1J5EL

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1j5eL00
1PA6A 4LFAL 3A74A 2EQSA 2HHHQ 3E0EA 4ALPA 3HOVG 3S2HH 1WFQA 3MXNB 4DAMA 1PYBA 4NXML 1HR0Q 1VQ5A 3CC2A 1I6HH 2Z0SA 4OO1I 1VQ9A 1NE3A 2D0PA 4HJ9A 2UXDQ 4GOPA 1UE7A 3K0XA 2R7ZH 5IT9c 4B3MQ 4KHZA 2R7FA 1NMGA 4JI7L 5C0XJ 1YHQA 3EIVA 4LF7Q 1PH5A 5JEAG 1MIUA 4YCWA 1VQLA 1IXRA 1FGUA 2AHOB 4YWLA 4LFCQ 2LXKA 2BA0A 2A19A 1VQCA 5JJKA 4A3LG 2CFMA 4IJLA 5C3EG 2K14A 4RMFA 1B70B 4OXPA 3CMAA 5ELNA 1PVOA 5C4XG 1L0WA 2B63H 5C4JH 3CCMA 4DV7Q 1X54A 2PMZE 1D8LA 1DGSA 1YHBA 3RZDH 2N78A 1V9PA 1IZ6A 2N8NA 3FKIG 1CKNB 2Y0SE 3U50C 3L0OA 2UXBQ 5DLQE 3HOXH 4A3MH 2Q2UA 4DR6Q 1FL0A 1QUQA 1UE6A 5IYCH 1QZGA 3KDFB 4A75A 4O2DA 2Q2TA 4P73A 1EWIA 1XMOQ 4PMWA 4X65Q 2E5LQ 1KC8C 2F4VQ 2I5HA 3D31A 1PH9A 2YU9H 5JJIA 2DUDA 2GN5A 1P16A 3RLFA 4HIDA 1N32Q 3J81j 1OXTA 4POGA 1IBLL 2ZM6L 2JA5H 3K8AA 2CCZA 2Z6KA 3AFPA 3KFUA 3S1QH 1Q12A 4JI3L 1PYSB 1VS0A 2CWPA 3STBC 4GNXB 1YJ9A 2B63G 3BJUA 4X66Q 3AYHB 4R4TA 3HOUG 5FLMH 3JAMc 4UP7A 1EYGA 2JA6H 4WJ4A 4JI6L 4IPHA 1Q1BA 3HKZE 4YWMA 4HJ7A 1WI5A 4DV4Q 4BBRG 3CQZH 1VQDA 1L1OA 1SMXA 3PUYA 2WAQG 4DK3C 3PF5A 4KI0A 1E1TA 4DV3Q 3PO3G 1HNWQ 1BKBA 2A8VA 2L15A 1SFOH 1GD7A 4GOPC 2UXCQ 3RLOA 4DV2Q 3H3VI 2EIFA 3ER0A 1YJWA 5M3FG 5J3BA 1IBKL 4A3BH 2JA7G 1EQRA 3GD7A 3I2ZA 4DV0L 3RN2A 1VQNA 4QIWE 1Q86C 4IO9A 4IFDI 2UUBL 3U58A 1EUJA 1NJIC 4A3GG 1WCMH 1M1KC 4BXXG 1SN8A 3NENA 4GN3B 1Y1VG 3TS0A 1IBMQ 5IP7G 3CP0A 3M4OH 1U0LA 4BY1H 5M5YH 1W3SA 1E24A 4DUYL 2E8GA 4IOCA 2VS1A 2IX0A 3J80i 3GDEA 3OTOL 3F2CA 3RZOH 3GTGH 2GVBA 2FXQA 3S1RH 3HOZH 1KRTA 1HZAA 1KRSA 4QL5A 3ULPA 2JA8H 4JBWA 3S24A 2YTXA 4K0KL 1HNXL 1UEBA 1PH6A 5IP9G 4JOIA 3HOYG 1XPOA 1AE2A 2PNHA 1PH2A 1YNXA 4PZ7A 4JI2L 4JI4L 3KLWA 4DKAC 1XMQQ 1X9NA 3DM3A 4LF9Q 3W1BA 2JEBI 3PCOB 4DK6C 4C2MH 4A3KH 1XPRA 2AKWB 4A3FH 2PI2A 1I94Q 4HJAA 1X3EA 2JK8A 4OWXB 1HH2P 2YTVA 3PIPA 1O7IA 2UUCL 1ASYA 1Z47A 2IHFA 5M3MH 3UDFA 3PIOA 4DR4Q 3ULLA 1VQMA 4DV1Q 3GTOH 5BR8L 5AJ3Q 1Q46A 4JI1L 5LMNQ 4DR3Q 2B3GA 1I50H 2VUMG 4BY1G 4YY3L 3UDGA 5C0XI 3ICEA 1E22A 2K52A 1UE1A 2ZJRA 1XNQQ 1UE5A 3K80C 1TXYA 2JJQA 3PO2H 2R93G 2LXJA 1HZCA 4IPDA 1VQFA 5IYDH 1W2BA 5GAHC 1Q81C 3J7A5 1JJCB 2VY3A 4BY7H 4JYAL 1TWAH 2WP8J 1J6QA 1VQ4A 2UU9L 4DR1L 4DR2L 4LFBQ 2PI2E 1J5EQ 1JJ2A 1HNZL 3BZKA 4NPSA 4NXNQ 3I4MH 2UUAQ 3M3YH 4A76A 1N34Q 4APVA 3CCLA 4LF4Q 4OWWB 1N36L 3STBD 3RR5A 2CWAA 5M5WH 4YCVA 4GKJL 3H15A 4DR5Q 4JBKA 2XGTA 1N33L 3H0GG 1K83H 4IFDG 2R92H 1HZBA 4JI8L 4LF6L 1K73C 4Y7NH 1EQQA 3JC66 3W5OA 1LUZA 4A3CG 3EBEA 2KHIA 1K8GA 5IYBH 1VQ6A 3GTQH 2HIVA 2VZAA 1RL2A 3GO5A 1VQAA 4A3IH 1VQEA 3CCVA 2KCMA 3T1HQ 4LF5L 3J81i 1VQ7A 1X65A 4R1JA 1FJGL 3NBHB 4YHHQ 4TVAB 1QVGA 3GTMH 4YWKA 4JV5L 1S3OA 1T9HA 5ELOA 1PH8A 2NN6G 4UPAA 2KHJA 