1J5EK

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1j5eK00
4DV7K 4B3SK 1IBKK 4LFAK 4JV5K 4DR1K 5LL6Z 4GKJK 2F4VK 4DV5K 4DV4K 1HNXK 2UU9K 1HNWK 4LFCK 4LF9K 4CVNE 4DV1K 3J7AP 2UUAK 1N32K 4DUYK 4DR7K 4X64K 5A2QO 2VQFK 2UXBK 4DV6K 1HR0K 4DR5K 1XMOK 4LF8K 4JI0K 4GKKK 4LF7K 5LMUK 3T1HK 2UXDK 4JI4K 4V19S 5IT9O 4K0KK 1XNRK 4JI3K 1IBMK 5AJ3K 4DR3K 2VQEK 4AQYK 4DV2K 3J7YP 1N36K 4LF6K 4JI7K 3J81O 2HHHK 1N33K 5LMNK 4X62K 3J80O 5FLXO 4B3RK 4LFBK 5IWAK 2UUCK 4DUZK 4DV3K 4DV0K 4X65K 4DR6K 4NXNK 4LF4K 1J5EK 4X66K 4YY3K 3OTOK 1N34K 5BR8K 4B3MK 4NXMK 4DR2K 4DR4K 1IBLK 1XNQK 4YHHK 1I94K 1FJGK 4JI5K 4JI6K 4JI1K 4CW7B 4JI8K 4JYAK 4LF5K 3JAMO 1HNZK 2UXCK 2ZM6K 2UUBK 4OX9K 1XMQK 4KHPK 2E5LK 3T1YK 4JI2K 4B3TK
chains in the Genus database with same CATH superfamily
4BDZA 3E1YA 3C6UA 3ZSVA 2Q3SA 3OHRA 4FOEA 4DV5K 2HW3A 3QIPA 2O8BB 3GE1A 1TKXA 1X9SA 1U45A 3QBXA 3K58A 5EOYA 4BC4A 3V1QA 3OYBA 1T05A 3WEEB 4KB0A 3AVGA 3WXJA 3AVBA 5AQRA 4CERA 2W6LA 3SQ1A 3ID6A 1YVNA 4CIGA 4OLBA 4LD0A 4AHCA 3HOTA 4CFBA 1ATNA 2GX9A 4CIFA 3KLEA 3RTVA 4V19S 5C25A 2HHVA 4JD2B 3AAPA 1NGGA 4KI6A 1RT6A 1C1BA 1FKPA 1WLJA 4IO8A 5KQDA 4DTRA 1VQ4N 1Z6RA 2OCEA 5AQNA 4FWSA 2QK9A 4FSVA 3S9HA 3NF9A 3G10A 4CJKA 3S3MA 5M1PA 3VQ5A 1HYVA 2JWKA 2OZMA 3LP2A 3VQAA 2AA4A 5H1SQ 5C24A 2VCPA 4LH5A 2F8TA 4AHTA 3K5LA 1RT3A 3ASMA 4ZHRA 3DMJA 4PL7A 4ILGB 4GV9A 4DFKA 4H0PA 4B8AB 4M7XA 4M3ZA 4JI6K 2G8IA 4AILC 4EHUA 3CCLN 4FLZA 1GLLO 2PYLA 4DTMA 2G8HA 4AM6A 4KTZA 1QHAA 3AVAA 1ASVA 3RVCA 3QEPA 3BF1A 1R0AA 3O80A 2W40A 4RTFD 3UKRA 2O8FA 5CZ2A 4CZGA 3D0PA 3MN6A 1BDGA 4H5NA 3VQQA 4KV8A 2GELA 1IH7A 1HRHA 1SS6A 3NDKA 4J8FA 3C94A 1SL0A 4CEFA 1KQSM 2F9TA 2NZTA 3QFUA 1BL3A 3CJAA 4FJGA 4DV4K 2UU9K 4CEEA 4JHDA 4DV1K 3ZETA 4AF1A 3P38A 3TANA 4JKBA 4NCAA 4CHNA 1Q8IA 3K9JA 4DV6K 3PO5A 3MX5A 2HBLA 4MDBA 4IOCL 4WE1A 4WCEL 1TK5A 4DS5A 1VSJA 1ZBFA 1RTDA 4Y0WA 3PIPL 3B6OA 4BGBA 1BGXT 3T1HK 4FM0A 1YUWA 3DAWA 2IAJA 3K59A 1WB9A 4L3QA 3QIOA 5HROA 2IIRA 3CJ9A 3CM5A 3RMDA 3KKRA 2YKMA 3WUHA 1KTQA 4WF9L 4BRKA 4AQYK 4EP5A 1BIZA 4IO9L 4RW6A 4CEAA 4ISGA 3A8YA 1YJ9N 1LWCA 4JN4A 4X62K 3UKRB 3NH1A 2QEXN 2O8FB 3M3ZA 1A5XA 3HSTB 2OPRA 1HQEA 4CZKA 1E3MA 3OTOK 5AQPA 3EZ5A 2GWJA 4KH5A 1MWKA 3HZ6A 2AP1A 2RE2A 4H5VA 2CH6A 4FWRA 4JHDB 4DQRA 1IBLK 2ETJA 2A42A 3ZETB 2ZE2A 1RDDA 3AO1A 3VQEA 3AVFA 4W5QA 2QI2A 3EKSA 3KWGA 3ZEUA 1YITN 1HQUA 3SAHA 1C0UA 4JI8K 3J7ZO 1JCEA 4JRPA 3OBYA 3DJCA 3GOIA 1J54A 1HNZK 1NGBA 1S9GA 5HOOA 1D4XA 3VQBA 3LZIA 5GAEP 5LY3A 3R1XA 3L2QA 2CH5A 3LDOA 2YJEA 1BOTO 3D2EA 3CM6A 5LL6Z 3B8AX 4BRPA 4FZZA 2E6LA 4I9LA 3BF3A 2P9NA 3NCIA 4HVJA 4C8NA 3U4LA 4X64K 4BRFA 2VGMA 3I33A 1A5WA 3MWPA 4B3OA 3F73A 4WFNL 4EAHD 3MCAB 1TKDA 4BRGA 4CZEA 3AA5X 1RNHA 5E41A 4DTJA 3QERA 1GOCA 3C6TA 5BPMA 1HKBA 1BCOA 5CYMA 1JLGA 4FJMA 2A41A 5C42A 5F2RA 1U2VA 4CEBA 4FJLA 4DHYA 3J80O 4JKGA 4ZTJA 3ZLJA 2W42A 2E20A 3CCSN 4DV3K 3VQDA 3A5NC 4MO5A 2V52B 5HRRA 4LF4K 4X66K 2JGUA 3OYJA 3D2EB 4OPKA 3RMBA 2X74A 4E89A 3T69A 4AHSA 2E4LA 3C7NA 2KFZA 5C12A 2P9NB 1P90A 5BRHA 2YHWA 2A3ZA 3U8XA 1ZBSA 1FW6A 1QE1A 5AQXA 4JKFA 3ZT3A 4FLYA 4CJ5A 3EY1A 1ZC6A 1XI1A 2HHXA 2E8AA 3H1VX 4H5TA 4FJIA 4B9LA 1U6ZA 4JK9A 4B8CA 2KW4A 4CJLA 2KTQA 4F3OA 3H6EA 4JRQA 2D0BA 3LZJA 2D0CA 3MN7A 1ASUA 2A1SA 4A61A 3HSCA 4G9ZA 3OYEA 1IKXA 4NO7A 3SBGA 4H0TB 3VF6A 4LSLA 4FJKA 1G99A 2XY8A 4IOXA 2P9PA 4WFBL 4HWIA 1X9MA 4H0VB 5F0XA 5B8HA 1VSKA 1NK9A 5FDLA 2HB5A 4FJJA 4BC2A 4Y1DA 1U2VB 3AA3A 4FJHA 1HNWK 1A5VA 3KLFA 1Z25A 3GG4A 4JKGB 4H8KA 1Q9YA 3SV4A 3TABA 3KKSA 2CGKA 3FR0A 1BA1A 1QZ5A 3RWUA 3WXIA 4K42A 4GVMA 5I9EB 1W97L 4YDUA 1TUUA 5LJVA 3MXJA 4GVEA 4C23A 3VPZA 3CFRA 4DSIA 3AO5A 3L2UA 3BGRA 4JS4A 4LSNA 3KK7A 3VQ8A 1D5AA 4CEQA 4YNQA 4OPAA 3PV8A 4F3TA 2FF3B 1HPMA 4CJQA 3CI5A 3CJBA 3T19A 4BRQA 3ZT0A 3VGLA 3MMVA 3HOSA 5C10A 3SMPA 2P9SA 4BDYA 1NGHA 2PFUA 4Z94A 1NGEA 1O1WA 4U7BA 4DV0K 1RDWX 2NLXA 1JLQA 4M3RA 2P9PB 4JK7A 1VSEA 3HM8A 1TYQA 3AARA 4DFJA 3AY9A 3MECA 1RT5A 5C0YA 4AM7A 3IRXA 5BRFA 3LDNA 4YFUA 1XNQK 1RCHA 3VGKA 3NHGA 5KTQA 3J8AA 3ATVA 4KB1A 1NMNA 3LAMA 4MO4A 1JLBA 1NJYA 1HJRA 4JI1K 3OA9A 4EZ6A 4JYAK 1NU0A 3O5BA 1WN7A 1WSFA 5AFUH 3FLCO 3HJFA 5DM6L 3SLCA 3SMSA 3TPQA 1RT1A 4HCCA 4M3YA 4PA1A 2HHQA 2UUBK 3V81A 2IVOA 2Q0UA 4KHPK 2Y1JA 1U48A 1UOCA 4KHWA 4H5WA 4O8UA 1GLBG 3HM9A 3TTCA 3QNOA 3M5RA 2ZF5O 4M41A 2VG5A 3L4IA 1DKGD 4AHUA 2P9SB 1HKCA 4M3WA 1LW2A 3QLHA 4CJUA 4QOZB 1VQ8N 2P5OA 3QO9A 4BR9A 3P4IA 1WBBA 4DUYK 4ILJA 3TAPA 3ZX3A 4B1YB 4MQ3A 4EHTA 4BR0A 1TYQB 4CF9A 3Q7BA 4LF7K 3MEGA 1QSLA 1MDUB 4KKOA 1U04A 2QKKA 4CFCA 4CBXA 1XHZA 3ENHA 2D5RA 1T8EA 3HBTA 3RRGA 2YJFA 1BQNA 4L8RB 5AZIB 1BIUA 1VSDA 1IBMK 1GLFO 4FJNA 3D45A 5AQTA 5KI6A 5AZJA 3SUPA 2NRWA 4H4MA 1N36K 3L3VA 3EE8A 4Z0UA 3HXMA 4K8XA 2A40A 4DSFA 1YI2N 1ZBUA 4CGDA 4OO1J 3IMXA 1ESVA 3CETA 5SZTA 3BEXA 1QQCA 3C65A 1TAQA 3ITHA 4F4KA 2QWNA 1NKCA 4M42A 1N34K 1BISA 