution structure of a paramagnetic copper(II) protein: the case of oxidized plastocyanin from the cyanobacterium Synechocystis PCC6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1j5cA00
4FA7B 3QJVB 3QJUB 4NB7A 3PLYA 4YSOA 1KYAA 4KNSA 2J5WA 4X4KA 2H5UA 2EIKB 2J55A 1QNIA 3EHBB 3FPXA 2XWZA 4A67A 2W88A 3NJHA 4YVNA 2GSMB 4AKQA 2QPDB 1ZIAA 3V9EA 3PPSA 2DY2A 3RYMA 1GY2A 4A66A 5AFAA 1EZLA 3DIVA 5B1KA 1L9OA 4WKXA 3ABGA 1CYWA 4A2FA 4KOCA 1ADWA 1MZZA 1KDJA 1KBWA 3AG2B 3NJNA 3T6VA 4YSUA 2B3IA 4GP5B 4ZK8A 1NINA 1ZV2A 4YVUA 3FQ1A 4DP8X 2FWLB 2YQBA 3TASA 4HHWA 2XLLA 2YARA 5TK4A 1MG3C 4E9RA 2Q9OA 2XUWA 3TU6A 2IWKA 2CUAA 2WO3B 2YXWA 2YAMA 3ABMB 5B1BB 5B7FA 3OM3B 1J9TA 4E9YA 2J56A 1NWPA 1V54B 1NIDA 4HALA 1SFDA 2HRGA 3EH3B 1IBYA 3ERXA 1OOWA 1W8EA 4DP9X 4DP7X 1J9QA 1JZGA 2VMJA 2VW4A 2YAQA 4G7RB 5I28A 3FSAA 4YSEA 4YSRA 3TA4D 1FFTB 1BQKA 3FU8A 1JXFA 1AZUA 5I26A 1GS6X 1L9QA 1KGYE 2BP8B 2FT8A 2XV3A 3DTUB 4JHUA 4BWWA 2XVBA 5B7MA 2CBPA 4G70B 5D4IA 5I6MA 1SHWA 1SF3A 5I6KA 3FU7B 2EINB 1XMEB 4GYBA 1GSKA 3SBPA 1WA0X 2NRDA 1E30A 1JZHA 4P5SA 9PCYA 2P80A 1L9RA 3TBCA 2IAAC 1X9RA 4DP1X 3FYEB 2YXVA 3EF4A 4F2EA 1AS8A 2DWSA 4PCYA 2BP8A 3PAZA 1L9TA 3S3DB 5B1JA 1OE1A 2DWTA 4KOBA 3FU7A 1CC3A 3ABKB 3BQVA 2IWEA 2MTAA 2BZ7A 1PNDA 2VM4A 1RKRA 3S3CB 4A68A 1OE2A 1M56B 3TBBA 1SDDB 1NIBA 2MRYA 4E9QA 2N0MA 1J5CA 4WTQA 3AG4B 3HB3B 2VM3A 3GDCA 4FAAB 4JHVA 1EHKB 1GY1A 3H56A 3NSFA 2VSMB 4HHGA 4N8UA 2AANA 1N70A 3NJGA 3H4HA 4K9JA 1CURA 1FA4A 1MZYA 2Y69B 1JVLA 3T6WA 1I53A 4A2GA 5D4HA 1PZBA 4BWUA 3AZUA 1OCOB 1BAWA 3JTBA 2BHFA 4A2EA 3AW5A 1R1CA 4UAHA 1GS8A 4UANA 4E9TA 2AZUA 4DP0X 1BYOA 2GC4C 1JXDA 3IN0A 1NWOA 2AFNA 4M4RB 1E5YA 1OCZB 2UXGA 3NJFA 3OMAB 1AANA 2GIMA 3UACA 5B3SB 1PLBA 3WNIA 1J9RA 3NSYA 3X1NA 4EF3A 3AG1B 3OQRA 4BXVA 2FT7A 1KDIA 1NICA 1HFUA 3GXUB 2PP7A 1A4AA 1M57B 1ETJA 1BXUA 4HIPA 1AG6A 3FYIB 3WKPA 1N68A 3OD3A 2EIJB 2XX0A 2PPFA 2BW5A 1XB6A 2GC7C 4GXFA 5B1JC 3NYKA 3N2JA 2A3TA 2QPEB 2ZONA 1JZFA 1SJMA 4KO6A 3EH5B 3MX0B 2FQDA 1J5DA 3CZUB 3FU9A 2HRHA 3X2QB 4KNTA 4P5RA 2YAEA 1NIAA 5IY5B 4HZ1A 4F2FA 1E65A 2DYRB 5AKRA 4HCIA 2I7OA 3IBOA 1KBVA 8PAZA 1SHXA 1M9WA 4GY4A 1PF3A 2IDSA 3QQXA 5A7EA 1GYCA 3N55A 1IC0A 5AZUA 2PPCA 2UX7A 7PAZA 4YSCA 3WNJA 4AKOA 4ENZA 1JOIA 4AZUA 4E9WA 4DPCX 2GB2A 4CSZA 5I5JA 2CAKA 1WAEA 3IN2A 3T6ZA 3ZDWA 2B08A 1ASQA 1TEFA 2XU9A 2DV6A 1RCYA 3ABLB 2IH9A 1IKOP 3CVCA 3CDZB 2JXMA 2HZHA 4A2DA 1VLXA 2LLNA 2H47C 3CVBA 4E9SA 2IWFA 2PLTA 4DP4X 2ZXWB 3FSZA 1CYXA 1PLCA 2XX1A 3PCYA 1GW0A 3QJQB 3AG3B 2VW6A 4Q8BA 3CDZA 3WIAA 2IDUA 3FSVA 3EH4B 4M3HA 4W9ZA 3IEAA 1ASPA 3ASOB 5I6NA 2PCYA 1AIZA 1RZQA 1AACA 3PXLA 4DPAX 3FQYA 1DYZA 4YSDA 1DZ0A 1IBZA 4KO9A 3NJKA 5I5MA 2YAOA 3NJMA 1ZPUA 1ET7A 3L45A 5I5IA 2BW4A 1GR7A 4AI7A 2OCCB 1NIFA 4G7SB 2FQEA 2RACA 1OF0A 3S8GB 4RH4A 1B3IA 1JERA 1NPJA 2JFCA 2AVFA 1ZDQA 4BXSV 1ID2A 1TEGA 1TU2A 2VSKB 7PCYA 4Q89A 1NDTA 2GHZA 1CUOA 1W6WA 1AZBA 4L0PB 5FC9A 2QDVA 1AZRA 4MFHA 1IUZA 2W8CA 3QJSB 4NERA 1AS6A 4G7QB 4KO7A 3IE9A 4A2HA 4BDVB 1T5KA 3NP4A 1HAWA 3NP3A 3D12B 2ZWNA 3UADA 2HX8A 4QLWA 3HEIB 1NTDA 4N4YB 4QKTA 2Y1AA 2VN3A 2YAFA 3CVDA 3NJJA 2FT6A 3FS9A 1ZIBA 2I7SA 5B1AB 3AY2A 1WA2X 4BDVA 1WA1X 3KW8A 2UXVA 3G5WA 4DPBX 2PP8A 2TSAA 5PCYA 2FQGA 2HXAA 1URIA 5I6LA 2IH8A 1NIEA 3X1BA 4KO5A 2P80D 5D4JA 4BWTA 3NJIA 2PP9A 2R7EB 1HAUA 4BK5C 2FNWA 2GBAA 1PZAA 1PZCA 2X87A 3QJRB 2EIMB 3QJTB 4GP8B 5I6OA 4YSAA 1OCCB 1PAZA 2OJ1A 3GYRA 3NSCA 2E86A 1JVOA 1AQ8A 4G72B 1ILSA 1W6LA 3T71A 1BQ5A 2GI0A 1TKWA 3T9WA 1SFHA 3UABA 2EILB 2J57A 1BEXA 1OCRB 2XXGA 3WG7B 2IDQA 2R7EA 2BWDA 3FT0A 1WS8A 4YSQA 1ET5A 1PY0A 1XB8A 3KW7A 5B7EA 4YSSA 1AOZA 1MG2C 2XV0A 3BVDB 3ZIYA 4AX3A 1V10A 1L9PA 1BQRA 1NPNA 4W1TA 5F7AA 1PCSA 1J9SA 4KNUA 3UGEA 3NT0A 1A8ZA 2PPDA 1E5ZA 4E9VA 3NJLA 1AZNA 2DYSB 1QLEB 2WO2B 3SBRA 1AS7A 3FQ2A 1BXVA 2Q5BA 1RZPA 2XV2A 2OV0A 3QPKA 1YLBB 3U25A 4CSPA 3JT2A 2CCWA 4DP5X 5LDUA 4YL4A 1BYPA 2WSDA 3X1GA 1F56A 4YSTA 1PLAA 1A65A 3S8FB 1WS7A 2BP0B 2BWIA 2CALA 1UATA 3X1EA 3ZX1A 4DP2X 2HLEB 2FTAA 5TK2A 3T6XA 4HCFA 4HCGA 3SBQA 3DKHA 3FSWA 3MBWB 4NAJA 3ZBMA 1JXGA 1JZIA 4F7KA 2JKWA 2BO0A 1ET8A 1ZDSA 4G71B 2TSBA 1BXAA 3UAEA 2BP0A 1KCWA 2VW7A 1AR1B 2X88A 5PAZA 1SF5A 2AZAA 4PAZA 1XB3A 2UXFA 3FPYA 2XXFA 3UAAA 4AKPA 1A3ZA 1AAJA 3WKQA 3CG8A 2XYBA 2FQFA 1ILUA 5E9NA 1JZJA 1NZRA 2YAPA 1SNRA 2HX9A 3PAVA 2PPEA 2PCFA 2HX7A 3PAUA 2I85A 1A4CA 3SQRA 3NSDA 2IDFA 1KV7A 1FWXA 2H3XC 1V55B 3OMNB 4TXVB 1GS7A 5ANHA 2UX6A 4YSPA 1X9UA 2IDTA 1QHQA 4DP6X 1JZEA 4GP4B 4UF7C 1AG0A 1OE3A 1MDAA 1PNCA 2YAHA 3ASNB 4HAKA 5EHFA 2BZCA 4JKNA 6PAZA 2QDWA 1PMYA 1KCBA 2UXTA 2CJ3A 5F7BA 1L9SA 3C75A 1SDDA 1OV8A 1E67A 2FJSA 1AZCA 2QT6A 3X1FA 3S3BB 3OMIB 3H4FA 2ZOOA 3V9CA 3WI9A 6PCYA 1ASOA 2PPAA 5I6PA 4E9XA 1A4BA
chains in the Genus database with same CATH superfamily