2AWNA 1YBYA 2MQHA 4IPGA 2XTIA 4DUZL 2R7DA 5LMUQ 1IL2A 3KYHC 2VW9A 1QZHA 1SRUA 1BBUA 4BY7G 1XJVA 2IHEA 4X62L 1GM5A 1JE5A 4GKKQ 3K81C 4KHPL 1YZ6A 4O0AA 2R7ZG 5M5XH 4JI0Q 1K8AC 4LF8Q 4JOIC 2MO1A 1N9WA 1TWHH 4DV5L 4OX9L 2WAQE 4LUZA 4B3SQ 2JA9A 3L7ZC 4IJHA 4LWCA 4PG3A 2QEXA 3TRZA 4DPGA 2V1CC 5IWAQ 4PZ6A 2OTLA 1XNRL 2ATWA 1YIJA 4LFAQ 2IX1A 4JBJA 3MEFA 5GQOA 1G51A 2NVTH 5C44H 3PV0A 3I56A 1OTCA 3Q8DA 4NXMQ 4B3TL 4R4CA 1A63A 4P72A 1JJGA 3KDFA 3KOJA 4IPCA 5C0XG 2MNAA 2Q2HA 1A62A 1BBWA 2PQAA 3OYYA 2WB1E 2D62A 2UU9Q 2HT1A 2JE6I 3NEMA 4AYBE 2ZTCA 4AQYL 2VL6A 3HKSA 3HOXG 3U4ZA 4JI7Q 4A3MG 1PV4A 2NZHA 1FVIA 2WFWA 1VQIA 3M9BA 3S16H 4OO1G 1Q1EA 1XPUA 4XTCS 5IYCG 4HIMA 1OXSC 3K7AH 4MNOA 3G4SA 1B8AA 4DR7L 4LF6Q 1WYDA 4JI5L 1YITA 2CKZB 1UWVA 3A5ZB 4A3EH 1S72A 1IYJB 2R93H 2KENA 1VQBA 2K5VA 3KJOA 3F2BA 4IOAA 3I4NH 3S15H 1GO3E 1OXVA 2EXDA 4B3RL 3CPWA 2OTJA 2BA1A 2NZOA 5HY6A 3SGIA 2JA5G 2WB1G 1Z9FA 4A3JH 4OONA 4X64L 4AYBG 3A0JA 3AEVA 1OXUA 1YJNA 4DAYB 3KF6A 4NB3A 1CKOA 2QA4A 1YI2A 1HR0W 1C9OA 5FLMG 1ASZA 3AQQA 4HIKA 2CQOA 4DV6L 2VQFL 2MO0A 3ERSX 2K4KA 2JA6G 3OW2A 2VQEL 4GLAC 2N3SA 4R4OA 4AH6A 4MTNA 3CCQA 2E2HH 2HHHL 3B6YA 4XIGS 4A93H 4HJ5A 2QGQA 1HR0L 1GVPA 1IBLQ 1I5FA 2ZM6Q 1KHIA 4R4IA 1S40A 1VQPA 3FHWA 2UXDL 5JJLA 4JI3Q 3EN2A 1P8LA 2RHQB 4B3ML 2KCTA 5GADC 1JB7A 1HZ9A 2RCNA 2E2IH 2IY5B 3RN5A 4LF7L 3T1YL 4A3BG 4MZ9A 1PFSA 3HOWH 4A3DH 1TWGH 4LFCL 4JI6Q 4L5SA 2YTYA 1Q7YC 2Z6KC 5JEAJ 3RLNA 1SROA 3HOVH 1WCMG 3VDYA 3BZCA 3W1GA 4DV7L 3F2DA 1XTDA 4X6AH 1V1QA 1G291 2ASBA 2JEAI 3AFQA 3M85A 2UXBL 2RHSB 3WWVA 4DR6L 4HIOA 4LUOA 1IBKQ 3CAMA 1NY4A 3HOZG 1K0RA 4DV0Q 1NTGA 1L1OC 4HJ8A 4A3LH 1X3FA 2A1AA 2UUBQ 2MFIA 2JA8G 1B7YB 4GOPB 4FDBA 1E1OA 1XMOL 1K9MC 1CSQA 4X65L 2E5LL 1HJPA 2F4VL 2BH2A 1SR3A 3PUXA 2I0QA 4GLXA 3S1NH 1CUKA 3CW2C 4A3KG 4DUYQ 1N32L 4C3IH 3FKIH 4A3FG 1G6PA 3G6EA 3CCEA 3E9HA 3PSIA 3OTOQ 3S14H 4UP8A 1X6OA 3J80c 3CC4A 5M3MG 2NVXH 1KL9A 2ALYB 2KBNA 4X66L 2OQ0A 3JAMi 2IT1A 1TWCH 1OXXK 4Y52H 4K0KQ 1HNXQ 3PGZA 4TQUS 3GTKH 3I55A 1KD1C 4JI2Q 4JI4Q 2R6GA 4AIMA 1JMCA 5IE8A 3GTLH 3TQYA 1VCIA 1QUQB 3PO2G 1RIPA 4DV4L 3T1YQ 2H5XA 1C0AA 2HQLA 4C3JH 2ZJQA 1PH3A 5IYDG 4DV3L 3CC7A 2YV5A 3FP9A 4JC0A 5GAGC 2UUCQ 4BBSH 1HNWL 2UXCL 1H95A 3HOUH 4DV2L 3I4MG 5BR8Q 3CPFA 4JI1Q 3U4VA 3NELA 2ID0A 1AH9A 2YYZA 4JG2A 3DLLA 3CD6A 3PUZA 4YY3Q 1CKNA 3KJPA 2R92G 2ZTDA 5GROA 2OCEA 1PH1A 3CCJA 2LSSA 1X55A 3CCSA 1NMFA 1LM0A 3BU2A 5IYBG 2F3IA 4BBRH 1D7QA 1Y1WH 3G48A 5FLXc 3PO3H 4A3IG 1VQJA 1IBML 4JYAQ 2NVQH 4POFA 1VQKA 3S2DH 5K36G 4DR1Q 1Y14B 4DR2Q 2PQAB 1HNZQ 4GN4B 3TS2A 2B29A 2AWOA 4H02A 3E9IA 2OWOA 4UY8C 1YVCA 1MJEA 5M3FH 1N36Q 1R9TH 4GKJQ 1N33Q 2JA7H 4GLVB 1L1OB 2DGYA 3UE0A 5IY0A 4P75A 4JI8Q 3K7UC 1EFWA 3UDIA 1EIFA 2Y0SG 