3QESA 3O9RA 5HP1A 4FYDA 1RBVA 4CGGA 3IUCA 5AQSA 4DLEA 3VERA 3A0IX 4CJRA 1ITGA 2HBMA 1QVGM 1SZ2A 2QTDA 3K57A 3HTVA 4I6MA 3NBPA 3KWIA 4RW8A 5FPNA 4CK1A 2DFHA 3DRSA 4XH5A 1K6YA 3SJJA 1KLNA 2YNFA 3KVGA 3HI0A 3OYCA 4FK0A 2ZM6K 1GLAG 3DRRA 1KVBA 3ZSYA 3S41A 3CD6N 1M1KO 1NBWA 4CHOA 3THWA 1S1VA 4B9NA 1L3TA 5AZJB 3VQPA 4DTPA 4KTQA 2HSTA 3NVMA 2BANA 2JWLA 3SCXA 1BI4A 1SAZA 4FL9A 1HPZA 4DLGA 1N32K 3H46O 3N4PA 2YHYA 3THXA 3SAFA 1NJWA 1S9EA 3B6PA 3D6RA 3TWHA 1VSLA 3AVNA 3AGRA 1UA0A 3G0ZA 2B4JA 4FOIA 4FWMA 2GTDA 3TAQA 5K14A 5CE3A 4RW9A 3ZX0A 1H1VA 1HKGA 4QS7A 5GADP 3MAQA 4PY5A 4I6MB 3BP8A 1NG9A 1TK0A 2QWOA 2QW9A 4NYFA 3ULDA 3OYGA 5E84A 3TR8A 2FBVA 3J81O 2QXLA 1ZBIA 3NAEA 1J53A 3NGYA 1HYZA 4LFBK 2WFBA 2WBNA 2E1ZA 4GY2B 4DR6K 1VQMN 3THWB 3UIQA 4CHQA 3ENOA 4CEOA 5BR8K 2Z1IA 3PSFA 4H0XB 1BI4B 3P83D 3VENA 4J2DA 4FW2A 2P9UA 4JKDA 2G8VA 3DOLA 1FJGK 1E4GT 1KD1O 1ZBLA 1T6DA 4FWQA 3CMEN 3JXUA 4FJ8A 4XH4A 3THXB 5J2PA 1RBRA 3A5MC 4H03B 4ZTFA 4CHYA 3CFPA 3AO4A 3MX2A 4JAXA 2Q36A 3CF5L 3TAFA 4HUEA 4PL8A 1C1AA 2O4IA 3U9DA 4DQIA 4WFAL 4OPJA 2E2NA 1RBUA 1B92A 4B3SK 4B08A 4H0YB 4GKJK 1GLCG 2OANA 3OYAA 3VTHA 1UA1A 1BCMA 3VA3A 3LP3A 3MEDA 4GV6A 4U67L 4DTNA 4KHUA 5A2QO 4BE1A 3LANA 1HR0K 3K5NA 4GKKK 2JLEA 2IS3A 1LV5A 1ATRA 2P9UB 4B1ZA 1QS4A 4BVPA 3LWMA 5BN8A 1DGKN 3OS1A 3HP6A 3ZYYX 3NH2A 4DTOA 4KRFA 5M1KA 4I2PA 3C6HA 4BRDA 4FZXC 3K5OA 4IG0A 5ELZA 4FPAA 3C95A 3VQ9A 2DY4A 4OKEA 4B1WB 1OVYA 4IEEA 3HL8A 1YXQA 3EO3A 4CZIA 4GMJB 2YKNA 3EL2A 3T7ZA 1Z26A 3O6WA 4IJAA 1NNEA 3CC2N 5M1OA 1JCGA 5KGWA 5LMNK 3KTQA 2NRHA 1XC9A 4FK4A 3CQYA 1SL1A 3QICA 4DQPA 4C8KA 2X6SA 3FZHA 4X65K 1N5YA 2Q2RA 4KHSA 4DF4A 2WONA 4IBNA 2VG7A 4YY3K 1ASWA 2G8KA 4KH4A 5GAGP 1VQPN 3LPTA 3AVLA 3WXLA 4OGEA 3O9TA 4KBOA 1I94K 2RKIA 2PY5A 4IJNA 1NGAA 4IWVA 1RDUA 3NF7A 4C1NI 3SI6A 4IG3A 1RTJA 1QZ6A 2KQ2A 4Q5VA 3HPOA 4CW7B 4DQSA 1KRPA 5AQHA 3VOVA 2OZSA 4DFPA 4CD1A 4NLBA 2VGNA 4DU4A 1Y97A 1L3UA 1VQ5N 2Q97A 1X3NA 2UXCK 4NB4A 3VQ7A 3QEXA 3SQ0A 2XRIA 1TL3A 3A5OC 1HJOA 3HPGA 3O9UA 2ZJRL 3EEQA 2NRXA 3ZSRA 1YF5L 2FSJA 4FW1A 3VQCA 1T44A 5AFUA 4FM1A 3CHWA 5AQJA 1FKOA 1B9FA 1MA9B 4JV5K 2OPQA 2OTJN 5FRMA 3DWLA 5FROA 1NLVA 4A5AA 5JVHL 4H0OA 4OJRA 2IOCA 4E1MA 2HHWA 3WXKA 3OYDA 3TU5A 5TKYA 1YTUA 3K9KA 1VQLN 4QS8A 3OJUA 3THVA 4LF8K 3CJCA 5CZ1A 1T7PA 3WQUA 4M45A 3AO3A 5AQFA 1SV5A 1REVA 4WQ4A 4XIUA 4JI4K 4WQ5A 4PKIA 4O55A 4KO0A 4YOXA 3DI6A 1NKEA 1TAUA 1JLFA 1C6VA 4ICLA 3JYTA 2D1KA 3I8DA 4DV2K 1YTAA 4B1VA 3OYMA 1M90O 1NK7A 4E0DA 1GLEG 4CBUA 1I3AA 5LJWA 2G8FA 4JLHA 2KHOA 2HHHK 2O8DA 4ELUA 3PO4A 1EQYA 3AVKA 1NWKA 1T6CA 1WAJA 4FCYA 3DM2A 4XH1A 5EU7A 2VWJA 4BGAA 4OLAA 1S6PA 4A2BA 3DLKA 1DT9A 3ZEUB 2GEMA 2V51B 3HO1A 1NGJA 2A5XA 1YAGA 1TKZA 2VYPA 4BRHA 2B5JA 1QQMA 1WSHA 4MLHA 2HHTA 2CGJA 5M1FA 3V4IA 3RSEA 3UB5A 1YVUA 4JI5K 1Q18A 2XY6A 1QQNA 1LAVA 4C8MA 3AA4A 4NCBA 3Q7CA 4EZ9A 5AQQA 1T3VA 2F7TA 3S3NA 3I56N 2E2PA 4YOUA 1JL1A 4R5PA 4FLWA 5D3GA 4JKHA 1S6QA 4G1QA 4ID1A 1HYSA 2XY7A 4CZJA 3O3FA 3O9QA 3U6FA 1L3SA 3LPUA 1TVRA 1J5OA 2FBYA 1BUPA 1ZYQA 2HNZA 1J9AA 4FO0A 4DMNA 3D7EO 4HUFA 1BU6O 1NOZA 3LDPA 2P9IA 4CD3A 2ZD1A 3M8PA 2IVPA 1WSJA 4YDUC 1GLJO 1RFQA 4WYBA 3M8RA 1KFSA 3CCEN 1XMOK 1MWMA 4BR5A 4JI0K 1D8YA 1KLMA 1CLQA 3D2FA 2Z1GA 3O1BA 3W3DA 4CJTA 2P1JA 4FJ7A 4M7YA 4IZ9A 4CJPA 4EP4A 4KH6A 5JICA 3RSEB 1SKWA 5J2NA 1S72N 1WSGA 2E2OA 4Z4CA 3MXMA 1GOBA 2VQEK 3OYNA 2WOMA 1RILA 3SPYA 3EZWA 4EIAA 1U4BA 3F9KA 3WNFA 4CBWA 4A59A 3U3GA 1IG8A 3WNHA 2D0AA 3ZT4A 3C7NB 5J2QA 5IWAK 4FWLA 4K41A 4DFMA 5JMVA 4OKKA 1QTMA 2XHBA 4CF0A 1IKYA 3CYMA 4RW7A 3OYIA 1Y64A 3M8QA 3PIOL 1K73O 2P9IB 3TSQA 2BE2A 2OPSA 4BC3A 3MDQA 4CZFA 1EXQA 5EXWA 3I8BA 4W5RA 3CCUN 3VQ6A 1ZXOA 2ASOA 1NGIA 1BA0A 1NMDA 4BQLA 3LDSA 1JLAA 3E9OA 1L3VA 4BWMA 4F2SA 3D2FB 1OVQA 2DPNA 2NRTA 3AV9A 4BRCA 2KZMA 3E01A 4DTSA 2IVNA 3P1GA 1BG3A 3RR7A 3LL3A 3LM9A 4W5NA 5EVZA 1JCFA 3CXCM 4E7LA 1XMQK 3OYLA 2F9WA 5AQMA 5BPNA 3IFRA 3T1YK 1ZBHA 1X9WA 4JI2K 5DMRA 4CZLA 4Z4GA 4B9TA 3L4QA 1RBTA 3VEWA 5KPTA 4JKAA 4MFBA 4BR2A 3NF6A 2NNWA 5KRSA 5JVGL 3IDHA 2HF4A 5J2MA 4CFAA 2H3GX 3BY5A 3LM2A 2ITGA 4E19A 1JL2A 3CCQN 2VQFK 2GUPA 4NYNA 2A1RA 4BY9C 2HHUA 2FLOA 4IFEA 5GAHP 2DFFA 4CFDA 3AVMA 3UKUA 3DLLL 4LC9B 3R9PA 3OBWA 3P31A 4PKGA 5CR4A 4DSEA 3HYFA 2E1YA 3EN9A 5AR0A 2YHXA 4FM2A 4O0IA 1KAYA 1KSPA 3NF8A 3NGIA 2RPIA 2GUIA 1NK8A 3LDLA 2YHBA 2ITMA 5HLFA 2PYJA 2DFEA 1CZAN 1RGIA 5I3UA 5FPDA 2KFNA 1XC3A 3H45C 2P9LA 3SNNA 3O4NA 3L0QA 3RMCA 1S1TA 3WQTA 1ATSA 1CXQA 3VEVA 4F2RA 5M1NA 4BG8A 4FWNA 3VEYA 3GL1A 1C1CA 3L2WA 1KVAA 4CJVA 3I0SA 2BGGA 1UWBA 5E26A 3TAGA 2QKBA 3ZX2A 5AQLA 1IKWA 3HVTA 1RDCA 3OJSA 3EKUA 4IFYA 5CY4A 3U9ZA 3O3GA 3AVCA 4N56A 4YOYA 4FLXA 4YHHK 4IXCA 1Q86O 3V9ZA 3PX6A 1SKRA 3DLBA 2GV9A 3QEVA 3VQ4A 4E7HA 2IC3A 3LDQA 3MN9A 1OH6A 3O4QA 4E7KA 4GNIA 3KD1E 3UKUB 4CE9A 4LF5K 1WSIA 5KRTA 2AJQA 3VA0A 1EKEA 2WTUA 3SUQA 2YCHA 2HVIA 