4ALAL 1DVYA 4TVPD 3KLHC 4IBZA 1PG7L 1R33A 1YPZE 5D7SL 5TF1L 2IPTL 2ZWYA 4L4VA 4LQ1A 5GSVA 3BVNA 3WD5L 2LU3A 3ZE0F 3IPEA 2NNRA 3JYCA 4JDEA 4Z77A 5I8OL 1ZK9A 3REWB 5K9JL 4HISA 4RA0C 4PWGA 5AW3B 3C8KA 3DK0A 3H9ZA 3Q2LA 1L0PA 1VADA 4R2GC 2WWKT 1KBWA 3UIZA 1A4KB 2X4NB 3QEQD 1QR4A 4MTMA 3ULSB 1Q9KB 1H3WM 2ILLA 2WTPA 1S9VB 1S4IA 2C26A 4YVUA 1XV8A 2WB7A 3EJTA 3HVDA 4NPYB 3SPJA 5BW7A 4RQQB 5TDOA 2ICEB 1OZUA 2IDCA 3IKCA 3OVUB 2H3NB 1JTPA 3ZE2E 3QDJA 3TPKA 1ZT7A 1DO6A 3IFOA 4HGWB 2PO6A 1MCDA 3BSZL 4YGAB 3RPKA 3TU6A 5JXEA 2DF3A 1DJZA 3LS4H 4JFHE 4LIQE 5D96B 2PWHA 1YZZA 1F2XK 1NC2B 2HMIC 2D3VA 2CE6A 1SMOA 5HHPA 2ZCHL 1T03L 3UOAB 5AVZB 4PIRF 5C08D 2F8XC 5IHBA 4OQTH 4TVPE 2Q8BH 2FK9A 2J6EH 3M07A 4GW1B 5ENWB 2AEIT 1TENA 2X6VA 3NCXA 4JE0A 2VW4A 2AEWA 4FE9A 1YCSA 5I28A 1BZDA 3V0DA 4ZTOL 3VFUB 1H3XA 1LO5A 5INCA 4JFUA 4XMPH 2EXSA 1YRKA 1AZUA 2X0UA 3O41A 2IOMA 3ETTA 5FM4A 3WCYA 4BWWA 1CF8H 3I50H 4PJGE 4RAUA 5I6MA 4F7CB 4MBRA 2D4DA 4NQCA 1D5RA 2K4WA 4JO1H 3KPPA 4HFUH 1T5WB 1YYCA 3QEQE 1RUQL 2EZ0D 5E9DB 4BEIA 2EIDA 1NM9A 1N7ML 3S2AA 1C08B 2HKHL 4DN3L 3B8YA 3CFEB 3TFKC 4FFWC 2BP8A 3PAZA 4F9LC 2IBGA 1E5AA 2H32B 1J0ZA 4JGMA 4OLVL 5MENA 4Z7QB 3FB6B 3VFRA 5C0NC 4J3UA 3MV7A 3JUZA 4FQXB 1U41A 4XT1C 3G6JF 4OSUH 5C7XH 2Z1KA 4NWUL 2O6CA 3BQVA 2IWEA 1KCLA 5CCGE 4P2CG 5F0MB 3TBTB 3EBIA 4MDRA 3W0WD 1XF3B 4P3WA 3STBA 1E5BA 3RTQC 3FO1A 3QS3A 4OZGB 1CE6A 5G4OA 5C08E 5K1VA 5BMFL 1MREH 2D03L 4MMXB 1E5CA 2N0MA 4N5EC 4Y5VA 1TEYA 4D0DB 5DFWH 3AXHA 4JFFD 4K9EH 2AW2A 5DD0L 3VXRB 2BHZA 1VACB 4NO0D 3HJEA 3T0EA 1JV5A 3BWUF 1COBA 4L8SB 1L4IA 4MD4A 2DMKA 5E8PA 4ANVA 4DTGL 2HP4A 4XCCH 5A2IH 4WQOA 1AD0B 1J1PH 4NSKB 1QFWL 4LLQA 5KS9F 4TTDD 3FK3A 1G4MA 2CHWA 3LEYH 5E5RB 3RJDA 1GS8A 4XO4A 1TT6A 3U4EB 2VLKA 2IANB 1NCIA 2HPOA 2XFXB 3IN0A 3OJMB 2QQNL 3MVSA 4ZS6C 1QUNB 3VXSA 1MLCA 2FJFB 4MA3A 5BS0A 2NXYD 3L3DA 4ZSOE 4GEJA 3O4LB 2HRLA 3OKDA 3ILPA 2KI6A 1JI2A 2VN7A 3SE3C 1JRHH 2EDHA 2Z4TA 5CN3A 3HBQA 1J05B 1F11B 1OHZA 1UM6H 3UYPA 3OBAA 3AG1B 1BWMA 1QRND 4XVSH 3FQNA 3GMLB 5EOCJ 1A4AA 3W0WE 1AP2A 3NGBB 5D6DA 3V6FB 2IXQA 2UZYB 1KLFB 3FQUB 4JFFE 1JGUL 3VI3E 1W72A 4OBRA 5HHNB 3TN0C 3FCTB 4KO6A 1NCNA 2FQDA 1WITA 2GBVA 3C09B 4E5XB 3O6KL 4PJIF 5IOPB 1XBDA 3D05A 3CZEA 4HIHB 1NIAA 3VU1A 1E65A 5FR3A 5F6IC 5J13B 4G11A 2GHWB 3GTTA 4G82A 5E4IA 4ZQKA 5KN5A 1NMAL 3R18A 4UTCA 3VGAC 3GBDA 4ZPTB 2ED7A 1DBAH 4KQ4H 1A3RL 3DV6A 5EZOL 5KJRH 1FZJA 5E6IA 7CGTA 3JV6B 2IH1A 5DRNA 5KVGL 3CMOH 1C5DB 5E4EC 4E9WA 4GQQA 4GIPD 4Y19A 1DO5A 3RURA 1E5UI 2A9NL 3MUHL 2DV6A 4OGXL 1QRNE 2IH9A 2YD0A 3EJYD 4FOMA 4X5WB 1TTAA 3RLSA 3CDZB 1E8XA 1TOXA 3T3PF 1HWWA 1M2VB 1JGDB 1DCLA 2X1OA 1G7MB 4FKHA 4HK0B 1FRGH 1NAML 4CNIB 2YJLA 5IROA 1KIUB 1T83A 3EJPA 4ENED 2B4CH 3JT0A 4JJOA 1FZMA 4XB3A 3ESVF 3AQZA 1R3IL 1ZA6B 1IC7L 3POHA 5H35B 2KC0A 3AG3B 4AZ8B 4L1TA 4GBXC 4BSVA 1BGXH 2IDUA 2ZOLB 5DYFA 2WXKA 3BCDA 3FUIA 5CJQH 3KPTA 5CZXD 5AOIA 2OZ4A 4ZZKA 4NZUL 5L8KB 2UY6A 5D6CA 4GI9A 5KYUA 3L1FA 2VDNL 3FUKA 4AMKH 4X5XB 1ICTA 1TU2B 5F7DA 4FL4B 1Z9NA 4J3OG 5AOMA 5FGSA 5J6GA 4KJWD 1RFDH 3CVIH 3L45A 5I5IA 5E4OA 5MEPB 2X7LB 4I4WA 4JJ5A 4FKEA 4NKIL 1UB5B 1JI1A 1Z6JT 4ISVB 1HSAB 3BAIA 1FIGH 5D72L 5KSBB 2AQQA 4GMSL 2KQNA 4EN3A 1DANT 3G5YB 4FFZH 3SPVA 1WAPA 5C07D 4BINA 4HPHA 3S4SA 1FNEA 4Q89A 1NDTA 3WN5B 1CGSL 5TJWK 5DUBA 3ZZSA 5EO9B 3MNVA 3V52H 4R97C 3UZEC 2ITCB 1OK0A 4ELMB 1LDSA 2ESVA 4HWEH 3IXTB 2LABA 5L4JA 5D55A 1D2OA 2NSQA 4FRWA 4NN6B 2NY0C 4AYEC 3NP4A 2ZXQA 1IB5A 1S7UB 5GGSA 4ZMAT 4XNBA 3QEGH 1A6AA 1TTCA 4BGLA 4R7NA 1WSST 2RQEA 4P4KC 1XCTB 1EXUB 2HX8A 2EH7H 4Y89A 3HE6D 3BQUB 2R1YB 4RGMC 4EI6A 4Y2OA 3LD8C 2EKSA 2WLHA 1JFQH 3F8UB 5T1MA 1WWBX 3PWLB 1YQVL 4CBZA 2W60B 3GBNL 2A9DA 2G2PA 4LMQI 3FB7B 4FXTA 2HXAA 1ZLDA 4PRIA 1F4YL 2E47A 1I7RA 3QIUA 3EYUL 1A14L 4S10A 4F58H 3WLBA 3KCWA 5D7LB 5D4JA 2JK5B 2EEBA 2ALAA 3OXSB 1QATA 1MFCH 2MKLC 2IPUG 5CZKA 2PYEA 1EK3A 2FX8L 5ICXA 4MXWH 5C07E 3BD5A 3BE1L 1IV8A 4OIIH 5FO9B 5JHBA 3EDFA 4OF3A 2O5XL 4PWEA 1YC8A 1KIQA 3PDDA 4RDQG 3ISRA 1SFHA 5TDNA 3ZJAA 1QP1A 1U95B 1CR9L 5CZVH 3O3DA 1YA5A 5TE7L 3WG7B 3FT0A 1MJUH 4EKJA 3KW7A 2E74C 3K8KA 1MG2C 3IMUA 3CAFA 2ZX9A 4U6HA 3LXAA 3AFLA 3ZL4H 3I2CH 4PWFA 3WXWL 2BK8A 4IMLB 1RP8A 2VGLM 2EUWA 4I48A 5T3XH 2QHRH 3BMWA 5DJ2A 4ZMZA 4Z5RA 1XBRA 3GUTA 3EOBA 3DBXB 1JCVA 2Q5BA 3FN0L 2XV2A 2BVEA 1B6DA 3HC2A 4NN7C 1ZPLA 1NCBH 2WIMA 2CJUH 4R90H 1T21A 4P5TD 3C08H 2AJUH 1NCUA 2CO3A 2IG2L 4DQAA 3NK4A 4L8DB 3M1OA 1FVDB 4P5MB 2DWXA 2VE6B 1YJDC 4WI5A 1RK0B 3RVTC 5DJXB 2VAJA 2IQ9H 1QSFD 2WSDA 3IF1B 4ZS7H 1ES0B 1YYLH 3DA0A 5EN2A 5IV2B 1YY9C 4F37F 2NUTB 3T6XA 4M6MH 2K9UA 5SX4H 3TJPA 4ZX3A 5BZXA 5E08H 4QOKB 5ANMA 5FYKL 2PMZA 3TCLA 2VRAA 4EOWH 3BFOA 2CCVA 3BEWB 3IJSA 3POCA 2CDFA 5J4MA 3VCLA 3LDBC 4Y4HC 2OXHA 3CSYA 4XP5H 2X1WL 1WP6A 3UAEA 2OMUA 3P30H 1HILA 2CDEB 3B9VA 3PDGA 4UQ2A 1G7LB 3B7RL 4U3SB 4BH8A 3NSXA 1JPST 4K8RC 4FI7A 3UG5A 1MRFH 4FI8A 5L2KA 2IQAA 5EWIL 2XXFA 1FYTA 3HIZA 3FUNA 4U7KA 4JFEB 4KHXH 1IGFH 4MXVE 3UTSA 4DK3A 2FQFA 2XQYA 1IVTA 5L8LB 5EO1A 1JZJA 1KEML 3AM8C 3QO0A 2BOBB 3II1A 3P9MA 1OLZA 2X4QB 1EZSA 3D4GA 2JKXA 5F96L 5DMGD 4JY5H 3H0TA 3DI2B 2BVYA 3DYMA 2WKLA 3GHEH 4AVJA 3MBEC 2Y6SC 4YE4L 4YXHH 1DHKA 3KYOB 4PGDA 4UIKH 4QRUB 2Y5QA 5FO2A 4PJBE 4P2QA 1FHNA 1HE8A 3LV3B 1QEXA 1QSFE 3KLSA 