4A4IA 4BBSG 1BVSA 1L2FA 4A3GH 4L5TA 3GTJH 4GNXA 4BXXH 1JT8A 2C35B 4KLKA 1X56A 1NBWA 1Y1VH 1XMQL 5IP7H 1WJJA 4LF5Q 4LF9L 5LMNW 1E7ZA 1I94L 1FJGQ 1QVFA 2K5NA 3J81c 3KF8B 1PH7A 4JV5Q 2F52A 4LUVA 1VQGA 2K75A 5GAEC 4DNIA 4DUZQ 4DR4L 5C44G 1CSPA 4DV1L 3KF6B 4GN5A 1PHJA 1QVCA 5AJ3L 2VNUD 3A5UA 5LMNL 1KQSA 4WJ3M 4DR3L 4X62Q 1A8VA 1LYLA 2BH8A 4JBMA 3S17H 2NVYH 4KHPQ 4ME3A 5FJ8H 2Q2IA 5IP9H 1XNQL 3HOYH 4EX5A 1YEZA 4DV5Q 4PZ8A 4OX9Q 1K3RA 4C3HH 4QGUA 3GTPH 1VQOA 1XNRQ 5HGQA 2K5HA 1X3GA 4QY7A 3TEHB 4EQ5A 2I5LX 3S1MH 1MJCA 4YCUA 4A3EG 1N8RC 4LFBL 1VQHA 5E7NA 3M4PA 4NXNL 3RNUA 1M90C 1J5EL 4B3TQ 2UUAL 2GVAA 3HKZG 3PUVA 3PF4A 4BA2I 1N34L 2E2JH 1SLJA 4LF4L 3I4NG 1V43A 4R4QA 2VUMH 3LGJA 1EOVA 3D0FA 3M4QA 2HIXA 4DR5L 3UE1A 1LTLA 1WOCA 4GS3A 3J7ZC 2ES2A 4AQYQ 4LNQA 2N49A 1KAWA 4P74A 3HFZB 3G71A 1I3QH 4A3JG 3I7FA 1U5KA 1KIXA 3TREA 3ZJYC 2NN6I 3I4OA 3CXCA 4UP9A 1C7YA 4IFDJ 2RF4A 4P71A 5H1SE 4DR7Q 2D0OA 3F8TA 4OWTB 1PH4A 4JI5Q 3T1HL 1SE8A 2K50A 3IRBA 4QJFA 3H3VH 4QQBX 1Q82C 5FJ8G 2OQKA 4YHHL 2AMCB 1AE3A 1CKMA 3F1ZA 3CCRA 2I5MX 2ZTEA 4L5QA 1MKHA 1Y1WG 1GKHA 3UDXA 2JQOA 3PUWA 3CF5A 5LMUL 4B3RQ 4A93G 1EIYB 3H0GH 4BA1I 1YHAA 5C3EH 1KXLA 4RG1A 4J15A 4LW1A 1VQ8A 1E3PA 1TWFH 4X64Q 3CMEA 5C4XH 3M7NA 4GKKL 4A3CH 1Q8KA 4JCVE 4GNXC 4JI0L 4LF8L 2ZJPA 1A0IA 3L2PA 4B3SL 4DV6Q 5EAYA 4A3DG 2VQFQ 3CCUA 3HOWG 5IWAL 3ULJA 2VQEQ 4L5RC
chains in the Genus database with same CATH superfamily
1VF5C 2NN6H 4LFAL 2HHHQ 2B39A 4UHVA 3S2HH 2F0WA 4DAMA 5C6AA 4NXML 1VQ5A 3CC2A 2Z0SA 1Y8NB 1RKNA 2D0PA 3MC0B 1S4ZA 4ILWA 2J0TD 4KHZA 1NMGA 3J7YW 4JI7L 1YHQA 3EIVA 4LF7Q 4YCWA 4J1MA 4LFCQ 5JJKA 2BA0A 5C4ZA 1RTOA 4IJLA 3FDTA 1EOTA 4KY7A 3FEWX 3NP8A 1JC7A 3BVGA 4DV7Q 4CKCA 1D8LA 3IFDA 5C0XH 1DGSA 2JA6B 2N78A 2B2WC 2AQ2B 1I4HA 3FKIG 1C4QA 2Y0SE 3CRKC 3L0OA 1SJHD 2Q2UA 3QOJA 1JOOA 4K2LA 5IYCH 3M7GA 5EJWA 4O2DA 2B8FA 1IW7D 3DHQA 1GHKA 4QF4A 4RGOS 4RGMA 1EWIA 3DMUA 4A3BB 3D31A 3EA6A 5JJIA 4DA2A 2GN5A 2Q8IB 2F4IA 4HIDA 2M9VA 1OXTA 2IW3A 4POGA 1IBLL 1PFNA 4EGVA 3K8AA 3TDQA 2Z6KA 3AFPA 1EL0A 1Q12A 3DWAA 4GNXB 3AYHB 4R4TA 3VA7A 4XYQA 5FLMH 3VYUA 2A6EC 1JOQA 3RZOB 4IUVA 3MTSA 2A74C 1S5BD 5CV5A 1A3TA 2G5DA 4YWMA 5KEEA 4DV4Q 4RGNA 1SMXA 4KI0A 2A8VA 2LFNA 4H44C 3F2UA 3RLOA 5I9OA 1NR4A 4KKSA 1KDCA 3NTIA 5J3BA 3I72A 1IBKL 1EQRA 1VQNA 4DV0L 1I4GA 1DM0B 1JR0D 5CR3A 4QIWE 1TKWB 3U58A 1PTOH 2JSOA 3OWEB 4BXXG 2XRQD 1SN8A 3T4AC 2L12A 1I50B 1K8OA 5M5YH 3NSWA 1W3SA 4DUYL 5CGKA 3MHBA 3K5LA 4IOCA 2VS1A 1TQOA 2HCIA 5D3IB 1SYCA 3PIO3 2FXQA 1TU2B 4XT3B 1TWAB 1QOHA 4KTAA 3T13A 4JBWA 3K5NA 3S24A 2YTXA 2F0UA 3CKIB 3HOYG 1XPOA 1PH2A 4JI4L 3KLWA 1XMQQ 2QEJC 1K83B 4DK6C 3PCOB 4C2MH 4EQPA 4A3FH 2PI2A 4IFDH 5JOBA 1LV9A 1X3EA 2JK8A 4OWXB 3PIPA 1Q90A 2UUCL 4A3IB 