4AHVA 1VQ9N 3AA2A 3ULEA 4E3SA 4CJSA 4B3TK 4M3TA 3ATUA 1QVFM 1C0GA 2P9LB 3WNGA 4DV7K 3T3FA 4BDPA 3SPZA 3ID8A 3U3YA 3BUZB 4CF1A 1HNXK 4LF9K 4BREA 3WT0A 1BWFO 1YJNN 1MU2A 4DSJA 1C0FA 4AH9A 4BC5A 3QFPA 1OKJA 3CCRN 5BREA 1DTQA 5AQIA 4JEPA 1Q81O 1CZBA 4A2AA 4M63C 2FSKA 2IDOA 4JKCA 3NE6A 5JS1A 1NK0A 4NLCA 4FJ9A 4Z4EA 3E9PA 2E2QA 4MDAA 3VN5A 4A57A 3FE1A 1TK8A 1IG9A 4K43A 3HVRA 2DTUA 2QWQA 4JI3K 3NFAA 1RT7A 3R3LA 3CPWM 5FRNA 4JS5A 5J1EA 2O4GA 3PSIA 1KAZA 4DU1A 4PUOA 1K8KA 1TGOA 2NUBA 3MCPA 4W5OA 4OKJA 3ULEB 2EWSA 4B3RK 4M3UA 1W0HA 3THYA 4CHPA 4JNEA 4KHYA 4CIEA 1J5EK 4B9MA 1G15A 1BQMA 2HF3A 3VGMA 4QS9A 4ELVA 1NK5A 1RT4A 2O8EA 2OA8A 4CZMA 1JXBA 5BPLA 3V1OA 3PX4A 1Q7YO 1HLUA 1QQOA 1HUXA 1OH8A 2YX6A 1XWLA 1S5JA 2D4WA 1Q9XA 3L3UA 4JK8A 5JLFA 3AVJA 4FWKA 4K8ZA 2BH1A 4BQZA 3WNEA 1EWQA 3JAMO 3QDKA 4J2AA 3O9SA 1IKVA 4N41A 3CPEA 2F8SA 3KK3A 3FZLA 1CXUA 5SWMA 5AQWA 3KZBA 3L2VA 5HL7L 4OGCA 4YOTA 1NKBA 1CZ9A 4BRNA 5AQKA 4K25A 3W0LA 3SJHA 1K8KB 1DTTA 4KI4A 4O5BA 3RMAA 4FJ5A 4KAZA 3KJVA 3I0RA 2I7NA 2I7PA 3THYB 2KKZA 2V7ZA 1TV6A 1NJIO 1D9DA 1W9HA 3FGUA 3QMLA 4DSLA 1LW0A 2PAVA 4CF2A 3CMAN 5I42A 3TARA 1TKTA 2O8EB 3HT3A 3V9WA 2P9KA 1X3MA 2OYQA 1DLOA 2FC0A 5AQYA 3DLHA 3OS0A 1N8RO 4IDHA 4K0KK 1RT2A 3IS9A 4BVOA 4CJ7A 4DF8A 3CC7N 1VQNN 3R8EA 3SZ2A 5C2DA 2YNHA 3K5MA 3SV3A 1IV0A 2D0PA 1VQON 3SQ4A 2PZSA 3NVKA 1NJZA 3GBTA 1WUAA 3O3HA 1J6ZA 2UUCK 3QBWA 3ZT2A 3RR8A 3HRGA 4CESA 4FVMA 1LWEA 1WAFA 3OYHA 3TTDA 1RTIA 3TSUA 1YIJN 1NJXA 4DR4K 2YHAA 2J4RA 1EWRA 3G4SN 3VEOA 3TI0A 5HRSA 4PHTX 4CGIA 1SKSA 4CJ4A 2FBXA 3QINA 1Z05A 4ILHA 3AAQA 3CC4N 2B6AA 4NCGA 1F21A 2P9KB 3FZMA 2V7YA 4Y1CA 4CGFA 3KIOA 4FWOA 5FPEA 1SUQA 2X78A 4O0JA 4BE0A 3AGKA 3H3NO 2E5LK 5BRDA 3CCMN 3HK2A 2I5JA 2VWKA 3ENBA 1RBSA 1TL1A 2GBZA 2G8UA 2IGIA 3WXMB 2NRZA 2ASPA 1P8ZA 1GOAA 4OPHA 3ZSOA 1OH7A 4YOVA 4Z4FA 4HHTA 2X6NA 4LFCK 3FFKB 4CVNE 3VETA 2UUAK 5BR9A 3ZT1A 1BHLA 3LWLA 1KC8O 1JLCA 1FXXA 3KLIA 1HX1A 2ASMA 4FLVA 5HRPA 4DU3A 4BE2A 1YT3A 4CK2A 3VEXA 4ELTA 5LMUK 4WQ4C 4CJFA 5T7BA 1EO1A 2FF6A 4WQ5C 2UXDK 1T03A 2HMIA 4BR4A 4Z4HA 4RWTA 3HP9A 1VQKN 2W6KA 3NH0A 4Q0BA 1VRTA 3DOKA 4W5TA 5AJ3K 3P39A 4FVUA 4O4GA 2HBJA 4FPBA 2QWRA 4HTUA 3NGZA 4YORA 4BRIA 3CJ1A 1TUYA 5C2FA 3DLRA 5EX5A 4TSXA 3EE9A 3SQ2A 3ZSZA 2Y1IA 1EX4A 1S1XA 4FXDA 3TSPA 2RHKA 4O5FA 4CJWA 3L2RA 2HNDA 2CGLA 2RF2A 2W41A 5KPRA 4PQUA 5AQVA 2BUPA 1VSHA 4BR7A 3OY9A 4CGHA 1NGFA 1VK0A 1S22A 3P5JA 3V6DA 2RN2A 1EP4A 5ADXH 2QWLA 4FWPA 4CEZA 3F5TA 3KLGA 3S3OA 3VMFB 3VTIA 4E7IA 3IKMA 3DLEA 3CCVN 5AQGA 3V1RA 5GINA 1VSMA 3MK6A 2VWBA 5KQ8A 3CQ8A 4KTWA 1QSSA 3UE5A 3MXIA 1C0MA 4E1JA 4DR1K 3TAEA 1XUPO 3PLAA 1S1WA 4CK3A 4LY7A 4A62A 3H3OB 3ZSXA 3VEZA 4BG9A 4CHZA 1YHQN 2KZZA 1WSEA 1RTHA 2HNYA 5KGXA 3E66A 3NMUA 4O44A 5AQUA 4B1XB 1LAWA 1VSIA 1EETA 5FPMA 2HVHA 1NM1A 4CEDA 4DQ8A 3QEWA 4Z4IA 2FBTA 4A5BA 3V9UA 2O8DB 2NRRA 4ISFA 4J2BA 3TTFA 4DQQA 3AO2A 2Q1NA 3QNNA 2ZQBA 1FK9A 3M8SA 4HUGA 1I39A 5AQZA 4LF6K 3JSMA 3MEEA 3SUOA 1SL2A 3M1FA 4EFHA 3SBTA 5DM7L 4C8LA 5JLHA 1IO2A 1QHTA 3F9MA 3SYZA 2ZJQL 3QEIA 4CF8A 1V4TA 4RG8A 5DK5A 3IAYA 4B3MK 1GLDG 3PUFA 1NGCA 3G6EN 4CI6A 4NXMK 2HOEA 1C0TA 4J2EA 4B1UB 4QCLA 4I7FA 1SQKA 4FJXA 5GIPA 3MWTA 3FFIA 3TAMA 5GIOA 3T1AA 1KFDA 2A6AA 1UAXA 2HMPA 3KK2A 2QM1A 1U47A 5CYQA 4UY8O 1L5UA 3AVHA 1K8AO 4C8OA 4OX9K 5EY4A 3MN5A 2QWMA 2P51A 2Z1JA 1KCFA 3C6AA 2OPPA 2YNGA 4QAGA 1S3XA 3LAKA 1Q82O 3KD5E 2PBDA 1VQ6N 1IBKK 2P5GA 3OS2A 4N5SA 5AQOA 3DXMA 1S1UA 3PX0A 3J7AP 2OTLN 4BROA 3K2PA 3JS6A 3A2FA 2YV0X 2UXBK 4CZHA 4DR5K 4DTUA 1YJWN 2EX3A 3R6MA 3PY8A 2NRVA 1XHXA 1D9FA 2YNIA 3OYKA 1HNVA 1K9MO 1VQ7N 4KFBA 3O4WA 2QWPA 3LALA 4R79A 2FXUA 1RDBA 3ISNC 3OYFA 2HBKA 1R59O 4IOAL 1JLEA 1XNRK 4B9SA 4RCHA 4DR3K 2UYTA 4BRAA 2F96A 3DYAA 3F2KA 4IDKA 4FZYA 2QXFA 2QA4N 1XQSC 4CCHA 4PWDA 3IG1A 3CJ7A 4ID5A 5F1XA 4CGJA 3V9XA 3LP1A 4BRMA 2ZWHA 1N33K 4BACA 3DLGA 5AZIA 1KXPA 3L8BA 4F8RA 5FLXO 1JKHA 1VSFA 3G71N 4FLTA 2O8CA 1WOQA 4NXNK 4CJEA 3ZSWA 4H4OA 1W7AA 3QB0A 4DCHA 3CCJN 4I9QA 3DXMB 1LWFA 4OVLA 3DXKA 3SK3A 4CJ3A 5CHIA 4GW6A 4KHQA 2Q31A 1V4SA 4MLEA 1NOYA 3SUNA 3H1QA 3N4QA 1W2BM 4DKWA 4B9VA 4AHRA 1HMVA 3A5LC 4O8KA 4F9OA 3BDPA 3H08A 4H5RA 3M6GA 3I55N 4IKFA 5BN9A 5TKWA 4FK2A 2ZJPL 1LOTB 2ATQA 3CERA 5M1QA 1E4FT 4PKHA 2XO7A 4B9QA 4DB3A 5JS2A 5C15A 4ISEA 3QETA 2D0OA 3L6QA 4FLUA 3G25A 5HRNA 3OVNA 3KK1A 3CQXA 3RRHA 4LFAK 3ZCMA 1KAXA 1JXEA 4C1NK 2YI1A 2F4VK 2GWKA 3SAGA 4IFVA 4DG1A 2E6MA 3VESA 4CECA 3FZKA 3BZKA 3KLHA 3KHYA 4DTXA 4DR7K 2HHSA 2BDPA 2EHGA 2O8CB 4N47A 1NK6A 1RDAA 1DEJA 4JKEA 1WNSA 4BWJA 1IJJA 4YOWA 2ZGYA 1ILYA 3C0BA 3DXKB 4HTLA 4E7JA 3V9SA 5IT9O 3BZCA 1NGDA 4DWIA 1HNIA 2G8WA 3DRPA 1B9DA 4E1NA 4KPYA 3GDQA 2WUSA 1NK4A 1X1PA 2Q0RA 3J7YP 3O08A 4JI7K 1VRUA 2VG6A 2O8BA 3O8MA 2XY5A 1LCUA 1QSYA 2Z1HA 3ZSQA 1VHXA 4KREA 2LSNA 4DUZK 3O1WA 3WEEA 4IEIA 4DSKA 1X9JA 1JJ2M 3OW2M 4N76A 3K0SA 3VF4A 4DS4A 2BTFA 4DR2K 4M3XA 2ZGZA 3FZFA 5MLCQ 1VAZA 5HBMA 2KLAA 1U49A 4JD2A 1WBDA 4HCBA 4UQGA 3EYZA 1BO5O 4KHNA 1O13A 3AVIA 3LP0A 4RW4A 2FSNA 3CFOA 1N6QA 4GV3A 2R7YA 4B9UA 3E9LA 5KPZA 3VF2A 4XEIA 2WC9A 1OH5A 4LH4A 2E88A 4I2QA 1KVCA 3HPHA 3ALYA 3CG7A 3CIPA 5ADXA 4BRLA