4GP4B 4E42A 5HGHB 2CGRH 1MHPL 3UBFA 1KEGH 1AGBA 3ZW3A 1OK8A 3MV9A 1XXDC 5ES4B 2XKSA 2KH2B 4ZMWA 3RZCC 1RZ7L 3V0EA 4QF1A 5LHDA 5IM7B 3S37H 3X1FA 1M6UA 1T4KB 1NMCB 5D2NC 4KKAD 3IDIA 4OCYH 5FYJU 3VXTA 3RGVD 2BSCA 4IGBD 4MAZA 4FABH 5FHAL 3QJUB 2H0FA 3KBEA 4H8WH 2QADB 1UM4H 5MP6L 2J5WA 5DHDA 3EYSL 3TURA 4A6YA 2J55A 1O0VA 4A67A 1J8KA 1I7ZB 4PJ9A 3U82B 4AKQA 1IC4L 5JIQA 1T0MA 5A2AA 4AL8C 2NDFA 4WHDA 2D7TH 1B4JL 5IJVB 1CDBA 1KCRL 4GB9A 4E0RA 4NQDE 4BFJA 5FV1L 4NNXA 3WIHH 2X1PA 3LNFA 4UTBH 4BFFA 5IGXH 4WY7L 1OM3L 3HS0A 3AG2B 4XVJH 1F3DJ 4M1GL 3T6VA 4I0PB 1JP5A 2XZQH 2E75C 1TLKA 3TEXA 4HIIA 2ZP8A 5DXWA 2X70A 3PGFH 1MCFA 4IIQC 3ZKND 3IM1A 2BVQB 2WTRB 5F0JB 5IB4A 3UX9B 1VEPA 5HHXL 1BFTA 4Y4KD 1M53A 4FJYA 4NENA 1KPRB 1KGWA 5DQDH 2V3EA 1S7WB 1SYSB 4L37A 4QRSB 2P7TA 4JDTH 4YHMH 5B1BB 1FGVH 3L5WB 2NSXA 3RNKB 4CL7A 4R4FH 3CFKA 3AVEA 1I3GL 2ZSWA 2RHEA 2HRGA 4PJ8D 1JAEA 1TO5A 1BQUA 3Q5OA 1J86A 2VUYA 3JWOL 3JV4B 3A21A 3HZYB 1MRCH 5I30H 4ORZC 4Z7NB 2ADIB 2N4IA 1X4YA 1X5ZA 4H25B 4GAYB 4OI8A 4C8XA 5CUSH 2X9WA 1UQSA 4HCRH 1O5PA 3CC5A 3IMSA 4LAJH 1D7DA 4QXTB 1BQKA 1HKFA 2OL3A 4BH7A 2Y0SA 5KSUB 2XBZA 1WLHA 3LHPL 2JJVA 3ZDYF 5CHNB 4TLUA 3TS8A 4XVTL 5KZCB 4OV6F 2WUCH 4OFIA 1JZHA 1DN0B 3QFGA 4JN1H 2V2WB 2A38A 4Z7VE 4HKXB 4JZJC 2HJLB 1UEYA 5TH2B 4Q2ZB 4KQ3L 2PCPB 3D52A 1Z32X 1L9TA 4LPWA 2NR6D 2P52A 3QNYB 2W91A 4PG2A 1DBBH 3OSVA 5I75C 4R0LB 1E4WL 4RRPM 4BIKA 4IMKA 1Q9LB 4TQIA 1ZLWK 4I89A 4QYAA 2GY7B 1H5BA 3D69B 3GSRB 4JZNB 5GJTL 2WXQA 2AJXL 1PJWA 3S3PA 5EZPA 1U42A 4PW3A 4YZWA 3SHSA 3VX0A 5BW7C 2G2NA 2XV6B 3OKMB 1TQVA 2ZX8A 1NH6A 4NQQA 3DMMC 3SKJH 1L3NA 2FJHA 4O00A 5TQ0H 1Y07A 3TF4A 2PO6C 3LRSA 2I32A 1J1XH 3L16A 3OKEA 1X5FA 2QQKL 5JXEC 5KSAB 4ANWA 1AGCB 3TV3L 4YS4A 3VFOA 3BT2L 3T4YA 3LXCA 2QBWA 1CZ8L 4JVWA 4LSVL 3NIFB 1H3UA 1U2YA 3FTZA 4UAHA 5IVZB 3U30C 1R3HA 2AGJL 3O2VL 4ZFFB 4TUKL 4JREC 1X7QB 1IKFL 1A21A 1GOHA 3AUWB 2VXSH 4LESA 3CFDB 1YNLH 4LCWA 1DVZA 3TNNA 1N2RA 4ZX6A 4B9IA 1XVSA 3C6EA 3GQFA 2EE9A 5DZJA 5BV7L 1KELL 2VMCA 2XIBA 3NPZB 3MBXH 4RRPA 5SX5K 4JFWA 5BO1L 1OARH 1X5HA 1YO4A 5C6TL 1SY6A 1UWYA 3PGCA 1DLHA 3N3EA 5KJ4A 1UADC 4U6XA 5HYJD 2AXFA 1HHHB 4Z3GA 1A6VL 1NUDA 3PWUA 2EIJB 2Q7YB 2H3KA 2OI9C 1R0AL 3HE7A 2OTWB 4N2NA 4FG4A 2O6DA 4PJFE 2XRAH 3UJTL 4EI5D 4DGIH 2GC7C 3BSZA 5IT2L 1E3XA 1WHOA 4UT9L 3RWFB 3WOVA 5DWPA 1FL5B 3TO4A 1HKLL 2CJTA 4KNTA 2R29L 4BKSC 4DKFH 2DMBA 5DD6A 2I60L 4WDIB 4FLSA 5HI3C 5CD3B 2DYRB 1MDTA 4YLCA 4JRYA 4WFFD 1E4XH 8PAZA 1BLIA 5DVOA 4ELKB 3LRMA 1O7DC 2G5RA 3FFCB 4XWGH 4BQ6A 3D2UB 1TDQA 3LTVA 4Y5VC 5DGRA 4PV9A 1NCCH 3SDCD 4ZAKA 3QH3B 2P8PB 3K80A 5HGAB 3P40A 3PV6A 5I1EL 1GRWA 3WNJA 2YRBA 3IMWA 1JOIA 4ENZA 4FQQB 4LDLB 4AV0A 5HJGA 4M02A 5HHOA 4OUUA 4ODSH 5GPRA 2QFRA 1QLRB 1NDGB 5CN2A 5CLXA 3VJ6A 4N0YL 3HB3C 3PHQA 4HUVA 4M61A 2FL5A 1E6OH 4ZFOL 2ZKXA 4NWTL 1TR7A 3S34L 2NNAA 5KVDL 5HYJE 5LWYH 1MCPL 5EBLB 3FULA 3M17B 3QULB 4NM8H 3I9GL 3BRDA 2PXYB 1JZ7A 3MLVL 1PKQA 2J8OA 5K5YA 1CDHA 1U3HA 2WBJB 2ZTBA 4HS3B 4KUZL 1ZHKB 1G1YA 3JTTB 4Z7WB 5D8JL 4X4MA 2G2RA 1S9YB 2A9CA 3C6LA 5GRVK 3SDDD 4DCQA 4K3GA 3ZUNC 2X4RA 3MUZ1 4DO6A 1EDHA 4M93C 4WNQB 4WFFE 4PJAE 5D6DC 2HWZL 5FGRA 3HHSA 2YKLH 5I6NA 2DQFA 2EDYA 1CXFA 5I1GL 4J3XA 2ZCLL 2DYPD 4EEEA 1AACA 5F9DC 5DURD 2FH8A 2YAOA 4LMQE 3CBJB 1PEZA 3L4WA 3ROOA 1F8TL 1EUUA 1A7QL 4H8VA 3GXIA 4L3CA 3DV4B 4W9KC 5D1QA 32C2B 4EBQL 4NAMA 5ID0A 2NY3C 3IMVA 7PCYA 3MROA 4HIXL 4FFYL 5KVFH 1CUOA 3F5WB 1D5ZB 4W4OA 3QZWB 3MXVH 5LNGA 1NGXA 1THAA 1V5JA 3ULUD 2BNRB 2CPUA 4GO8A 4I77L 1AVAA 1UFUA 2XWCA 2RQ8A 1JXKA 3KYKL 3LZLA 3QJSB 4G8GD 3ARFC 2Y7NA 3RKPA 2A0LD 3A6BH 3TT1L 4KO7A 3ARXA 2EDLA 1DVTA 4K4KA 1R5IA 1AHWB 1KYUA 2FEEI 4PJCE 2R0KL 5FA4B 2EDJA 2I69A 4X98A 1EAQA 2VR4A 2Y07L 3TBSA 4OJFL 1NTDA 3QNXA 1PD0A 3HFMH 2Y23A 2HFEB 1TJMA 2AQ1A 5I15L 2MCPL 2XIIA 2HVJA 3FS9A 2XWTB 2C8NA 3CLWA 2WXNA 4M7ZC 4OLUL 3ZT7A 1AO7A 1T5XA 2VC2H 5EUKA 4BDVA 4JM2A 3QIWA 4YDLC 2GUOB 3BIKA 1ORSA 5IROC 5JW5B 4XNUH 5BO0D 2FQGA 3UC0L 1LQBC 3QUZD 4UI2A 5IG7B 3QJZA 2J7LA 5FUCC 3RUGA 4L8CA 2NY7H 1V27A 1DQTA 1MCEA 4FTVA 3MPCA 5E5MB 5JIDA 2R7EB 4G8IB 3MN8A 1HCFX 1YPZA 2HA1A 3CPUA 3H9YA 3SZ6A 3GSNL 1QBMH 5I1JH 5ETUB 3WY1A 1AQ8A 3O6MH 1NKOA 2GSIA 1ILSA 4WZ9A 3T71A 1BQ5A 5C7ZA 2C5DC 3T9WA 3ULUE 1HOCB 4P9HH 4G8GE 4MDJB 2WV3A 1G9NC 3C5ZA 4JY6B 3MRBB 1C1EL 4HGKC 2AJZB 2Y5TA 4QEGA 1ETZB 3Q8FA 4BQBA 1OTUC 5BRPA 1ZGLB 1T1ZA 4EN3C 2WVUA 4QY8A 1FUNA 5HY9B 4LSTH 3NT0A 2HG5B 2Z93A 4HBCL 5EFIB 4A1RA 2R1XA 1IAIM 4K0OA 5I2IB 3HR5B 2D2OA 3QA3A 1U3NA 3AY4C 5DVKA 1K8IB 3VXNA 4JS7A 1JHLL 3WYRA 3GSVA 4ONHB 1AQDA 3ZE1B 4EZJA 4PB9H 1IEHA 4HS6B 5ID1A 2QZ5A 2CA4A 4LCYA 3O2WL 2GJRA 4TL4A 1WF5A 3U6XA 4ICXA 3UMNA 4EVNB 2Z31B 5B39A 5EC2A 1RZKL 4G8FA 1JGVH 2EDBA 4S1SL 1E28B 5CEZH 3LZPA 1HCVA 5K9KB 1MN4A 2CALA 2EO9A 1XR8B 3O0RL 4R2GB 2OTUA 2AXHA 4PY8J 1HIML 5DVLA 1SXSA 1YECH 1S5HB 4H2CA 2B59A 3MCLH 3QIUC 2Q1EA 4IU2B 1EEUA 4PP2B 3W11D 2JJTC 3H3KA 1NQBA 2P5PA 5ALCL 4ZMOA 5IIEA 3L4ZA 4OD3H 3KGUA 1B9ZA 3QEQA 4DK6A 4HDIB 3TV8A 3QZMA 2P5EA 1XB3A 2DQUH 2M26A 4CVZB 