3ULLA 4RA8A 5BR8L 4JI1L 4DXFA 4QB4A 3H6MA 1AFPA 2B3GA 1CFMA 4BY1G 1ZEQX 2HDLA 1E22A 1GUTA 1UE5A 4NKLA 3K80C 4RCNA 1J9OA 4M8AA 2PMZB 1VQFA 3V05A 1W2BA 1BR9A 2VY3A 4IUNA 5IIFA 2UU9L 4DR1L 4LFBQ 4NXNQ 1TWHB 1B3AA 3A8KE 2MPMA 1N34Q 1D1KA 3X3MA 1N36L 5M5WH 1BF4A 5A35A 3H15A 1N33L 5KGUA 1F2MA 2NVTB 4LF6L 1ILQA 2DY7A 3C1FA 5C44B 4A3CG 2KHIA 4XT1B 2FFKB 5IOCA 1RL2A 3CCVA 4LF5L 3NBHB 1TY0A 4TVAB 3GTMH 4YWKA 4JV5L 5ELOA 3S16B 4KJOA 3R93A 4IPGA 2AWNA 3OSOA 1I4PA 1IL2A 2R7DA 3K57A 1QWYA 2RDFA 4A3EB 5ELBA 1XJVA 1GM5A 1JE5A 3K81C 1WVLA 1HUNA 1YZ6A 2BE5C 4CKBA 4FXGC 1NSNS 3MXPA 4LF8Q 3I4NB 4JOIC 2MO1A 1L0YB 3L7ZC 2QEXA 4LJZC 2V1CC 2SNMA 4DPGA 3OOCA 1YIJA 4LFAQ 1GJXA 5GQOA 3P7JA 4NXMQ 4DF7A 2EOTA 1JJGA 3KDFA 3KOJA 1A2UA 4IPCA 1K3BC 1HQMC 1BBWA 2WB1E 2D62A 2VL6A 3HKSA 3HOXG 4JI7Q 4A93B 1BOSA 1FVIA 2WFWA 1LLRD 3M9BA 5KRUA 1SBBB 4XTCS 5BN3A 1QCBD 2Q8RE 3I90A 5COYA 1WYDA 2R93H 1UWVA 1M8AA 1IYJB 1NCVA 2KENA 4FF2A 3F2BA 1WD0A 3FVQA 3HOWB 5FLXL 4KMUC 1TWGB 1OXVA 2A5HA 2EXDA 1VMPA 3S9WA 3CPWA 4TRDA 4H0LC 2LMCB 1YI2A 2NTTA 1EY6A 4X3UA 2RQXA 2KJXA 1C9OA 3AQQA 4HIKA 1VF7A 1TS4A 5EBDA 5J1ZA 4DV6L 2VQFL 2MO0A 3MFGA 2VQEL 5J22A 1FD7D 2N3SA 1CHPD 2NYZD 4MTNA 4XIGS 1KAAA 5FO9B 4HJ5A 2QGQA 1FR3A 1GVPA 1HR0L 1IBLQ 2R61A 1VQPA 5EBCA 3FHWA 3AU7A 3EN2A 2NTSA 2RHQB 4RCOA 2OT2A 3SR1A 1TS2A 1AW7A 2IY5B 3RN5A 3S14B 3A7AB 4EQOA 2Z6KC 3CU7A 1SXTA 3HOVH 3VDYA 1CZGA 3W1GA 3GTKB 2ASBA 2RHSB 3WWVA 4DR6L 2PNRC 1IBKQ 4DV0Q 4HJ8A 2JA8G 1LABA 4BWGB 2B63B 1TIID 3MEHA 4FDBA 1E1OA 2E5LL 3BYTB 5BN4A 4RKLA 1SE2A 4ABNA 2I0QA 3S1NH 4DUYQ 3G6EA 3G7LA 4UP8A 2A69C 4BBRB 1SNQA 2ALYB 2ICIA 2NVQB 2Z1CA 4CGYB 5C5MA 5M3FB 4JI4Q 1H9SA 4IUQA 1GUSA 1EY5A 1MHWC 4UDUC 2ZJQA 4A3GB 2QDBA 5I2XA 3I73A 4DV3L 4JC0A 5GAGC 1ML0D 2UUCQ 1DCZA 3E6ZX 5BR8Q 1F9PA 4JI1Q 2ID0A 2XN9C 1JB3A 2R92G 5GROA 4DNTB 5KNDA 3CQZB 1NMFA 3CCSA 5T1GA 5IYBG 3Q24A 1Y1WH 2DNCA 3PO3H 1IBML 2RDHA 2ENBA 2GA4B 3S2DH 5K36G 4DR1Q 1Y14B 3TS2A 2QCPX 4GN4B 5ISRA 2AWOA 3SE0A 4K6DA 1N36Q 1MJEA 1R9TH 1X3QA 1N33Q 4GLVB 2L5TA 5IGFA 3K7UC 4A4IA 3C1EA 3D8GA 4L5TA 4GNXA 1JT8A 3TP8A 2C35B 1JCKB 3EQLC 1SYFA 3HG9A 2VUMB 1Y1VH 2X6GA 2IPKD 4LF5Q 3ND9A 1Y8OB 4LF9L 1I94L 4JV5Q 3GTGB 4F7XA 4RHRA 1XYIA 1CSPA 2CQAA 4DV1L 3P20A 1QVCA 2VNUD 1A8VA 1W6JA 2Q2IA 1GXDC 4C3HH 4Q0FA 1IW7C 4OELB 1FGBD 1CA6A 5E3FA 2L55A 2K5HA 1X3GA 5IODA 3S1MH 2Q8TA 4ZRZA 4DAYA 2RCFA 2UUAL 3PF4A 1O7YA 1JE4A 2RVLA 5E4WC 4F8MA 5FO8B 1SLJA 2TMPA 4LF4L 5EKKA 2B2WA 4G4KA 4J8QA 1LTLA 3SK4A 3PO2B 1I4RA 3S2HB 4P74A 3BZDB 3G71A 1O80A 3MXUA 3I4OA 3AMUA 2RF4A 4OWTB 1PH4A 1SE8A 1Q82C 2OQKA 1CKMA 3SK5A 3CCRA 3CHBD 1BO0A 4ODGA 1D5ZC 2JQOA 4BA1I 1YHAA 1PTOC 5CV6A 1C48A 1FYCA 4ZKBB 1Q8IA 1K0SA 1Q8KA 4JI0L 4E6IA 4B3SL 3IAYA 2JN4A 4DV6Q 