chains in the Genus database with same CATH topology
4DV7K 4B3SK 1IBKK 4LFAK 4JV5K 4DR1K 5LL6Z 4GKJK 2F4VK 4DV5K 4DV4K 1HNXK 2UU9K 1HNWK 4LFCK 4LF9K 4CVNE 4DV1K 3J7AP 2UUAK 1N32K 4DUYK 4DR7K 4X64K 5A2QO 2VQFK 2UXBK 4DV6K 1HR0K 4DR5K 1XMOK 4LF8K 4JI0K 4GKKK 4LF7K 5LMUK 3T1HK 2UXDK 4JI4K 4V19S 5IT9O 4K0KK 1XNRK 4JI3K 1IBMK 5AJ3K 4DR3K 2VQEK 4AQYK 4DV2K 3J7YP 1N36K 4LF6K 4JI7K 3J81O 2HHHK 1N33K 5LMNK 4X62K 3J80O 5FLXO 4B3RK 4LFBK 5IWAK 2UUCK 4DUZK 4DV3K 4DV0K 4X65K 4DR6K 4NXNK 4LF4K 1J5EK 4X66K 4YY3K 3OTOK 1N34K 5BR8K 4B3MK 4NXMK 4DR2K 4DR4K 1IBLK 1XNQK 4YHHK 1I94K 1FJGK 4JI5K 4JI6K 4JI1K 4CW7B 4JI8K 4JYAK 4LF5K 3JAMO 1HNZK 2UXCK 2ZM6K 2UUBK 4OX9K 1XMQK 4KHPK 2E5LK 3T1YK 4JI2K 4B3TK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 K;  4B3S K;  1IBK K;  4LFA K;  4JV5 K;  4DR1 K;  5LL6 Z;  4GKJ K;  2F4V K;  4DV5 K;  4DV4 K;  1HNX K;  2UU9 K;  1HNW K;  4LFC K;  4LF9 K;  4CVN E;  4DV1 K;  3J7A P;  2UUA K;  1N32 K;  4DUY K;  4DR7 K;  4X64 K;  5A2Q O;  2VQF K;  2UXB K;  4DV6 K;  1HR0 K;  4DR5 K;  1XMO K;  4LF8 K;  4JI0 K;  4GKK K;  4LF7 K;  5LMU K;  3T1H K;  2UXD K;  4JI4 K;  4V19 S;  5IT9 O;  4K0K K;  1XNR K;  4JI3 K;  1IBM K;  5AJ3 K;  4DR3 K;  2VQE K;  4AQY K;  4DV2 K;  3J7Y P;  1N36 K;  4LF6 K;  4JI7 K;  3J81 O;  2HHH K;  1N33 K;  5LMN K;  4X62 K;  3J80 O;  5FLX O;  4B3R K;  4LFB K;  5IWA K;  2UUC K;  4DUZ K;  4DV3 K;  4DV0 K;  4X65 K;  4DR6 K;  4NXN K;  4LF4 K;  1J5E K;  4X66 K;  4YY3 K;  3OTO K;  1N34 K;  5BR8 K;  4B3M K;  4NXM K;  4DR2 K;  4DR4 K;  1IBL K;  1XNQ K;  4YHH K;  1I94 K;  1FJG K;  4JI5 K;  4JI6 K;  4JI1 K;  4CW7 B;  4JI8 K;  4JYA K;  4LF5 K;  3JAM O;  1HNZ K;  2UXC K;  2ZM6 K;  2UUB K;  4OX9 K;  1XMQ K;  4KHP K;  2E5L K;  3T1Y K;  4JI2 K;  4B3T K; 
#chains in the Genus database with same CATH topology
 4BDZ A;  3E1Y A;  3C6U A;  3ZSV A;  2Q3S A;  3OHR A;  4FOE A;  4DV5 K;  2HW3 A;  3QIP A;  2O8B B;  3GE1 A;  1TKX A;  1X9S A;  1U45 A;  3QBX A;  3K58 A;  5EOY A;  4BC4 A;  3V1Q A;  3OYB A;  1T05 A;  3WEE B;  4KB0 A;  3AVG A;  3WXJ A;  3AVB A;  5AQR A;  4CER A;  2W6L A;  3SQ1 A;  3ID6 A;  1YVN A;  4CIG A;  4OLB A;  4LD0 A;  4AHC A;  3HOT A;  4CFB A;  1ATN A;  2GX9 A;  4CIF A;  3KLE A;  3RTV A;  4V19 S;  5C25 A;  2HHV A;  4JD2 B;  3AAP A;  1NGG A;  4KI6 A;  1RT6 A;  1C1B A;  1FKP A;  1WLJ A;  4IO8 A;  5KQD A;  4DTR A;  1VQ4 N;  1Z6R A;  2OCE A;  5AQN A;  4FWS A;  2QK9 A;  4FSV A;  3S9H A;  3NF9 A;  3G10 A;  4CJK A;  3S3M A;  5M1P A;  3VQ5 A;  1HYV A;  2JWK A;  2OZM A;  3LP2 A;  3VQA A;  2AA4 A;  5H1S Q;  5C24 A;  2VCP A;  4LH5 A;  2F8T A;  4AHT A;  3K5L A;  1RT3 A;  3ASM A;  4ZHR A;  3DMJ A;  4PL7 A;  4ILG B;  4GV9 A;  4DFK A;  4H0P A;  4B8A B;  4M7X A;  4M3Z A;  4JI6 K;  2G8I A;  4AIL C;  4EHU A;  3CCL N;  4FLZ A;  1GLL O;  2PYL A;  4DTM A;  2G8H A;  4AM6 A;  4KTZ A;  1QHA A;  3AVA A;  1ASV A;  3RVC A;  3QEP A;  3BF1 A;  1R0A A;  3O80 A;  2W40 A;  4RTF D;  3UKR A;  2O8F A;  5CZ2 A;  4CZG A;  3D0P A;  3MN6 A;  1BDG A;  4H5N A;  3VQQ A;  4KV8 A;  2GEL A;  1IH7 A;  1HRH A;  1SS6 A;  3NDK A;  4J8F A;  3C94 A;  1SL0 A;  4CEF A;  1KQS M;  2F9T A;  2NZT A;  3QFU A;  1BL3 A;  3CJA A;  4FJG A;  4DV4 K;  2UU9 K;  4CEE A;  4JHD A;  4DV1 K;  3ZET A;  4AF1 A;  3P38 A;  3TAN A;  4JKB A;  4NCA A;  4CHN A;  1Q8I A;  3K9J A;  4DV6 K;  3PO5 A;  3MX5 A;  2HBL A;  4MDB A;  4IOC L;  4WE1 A;  4WCE L;  1TK5 A;  4DS5 A;  1VSJ A;  1ZBF A;  1RTD A;  4Y0W A;  3PIP L;  3B6O A;  4BGB A;  1BGX T;  3T1H K;  4FM0 A;  1YUW A;  3DAW A;  2IAJ A;  3K59 A;  1WB9 A;  4L3Q A;  3QIO A;  5HRO A;  2IIR A;  3CJ9 A;  3CM5 A;  3RMD A;  3KKR A;  2YKM A;  3WUH A;  1KTQ A;  4WF9 L;  4BRK A;  4AQY K;  4EP5 A;  1BIZ A;  4IO9 L;  4RW6 A;  4CEA A;  4ISG A;  3A8Y A;  1YJ9 N;  1LWC A;  4JN4 A;  4X62 K;  3UKR B;  3NH1 A;  2QEX N;  2O8F B;  3M3Z A;  1A5X A;  3HST B;  2OPR A;  1HQE A;  4CZK A;  1E3M A;  3OTO K;  5AQP A;  3EZ5 A;  2GWJ A;  4KH5 A;  1MWK A;  3HZ6 A;  2AP1 A;  2RE2 A;  4H5V A;  2CH6 A;  4FWR A;  4JHD B;  4DQR A;  1IBL K;  2ETJ A;  2A42 A;  3ZET B;  2ZE2 A;  1RDD A;  3AO1 A;  3VQE A;  3AVF A;  4W5Q A;  2QI2 A;  3EKS A;  3KWG A;  3ZEU A;  1YIT N;  1HQU A;  3SAH A;  1C0U A;  4JI8 K;  3J7Z O;  1JCE A;  4JRP A;  3OBY A;  3DJC A;  3GOI A;  1J54 A;  1HNZ K;  1NGB A;  1S9G A;  5HOO A;  1D4X A;  3VQB A;  3LZI A;  5GAE P;  5LY3 A;  3R1X A;  3L2Q A;  2CH5 A;  3LDO A;  2YJE A;  1BOT O;  3D2E A;  3CM6 A;  5LL6 Z;  3B8A X;  4BRP A;  4FZZ A;  2E6L A;  4I9L A;  3BF3 A;  2P9N A;  3NCI A;  4HVJ A;  4C8N A;  3U4L A;  4X64 K;  4BRF