5DC4B 4DO5A 4G9DB 3CFMA 3QFDA 4NDMB 4YBHA 2ZXEB 5EZIH 5HYQA 1QUPA 4L1BA 5CCJA 5E9NA 4G7VL 3WAKA 1CGXA 3HG1A 4J39A 1K85A 4NNYA 4L8BA 2ZSVA 4JZOA 2HH0H 2JIXD 3LRLA 3S35X 1XR9B 1GOGA 5D2LB 3WTSA 1MJ8L 5LCVL 3V8CA 1SJVA 4DKDC 2F5BL 5E99H 3QJXA 1CFVL 3NCJL 1XMWA 4PJHB 3WJJC 5I1AA 3ET9F 4V1DB 3I6GB 4XXWA 1QA9A 4LVOB 4PBDA 4KZEH 4U6VL 5EU7C 2AJVH 2YPLD 2ENQA 4MMYA 5FPIA 2V9RA 5BPPA 1MCBA 2WTOA 4BZ2L 3KS0H 3MLZL 2VZOA 4YGVB 2ZUQC 2CJ3A 3WE6B 1JK9A 3VG0L 1VB9A 5FYLL 1WGOA 3K6SA 5FHBH 2H8PA 2UVEA 5ICUA 4BUHA 3EO0B 2L7UA 3NRFA 4M6AA 4DNLA 1PS3A 1LE5B 2FSDA 5FYJD 4KVPA 4HUWB 3GBLA 2YD7A 4KXZI 4M29A 3B9KC 1GW6A 4TVUA 1BQLH 5GZOD 4OJEH 3BGFC 3ME0B 5ITFB 3L3OB 1KXTB 3RWIB 3L5IA 4LPUA 5AB1A 4MQXC 4OLXH 3RTQB 1K72A 3ESOA 3HBPA 4NZTL 4NP9A 4PBWD 4JGJA 4FG6D 2V7NA 3K5RA 5GIRB 3UTPE 1CGVA 1OO2A 4HZLB 1WBYA 2G75B 2WSPA 1ADWA 4M48L 1IBDA 1U9KA 3QDAA 5LB1A 1OANA 1FNAA 3I74A 3W0WA 3OPZH 4S1DC 4LSRL 2YSSB 1M05A 5E70A 4WUKL 3GZPA 5JQHC 4N2KA 3BVWA 4KTDL 3HLKA 1CIDA 2FUQA 2YPLE 1N3NA 1BIHA 1WO2A 4YBLB 2GBUA 4DGVH 4WU7A 2N7SA 1B0RB 1G7PB 1UZ8A 2JCCB 2CCLA 4AEFA 3ZTCC 4GRWF 2Q9OA 2NY4C 1YEIH 2CUAA 4FQ1L 5GGSY 3G5XA 3W9DA 1RAMA 4IEFB 2F54A 2J56A 1J48A 2W80C 1LO2L 4AIEA 4HKZB 2F5AL 3HZKA 5FYJE 4WKZB 1LD9B 4X9IA 1PKOA 3GMPA 1U58B 2NNCA 3KDPB 3I75A 5F7EH 4K94H 2BVPB 1GXEA 4P57B 4QXVA 1VZHA 1EJFA 2AF2A 4GSDH 3RZWA 1FFTB 4X6DA 2IV9A 2AEPL 4N8VA 3FSOA 5DK3A 3DTUB 4U1JB 3RDTD 3WEXA 4X80H 3U2SB 1QG3A 4DQOH 2DEYX 2EINB 3PWPD 2O5ZH 5EC1A 3DJ9A 3G9VA 1S5IH 2Y36L 4GAAA 2RH0A 3C5JA 3CSPA 2ZE0A 2DPKA 3HG5A 3MRRA 3W5NA 1RZIB 4PJXB 3OKOA 1CICA 2C3VB 3TJEL 5F6IB 4PJ9C 4UU9A 2NNFA 4X8JA 2DWSA 3DSFL 4FD0A 1OSZB 2E7HA 1QKZH 4DAGH 3VGAB 1NC4A 2NX5A 1NFIA 3MRKA 4FLQA 2BNUA 1P5VA 5SWSB 4XCFL 3DO7A 4HC1H 1IM9A 5BQDA 4Y2DA 2VR9A 5E4EB 3D48R 1OAKH 2DQHL 3K2MC 4UMGA 4AOFA 4JN2B 1HDMB 3TBBA 1AXIB 2OMVB 1NIBA 3NABL 3QUML 2WK2A 4L1HA 4OM0L 4HHAB 2XWBA 4D9RD 3KG5A 5HPMA 5KW9H 1I9RL 3RU8L 2CZNA 5E03A 1FNFA 5GRXG 1HYRC 3K2UH 3WTTA 1T7YA 5FIEA 4LOUC 1DJHA 1UWEL 5B1CA 1TJXA 1Z9SA 4NQEB 3NIDE 2W81C 2ATKB 3SKMB 4GAJL 5GGQH 4DHLA 5DHYA 3QQNA 3T6WA 3MRPB 4URKA 1PZBA 3TEUA 2VR8A 2H1PH 4A2EA 4KNQA 3PWPE 1FGNH 1S7VB 2Y2YA 3LKRA 4GBXB 3QNZB 5I74C 4JM2F 2MCG1 1BYOA 1ZJBA 3MO1A 3F65A 2WW8A 3HPLB 1Q94A 1NBVH 4HIJA 2YIHA 2VKXA 1UTDA 3RUGF 3IDNB 5TPWH 3NJFA 3FT2A 4PU2A 2YPKB 2PWFA 5HHQB 5JIIA 3H9SB 4DF9A 5B3SB 3KMDA 3ZE0B 4PV8B 4ZPVB 1XCQA 2Y06L 3CUPB 1YPZF 4O2FB 4OFPA 3KLDA 1FH5H 1IFHH 3BZFB 3EYOB 3PQYB 4G1MA 4UZUA 3VQ2C 1HYSC 1EJOH 1X7SA 3VFTA 4Y16A 1KY6A 5JOFB 1AKJD 2YD1A 3D9AH 3A4EA 4X6BA 3GEWB 3SDYL 4D9RE 4Y9GA 1A25A 3WKPA 3U7AA 3MOAL 5LGHL 4WU5B 1S78D 5FGCB 4GI8A 1QPKA 2WCSA 5FW8A 5HJBA 5T33L 1P6AB 2FR4B 3GZOA 1L5GA 4PY7B 4Z3IA 3BAKA 2IH3B 4NQUA 4R97B 1FFPA 3HMXL 3CZUB 1TG8A 2FB4H 2YUXA 3LMJL 1KENL 4JO4L 5TE4H 3VSQA 4MJJA 1E9OB 4P5RA 2NW2B 2FYVA 2E7CA 5ALBL 1H5BC 1IIIA 4WTXA 2NY0B 4R8WL 4GRMB 3X3FH 1IT9L 1XTMA 3GJEB 5E24E 1XF5B 2CM5A 1Z9PA 2BOLA 3DOIA 4LGSB 2C9XA 4G5ZH 3N9GH 4B9KC 4JL1A 1I8KB 4RGMB 3MX0A 4MAYB 3LD8B 1YNTA 2PPCA 5E9AA 3JWNG 1AGDA 7PAZA 3AADB 4YDVA 4I7ZC 2VDRH 3NACH 4FTDA 3B8SA 3IN2A 1G7JB 4HLZH 1JPFA 3QORC 1KCUL 4HG4J 2B5IC 4YXKH 4KC3B 1CE1L 1IKOP 1ZANH 3N91A 1T1XB 3CVCA 3ELAT 4F33B 1K2DA 4JO5A 1NAKL 3TTSA 2WXGA 3K1DA 4MJHA 1BX2A 4RCAA 1KCVL 4OZFB 2CKBB 5FUOL 4N28A 2YMTA 4ZW6A 1CYXA 5LBSL 3H2WA 2WM0A 4L23A 2CLVA 3QJQB 4JM4L 4O02B 4AITA 3TNMA 4XNQB 1P7BA 2ZWSA 1OWWA 2N3JA 4ES9A 2EIZB 3WIAA 5DD5H 3VFWA 4M8QA 4JHWL 3ZQXA 3CFIC 4G8EA 3WS3B 3LB6C 3PAYA 1HHIB 3T2PA 1YMHB 2PCYA 3G6JB 1QLEL 4OV5A 1FORL 3QYNA 3HC4H 3BP7A 5ICYA 4JO2L 2ODIA 3RWGB 4KO9A 1FVEA 3HE7C 3KXFA 1HXKA 3V95A 5DUPH 3FOMB 1XFPA 3B2MA 3I85A 5C0GA 2ETWA 1N19A 4HKJB 3CXHJ 4G7SB 1VGEL 3VRLE 1BM3H 3JXAA 2FO4B 3NQKA 4U1GC 4NN7B 3VM7A 1NPJA 1I7UB 2X4UA 2XHNA 4OBSA 5FDWA 1PYWB 4IRJA 1SDAB 3L9BA 4Y5XB 1A9VA 4IRZL 1MPAH 4ZAKC 3S5LA 5KS9B 1BJMA 2XTSA 3LZFL 5E8NB 1GZPB 1XGRB 3B2UD 3BJ91 4NUPA 5GS0L 3S9DB 2DQEH 4HIQA 1ZSDA 4YDNA 3VQLA 2H26B 1IX2A 4PGEA 2WUBH 4N8PA 3BPOC 3GJFA 2ZP0T 4GS7C 1C5CH 5E4AA 3O6FC 2P8LB 2J44A 4HBQA 3V0VA 5IMKA 2WOBA 1DBML 2HFGL 2XZAH 3LDBB 3F58L 4JQIL 4LLDA 4H0GA 3EGDB 3EFOA 3EJZD 4BJLA 3MLUL 1P1VA 3GIVB 1I9IL 4IIZA 1Z3GL 2CXGA 3AS1A 1FZKA 3JSSA 4JFTA 4UT9A 3NCFB 1U8JB 3GXFA 5GS2H 1OPGL 3SJVB 3G08B 3V7AE 3CX2A 1U3HC 4UAOC 4ZG1A 2J3SA 2VXTL 1A7PH 1Q90A 2H2SC 4P99A 4QHUB 2PCXA 3C6LC 3ZXAC 3RE0A 1JRHI 2ZUTA 1MEXL 3IETA 3M86A 3SYCA 1JGLH 4UTAA 4K3DH 4XGZA 5JW3L 4QGYA 2H0PA 4PJIB 1EUTA 3PPEA 3VRIA 1ZLVH 4G3YL 2A83A 1N8ZA 2ZOUA 3L9YA 1CFSA 4OIAA 5BJTA 1KYOJ 3MFFB 5K1JA 5T1KB 3MRIA 1TXKA 3K8LA 4HXBH 1VESA 3Q3GA 4H1LB 1AIFA 5IFHL 2EQDA 2L7EA 1I8AA 1MI5A 3ZIYA 4ZFOA 4MLIA 3DIFB 1F2QA 5MEOA 3VYNA 1XWVA 1RUAH 2R9HC 4L3AA 4OAWB 5D2NB 4W4OC 4XPTL 5TE6H 3L3IB 1PDKB 4KKLC 2BSTA 3RI5K 3W5MA 3ISWA 2FE0A 5FGBA 5ESVA 2OV0A 5F89B 3P3YA 4U1KA 5AYUH 1HQ4A 1B2WL 3T3PB 2F9BT 2IMNA 3AS0A 4OH2A 4PV1C 3IDJB 2NW3B 1UM5L 3GSUA 4AYFB 2WWNA 1HEZA 1KLGA 2R0ZH 5ACZA 5GRJL 1EO5A 1FDLL 4UIMB 3RGVA 4P3DB 