4A3DG 2VQFQ 3KBXA 3IL8A 2VQEQ 1PA6A 2OXPA 1F9QA 3MXNB 1PYBA 3VA5A 1HR0Q 1BCPC 3D4RA 1RF2D 4HJ9A 3K0XA 1LTAD 1MSGA 4C1NK 2QF7A 4ZYSA 5I2YA 3NUCA 4F87A 1IXRA 2AHOB 2HUGA 2LXKA 1VQCA 3MAQA 4RMFA 5ELNA 1L0WA 2B63H 2A6HD 1WTQA 4ZUJA 4HN7A 1IZ6A 1SE3A 2N8NA 2A73B 3NBHA 4C3IG 4HTHA 5IT9L 4IUPA 5DLQE 4DR6Q 1U4MA 3R3OA 3K7AB 1X32A 4OO1H 1BQQT 3O13A 2K5DA 3KDFB 2FMCA 1TY2A 2SNSA 2E5LQ 5D3DA 4OL7A 2YU9H 3U9SA 3M4YA 1PTOB 4OEMB 4C3JG 2JA5H 2KECA 3S1QH 2KQ3A 1PYSB 3HOUG 2KCNA 1EIGA 1F9RA 5M5YB 1G6ZA 1Q3LA 3JAMc 2G9DA 1Y69U 4NMZA 4UP7A 4WJ4A 4JI6L 2FINB 4IPHA 2K5WA 4WJWA 1WI5A 3CQZH 1VQDA 1L1OA 1BCPB 4DK3C 2WAQG 3BS1A 1QVGA 1HRJA 4DV3Q 4K8JA 3BVZA 1GD7A 4GOPC 3H3VI 2F3WA 3ER0A 4A3FB 1T5XD 3VYSA 4DK0A 4M1UB 2JA7G 1II3A 4TSSA 3RN2A 3DEPA 4IO9A 1Q86C 1WCMH 1RHPA 4K5WA 4GN3B 3K6OA 3TS0A 1IBMQ 5IP7G 3M4OH 1WTRA 1U4LA 1E24A 2IX0A 3J80i 3GDEA 3F2CA 1TR5A 3PIP3 5LHY1 3GTGH 1ICFB 3HOZH 3KLRA 1HZAA 4QL5A 1RDPD 3ULPA 3NTHA 1UEBA 1PH6A 2J7ZA 4JOIA 2F0FA 2SEBD 2PNHA 5CBEE 5M5WB 3H94A 3TZUA 1X9NA 4LF9Q 3C46A 1AP0A 5DM73 4A3KH 2M00A 4RGTA 1VMCA 1XPRA 1I94Q 2EYFA 3KUPA 3FPPA 3D4WA 1ZYRD 4ZUIA 3VR4A 2YTVA 1O7IA 1PLFA 5M3MH 3UDFA 2XRSD 1VQMA 4DV1Q 2HCCA 1LT4D 1BXTA 1PZKD 3ICEA 2ZJRA 1HA6A 4CDDC 3PO2H 1HZCA 4ZQ3A 1SAPA 2J4XA 5IYDH 3J7A5 2WINB 4NDXA 1CQFA 2WP8J 1J6QA 4FXKC 2O5IC 2PI2E 1IYUA 3I4MH 1WD1A 2UUAQ 2EJGC 4X3SA 4LF4Q 3J7AF 3STBD 3RR5A 1H9SB 2EYJA 4YCVA 4GKJL 2QDLA 2XGTA 3H0GG 4IFDG 1HZBA 1EEID 4Y7NH 3GTQH 2HIVA 2VZAA 5D14A 1VQEA 2KCMA 2EY5A 3J81i 1VQ7A 3GP7A 1X65A 4R1JA 2XWBB 2F0LA 1HTLD 1D1IA 2RDGA 1T9HA 1EEFD 1S5CD 4K5VA 3KYHC 2R93B 1SRUA 1XWEA 4KHPL 3HKZB 5T1IA 2LY7A 4O0AA 2R7ZG 3D3RA 4JI0Q 1K8AC 1AN8A 4CJ2C 4KN4C 2WAQE 4B3SQ 1R4PB 4LWCA 1UAPA 2EZVA 2OTLA 4NP5A 1XTCD 3K5MA 2IX1A 1OTCA 5KNBA 4HMIA 4P72A 3X3NA 4FF4A 4DK1A 2B2YC 1U4PA 4PMCA 4HSVA 2JE6I 2OF1A 3NEMA 3U4ZA 4A3MG 2NZHA 4H13C 1ZXTA 1Z6HA 1Q1EA 1XPUA 3K7AH 2EYOA 2WKCA 4DR7L 4HMJA 1YITA 3A5ZB 2XWJB 2C9OA 5AFWA 1BBXC 1HCZA 2F0GA 3S15H 4B3RL 1W6KA 3SGIA 3HOVB 2WB1G 4A3JH 3HP3A 1OXUA 3AEVA 4DAYB 4S3SA 2QA4A 1WTXA 1RCVD 1HR0W 1KNAA 1ASZA 4KKTA 1UUPA 1JWUD 2A68D 4ZKCB 2JA6G 3OW2A 1SE4A 1CA5A 2QKIC 4QUCA 5C3EB 1CZWA 1I5FA 1IL8A 5C4XB 4R4IA 2UXDL 2JP1A 1PDQA 1RJTA 4B3ML 5GADC 3S1NB 1JB7A 3BDLA 2PCFB 4A3BG 4V0BA 4JI6Q 4L5SA 2YTYA 2NB0A 3RLNA 1UNSA 2LS01 2WACA 3BZCA 4BS9A 1XTDA 2B2TC 1PXUA 4FNFA 1PFBA 3BDOA 3AFQA 2UXBL 1GUWA 3ZYYX 1MGSA 4HSPA 1CM9A 1L1OC 2K03A 3QWNA 1B7YB 2F0MA 1K9MC 2BH2A 3PUXA 1CUKA 3V2TA 2NUCA 1G6PA 2FHTA 3FKIH 4L8JA 4DU9A 2PZUA 3CCEA 3PSIA 1X6OA 1Y1WB 2DJFC 3MXNA 3PO3B 2NVXH 1KL9A 2KBNA 2EVBA 4X66L 4XQQA 3S2DB 1TWCH 2Z6BA 5DAUA 3P75A 1KD1C 1R9TB 2DN8A 1JMCA 5IE8A 2JYOA 4CJ1B 1RIPA 3KBGA 2HQLA 1PH3A 2F0HA 3H09A 2YV5A 