A;  2VGM A;  3I33 A;  1A5W A;  3MWP A;  4B3O A;  3F73 A;  4WFN L;  4EAH D;  3MCA B;  1TKD A;  4BRG A;  4CZE A;  3AA5 X;  1RNH A;  5E41 A;  4DTJ A;  3QER A;  1GOC A;  3C6T A;  5BPM A;  1HKB A;  1BCO A;  5CYM A;  1JLG A;  4FJM A;  2A41 A;  5C42 A;  5F2R A;  1U2V A;  4CEB A;  4FJL A;  4DHY A;  3J80 O;  4JKG A;  4ZTJ A;  3ZLJ A;  2W42 A;  2E20 A;  3CCS N;  4DV3 K;  3VQD A;  3A5N C;  4MO5 A;  2V52 B;  5HRR A;  4LF4 K;  4X66 K;  2JGU A;  3OYJ A;  3D2E B;  4OPK A;  3RMB A;  2X74 A;  4E89 A;  3T69 A;  4AHS A;  2E4L A;  3C7N A;  2KFZ A;  5C12 A;  2P9N B;  1P90 A;  5BRH A;  2YHW A;  2A3Z A;  3U8X A;  1ZBS A;  1FW6 A;  1QE1 A;  5AQX A;  4JKF A;  3ZT3 A;  4FLY A;  4CJ5 A;  3EY1 A;  1ZC6 A;  1XI1 A;  2HHX A;  2E8A A;  3H1V X;  4H5T A;  4FJI A;  4B9L A;  1U6Z A;  4JK9 A;  4B8C A;  2KW4 A;  4CJL A;  2KTQ A;  4F3O A;  3H6E A;  4JRQ A;  2D0B A;  3LZJ A;  2D0C A;  3MN7 A;  1ASU A;  2A1S A;  4A61 A;  3HSC A;  4G9Z A;  3OYE A;  1IKX A;  4NO7 A;  3SBG A;  4H0T B;  3VF6 A;  4LSL A;  4FJK A;  1G99 A;  2XY8 A;  4IOX A;  2P9P A;  4WFB L;  4HWI A;  1X9M A;  4H0V B;  5F0X A;  5B8H A;  1VSK A;  1NK9 A;  5FDL A;  2HB5 A;  4FJJ A;  4BC2 A;  4Y1D A;  1U2V B;  3AA3 A;  4FJH A;  1HNW K;  1A5V A;  3KLF A;  1Z25 A;  3GG4 A;  4JKG B;  4H8K A;  1Q9Y A;  3SV4 A;  3TAB A;  3KKS A;  2CGK A;  3FR0 A;  1BA1 A;  1QZ5 A;  3RWU A;  3WXI A;  4K42 A;  4GVM A;  5I9E B;  1W97 L;  4YDU A;  1TUU A;  5LJV A;  3MXJ A;  4GVE A;  4C23 A;  3VPZ A;  3CFR A;  4DSI A;  3AO5 A;  3L2U A;  3BGR A;  4JS4 A;  4LSN A;  3KK7 A;  3VQ8 A;  1D5A A;  4CEQ A;  4YNQ A;  4OPA A;  3PV8 A;  4F3T A;  2FF3 B;  1HPM A;  4CJQ A;  3CI5 A;  3CJB A;  3T19 A;  4BRQ A;  3ZT0 A;  3VGL A;  3MMV A;  3HOS A;  5C10 A;  3SMP A;  2P9S A;  4BDY A;  1NGH A;  2PFU A;  4Z94 A;  1NGE A;  1O1W A;  4U7B A;  4DV0 K;  1RDW X;  2NLX A;  1JLQ A;  4M3R A;  2P9P B;  4JK7 A;  1VSE A;  3HM8 A;  1TYQ A;  3AAR A;  4DFJ A;  3AY9 A;  3MEC A;  1RT5 A;  5C0Y A;  4AM7 A;  3IRX A;  5BRF A;  3LDN A;  4YFU A;  1XNQ K;  1RCH A;  3VGK A;  3NHG A;  5KTQ A;  3J8A A;  3ATV A;  4KB1 A;  1NMN A;  3LAM A;  4MO4 A;  1JLB A;  1NJY A;  1HJR A;  4JI1 K;  3OA9 A;  4EZ6 A;  4JYA K;  1NU0 A;  3O5B A;  1WN7 A;  1WSF A;  5AFU H;  3FLC O;  3HJF A;  5DM6 L;  3SLC A;  3SMS A;  3TPQ A;  1RT1 A;  4HCC A;  4M3Y A;  4PA1 A;  2HHQ A;  2UUB K;  3V81 A;  2IVO A;  2Q0U A;  4KHP K;  2Y1J A;  1U48 A;  1UOC A;  4KHW A;  4H5W A;  4O8U A;  1GLB G;  3HM9 A;  3TTC A;  3QNO A;  3M5R A;  2ZF5 O;  4M41 A;  2VG5 A;  3L4I A;  1DKG D;  4AHU A;  2P9S B;  1HKC A;  4M3W A;  1LW2 A;  3QLH A;  4CJU A;  4QOZ B;  1VQ8 N;  2P5O A;  3QO9 A;  4BR9 A;  3P4I A;  1WBB A;  4DUY K;  4ILJ A;  3TAP A;  3ZX3 A;  4B1Y B;  4MQ3 A;  4EHT A;  4BR0 A;  1TYQ B;  4CF9 A;  3Q7B A;  4LF7 K;  3MEG A;  1QSL A;  1MDU B;  4KKO A;  1U04 A;  2QKK A;  4CFC A;  4CBX A;  1XHZ A;  3ENH A;  2D5R A;  1T8E A;  3HBT A;  3RRG A;  2YJF A;  1BQN A;  4L8R B;  5AZI B;  1BIU A;  1VSD A;  1IBM K;  1GLF O;  4FJN A;  3D45 A;  5AQT A;  5KI6 A;  5AZJ A;  3SUP A;  2NRW A;  4H4M A;  1N36 K;  3L3V A;  3EE8 A;  4Z0U A;  3HXM A;  4K8X A;  2A40 A;  4DSF A;  1YI2 N;  1ZBU A;  4CGD A;  4OO1 J;  3IMX A;  1ESV A;  3CET A;  5SZT A;  3BEX A;  1QQC A;  3C65 A;  1TAQ A;  3ITH A;  4F4K A;  2QWN A;  1NKC A;  4M42 A;  1N34 K;  1BIS A;  3QES A;  3O9R A;  5HP1 A;  4FYD A;  1RBV A;  4CGG A;  3IUC A;  5AQS A;  4DLE A;  3VER A;  3A0I X;  4CJR A;  1ITG A;  2HBM A;  1QVG M;  1SZ2 A;  2QTD A;  3K57 A;  3HTV A;  4I6M A;  3NBP A;  3KWI A;  4RW8 A;  5FPN A;  4CK1 A;  2DFH A;  3DRS A;  4XH5 A;  1K6Y A;  3SJJ A;  1KLN A;  2YNF A;  3KVG A;  3HI0 A;  3OYC A;  4FK0 A;  2ZM6 K;  1GLA G;  3DRR A;  1KVB A;  3ZSY A;  3S41 A;  3CD6 N;  1M1K O;  1NBW A;  4CHO A;  3THW A;  1S1V A;  4B9N A;  1L3T A;  5AZJ B;  3VQP A;  4DTP A;  4KTQ A;  2HST A;  3NVM A;  2BAN A;  2JWL A;  3SCX A;  1BI4 A;  1SAZ A;  4FL9 A;  1HPZ A;  4DLG A;  1N32 K;  3H46 O;  3N4P A;  2YHY A;  3THX A;  3SAF A;  1NJW A;  1S9E A;  3B6P A;  3D6R A;  3TWH A;  1VSL A;  3AVN A;  3AGR A;  1UA0 A;  3G0Z A;  2B4J A;  4FOI A;  4FWM A;  2GTD A;  3TAQ A;  5K14 A;  5CE3 A;  4RW9 A;  3ZX0 A;  1H1V A;  1HKG A;  4QS7 A;  5GAD P;  3MAQ A;  4PY5 A;  4I6M B;  3BP8 A;  1NG9 A;  1TK0 A;  2QWO A;  2QW9 A;  4NYF A;  3ULD A;  3OYG A;  5E84 A;  3TR8 A;  2FBV A;  3J81 O;  2QXL A;  1ZBI A;  3NAE A;  1J53 A;  3NGY A;  1HYZ A;  4LFB K;  2WFB A;  2WBN A;  2E1Z A;  4GY2 B;  4DR6 K;  1VQM N;  3THW B;  3UIQ A;  4CHQ A;  3ENO A;  4CEO A;  5BR8 K;  2Z1I A;  3PSF A;  4H0X B;  1BI4 B;  3P83 D;  3VEN A;  4J2D A;  4FW2 A;  2P9U A;  4JKD A;  2G8V A;  3DOL A;  1FJG K;  1E4G T;  1KD1 O;  1ZBL A;  1T6D A;  4FWQ A;  3CME N;  3JXU A;  4FJ8 A;  4XH4 A;  3THX B;  5J2P A;  1RBR A;  3A5M C;  4H03 B;  4ZTF A;  4CHY A;  3CFP A;  3AO4 A;  3MX2 A;  4JAX A;  2Q36 