3T1WA 2KBGA 1BYPA 2JV6A 5CEYB 5EU6D 1LWHA 4X6FA 3S8FB 1R47A 4JM2C 4NIYE 1HXYA 3FMGL 1NDMA 2I9LA 4HCFA 3U9WA 3DSNA 1GTNA 4MD0B 3FSWA 2QV2A 3G6DH 1OAXL 3PGDA 3V6OC 2JKWA 4IIQB 2GPZA 4JKMA 2Y2WA 2PCFB 4M43H 2IGTA 2NZIA 4P2OD 3S35L 5I1HL 1EJ8A 4UNTA 2F2HA 5ESQB 3VE0A 2CD0A 3BW9A 1BQHA 1ZT4B 4HUXA 1CI5A 3FRPA 2FHCA 3M1BA 1Q0XL 4R83A 4FQJH 1QPPA 4X7SL 1TZIB 4P0DA 5JYMA 1ADQL 4F8OA 3IMBA 5IVNA 2HX9A 3K6DA 3PAUA 1N64L 3C5ZC 3GLZA 5L6YL 4HK3J 2YD9A 4J6RL 2DQCH 2EXWD 2G5BB 4XXDB 4W9IC 3QQDA 3TH4T 3WXVH 3IRPX 4JO3H 3SPHA 2OYMA 5F7UA 5JORA 3DECA 4TNWF 2WD0A 4YSPA 5E1AB 5F1NA 1JPEA 4OGAC 4PGZA 1VCBC 5IB3B 2ADJA 1JZEA 2EYTB 4UM8A 4RMVA 3GIZL 5DQ9A 3TBWA 3KYNA 5EU6E 3RFRA 1T3FA 3BN9D 3VTTA 1ZMYA 2DTSA 4JE4B 2VN6A 1M1XA 3VD3A 6FABH 2QLVB 1JXJA 2DOCA 5EOQL 3RVWC 3VQMA 5D7IE 5I8CA 1DJXA 5GSVB 3BVNB 1FIEA 4N6RA 4R7DA 4YEEA 5EF3A 1WAAE 1MHCA 1N0XH 5DRZA 3L9EA 4AYBA 4JDEB 4Z77B 4JFVA 4J3WA 3GSNA 1A4BA 5I75B 4IKLA 5T3ZH 3WEBA 3GRBA 1I9EA 3GNMH 3C8KB 4YSOA 3Q44A 1VADB 3HTLX 4J12A 1U91A 2WZAA 4GAGH 2R2BA 2OYPA 3ZQWA 4MA8L 1RJZA 4I87A 5CJBA 2QPDB 2V5SA 4LQFL 1EZLA 4Q74A 5TDOB 3C8HA 3E8UL 5EU4A 1J0HA 2YLHA 4X7DC 4PS4H 3IKCB 4NZRL 1UVQA 5KBDA 1XGYH 3QDJB 1G7QA 3DYPA 3IFOB 2PO6B 4LFHD 1MFDH 3NJNA 4DERA 3ILQD 2ARJQ 4EQ3A 2PR4H 4LVEA 1GGTA 2XKNB 5HHPB 1U93A 1MWOA 5BOZG 4K07A 3HBZA 1YNTF 2OYLA 3E80A 3L3KA 2YQBA 3AU1A 3GRWL 4GIAA 4G9FD 1G6VK 3QE5A 4YIQA 4NXSA 4PJ5D 3U30B 1VFOA 3FT3A 3L13A 4LSUH 4JREB 2VCOA 3BXNA 1WC7A 3NFSH 1WIPA 1QWNA 4NKOA 1DQDL 3DETD 1AR1D 3MRHA 4YHKL 4KITB 3QJHA 1SM3L 3DVNA 4FCAA 2ZKYA 4U1SA 1LO5B 5DFVD 5INCB 1AFVL 1D5MA 1N0LA 3IJYA 3LY6A 4WLCA 3T08A 4XXWC 3BZEB 2DDQL 3O41B 4LPYA 1MHHA 1XD1A 4FXGA 3PF2A 4JW3A 4PRNA 3N6YA 4RAUB 4BFRA 4I2XE 2XTLA 3QHZL 1QX1A 4NQCB 1H6FA 1JZGA 1AY1H 4HF5L 1EDYA 3BWSA 3DGDA 3WAJA 3BEVA 2MJWA 5GRYA 4ONFH 4OZFG 4GLRI 2OI9B 1E40A 4N68A 3SGKC 1S7RA 4BFIA 1SOSA 2BP8B 5AB2A 1R46A 5AVUB 5D1XA 2MMXA 5MENB 5JIMA 4U1NA 3MV7B 4AJ0A 3HAEH 1CFQB 2Y7QA 2EZ0C 4PM1A 4M3KB 5HYJA 4WENB 3BSGA 3V4PH 2XNAA 3QO1A 3JV0A 1L9RA 4KVNH 5D7KE 4W6WB 1WUZA 3UC2A 4MNGA 3FO1B 3UZVA 1VCAA 3A23A 1INEH 2ICES 1JFHA 2XWEA 4G9FE 5SX4I 4Y5VB 5LCVA 4PJ5E 3SPGA 4QTIH 2Z91A 2DWTA 3Q1SL 1FCGA 4M9OA 5CF3A 4RGNB 2YPVL 3T0EB 2W5PA 2YSTA 3N06B 5JUEL 3TX4A 2OKMA 4OB5H 4MD4B 5D9SA 1J12A 1FG2A 5E8PB 2CUMA 4MXVF 3HUJE 3HCVA 4CBPA 3APNA 3SDCA 1JGIA 3G5VA 1S2EA 4BZ2A 5E6ZA 3AWEA 3AG4B 3HB3B 3G5ZA 3NG5A 2EDMA 4F15C 5JHDA 3LZQA 3NCYS 1A7RL 2AC0A 2Z0UA 3KH4A 1D6VL 4OLEA 5A2CA 1MFBL 2VLKB 5IQNA 4OCMC 2IPKA 3ZDZF 1MLCB 4EDXA 1MZYA 5BS0B 5GRWA 2VSCA 1X5AA 4TTDC 3OKDB 3O0LA 1FFNB 3LNGA 1NSNL 1BIIA 3ZTJG 3VU2A 3OKLB 4IU3A 3UYPB 4JFDB 3US1A 2P5WD 2DMHA 2AK4B 3FQNB 6TAAA 4WTZG 2RALA 4P2AA 1AP2B 4OI7A 1OIOA 2DLFH 4XH2A 2NXYC 5D5MA 3OAUL 1H3PH 3UMTA 2WN3A 4QXGH 2FX9L 4AENA 2IXQB 4KTEH 4K7FA 2E7LA 4KUCF 1QFPA 4U6YA 1V7ML 4R26H 2CUHA 1VFBA 1GAFH 1PLBA 3WNIA 1W72B 1E2VA 5E00A 5BRZD 1JBJA 1T1WA 2AXGA 1T2QH 4PREA 1G6RH 3INUH 2ZNWA 3GXUB 2BIPA 4WO0A 2DQGL 3CQPA 5C3TA 4NNPL 1MCJA 1QMUA 3NZHL 1N18A 4O58H 5D93C 2OP4H 2DYPA 5K33A 1N12A 2ICWB 1I1AA 5HVGB 1N68A 1FFQA 3D3VA 2NY3B 3VMNA 2BW5A 4ZQKB 4X0NA 1J87A 2QLYA 3RIKA 4OD1H 4RFOH 3DV6B 3MCYA 1FZJB 5E6IB 4LEXH 3ARFB 2IH1B 2WNKA 2YQ3A 3DTXA 4MJID 3RIFF 1IQWH 4YZFF 2I7OA 1NCDH 4H1LG 4Y19B 4U4IA 3I6KA 4P05A 2A9AA 3H2PA 1QABA 3FTXA 5A2LH 3NK3A 3J07A 3O6LL 2H45A 2L04A 2P5WE 4EMZA 1KB5L 1KGJA 2CO4A 2VDPH 1PZUB 2YZ8A 1BAFH 4U1HA 3HNVL 4RMTA 2OXGA 4YR6A 1KMGA 5F7NC 1KF9B 3OR6A 4YDLB 4YDKL 1IIKA 1FN4A 1UD3A 2W9DL 3VXMD 5C0BD 4I88A 1MHEA 1FZMB 5BRZE 4UM9A 5CLYA 2B08A 3CN4A 1TEFA 2WKGA 3EJYC 4F2ME 4H8HA 3NN8A 3NEXA 4NLAA 4BSVB 5ICZA 2MOGA 3ZTNL 3RL1A 1UD4A 1I1YA 3HC3L 1ERNA 3DOSA 3MRCA 4LLAA 4GUQA 2PLTA 4ZOCA 3ZDYB 5D6CB 5KYUB 2AEQL 2BXYA 3CXDH 4NGHH 4ENEC 3BZDA 1E90A 3I9AA 4ZYKA 3OKKA 1YUHA 4PIBA 5G2NA 5ITBL 2CMRH 5F7DB 1M7DA 2EEFA 2C9UA 5J6GB 4Q8BA 4XRCA 2GT9A 4LBAA 1U6AH 1JF6A 5A2BA 3FSVA 3EH4B 4I4WB 4JJ5B 4XI5C 5CZXC 4RBPH 4MJIE 3LZRA 4J2XA 1VJSA 4H26A 3QUMA 1CD9B 2XQBL 5KTEL 4F80A 1ND0A 3NIGF 1TQUA 1TJHL 2Y25A 4KXBA 3ZKMD 1RHHA 4EN3B 3T2NL 4KJWC 3S4SB 1FNEB 2CIIA 4B60A 1JPSH 3AROA 1ET7A 5DUBB 4TVPH 1LM8V 3E2HC 1YMMD 4H20L 3TLRA 3FO2B 2ESVB 4U3XA 3FUEA 3FBKA 3VXME 5C0BE 1OP4A 3L1OH 3CDGA 1T7ZA 2AVFA 1FPTL 2DICA 4PPTA 4UILL 4BXSV 3BH9B 1ACXA 2FATH 4DEPB 2CRIA 1A6AB 4NFBA 4R7NB 3EZ8A 3MRFA 4L4TD 4MFHA 3LRGA 5T1JA 1IGIH 5GRZA 4EI6B 3B9AA 4Y2OB 2EKSB 3WIIL 3I9PA 1CD1A 4AQ1C 1FBIH 3ULVL 5IHWA 3MODH 5JQIB 5LLIC 4O2CA 1J1OL 1JN6A 1V8HA 2DH3A 1R75A 4N2OA 4PRIB 3BSHA 1MRDH 2D0GA 3QIUB 3RWCA 4YEFA 1AC0A 4N4YB 3WLBB 5CR1A 3RX5A 1QTYT 3VD2A 4F5CE 2FSEA 3CXFA 2PYEB 2QSCH 5ICXB 1R9FA 4XBEL 3S37X 4X9YA 5PCYA 3HMXA 5DZLA 2LFEA 3QUGA 1QO3B 2WAQA 3PHOB 1MJ7H 4AYID 3P73A 3BT0A 5K1NA 1YMME 4QAWA 5I76A 5IHLB 1HI6A 2ODHA 4MJ6A 3O3DB 1TZ8A 3O4OC 3Q2NA 2FNWA 4PI2A 1YQ2A 2HLAA 3K3QA 4F8PA 4GP8B 3FZUD 3D18A 5C0EA 2E7MA 4KI5D 4U6HB 2E86A 4LF3A 3QUXA 2D9QB 4L4TE 1U8LB 3ETBF 1BEXA 1Z7JA 4I48B 4BZYA 4FF9A 1HE7A 3PE9A 5DJ2B 1KPUA 5H4YA 