3TZDA 4KY5A 3H91A 3J80L 1A15A 1Y1VB 3HS0C 4U68A 2UXCL 4DV2L 3MWYW 4K2KA 4HCEA 1EZ8A 2YYZA 4JG2A 1ILPA 3C3LA 2F03A 2ZTDA 5M9OA 1PH1A 3CCJA 2Z4IA 3W2DA 3DUZA 1EZ6A 2F3IA 2L0CA 4FXDA 4A3IG 2EYPA 2V4DA 1SYBA 3L3OC 4H02A 4C3HB 4UY8C 4PNYA 1KLGD 1HTPA 1BDOA 4GKJQ 1HFNA 1L1OB 2DGYA 3S1MB 1XXGA 3UDIA 1OO9B 5ELEA 4BXXH 5DNFA 3D4DA 2WV6D 1GOZA 3LWEA 1WJJA 1E7ZA 1QVFA 2K5NA 1E2VA 2PYKA 2F52A 1VQGA 2K75A 1BNZA 5C44G 1PHJA 4GN5A 4B08A 5AJ3L 3UI2A 2BH8A 4OGQC 1SNMA 4KHPQ 5FJ8H 4PV1C 3D6WA 2F0NA 1XNQL 1T5EA 2H4OA 3HOYH 4L63B 3QJYA 2DY8A 1K3RA 2EY6A 3JAML 1PRTF 2NBFA 3VR6A 1I4QA 3J81L 2D9UA 3TEHB 2VB2X 2I5LX 4HR7B 1MJCA 4I65A 2IWHA 4A3EG 2F3VA 1VQHA 1STEA 3M4PA 3RNUA 1J5EL 1F9SA 3RUZA 4BA2I 3GV6A 3I4NG 1V43A 3LGJA 1EOVA 3D0FA 1D6EC 2HIXA 3M4QA 3UE1A 1WOCA 4GS3A 4DR5L 2ES2A 2X69A 3NQTA 2N49A 3I91A 3I7FA 5D65A 1GUGA 1KIXA 2IL8A 2F0EA 2NN6I 4BY7B 1Z7TA 4IFDJ 4DAPA 4DR7Q 2D0OA 1ESRA 4QQBX 1PRTD 3IRBA 3H3VH 1NR2A 5IGCA 4NW2A 1WTOA 4F88A 2I5MX 4L5QA 1LACA 1GKHA 2KHSA 1O7LA 3A56A 3K0YA 3LX0A 3PUWA 1R4QB 3UDXA 4B3RQ 4A93G 2R92B 5C5LA 5C3EH 4RG1A 4GKKL 4LW1A 4A3CH 1E3PA 3BDCA 5C4XH 3G6JB 3RD4A 1STAA 1A0IA 5NUCA 4PMBA 3HOWG 1IHZA 3FPUB 2XVSA 3A74A 2EQSA 5EPKA 5JPMC 3E0EA 4YIJA 1S5FD 2AQ1B 4ALPA 4L6TB 3FMCA 1I6HH 1F2YA 3NQIA 1NE3A 3KLSA 2UXDQ 4GOPA 1HXYD 1YNJC 3QIAA 2F0VA 2F0OA 3A8IE 4N8FA 4B3MQ 3A54A 4K6LA 2YU9B 1SJED 5JEAG 1FGUA 2JA5B 3S1QB 4AYBB 4A3LG 2K14A 1B70B 3CMAA 2O4XA 1PVOA 4O42A 5C4JH 3E3XA 5FK9C 2PMZE 1ZYRC 1YHBA 3RZDH 1CKNB 3BVMA 1JWSD 3U50C 2UXBQ 3HOXH 5JVG3 2BCOA 4I7ZC 1QUQA 1UE6A 1EQTA 3I8ZA 4KD4A 1QZGA 1V1PB 4A75A 1NNXA 1SNCA 4FO2A 2Q2TA 4P73A 4KD3A 3J80E 2B2UA 1KC8C 2I5HA 2KCCA 3NWTA 4JK1C 4C1NI 2DUDA 1P16A 1KLUD 2CW0D 3VYRA 1WCMB 4JI3L 2CWPA 3STBC 2B63G 3BJUA 4X66Q 3M4OB 4RH6A 3R2TA 3TP5A 4G7HC 1EYGA 2E2HB 3MVVA 2MGSA 3HOZB 4HJ7A 1NAPA 4BBRG 3PF5A 1E1TA 1HA5A 1BKBA 2L15A 1SFOH 3URYA 1STHA 2UXCQ 2DNEA 4XDXA 4DV2Q 4A3KB 2EIFA 2F0QA 4ZCKA 1YJWA 5M3FG 1LTGD 5FLXE 3Q22A 3NK9A 2B2VC 5M3MB 3QOLA 4IFDI 2UUBL 1NJIC 4K5XA 4A3GG 4WFN3 3A7LA 3CP0A 1U0LA 4ZAIA 1DOMA 3FRPB 1ZKOA 5EKIA 2N55A 3S1RH 3SVMA 3TMEA 4QCLA 1H9RA 3W3AA 2CH4A 2JA8H 3I4MB 3TBIB 2KUMA 5IP9G 5K5PA 4HEDA 4ZLTF 3NHHA 4JI2L 5JJZA 2G9HD 1B9MA 4DKAC 1V8QA 2JEBI 5CV4A 2AKWB 4Y7NB 4HJAA 3E0JA 3GTQB 3R2IA 1FNVA 1HH2P 1B2TA 1ASYA 5JPNC 1Z47A 4IUTA 3GTOH 5AJ3Q 3HEJA 3SEBA 4KV6A 4MTKA 2B2YA 5L37A 2VUMG 4YY3L 1UE1A 1XNQQ 2MP1A 1TXYA 3TSSA 5IGBA 4B9XA 2LXJA 1HHVA 4IPDA 1STNA 2Y0SB 4BBSB 2A68C 4RWSC 5GAHC 4RFBA 1JJCB 4BY7H 3QO2A 4DR2L 2ZXRA 1J5EQ 3M3YH 4NPSA 2KEEA 1FNUA 4A76A 4APVA 3CCLA 1LO5D 2CWAA 4DR5Q 4K14A 2BOSA 2R92H 1G2TA 3W5OA 1LUZA 3EBEA 1K8GA 5IYBH 1QG7A 3N52A 3MA2B 3SK8A 1VQAA 3DXJC 2H1EA 5K36H 1FJGL 3MFYA 5EGTA 2NN6G 