A;  3CF5 L;  3TAF A;  4HUE A;  4PL8 A;  1C1A A;  2O4I A;  3U9D A;  4DQI A;  4WFA L;  4OPJ A;  2E2N A;  1RBU A;  1B92 A;  4B3S K;  4B08 A;  4H0Y B;  4GKJ K;  1GLC G;  2OAN A;  3OYA A;  3VTH A;  1UA1 A;  1BCM A;  3VA3 A;  3LP3 A;  3MED A;  4GV6 A;  4U67 L;  4DTN A;  4KHU A;  5A2Q O;  4BE1 A;  3LAN A;  1HR0 K;  3K5N A;  4GKK K;  2JLE A;  2IS3 A;  1LV5 A;  1ATR A;  2P9U B;  4B1Z A;  1QS4 A;  4BVP A;  3LWM A;  5BN8 A;  1DGK N;  3OS1 A;  3HP6 A;  3ZYY X;  3NH2 A;  4DTO A;  4KRF A;  5M1K A;  4I2P A;  3C6H A;  4BRD A;  4FZX C;  3K5O A;  4IG0 A;  5ELZ A;  4FPA A;  3C95 A;  3VQ9 A;  2DY4 A;  4OKE A;  4B1W B;  1OVY A;  4IEE A;  3HL8 A;  1YXQ A;  3EO3 A;  4CZI A;  4GMJ B;  2YKN A;  3EL2 A;  3T7Z A;  1Z26 A;  3O6W A;  4IJA A;  1NNE A;  3CC2 N;  5M1O A;  1JCG A;  5KGW A;  5LMN K;  3KTQ A;  2NRH A;  1XC9 A;  4FK4 A;  3CQY A;  1SL1 A;  3QIC A;  4DQP A;  4C8K A;  2X6S A;  3FZH A;  4X65 K;  1N5Y A;  2Q2R A;  4KHS A;  4DF4 A;  2WON A;  4IBN A;  2VG7 A;  4YY3 K;  1ASW A;  2G8K A;  4KH4 A;  5GAG P;  1VQP N;  3LPT A;  3AVL A;  3WXL A;  4OGE A;  3O9T A;  4KBO A;  1I94 K;  2RKI A;  2PY5 A;  4IJN A;  1NGA A;  4IWV A;  1RDU A;  3NF7 A;  4C1N I;  3SI6 A;  4IG3 A;  1RTJ A;  1QZ6 A;  2KQ2 A;  4Q5V A;  3HPO A;  4CW7 B;  4DQS A;  1KRP A;  5AQH A;  3VOV A;  2OZS A;  4DFP A;  4CD1 A;  4NLB A;  2VGN A;  4DU4 A;  1Y97 A;  1L3U A;  1VQ5 N;  2Q97 A;  1X3N A;  2UXC K;  4NB4 A;  3VQ7 A;  3QEX A;  3SQ0 A;  2XRI A;  1TL3 A;  3A5O C;  1HJO A;  3HPG A;  3O9U A;  2ZJR L;  3EEQ A;  2NRX A;  3ZSR A;  1YF5 L;  2FSJ A;  4FW1 A;  3VQC A;  1T44 A;  5AFU A;  4FM1 A;  3CHW A;  5AQJ A;  1FKO A;  1B9F A;  1MA9 B;  4JV5 K;  2OPQ A;  2OTJ N;  5FRM A;  3DWL A;  5FRO A;  1NLV A;  4A5A A;  5JVH L;  4H0O A;  4OJR A;  2IOC A;  4E1M A;  2HHW A;  3WXK A;  3OYD A;  3TU5 A;  5TKY A;  1YTU A;  3K9K A;  1VQL N;  4QS8 A;  3OJU A;  3THV A;  4LF8 K;  3CJC A;  5CZ1 A;  1T7P A;  3WQU A;  4M45 A;  3AO3 A;  5AQF A;  1SV5 A;  1REV A;  4WQ4 A;  4XIU A;  4JI4 K;  4WQ5 A;  4PKI A;  4O55 A;  4KO0 A;  4YOX A;  3DI6 A;  1NKE A;  1TAU A;  1JLF A;  1C6V A;  4ICL A;  3JYT A;  2D1K A;  3I8D A;  4DV2 K;  1YTA A;  4B1V A;  3OYM A;  1M90 O;  1NK7 A;  4E0D A;  1GLE G;  4CBU A;  1I3A A;  5LJW A;  2G8F A;  4JLH A;  2KHO A;  2HHH K;  2O8D A;  4ELU A;  3PO4 A;  1EQY A;  3AVK A;  1NWK A;  1T6C A;  1WAJ A;  4FCY A;  3DM2 A;  4XH1 A;  5EU7 A;  2VWJ A;  4BGA A;  4OLA A;  1S6P A;  4A2B A;  3DLK A;  1DT9 A;  3ZEU B;  2GEM A;  2V51 B;  3HO1 A;  1NGJ A;  2A5X A;  1YAG A;  1TKZ A;  2VYP A;  4BRH A;  2B5J A;  1QQM A;  1WSH A;  4MLH A;  2HHT A;  2CGJ A;  5M1F A;  3V4I A;  3RSE A;  3UB5 A;  1YVU A;  4JI5 K;  1Q18 A;  2XY6 A;  1QQN A;  1LAV A;  4C8M A;  3AA4 A;  4NCB A;  3Q7C A;  4EZ9 A;  5AQQ A;  1T3V A;  2F7T A;  3S3N A;  3I56 N;  2E2P A;  4YOU A;  1JL1 A;  4R5P A;  4FLW A;  5D3G A;  4JKH A;  1S6Q A;  4G1Q A;  4ID1 A;  1HYS A;  2XY7 A;  4CZJ A;  3O3F A;  3O9Q A;  3U6F A;  1L3S A;  3LPU A;  1TVR A;  1J5O A;  2FBY A;  1BUP A;  1ZYQ A;  2HNZ A;  1J9A A;  4FO0 A;  4DMN A;  3D7E O;  4HUF A;  1BU6 O;  1NOZ A;  3LDP A;  2P9I A;  4CD3 A;  2ZD1 A;  3M8P A;  2IVP A;  1WSJ A;  4YDU C;  1GLJ O;  1RFQ A;  4WYB A;  3M8R A;  1KFS A;  3CCE N;  1XMO K;  1MWM A;  4BR5 A;  4JI0 K;  1D8Y A;  1KLM A;  1CLQ A;  3D2F A;  2Z1G A;  3O1B A;  3W3D A;  4CJT A;  2P1J A;  4FJ7 A;  4M7Y A;  4IZ9 A;  4CJP A;  4EP4 A;  4KH6 A;  5JIC A;  3RSE B;  1SKW A;  5J2N A;  1S72 N;  1WSG A;  2E2O A;  4Z4C A;  3MXM A;  1GOB A;  2VQE K;  3OYN A;  2WOM A;  1RIL A;  3SPY A;  3EZW A;  4EIA A;  1U4B A;  3F9K A;  3WNF A;  4CBW A;  4A59 A;  3U3G A;  1IG8 A;  3WNH A;  2D0A A;  3ZT4 A;  3C7N B;  5J2Q A;  5IWA K;  4FWL A;  4K41 A;  4DFM A;  5JMV A;  4OKK A;  1QTM A;  2XHB A;  4CF0 A;  1IKY A;  3CYM A;  4RW7 A;  3OYI A;  1Y64 A;  3M8Q A;  3PIO L;  1K73 O;  2P9I B;  3TSQ A;  2BE2 A;  2OPS A;  4BC3 A;  3MDQ A;  4CZF A;  1EXQ A;  5EXW A;  3I8B A;  4W5R A;  3CCU N;  3VQ6 A;  1ZXO A;  2ASO A;  1NGI A;  1BA0 A;  1NMD A;  4BQL A;  3LDS A;  1JLA A;  3E9O A;  1L3V A;  4BWM A;  4F2S A;  3D2F B;  1OVQ A;  2DPN A;  2NRT A;  3AV9 A;  4BRC A;  2KZM A;  3E01 A;  4DTS A;  2IVN A;  3P1G A;  1BG3 A;  3RR7 A;  3LL3 A;  3LM9 A;  4W5N A;  5EVZ A;  1JCF A;  3CXC M;  4E7L A;  1XMQ K;  3OYL A;  2F9W A;  5AQM A;  5BPN A;  3IFR A;  3T1Y K;  1ZBH A;  1X9W A;  4JI2 K;  5DMR A;  4CZL A;  4Z4G A;  4B9T A;  3L4Q A;  1RBT A;  3VEW A;  5KPT A;  4JKA A;  4MFB A;  4BR2 A;  3NF6 A;  2NNW A;  5KRS A;  5JVG L;  3IDH A;  2HF4 A;  5J2M A;  4CFA A;  2H3G X;  3BY5 A;  3LM2 A;  2ITG A;  4E19 A;  1JL2 A;  3CCQ N;  2VQF K;  2GUP A;  4NYN A;  2A1R A;  4BY9 C;  2HHU A;  2FLO A;  4IFE A;  5GAH P;  2DFF A;  4CFD A;  3AVM A;  3UKU A;  3DLL L;  4LC9 B;  3R9P A;  3OBW A;  3P31 A;  4PKG A;  5CR4 A;  4DSE A;  3HYF A;  2E1Y A;  3EN9 A;  