3V0WL 4Z5RB 1KTJA 3IE4A 1J5IA 2VM9A 3EOBB 2ZUQB 2JKRM 4JGUA 3GUTB 3MV01 4XPAH 3T4AA 2P28B 4MGXA 5BRQA 2BSDA 1QI3A 3LS4L 1WZKA 1T21B 1PCSA 1TTGA 4L5FL 5F7HA 5A1AA 3DUHA 3L2MA 1EGJA 2VZ3A 2Z7ZA 2MH4A 2NCEA 2Q8BL 5SWQA 4X4YA 3R4RA 3D4ZA 4CVXB 1M7IA 1NCAH 5EN2B 4XCEA 1OT2A 5J3HD 1QZNA 3EUUA 4RQQA 1ORQA 3CX5J 3WS6C 5ANMB 4DSYA 4MBOA 4WJ5B 2WYIA 3TCLB 3P3RA 1KXQA 1TO4A 4WW1A 5MEQA 2WXOA 1WG3A 3IJSB 4XMPL 1O6SA 2CDFB 4HMEA 2DM3A 1CF8L 2R0WL 3I50L 3X1GA 5GZOA 2EE6A 1OT4A 2OXHB 4Q6IC 3ARDD 2GITA 2VXUL 3PABB 4JO1L 1HILB 2VXVH 4KI5E 4LP8A 4UQ2B 4HFUL 4URTB 4DP2X 1H6UA 2DJSA 3ARZA 2BVUA 4PR5A 5B21A 4F37K 5L2KB 2IQAB 4UBDD 5CGMA 2V2XA 3BJLA 4GW1A 3FH7A 3UTSB 3QIBD 4XNAA 2C34A 5EO1B 2NY5C 1ET8A 3MNWA 1LEKB 1BXAA 1RLWA 3P9MB 1F4HA 4YDIL 4OSUL 3FQWA 2NY4B 5BVPL 1JD7A 1MIEH 1IARB 3H0TB 3L7EA 4IRZA 2BY0A 3G6AA 4IJ3C 1U21A 5IBLD 2J43A 1U0QA 2ZAGA 4PGDB 3UAAA 4OCXH 4AKPA 4BGDA 4L48A 3GZKA 5T3XD 4P2QB 2X44D 1OP3H 1WICA 1CL7I 4S2SA 4E42B 5I1LA 4K9EL 2R56H 2HX7A 2F74A 3ARED 3ZLQC 5DMGC 1SXZA 1T2XA 2JB5H 4AQZA 2IDFA 1KOAA 2KZKA 2R4SH 2WBKA 3MV9B 3Q8AA 5E1QA 3VFGH 5EEYA 3EGSA 1RZ8B 2H32A 4OI9A 3ZPDA 3MLTA 4QF1B 5IEHA 1HINH 1X9UA 3FB6A 1Z0NA 4O5LH 4OTXL 4QWWC 2BOCB 5IMOA 2C9VA 3IDIB 2DIEA 5HP5A 1WFMA 3BIBX 1QTSA 3ASNB 3LEYL 1NEUA 2WIIB 5EHFA 4L0ZA 3TBTA 5D5MF 5C0DB 2NY1C 6PAZA 4M7LT 4EIBA 5HYSA 4IRSD 1R17A 3GXNA 1P9MC 2OW7A 4A6YB 4NUGH 3CGTA 3GHPA 4PJ9B 4F7MA 4KKAC 3F00A 1MSPA 4OJCA 1D2PA 1T0MB 4MQTB 2DWEA 3RGVC 5TD4A 3PL6D 4IGBC 4M6OL 3OGOE 1KYFA 1JRHL 3WO4C 4AJYV 2E8ZA 3QQ9D 4E0RB 1AD0A 4XVSL 1P6WA 2HT4D 4KKNA 2Y7LA 3BGMB 3I9IA 4NNXB 3HS0B 4UDTA 2NQCA 1S7QA 2N01B 1WH0A 1MIMH 4HYTB 3A6OA 3LN5A 4QRQA 5T3XE 4HIIB 3PUCA 4X2UA 3T0WA 3R0NA 3CPLA 4BQ8A 5B1KA 1AYRA 3CIQA 1F4WH 1OF2A 2XFXA 4NKMA 3IRCA 4UT7H 5IB4B 2YGPA 2FJFA 1PZSA 3UTZA 4NENB 5C0RH 4I8DA 4N6QA 4WGVB 4L37B 5IB5A 2WQXA 3T6QC 1QEWA 1M3IA 4CU6A 2ZSWB 4FFVD 4EIUA 3FTUA 4KU1A 2FWLB 2ZWZA 3ZKNC 2CO2A 1TVBA 4HPYH 1OP9A 3L1GA 4LLYA 4Y4KC 3ALWA 1DBAL 2YARA 4KQ4L 3ILDA 3IFPA 2MHAA 1JSYA 1SXCA 4U1MA 3A67H 5DGQA 3UJIH 5KJRL 2XUWA 1IEAA 2JF1A 2IWKA 1UQSB 2XN1A 4W9LC 1GPOH 3N1FC 3CC5B 3CMOL 1V54B 5JHLL 4PJ8C 2OL3B 4BH7B 1MCQA 3KEHA 4P2YA 3QCUH 1J9QA 4LASH 1U8MA 3MLPA 3T0VA 4NIKB 1F4AA 2ZXAA 3GC3A 1SJEA 3ML9A 2J8UE 4WEBL 1YEWA 1PIFA 1XCWA 1FRGL 4YSRA 1CLOL 4IQHA 3GLDA 2B4CL 4FNPA 3VNYA 4AGMA 2FT8A 1KB9K 1NM4A 5ACMA 4WWKD 4JQXA 2XTJC 1SF3A 4DVBA 3REVA 4MHHI 3MHZA 3ATEA 3UL4A 1JNLH 1BGXL 1AKJA 1Q9OB 5CJQL 5ERWA 5E7BA 1H5BB 1ADQA 5BQ7A 2IAAC 4DP1X 5IVXB 2Y7MA 2GBTA 4ZODA 4AMKL 1VSCA 5INDA 1MCKA 1A02N 2NR6C 3FW6A 4ZNEA 5KVEE 1BLNA 3P0GB 2C9SA 4AEEA 4CSSA 5DZNA 3S4SG 1RFDL 3CVIL 2Z65C 4NEHB 3LPGA 3MJ9A 5LG6A 5IEKA 5D70H 1SEQH 3S5ZA 4KRNA 4RDBA 4X9HA 2OMWA 3O81A 5H35A 3DNKA 2YEQA 3OKEB 4OFDA 3MV8A 1FIGL 4KMTL 1MNUH 1OW0C 2MCMA 2B5IB 1UJ3A 5DZPA 3T4YB 5JA8B 4UINH 5HDRA 2V4LA 4P46D 4CDHA 3KBPA 3C2SA 3V52L 4K3HA 1N70A 4NP4H 3T3MF 1FA4A 2VDQH 4HWEL 4NZFA 1RZKC 2Y69B 3GKZA 1KWKA 4LCWB 4TLTA 3TNNB 3IS0X 1D9KD 1N2RB 3BN3B 1OCOB 3NFNA 3QEGL 1ONQA 2BHFA 4FXGC 4J3VA 1MFUA 1LEIA 2YUWA 2EH7L 3X3GH 4UANA 2XC8A 3CFJA 3BUDA 2JJWA 2V0AA 5H37H 1JF1A 2V5YA 1DLHB 3BMVA 3PGCB 4PRPD 2Z0BA 3PWUB 4OGYH 5A16B 2KL6A 4M62H 4A55A 1UH3A 1FSKC 3HE7B 3DOHA 2JLPA 2CDGB 2CHZA 3IXTA 1H6EA 2YEZA 3V8OA 4BXVA 4Y7OC 4Q9BA 4F58L 4WW2A 1CDUA 3LS5H 1NLBL 4FA8A 2VO8A 5DO2D 2GTWA 3TO4B 4HG4K 4IKJA 1X44A 4U1GB 1YEGH 3CDFA 4UZGA 5DD6B 1G94A 3ZDXF 2BZDA 3CD4A 4JRYB 1RZFH 4MXWL 2E6JA 4IBLT 4OIIL 1OAZH 4LEEA 4GXUM 2ZPKH 5SWZA 3VSTA 4LCIH 4XMKH 1O6VA 4PV9B 4EXPX 4ZAKB 2NYYD 3ARGA 3B9DA 3FU9A 5CZVL 2KPNA 3PV6B 4H13C 4GUPA 4GRLD 1E43A 5DSCA 2WXRA 1NANH 2CO7A 1IZJA 2LU7A 2R2HA 5AKRA 3BPOB 4OUUB 1SHXA 4Z95H 4FX5A 1PF3A 4GRWB 4GS7B 1MQ8A 3BISA 2JK5A 3O6FB 3SDCC 3T1FB 3ZL4L 3I2CL 3P0YH 1IC0A 3K74B 4J3OD 2NY5H 2YGNA 4APQA 3ZY7A 3L81A 4HUVB 4M61B 2FL5B 2QHRL 1XSOA 2UX7A 3W39A 2VB5A 2NNAB 4JKWA 4PRPE 2QEJA 4JKPL 2O4EA 1NCBL 3OLEA 4LB8A 4YFLI 4AE0A 7TAAA 3C6SA 3ZRFC 2AJUL 4UAOB 1U3HB 4ZMQA 1UGNA 5CD5D 3OB8A 5CIPH 2VLRA 1CLCA 2CA3A 2G2RB 5CCKH 5E8OA 2WWMC 3C6LB 4DCQB 2IQ9L 5I82A 3SO3C 1PAMA 1U8OA 3RP1A 4ZS7L 4HT1H 1YYLL 2DQFB 3GI9H 2J1YA 1AGEA 3LCYA 3DK2A 5ECJE 4J28A 4HSCX 4TUJA 1PLCA 2V5RA 4M6ML 3VYPA 1B0IA 2XACC 2YPVA 3BFQG 5E08L 3H85A 1NBZA 1A5FH 3AQXA 3DBXA 1J8HA 4G7YH 2XQYG 3MV11 3ECBA 4W9ZA 1UCBL 2DQIH 5AZEH 3P30L 4L3CB 1A6WL 3MOBH 3IDGB 1UD5A 4UDUB 1RK0A 1MRFL 3FQYA 3KJ6H 3CQQA 1DZ0A 4N3UA 4QGTA 1TZHB 5I5MA 4KHXL 2BC4A 1IGFL 3H3PH 1NGXB 4B3VA 2NUTA 2A5UA 1I85A 5LXGH 5FCUH 5AKSA 4JY5L 3U0PA 4LHUA 3PHSA 4N2DA 1R5IB 3OZLA 3K8MA 5KSVA 4KTYA 4YXHL 4UIKL 2AI0H 2KMWA 3TIDA 2LW3A 1KJ2A 1O7SA 3TBSB 1IUZA 4GI6A 2CGRL 3QWOA 2A0LC 5DVNA 2JQZA 2W59A 3ZO0A 1KEGL 4XMLH 5DRWA 5LAXA 3KDMA 1AO7B 3IE9A 5EUKB 4BDVB 4JM2B 3QIWB 1UYWH 2IBZX 1ORSB 4JPWH 1ZLVK 5ACLA 3U7WH 3ZT6A 3S37L 2FUTA 3RUGB 1DVFD 3AC0A 4J2QA 5D7HA 2V9UA 5EU6A 4OCYL 3UJJH 1W8NA 2Y1AA 5E0FA 1ZSHA 4D7BA 3BZ5A 1VAHA 4B7IA 1F6AA 2X3BA 4TMPA 4FABL 1YPZB 5F7YC 3IVKB 1V7NH 5IHZB 4OZHA 3CC1A 