2KHJA 3IFTA 4DUZL 3SK6A 2VW9A 1QZHA 1X3PA 3HRZC 3GTJB 4GKKQ 2IHEA 4X62L 3R8BA 5M5XH 3S15B 4DV5L 4OX9L 2Z4HA 4LUZA 2JA9A 4IJHA 1GHJA 4A3JB 4PZ6A 3OWFA 3N6RA 1STBA 2XSCA 3I56A 1JWMD 4B3TL 1A63A 3DM1A 3P1HA 4RAUC 2B2TA 4QIWB 5C0XG 2MJ8A 3OYYA 4AYBE 4KJNA 1PV4A 1GUOA 4JVZA 1TT2A 5IYCG 4HIMA 4MIUA 1TS5A 2CKZB 1S72A 1XX8A 5FOBB 1VQBA 3KJOA 3ND8A 2P5ZX 1M4VA 4CJ0B 4HCSA 1GO3E 2E76C 3RMHA 5J39A 4FVMA 2NZOA 2O2LD 4OONA 4X64L 1SSOA 1QE6A 1YJNA 4WORA 5HGTA 1E2ZA 1KDBA 5FLMG 2K05A 3ERSX 2K4KA 5LL6S 5TSSA 1CK1A 1EYCA 1EWCA 2D5DA 4AH6A 1SYEA 2E2HH 2EE1A 4R8NA 4XQNA 1KHIA 1S40A 1JORA 4PQXA 4JI3Q 1G2SA 5HURA 1P8LA 5CORA 1NUCA 2B2UC 1EY9A 2A69D 2RSNA 3OMGA 1HZ9A 3FKIB 2E2IH 1A6XA 1ESFA 3EFXD 1PFSA 4A3DH 4QUFA 2K04A 1Q7YC 4UAIA 2NVXB 5JEAJ 4K8IA 1TWCB 5KNCA 3F2DA 4X6AH 1AEXA 5FKAC 1G291 3T51B 4ID6A 4DNRB 3KK7A 1ONLA 1NY4A 1K0RA 4IUUA 2MUYA 2UUBQ 5KYLA 2MFIA 4GOPB 3SXHA 1XMOL 1SEBD 4X65L 2XIWA 2F4VL 1SR3A 1J8IA 2HDMA 4GLXA 3CW2C 1A2TA 1N32L 4C3IH 4A3FG 1WTVA 2O5JC 5CV9A 1E2WA 4IURA 3OMCA 2IJ0A 3VR5A 3H3VC 2OQ0A 3JAMi 2IT1A 4FP5D 1RD9D 3AB9A 3OIQA 4Y52H 1HPCA 2I07B 4JI2Q 2R6GA 4TKOB 4AIMA 3GTLH 1QUQB 2TSSA 3T1YQ 1PRTC 2WB1B 1C0AA 4C3JH 1U9RA 4BBSH 1HNWL 1RTNA 2CHBD 1PYWD 1H95A 3HOUH 2EXZA 1B44D 2XNAC 3U4VA 5EQ0A 1AH9A 3PUZA 4YY3Q 4G7OC 1CKNA 1ENFA 3DWPA 3KJPA 3EROA 1VDZA 2AUJD 2OCEA 5IT9E 2LSSA 3SHLA 1DOLA 3BYYB 1D7QA 1V1PA 3G48A 2K6AA 1C8CA 1YNND 5ELCA 1K28A 4POFA 3HOYB 2QW7A 4DR2Q 2PQAB 4GZYC 2B29A 2ICEC 3E9IA 2OWOA 2LKVA 4EVOA 1PFMA 2JA7H 2SDFA 2F0IA 3UE0A 1EWHA 4P75A 1PTOF 1EFWA 2K28A 2PO4A 2PZWA 1L2FA 3GTJH 1CHQD 5CV8A 1X56A 2R3ZA 1NBWA 4BY1B 5IP7H 1FJGQ 2KVMA 1PH7A 2B8GA 1EFID 4DUZQ 4DR4L 4DN4M 3KF6B 3DEOA 1BCPF 1ENCA 5LMNL 1KQSA 4DR3L 4X62Q 3S17H 2NVYH 4ME3A 5F2DA 1PTOD 4EX5A 1O78A 4DV5Q 4OX9Q 4QGUA 1PRTB 4DGZA 3GTPH 1VQOA 1EU4A 3GQBA 5E4XA 4KK7A 2R93G 4CDEC 1M90C 1I4XA 4B3TQ 3BG3A 3PUVA 3HKZG 1QNKA 2CW0C 2E2JH 2K01A 4KN7C 3J7ZC 1BCPD 2VXWA 3MZ5A 1JQYD 1KAWA 2EDGA 3Q6SA 1KDAA 1I3QH 3U9OA 2EPBA 1I6HB 3CXCA 1C7YA 5H1SE 1LTRD 4P71A 3F8TA 3T1HL 4QJFA 5FJ8G 4YHHL 2ZTEA 3NTKA 4G7ZC 5ELFA 3CF5A 5LMUL 1EIYB 3H0GH 4CHTB 1KXLA 3MXGA 5C4JB 1VQ8A 2HQEA 4X64Q 1TWFH 1LT6D 3M7NA 4JCVE 3RZDB 2ZJPA 3L2PA 2M2LA 2IX3A 1Y8PB 1SDFA 5EAYA 3CCUA 3HOXB 5IWAL 3ULJA 4L5RC 1D5XC 5ELDA 2PW5A 3HOVG 1WFQA 3K58A 4OO1I 1KNEA 1VQ9A 2NZ1D 1UE7A 2R7ZH 2N88A 5EKLA 5IT9c 3TP6A 2R7FA 2K7VA 1EY8A 5C0XJ 1PH5A 1MIUA 1VQLA 3EVQA 4YWLA 2B2VA 1LT3D 2A19A 2CFMA 4XQJA 4ZK9B 5C3EG 4V190 4OXPA 5JVH3 5C4XG 2BDOA 3CCMA 1HFGA 1X54A 1HUMA 1STGA 1V9PA 2F0KA 2PQEA 5KIXA 3I4LA 1JOKA 1MD2D 4A3MH 1FL0A 4IALA 3T56B 2F0DA 2PPBC 1SFOB 3ONAB 1DZ1A 1XMOQ 2I46A 4KHVA 4PMWA 4X65Q 2F4VQ 1PH9A 3NXWA 4JPBW 4H7BA 3IKJA 2F0PA 2OEOA 3RLFA 1N32Q 