5AR0 A;  2YHX A;  4FM2 A;  4O0I A;  1KAY A;  1KSP A;  3NF8 A;  3NGI A;  2RPI A;  2GUI A;  1NK8 A;  3LDL A;  2YHB A;  2ITM A;  5HLF A;  2PYJ A;  2DFE A;  1CZA N;  1RGI A;  5I3U A;  5FPD A;  2KFN A;  1XC3 A;  3H45 C;  2P9L A;  3SNN A;  3O4N A;  3L0Q A;  3RMC A;  1S1T A;  3WQT A;  1ATS A;  1CXQ A;  3VEV A;  4F2R A;  5M1N A;  4BG8 A;  4FWN A;  3VEY A;  3GL1 A;  1C1C A;  3L2W A;  1KVA A;  4CJV A;  3I0S A;  2BGG A;  1UWB A;  5E26 A;  3TAG A;  2QKB A;  3ZX2 A;  5AQL A;  1IKW A;  3HVT A;  1RDC A;  3OJS A;  3EKU A;  4IFY A;  5CY4 A;  3U9Z A;  3O3G A;  3AVC A;  4N56 A;  4YOY A;  4FLX A;  4YHH K;  4IXC A;  1Q86 O;  3V9Z A;  3PX6 A;  1SKR A;  3DLB A;  2GV9 A;  3QEV A;  3VQ4 A;  4E7H A;  2IC3 A;  3LDQ A;  3MN9 A;  1OH6 A;  3O4Q A;  4E7K A;  4GNI A;  3KD1 E;  3UKU B;  4CE9 A;  4LF5 K;  1WSI A;  5KRT A;  2AJQ A;  3VA0 A;  1EKE A;  2WTU A;  3SUQ A;  2YCH A;  2HVI A;  4AHV A;  1VQ9 N;  3AA2 A;  3ULE A;  4E3S A;  4CJS A;  4B3T K;  4M3T A;  3ATU A;  1QVF M;  1C0G A;  2P9L B;  3WNG A;  4DV7 K;  3T3F A;  4BDP A;  3SPZ A;  3ID8 A;  3U3Y A;  3BUZ B;  4CF1 A;  1HNX K;  4LF9 K;  4BRE A;  3WT0 A;  1BWF O;  1YJN N;  1MU2 A;  4DSJ A;  1C0F A;  4AH9 A;  4BC5 A;  3QFP A;  1OKJ A;  3CCR N;  5BRE A;  1DTQ A;  5AQI A;  4JEP A;  1Q81 O;  1CZB A;  4A2A A;  4M63 C;  2FSK A;  2IDO A;  4JKC A;  3NE6 A;  5JS1 A;  1NK0 A;  4NLC A;  4FJ9 A;  4Z4E A;  3E9P A;  2E2Q A;  4MDA A;  3VN5 A;  4A57 A;  3FE1 A;  1TK8 A;  1IG9 A;  4K43 A;  3HVR A;  2DTU A;  2QWQ A;  4JI3 K;  3NFA A;  1RT7 A;  3R3L A;  3CPW M;  5FRN A;  4JS5 A;  5J1E A;  2O4G A;  3PSI A;  1KAZ A;  4DU1 A;  4PUO A;  1K8K A;  1TGO A;  2NUB A;  3MCP A;  4W5O A;  4OKJ A;  3ULE B;  2EWS A;  4B3R K;  4M3U A;  1W0H A;  3THY A;  4CHP A;  4JNE A;  4KHY A;  4CIE A;  1J5E K;  4B9M A;  1G15 A;  1BQM A;  2HF3 A;  3VGM A;  4QS9 A;  4ELV A;  1NK5 A;  1RT4 A;  2O8E A;  2OA8 A;  4CZM A;  1JXB A;  5BPL A;  3V1O A;  3PX4 A;  1Q7Y O;  1HLU A;  1QQO A;  1HUX A;  1OH8 A;  2YX6 A;  1XWL A;  1S5J A;  2D4W A;  1Q9X A;  3L3U A;  4JK8 A;  5JLF A;  3AVJ A;  4FWK A;  4K8Z A;  2BH1 A;  4BQZ A;  3WNE A;  1EWQ A;  3JAM O;  3QDK A;  4J2A A;  3O9S A;  1IKV A;  4N41 A;  3CPE A;  2F8S A;  3KK3 A;  3FZL A;  1CXU A;  5SWM A;  5AQW A;  3KZB A;  3L2V A;  5HL7 L;  4OGC A;  4YOT A;  1NKB A;  1CZ9 A;  4BRN A;  5AQK A;  4K25 A;  3W0L A;  3SJH A;  1K8K B;  1DTT A;  4KI4 A;  4O5B A;  3RMA A;  4FJ5 A;  4KAZ A;  3KJV A;  3I0R A;  2I7N A;  2I7P A;  3THY B;  2KKZ A;  2V7Z A;  1TV6 A;  1NJI O;  1D9D A;  1W9H A;  3FGU A;  3QML A;  4DSL A;  1LW0 A;  2PAV A;  4CF2 A;  3CMA N;  5I42 A;  3TAR A;  1TKT A;  2O8E B;  3HT3 A;  3V9W A;  2P9K A;  1X3M A;  2OYQ A;  1DLO A;  2FC0 A;  5AQY A;  3DLH A;  3OS0 A;  1N8R O;  4IDH A;  4K0K K;  1RT2 A;  3IS9 A;  4BVO A;  4CJ7 A;  4DF8 A;  3CC7 N;  1VQN N;  3R8E A;  3SZ2 A;  5C2D A;  2YNH A;  3K5M A;  3SV3 A;  1IV0 A;  2D0P A;  1VQO N;  3SQ4 A;  2PZS A;  3NVK A;  1NJZ A;  3GBT A;  1WUA A;  3O3H A;  1J6Z A;  2UUC K;  3QBW A;  3ZT2 A;  3RR8 A;  3HRG A;  4CES A;  4FVM A;  1LWE A;  1WAF A;  3OYH A;  3TTD A;  1RTI A;  3TSU A;  1YIJ N;  1NJX A;  4DR4 K;  2YHA A;  2J4R A;  1EWR A;  3G4S N;  3VEO A;  3TI0 A;  5HRS A;  4PHT X;  4CGI A;  1SKS A;  4CJ4 A;  2FBX A;  3QIN A;  1Z05 A;  4ILH A;  3AAQ A;  3CC4 N;  2B6A A;  4NCG A;  1F21 A;  2P9K B;  3FZM A;  2V7Y A;  4Y1C A;  4CGF A;  3KIO A;  4FWO A;  5FPE A;  1SUQ A;  2X78 A;  4O0J A;  4BE0 A;  3AGK A;  3H3N O;  2E5L K;  5BRD A;  3CCM N;  3HK2 A;  2I5J A;  2VWK A;  3ENB A;  1RBS A;  1TL1 A;  2GBZ A;  2G8U A;  2IGI A;  3WXM B;  2NRZ A;  2ASP A;  1P8Z A;  1GOA A;  4OPH A;  3ZSO A;  1OH7 A;  4YOV A;  4Z4F A;  4HHT A;  2X6N A;  4LFC K;  3FFK B;  4CVN E;  3VET A;  2UUA K;  5BR9 A;  3ZT1 A;  1BHL A;  3LWL A;  1KC8 O;  1JLC A;  1FXX A;  3KLI A;  1HX1 A;  2ASM A;  4FLV A;  5HRP A;  4DU3 A;  4BE2 A;  1YT3 A;  4CK2 A;  3VEX A;  4ELT A;  5LMU K;  4WQ4 C;  4CJF A;  5T7B A;  1EO1 A;  2FF6 A;  4WQ5 C;  2UXD K;  1T03 A;  2HMI A;  4BR4 A;  4Z4H A;  4RWT A;  3HP9 A;  1VQK N;  2W6K A;  3NH0 A;  4Q0B A;  1VRT A;  3DOK A;  4W5T A;  5AJ3 K;  3P39 A;  4FVU A;  4O4G A;  2HBJ A;  4FPB A;  2QWR A;  4HTU A;  3NGZ A;  4YOR A;  4BRI A;  3CJ1 A;  1TUY A;  5C2F A;  3DLR A;  5EX5 A;  4TSX A;  3EE9 A;  3SQ2 A;  3ZSZ A;  2Y1I A;  1EX4 A;  1S1X A;  4FXD A;  3TSP A;  2RHK A;  4O5F A;  4CJW A;  3L2R A;  2HND A;  2CGL A;  2RF2 A;  2W41 A;  5KPR A;  4PQU A;  5AQV A;  2BUP A;  1VSH A;  4BR7 A;  3OY9 A;  4CGH A;  1NGF A;  1VK0 A;  1S22 A;  3P5J A;  3V6D A;  2RN2 A;  1EP4 A;  5ADX H;  2QWL A;  4FWP A;  4CEZ A;  3F5T A;  3KLG A;  3S3O A;  3VMF B;  3VTI A;  4E7I A;  3IKM A;  3DLE A;  3CCV N;  5AQG A;  3V1R A;  5GIN A;  1VSM A;  3MK6 A;  2VWB A;  5KQ8 A;  3CQ8 A;  4KTW A;  1QSS A;  3UE5 A;  3MXI A;  1C0M A;  4E1J A;  4DR1 K;  3TAE A;  1XUP O;  