1UM4L 1FO0H 2M2DA 3QUZC 3UO1H 2VZTA 3C2AH 3OKYA 4PRDA 4U0RC 2GSIB 3RG1C 5LN4A 5IMLA 3W57A 2VR5A 3HI5H 5MI0C 4Z7UA 1P4UA 4U2ZA 2G3ZA 2JKNA 4P2OA 3C5ZB 5IM7A 3DRQB 2LU5A 2Y5TB 3WIHL 4UTBL 4CJ0A 5IGXL 1OCCB 1F90H 1KB5A 4XVJL 1T1ZB 4R3SA 1SBSH 2XZQL 4QY8B 5E9DD 1W6LA 1X5YA 5DT1H 2EILB 4S0TD 3BAEL 4NLHA 2Z93B 1NUNB 2R1XB 4TVSa 3PGFL 3BKJH 3QA3B 3MUJA 4GG6A 1ET5A 1UWXH 2AKRA 5B7EA 3VXNB 4POZD 1GGIH 2ZJSH 1AOZA 2YBRA 3BESR 2E9JA 2K7QA 3K46A 3GSVB 4FQXD 5T1LD 4B53A 5DQDL 4WHTA 3BDYH 1EMTH 3X14A 4YHML 4JDTL 2VDLB 5ID1B 4LCYB 4NQSA 4R4FL 3UGEA 4IBVA 4HWBH 1E5ZA 1A7OL 5B39B 1V3LA 4ZJ9A 5EC2B 2EUXA 2VDNB 4QKXB 2FBJH 3EIFA 4G8FB 1IO4C 3ZKXC 4V11A 2BIQA 3SBRA 1ACYH 3DX0A 1BXVA 2W0FA 1MRCL 4CW1B 4I0KA 4LHQB 3V9FA 5LBVA 2OTUB 5DEFA 4OM1H 5CUSL 4HCRL 5F6HI 4TLKA 1ZXQA 2BVQA 2CCWA 2B59B 4PLOB 4X6CA 4AXWB 1DDTA 1OM9A 2JI1A 1INQA 2K45A 3SPCA 3EOTH 5FK9B 4I2XA 5EDXA 4ADJA 4FQIH 1MY7A 1IE5A 1WS7A 2K8MA 4KH2A 1I8LA 4JMNA 5IIEB 3VG9C 3TWYA 3ETBJ 2H7WA 3QEQB 4QPEA 2P5EB 1OB0A 5E9DE 3WNNA 2WUCL 2IAND 2EYSA 3RNQB 4JN1L 5FF6A 3QFDB 5IQ7H 4ES8A 4PG9B 5HYQB 1CCZA 3X12A 3LPWA 2H1LM 5KANI 4Z8FH 2KKQA 4H25A 3HG1B 3O4LD 4A39A 1F1AA 3W11C 1LP9A 1ZDSA 1DZBA 4L8BB 4NNYB 3UZQA 1Q9WA 2ZSVB 2BP0A 2ZAIA 4UQBA 4HUCA 3PXJA 4DT2A 4AC2A 1HSBA 3ZTEA 2CIKA 2CK2A 3FPYA 3HFFA 5I1AB 3O2DH 2YA2A 4OZGE 4N5UA 4G2AA 4JPKH 4XCYA 3T09A 1DEDA 2YRLA 2WP3T 4PJ5A 1Z1WA 2FLBT 1TVHA 2BWQA 4MMYB 3VXRE 3STZA 2V2WA 1QZ1A 2K7PA 3SKJL 1TTFA 4N9GA 5TDPA 1JK9B 3T4AC 4IOSA 4PWJA 3D0LA 1J1XL 4U7MA 3HUJA 2I24N 4DP6X 4XPBH 3K6SB 4HSAC 1T0NA 1Q9LA 4ONGH 1OE3A 2NY6D 4FYQA 5DLML 3SGEH 3K0WA 4QJ4B 4HAKA 1E3ZA 3DVIA 4FP8H 2YHGA 3FF8A 4NHUA 4RRPG 1IC1A 1PJ9A 2AXWA 3IK2A 2IANE 4XNYH 1Z9LA 4BM7A 1NKRA 2VXSL 2XBTA 2ZYRA 3NJVA 4L3EA 5LKNA 1CQKA 2Y7OA 3QWRD 1YNLL 3IFLH 2I07A 5CJOH 3CV5A 3O4LE 3V9CA 1QWHA 2UZIH 5GRUH 4WW2F 1ASOA 3QP3A 3KNBA 4Z3FA 2V7NB 4MYPA 3EDDA 3D30A 1WBYB 4X6EA 5GZOC 2P8MA 1GZHC 3VX1A 5KSAA 3ABZA 2DJUA 1VKXA 2DM7A 3W0WB 2F19L 4X4KA 4I18A 3U9PH 3F7PC 4B5ZA 2I26N 1M05B 1YEJH 5AOLA 4YVNA 5K93A 2GSMB 2ZUWA 4FG6C 5IVZA 5A3IC 1GY2A 4ZFFA 2W9LA 1MVFA 4EQ2A 4WI6A 3QXVA 3WIFA 3QEHA 4F15B 2XRAL 4WU7B 4DGIL 2XPYA 4RWYH 1C12B 3EJSA 1OTTD 3BYYA 4Y7MA 2B3IA 4HJIA 5ADPL 4PB0H 3W9DB 4OQTA 2F54B 3NVQA 1NMBH 3VFNA 2J6EA 2CWRA 3OG4B 4F91B 1KN2L 1E4XL 3FQ1A 4XWGL 4ZMPA 5JO5A 5DS2A 1NCCL 3GMPB 3M8OH 3GEFA 4NOBA 4E9RA 4GAFB 4EPSA 3I75B 1MFVA 1AMYA 1WZ1H 1JZDC 2NXYB 4K8RL 3SOTA 1QYGL 4C54A 3MKKA 4ODBD 4ODSL 1DL7H 4N8VB 1KJVB 2CLZA 1PBYA 1DEEA 2CBQA 4XP9H 3WEXB 1OOWA 1WBXB 4DP7X 2E9WA 4AM0Q 1C8PA 4GKNA 1E6OL 5EC1B 2YAQA 2VTFA 4N3TA 5CO1A 2ED8A 4ZDHA 3C5JB 4LNRA 1NUGA 2OMBA 4FQHA 5D93B 5I8EA 4Q9QH 3RJOA 3MRRB 4JPSA 3OKOB 1CICB 4NM8L 4DPRA 2P8PA 2YZ1A 4UU9B 4X8JB 2RR3A 5BRZA 3RDTC 1L7IH 4X8XA 5DA0B 3UTQA 3ULUH 2NX5B 1AR2A 1NFIB 3MRKB 1SHWA 2BNUB 2X10A 1P5VB 1LHZA 5KG9A 3DO7B 3W2DH 4I0CC 1IM9B 2PETA 4HJ0D 4LVHC 5CP3H 3BQUD 1WA0X 5I0YA 5KYNA 4BKLA 2KYIA 2P80A 3N04A 3MLXL 2YKLL 4JFXA 3UTTA 1RERA 2LTQB 1AS8A 5AOKA 3VA2C 5HPMB 3B2XA 2XWBB 4YWGL 3UERA 4X7TA 2NXZC 3C60D 1G1KA 3M17A 1A6PA 4ZFGL 1GSMA 1I1FB 2AEOA 5D7LD 1Z9SB 2EABA 1UCTA 5T5NF 3W81A 3EYQC 3S3CB 5L2JA 3BCFA 1ZHKA 3JTTA 1JIBA 5DHYB 4WTQA 3FU0A 2XN0A 4GQRA 4Q14A 3U7YH 3TYGL 5KVFL 5EZJA 4AL8L 3LKRB 2WLMA 2BSSA 3TVMD 1D5BA 3MXVL 4NXKA 3MO1B 3QZLA 4ELME 5F97E 4E68A 4EDWH 1Q94B 3VXMA 4HIJB 5C0BA 1R24A 1G5AA 3K4AA 5DJDA 1GYWA 1QW9A 4HX1A 3H7BA 3FT2B 4Z7AA 5BZDA 1EV2E 3JTBA 4XVOA 12E8H 5IBTH 1WQVT 4OZHF 3D4CA 1BPVA 2B3RA 2WZPA 32C2A 3VFTB 4Y16B 4EJ1C 2F18A 4XHQA 1BF2A 3U46A 2VC2L 3UEQA 1BVKA 3BH4A 3BPCA 3F5WA 3KCPA 1LK3H 5AW8B 3OMAB 4FHBD 4Z7UF 4XNUL 3H7LA 3LKPA 4XAKE 4KZDH 1SPDA 2R51A 2D4FA 3U1SH 1RIUH 3NOIA 4PJ7A 2SODB 3E9TA 4WI0A 2NY7L 1SRDA 3E2HB 3OAZH 1SLXA 5GGRA 5D7LE 1FFPB 1HFUA 1JCKA 4FQPA 1R5VB 1YEFH 3BAXA 3QEUA 1XEUA 3VW3L 1JYWA 1NGQH 3QXWA 1P0SE 5C07B 2ZWKA 4ZFZA 3O8XD 1CBJA 1QBML 1S78C 4GPVA 2JKSA 2MQ3A 5J1AA 1T89A 5I1JL 1M4KA 3NQIA 5I19L 3B43A 3O6ML 4P59H 5GS1C 1EXHA 4GG6F 4QOKD 1JZFA 4P9HL 3VFMA 3MX0B 1YNTB 3RY6C 1AGDB 4BRVA 1FZOA 4YDVB 5IQ9A 2YAEA 5IG7A 2ZUXA 43CAA 4KKBD 1Y7VA 1M9WA 3QQXA 2XYCA 1JPFB 2VWEE 4XMUA 1GYCA 4BSWA 3D0VA 1UJ3C 5I8KH 3UBGA 4OZIE 4RBPK 3IMTA 5E1HB 4JFED 4LSQL 2D0HA 5B39G 1K2DB 5HJDA 2AV1A 5B22A 3GSXA 4AZUA 1TVDA 3SSGA 1BX2B 1OGTA 2DQDL 4QNPF 2Z35A 4X6CF 1MAMH 2WXJA 3J27A 2CLVB 4QHNA 3TNMB 5E51A 3MRBA 3FTGA 5GISH 4B0MM 3CZKA 3VFWB 1QSEA 4M8QB 3SE6A 5CEZL 4G8EB 4AENB 4HPOH 5JTWA 3KWWA 1DBJH 2QSTA 5I66A 3Q2CA 5EFIA 4OV5B 2BRRL 4M1CD 5ICYB 1PCXA 1LP9F 2E9GA 4QOKE 4ZMVA 1FVEB 1XGUA 1YECL 3KXFB 1J11A 1NEZA 1HESA 1XF4A 3QZOA 4MCYA 3P3TA 1CXEA 2J88L 2Z92A 3H6AA 4BRJA 4J27A 3KYAA 4FFZA 1ASPA 3GK8H 5J1SC 4DK5A 5SV4A 4OD3L 4ODTH 5GZND 3TO2A 1RZQA 2X4UB 4U3CA 3FH8A 1ZKAA 5FDWB 3W1ZA 4Y88A 4ATTA 4XTRD 5FYJH 1M6OA 4IRJB 5EZIL 4JFEE 1IM3A 4AEHH 1H3VA 5K9KA 2A6JA 1XR8A 4LXFA 4IS6B 5ABDE 3WNOA 3HKZA 3S5LB 2WMPA 1NIFA 4RNRA 4EN2A 1HEJC 3R8BB 2HH0L 3ZHNA 4PRAB 3HUJF 1FH2A 1ZSDB 4ZW3A 5I1KH 1DDHA 4YC2C 4BUGA 