3PLA A;  1S1W A;  4CK3 A;  4LY7 A;  4A62 A;  3H3O B;  3ZSX A;  3VEZ A;  4BG9 A;  4CHZ A;  1YHQ N;  2KZZ A;  1WSE A;  1RTH A;  2HNY A;  5KGX A;  3E66 A;  3NMU A;  4O44 A;  5AQU A;  4B1X B;  1LAW A;  1VSI A;  1EET A;  5FPM A;  2HVH A;  1NM1 A;  4CED A;  4DQ8 A;  3QEW A;  4Z4I A;  2FBT A;  4A5B A;  3V9U A;  2O8D B;  2NRR A;  4ISF A;  4J2B A;  3TTF A;  4DQQ A;  3AO2 A;  2Q1N A;  3QNN A;  2ZQB A;  1FK9 A;  3M8S A;  4HUG A;  1I39 A;  5AQZ A;  4LF6 K;  3JSM A;  3MEE A;  3SUO A;  1SL2 A;  3M1F A;  4EFH A;  3SBT A;  5DM7 L;  4C8L A;  5JLH A;  1IO2 A;  1QHT A;  3F9M A;  3SYZ A;  2ZJQ L;  3QEI A;  4CF8 A;  1V4T A;  4RG8 A;  5DK5 A;  3IAY A;  4B3M K;  1GLD G;  3PUF A;  1NGC A;  3G6E N;  4CI6 A;  4NXM K;  2HOE A;  1C0T A;  4J2E A;  4B1U B;  4QCL A;  4I7F A;  1SQK A;  4FJX A;  5GIP A;  3MWT A;  3FFI A;  3TAM A;  5GIO A;  3T1A A;  1KFD A;  2A6A A;  1UAX A;  2HMP A;  3KK2 A;  2QM1 A;  1U47 A;  5CYQ A;  4UY8 O;  1L5U A;  3AVH A;  1K8A O;  4C8O A;  4OX9 K;  5EY4 A;  3MN5 A;  2QWM A;  2P51 A;  2Z1J A;  1KCF A;  3C6A A;  2OPP A;  2YNG A;  4QAG A;  1S3X A;  3LAK A;  1Q82 O;  3KD5 E;  2PBD A;  1VQ6 N;  1IBK K;  2P5G A;  3OS2 A;  4N5S A;  5AQO A;  3DXM A;  1S1U A;  3PX0 A;  3J7A P;  2OTL N;  4BRO A;  3K2P A;  3JS6 A;  3A2F A;  2YV0 X;  2UXB K;  4CZH A;  4DR5 K;  4DTU A;  1YJW N;  2EX3 A;  3R6M A;  3PY8 A;  2NRV A;  1XHX A;  1D9F A;  2YNI A;  3OYK A;  1HNV A;  1K9M O;  1VQ7 N;  4KFB A;  3O4W A;  2QWP A;  3LAL A;  4R79 A;  2FXU A;  1RDB A;  3ISN C;  3OYF A;  2HBK A;  1R59 O;  4IOA L;  1JLE A;  1XNR K;  4B9S A;  4RCH A;  4DR3 K;  2UYT A;  4BRA A;  2F96 A;  3DYA A;  3F2K A;  4IDK A;  4FZY A;  2QXF A;  2QA4 N;  1XQS C;  4CCH A;  4PWD A;  3IG1 A;  3CJ7 A;  4ID5 A;  5F1X A;  4CGJ A;  3V9X A;  3LP1 A;  4BRM A;  2ZWH A;  1N33 K;  4BAC A;  3DLG A;  5AZI A;  1KXP A;  3L8B A;  4F8R A;  5FLX O;  1JKH A;  1VSF A;  3G71 N;  4FLT A;  2O8C A;  1WOQ A;  4NXN K;  4CJE A;  3ZSW A;  4H4O A;  1W7A A;  3QB0 A;  4DCH A;  3CCJ N;  4I9Q A;  3DXM B;  1LWF A;  4OVL A;  3DXK A;  3SK3 A;  4CJ3 A;  5CHI A;  4GW6 A;  4KHQ A;  2Q31 A;  1V4S A;  4MLE A;  1NOY A;  3SUN A;  3H1Q A;  3N4Q A;  1W2B M;  4DKW A;  4B9V A;  4AHR A;  1HMV A;  3A5L C;  4O8K A;  4F9O A;  3BDP A;  3H08 A;  4H5R A;  3M6G A;  3I55 N;  4IKF A;  5BN9 A;  5TKW A;  4FK2 A;  2ZJP L;  1LOT B;  2ATQ A;  3CER A;  5M1Q A;  1E4F T;  4PKH A;  2XO7 A;  4B9Q A;  4DB3 A;  5JS2 A;  5C15 A;  4ISE A;  3QET A;  2D0O A;  3L6Q A;  4FLU A;  3G25 A;  5HRN A;  3OVN A;  3KK1 A;  3CQX A;  3RRH A;  4LFA K;  3ZCM A;  1KAX A;  1JXE A;  4C1N K;  2YI1 A;  2F4V K;  2GWK A;  3SAG A;  4IFV A;  4DG1 A;  2E6M A;  3VES A;  4CEC A;  3FZK A;  3BZK A;  3KLH A;  3KHY A;  4DTX A;  4DR7 K;  2HHS A;  2BDP A;  2EHG A;  2O8C B;  4N47 A;  1NK6 A;  1RDA A;  1DEJ A;  4JKE A;  1WNS A;  4BWJ A;  1IJJ A;  4YOW A;  2ZGY A;  1ILY A;  3C0B A;  3DXK B;  4HTL A;  4E7J A;  3V9S A;  5IT9 O;  3BZC A;  1NGD A;  4DWI A;  1HNI A;  2G8W A;  3DRP A;  1B9D A;  4E1N A;  4KPY A;  3GDQ A;  2WUS A;  1NK4 A;  1X1P A;  2Q0R A;  3J7Y P;  3O08 A;  4JI7 K;  1VRU A;  2VG6 A;  2O8B A;  3O8M A;  2XY5 A;  1LCU A;  1QSY A;  2Z1H A;  3ZSQ A;  1VHX A;  4KRE A;  2LSN A;  4DUZ K;  3O1W A;  3WEE A;  4IEI A;  4DSK A;  1X9J A;  1JJ2 M;  3OW2 M;  4N76 A;  3K0S A;  3VF4 A;  4DS4 A;  2BTF A;  4DR2 K;  4M3X A;  2ZGZ A;  3FZF A;  5MLC Q;  1VAZ A;  5HBM A;  2KLA A;  1U49 A;  4JD2 A;  1WBD A;  4HCB A;  4UQG A;  3EYZ A;  1BO5 O;  4KHN A;  1O13 A;  3AVI A;  3LP0 A;  4RW4 A;  2FSN A;  3CFO A;  1N6Q A;  4GV3 A;  2R7Y A;  4B9U A;  3E9L A;  5KPZ A;  3VF2 A;  4XEI A;  2WC9 A;  1OH5 A;  4LH4 A;  2E88 A;  4I2Q A;  1KVC A;  3HPH A;  3ALY A;  3CG7 A;  3CIP A;  5ADX A;  4BRL A; 
#chains in the Genus database with same CATH homology
 4DV7 K;  4B3S K;  1IBK K;  4LFA K;  4JV5 K;  4DR1 K;  5LL6 Z;  4GKJ K;  2F4V K;  4DV5 K;  4DV4 K;  1HNX K;  2UU9 K;  1HNW K;  4LFC K;  4LF9 K;  4CVN E;  4DV1 K;  3J7A P;  2UUA K;  1N32 K;  4DUY K;  4DR7 K;  4X64 K;  5A2Q O;  2VQF K;  2UXB K;  4DV6 K;  1HR0 K;  4DR5 K;  1XMO K;  4LF8 K;  4JI0 K;  4GKK K;  4LF7 K;  5LMU K;  3T1H K;  2UXD K;  4JI4 K;  4V19 S;  5IT9 O;  4K0K K;  1XNR K;  4JI3 K;  1IBM K;  5AJ3 K;  4DR3 K;  2VQE K;  4AQY K;  4DV2 K;  3J7Y P;  1N36 K;  4LF6 K;  4JI7 K;  3J81 O;  2HHH K;  1N33 K;  5LMN K;  4X62 K;  3J80 O;  5FLX O;  4B3R K;  4LFB K;  5IWA K;  2UUC K;  4DUZ K;  4DV3 K;  4DV0 K;  4X65 K;  4DR6 K;  4NXN K;  4LF4 K;  1J5E K;  4X66 K;  4YY3 K;  3OTO K;  1N34 K;  5BR8 K;  4B3M K;  4NXM K;  4DR2 K;  4DR4 K;  1IBL K;  1XNQ K;  4YHH K;  1I94 K;  1FJG K;  4JI5 K;  4JI6 K;  4JI1 K;  4CW7 B;  4JI8 K;  4JYA K;  4LF5 K;  3JAM O;  1HNZ K;  2UXC K;  2ZM6 K;  2UUB K;  4OX9 K;  1XMQ K;  4KHP K;  2E5L K;  3T1Y K;  4JI2 K;  4B3T K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...