4PGEB 3HRPA 5E99L 2ARWA 3GJFB 1QFUH 1XX9C 2UYLA 2A4CA 4KRPB 1F4XH 2OULB 4QJ3B 3V0VB 4Z1PA 4I0PD 3PJLA 2PTTA 3QPXH 4F1SA 5G4MA 4KZEL 2GK0A 3B2UC 2XWRA 1N5YH 2BHYA 3ZN6A 4NERA 3NEEA 3EFOB 4HIEA 4I5BA 1IC5H 2K9FB 1DFXA 1G0DA 2NDGA 4YPGA 5CGYD 5AW6B 4K7PY 3D85A 2GJ6D 4KMLB 4PTTA 5CJ5A 3BFWA 3UXFA 1C16A 3ARDA 3KAAA 4LRIA 4A63A 4JFZH 2DZEA 1BEYH 3EJZC 4YH6A 4ALAH 1H8SA 2I7SA 5D7SH 4YHLH 3SDAD 2IPTH 2UXVA 3EAKA 5L7XL 1VHPA 2J73A 3IETB 3GPSA 4MQ7A 2PP8A 4A37A 4XGZB 2ITEA 3TFBA 3WD5H 4YX2H 4GQPH 3BP4A 2AQPA 4AEIH 2VLJA 3W9EA 5LVEA 3HRZC 4OLXL 3VRIB 4LEBA 2K3HA 1DQKA 2A83B 1N8ZB 2A9ML 5CIPB 1C5BL 4UQ3A 1CFSB 5BJTB 3VWJA 3MRIB 3N1QC 2BFVH 1PZAA 1TZGL 3DHPA 3Q3GB 3FQXA 3EO0A 3OPZL 4YSAA 1AIFB 2UZXA 2HTKC 5DC0A 1LE5A 1MI5B 1U92A 5KZCD 4ZFOB 4MVBD 5MEOB 3I3DA 2BNQD 3ZO9A 2C4FU 1MF2L 1Y6KR 1DQLH 4DGVL 1U8IB 4WCYL 4NI3A 2NY1B 4BQ9A 2BSTB 3D50A 2ZNXA 4PP1D 4YSQA 4XCNA 5ESVB 4W70A 5HBBA 4FNSA 4RIRA 3LH9A 4XP1L 1HQ4B 4KDTA 1YEIL 2IBBA 1TQTA 1BQRA 3L3JB 2GJ6E 4KPHL 2K4AA 1HL5A 2KPWA 3GSUB 2ZCHH 1BREA 1HEZB 1KLGB 5FFOA 2ZG3A 5ACZB 2ISDA 3RGVB 2Q2LA 5H8DA 5E6UB 4FEIA 1WK0A 3FQ2A 4X6FB 2MKWA 4JY4A 3CFCH 4L2LA 5F7EL 5CWSB 1PY9A 4OCSH 1HXYB 1NDMB 1XSKA 2AQ3A 2I9LB 1IAOA 4DGWC 3DSNB 1WFIA 4GSDL 3BVUA 4I3SL 3TT3L 1OP3K 1B0RA 1UD2A 3PL6A 5C9KA 2XXMB 3PGDB 1P2CB 2KLRA 3RWEA 3OWEA 2ICCA 4PJDA 1B0WA 4CN4A 4WK2B 4X80L 4ZMXA 2R8SH 3EJRA 4DQOL 4DZBA 4YFDB 2WLYA 2O5ZL 3LZOA 1S5IL 1VFMA 1UACH 4N86A 2DJMA 2G4GA 3LKSA 3ZRSA 1DLFH 4HCGA 1OAJA 2BNQE 3AMLA 3IGFA 3VE0B 1BQHB 5FCSH 3FRPB 3NIGB 3M1BB 4TSBH 1IJNA 3WBDA 1QKZL 3WY2A 4DAGL 3VXUA 3HPJA 3VDAA 4FXKA 1SMAA 4P2OC 2WC7A 4HC1L 3QQDB 5JORB 3F6LA 4R7LA 3ARBD 1OAKL 1JWMA 3TN0A 1RSFA 2DN7A 4F20A 4WK4B 5F1NB 3A5VA 5BMFH 1AQHA 3IBEA 2EDDA 2ADJB 1T0OA 4UV4H 4UM8B 3TBWB 5KW9L 3GZQA 3CN1A 3KYNB 4LRNH 1T3FB 2YN3A 4OKVA 2E8YA 2EXWC 4PJXA 4CU8A 4CGTA 3K2UL 1KV7A 1M1XB 1ITBB 5LGJA 1T20A 3FXIC 4DTGH 4BFOA 3AXIA 5I8CB 3BLPX 4N6RB 4R7DB 5SWSA 3CZSA 1MHCB 5DRZB 5GGQL 3KWTA 4UYQA 4UF7C 4X99A 2B1AL 1EHLH 2XTJB 2A74C 3GSNB 2H1PL 3NIFE 1FLRH 1FGNL 3D2UD 1JVKA 4JN2A 1DUZA 5K59E 2WYZA 1LQSR 1I8IB 2YBGA 1E67A 4ABQA 4BHUI 3NH7H 4A04A 1NBVL 1U91B 4FFTA 3V55A 2R2BB 4PJ7F 5TPWL 1RJZB 4WWKA 1ZT1A 1Q72H 4ZW5A 4L5FE 5TQ2L 3WIHA 3F12A 4X9BA 1SN0A 1IFHL 1UVQB 4QCIA 2VXQH 4AH2B 1MFAH 1S3KH 1I8LC 2F1BA 2P48B 1G7QB 3V4VH 1MAKA 3GUFA 3D9AL 2RD0A 2D31A 3F2LA 3T8XA 1ZIAA 4HS8H 4ZUSA 2DY2A 1U93B 3GD1C 4TNEA 4OFYD 3L3KB 3AU1B 2PXYD 2VERN 1IAKA 1QRKA 2E5EA 2YQ2A 5FECA 1CLYL 4YIQB 2WBJD 4TUUA 3FB8A 3SKUD 3FT3B 3TESA 3BXNB 3O6KH 1WC7B 4RX4D 2YPKA 3ILQC 4KZCA 4NKOB 3B7TA 3LKNA 3MRHB 3QJHB 4U1SB 3DVNB 4ZPVA 1GC1C 3AAZA 3T04D 4BK8A 1NINA 1N0LB 1D5MB 3IJYB 3X3FL 2OMNA 4N2MA 5IFAL 2AK1H 3JTSA 1MHHB 1F0LA 3OZKA 1HK6A 2DW5A 4FXGB 4P46A 1VFAA 4PRNB 3WTUA 2EXYC 4G5ZL 5DDHA 2XLLA 2QQQA 5CLWA 4HCRA 3K2IA 4DGUA 5G5DA 3DETC 1AR1C 2WVVA 3I84A 3WDHA 2O5NA 4OT1H 3BEVB 2VDRL 3GSOA 3UDWC 3BUQA 1KG0B 5DFVC 1D9KA 2OMZA 1F45A 4PY7A 3KHOA 5BZWA 2YC1A 2W0PA 4BFIB 1S7RB 1FSKB 3EH3B 1IBYA 4I9WD 1WD9A 3D39A 1E9OA 3KVPA 4OGXH 5LJYH 5CBEA 3I02A 2HJKA 1ZANL 4QR7A 1NFKA 3ZYIA 2Y7QB 5DR5H 1F5WA 5HYJB 5HHMB 2BNRD 1NAMH 3BUIA 1KTLA 2XNAB 3QO1B 4P4KA 3WHXB 3VUAA 4EI0A 4MNGB 5HGBA 2JWYA 3UZVB 5IWLA 1KGYE 1R3IH 4H5SB 1IC7H 2C9RA 2E46A 4KBPA 1P4IL 4G70B 5D4IA 3RKDD 3BGAA 2Z91B 4Z7WE 2LU4A 2PWDA 5EBWA 5BUGA 5DD5L 1KCSH 3FU6A 2WLIA 4HLJA 2NRDA 4NZUH 4IOFD 4PWKA 3AB0B 5D9SB 4QD2E 1FG2B 5D4QA 5DD3H 2WO4A 4J8RB 4S0SD 2WLNA 4WEEA 3LVTA 3PWVA 3SDCB 3HC4L 3G5VB 4MCZA 3T0XA 4RZKA 2DIAA 3RHWK 4KOBA 5JHDB 5HTSA 4B27A 5IB1A 2IFGA 1TJIL 1BVOA 4NKIH 2BZ7A 3S5LG 3HZVA 4IDJL 4ZTPH 1BA9A 1BM3L 2IPKB 4MNQA 4HEMA 4XNQA 4EDXB 1OE2A 4GMSH 1Q1PA 3EHBD 8FABA 4I9WE 5DJ6B 1UJTA 1IEBA 5F88B 1FI8C 1G0XA 1G87A 4MA7H 1BIIB 2PN5A 4O2EA 4IU3B 1EO8H 1MPAL 3QG7L 4KH9A 2BNRE 5L88H 3H4HA 3SO3B 2N59A 4OF6A 3VH8A 1CURA 1DCEA 4XH2B 5D5MB 3QUHA 4AQEB 3AGWA 2DQEL 2VDOB 1TITA 1HHKA 4ZW7A 2WUBL 1YEDA 3MNMA 3O45A 4K7FB 1J0YA 1T6BX 5C70A 4N0RA 2V8MA 4U6YB 1N4XH 3R1GH 1VFBB 5F1IA 1R1CA 1T1WB 2AXGB 3HNSH 2XZAL 1TNMA 2YD3A 4PREB 4D9QD 4L3FA 2APWA 3G04A 1ZHNA 1IRAY 5A2KH 3KLHD 1YG9A 2DYPB 3EJCA 5EO0B 5C09A 1W0WA 3KPRA 3SYOA 4N0UA 4QTHA 1I1AB 5DURB 1JHKH 3D3VB 2XSKA 4UNIA 3W82A 1E9PA 1F4YH 3LXUX 5FDYA 1QNZH 4IBSA 4KDVA 4OU3A 2GCYA 1GZPA 1A14H 1XGRA 3EYUH 4I1RA 1PD1A 1A7PL 1NICA 3I6LD 1Z5YD 1J10A 1ZWIB 2Z31D 4FQLL 4P2RA 4ADIA 5IUCA 4PD4K 1MCOH 1CXHA 4KV5F 2FX8H 3DTXB 4GW5B 5HDLA 3BE1H 1FAKT 1AYOA 4Y4HA 3I6KB 2P1YA 1JS4A 4TNVK 2JQMA 1NFDA 1ZRUA 4H4NA 5CKGA 1D5IH 2V33A 1EAOA 1YAIA 1WWCA 1SJMA 1CR9H 1TCRA 5ADOL 2ZCZA 4GXVH 4W9JC 4U1HB 2OXGB 4YR6B 2F58H 4JG1H 4K73A 4HXBL 1ZLUH 3OR6B 1KBVA 2ARJA 2J71A 1FN4B 3AM8A 1MHEB 4JJHA 35C8H 2QKIA 4YXLL 5IK3A 4UM9B 4HEPA 5B3JE 3FCBA 1QI4A 1RUAL 1X5LA 3JWNE 5ICZB 2ERJB 2R59A 2XI9A 3NCMA 3RL1B 3MBEA 2QGEA 1I1YB 3MRCB 4FEMA 2OCJA 4M4PA 2CAKA 2LLLA 1CDGA 3QUZB 3ZE1E 5AYUL 4ZYKB 3T6ZA 1OVZA 3KEDA 3OKKB 4XX1G 1ASQA 3B7UX 1HQRA 3RI5F 1FL6A 1RCYA 4PJDF 2IG2H 3P11H 1M7DB 4XN4A 3FF7A