3J81j 3SDZA 3D6CA 3QG1A 2ZM6L 1HQRD 1SMYD 2K5QA 1WTPA 2CCZA 3KFUA 1VS0A 1YJ9A 3NPPA 1S5ED 4CDFC 2D2CC 2PW7A 1ENAA 2EY1A 4JW0A 2JA6H 3S1RB 1Q1BA 2A6HC 1SNPA 3HKZE 3DWQA 5FO7B 2JA8B 1FNWA 1Y1WG 3PUYA 3PO3G 1HNWQ 4N9PA 1B9NA 5BN5A 1EIHA 4U673 4A3BH 3GD7A 3I2ZA 3KF8A 3V96A 1AZPA 1SNOA 3GTOB 1EUJA 4R8IA 1M1KC 3NENA 1TS3A 2EJFC 1Y1VG 3OIPA 1K8MA 4BY1H 2E8GA 2AQ3B 3RZOH 3OTOL 2HD3A 4MN3A 4N8X1 2K33A 2GVBA 2ZXOA 1KRTA 2KEDA 1S5DD 1KRSA 1V1OA 3Q0AA 3M3YB 4K0KL 5LL6X 1HNXL 3NE5B 5IGGA 1AE2A 1YNXA 4PZ7A 1L0XB 3DM3A 3W1BA 4C3HG 2WIIB 1CI3M 4KKUA 4IZ8A 2IHFA 4DR4Q 1D5MC 1F2LA 5DEHA 3PIOA 1PZJD 2L1BA 1IYVA 1Q46A 1MSHA 5LMNQ 4DR3Q 4EQNA 1I50H 3UDGA 5C0XI 4OIKA 2K52A 5EPLA 3T53B 1EU3A 3QB3A 2JJQA 1LTID 1KTKA 4C56C 1RODA 1Q81C 4X3KA 4JYAL 2KA7A 5M5XB 1TWAH 1VQ4A 1CTMA 1ET9A 1JJ2A 1HNZL 3BZKA 3CRLC 2Z9HA 4OWWB 1DXMA 2F1MA 4JBKA 1K83H 4JI8L 2A6ED 4DAVA 1K73C 1EQQA 3JC66 3WDNA 1SNDA 1CT1D 1VQ6A 3LNNA 2L9HA 1U4RA 3GO5A 4A3IH 2FMMA 3VYTA 1EYAA 2RA4A 3T1HQ 2NWGA 4YHHQ 1S3OA 1PH8A 4UPAA 1YBYA 2MQHA 2XTIA 5LMUQ 3HZXA 4Q5VA 4LAAA 4DFAA 1EQVA 3TP7A 1BBUA 5I9PA 5CMDA 4BY7G 4I7AA 5EPJA 1UEAB 2RKSA 3TN2A 1N9WA 1TWHH 1IKLA 2VB3X 4CKEA 5A2QL 4PG3A 3TRZA 5CC4A 2ZT9C 5IWAQ 1XNRL 2ATWA 1EYDA 4FF1A 4JBJA 3MEFA 1G51A 2NVTH 5C44H 3PV0A 3VR2A 3Q8DA 4R4CA 1I6VC 1IKMA 5IGEA 2Q2HA 2MNAA 1A62A 2PQAA 2UU9Q 4XYOA 2HT1A 2RBMA 2ZTCA 4AQYL 5C3XA 1AZQA 1VQIA 3S16H 4OO1G 4RKBA 5DM63 1OXSC 2Z8LA 3OW7A 4MNOA 3G4SA 1B8AA 4LF6Q 5CV7A 4JI5L 1D2BA 1DJRD 4A3EH 1STYA 3K5OA 2QILA 3C2PA 2E2IB 1O7ZA 2K5VA 4IOAA 2F0TA 3KLSX 4A3DB 3I4NH 1LT5D 2OTJA 2BA1A 4R9WA 2WKDA 5HY6A 2JA5G 1B3QA 1Z9FA 1QNUA 4AYBG 3A0JA 4B9WA 3KF6A 4NB3A 1CKOA 4LMQD 3J7AV 1QJOA 2JXMB 2CQOA 1KABA 2F0JA 3WOEA 3E5SA 4GLAC 4OHJA 4R4OA 3CCQA 2HHHL 1F2ZA 3B6YA 1YNNC 4A93H 3JAME 2ZM6Q 3J81E 5JJLA 1MBYA 2KCTA 4C3IB 2RCNA 4LF7L 3T1YL 4MZ9A 3HOWH 1EY7A 3GV3A 1TWGH 4LFCL 4RHSA 1SROA 1PZID 1WCMG 1A3VA 5I6YA 4DV7L 4FF3A 4CDCC 1V1QA 1G91A 3GTLB 2JEAI 2K1BA 3M85A 3OPOA 3A8JE 2C5CA 2BE5D 4LUOA 5JEAH 4HIOA 4C3JB 3CAMA 3HOZG 1CQVA 1NTGA 4DXGA 2EYLA 3K59A 4A3LH 1WTWA 1X3FA 2A1AA 3HOUB 1DD2A 1CSQA 4ME5A 3WOFA 1HJPA 1DYQA 5C3WA 1EY4A 2CVRA 3ITPA 1LTSD 4A3KG 3LWUA 4N9TA 5C4HA 2ZXPA 2PZTA 4HAEA 3E9HA 4IN3A 3OTOQ 3S14H 3J80c 3CC4A 2WAQB 5M3MG 2RSOA 1DONA 4KY6A 1OXXK 4K0KQ 4QMGA 1HNXQ 3PGZA 4TQUS 3GTKH 3I55A 4LK1C 2BDNA 2JA7B 3I70A 1VCIA 3I3CA 3TQYA 3PO2G 4DV4L 2H5XA 2K32A 2L4NA 5IYDG 2KOLA 3CC7A 3FP9A 5JAVA 3I4MG 2EJMA 3CPFA 2L11A 3NELA 3DLLA 3CD6A 1G8ZD 1X55A 1LM0A 3BU2A 1H9KA 4BBRH 3S17B 5FLXc 2SOBA 2NVYB 1VQJA 4JYAQ 1B50A 2NVQH 1VQKA 1HNZQ 2E74C 3GTPB 1YVCA 3QR8A 5M3FH 1F77A 5E1FA 2DJGC 3NWSA 3PMFA 5IY0A 4JI8Q 5A2QE 2EYHA 1JICA 1EIFA 2Y0SG 4BBSG 1BVSA 4A3GH 4CBVA 2E2JB 4KLKA 1XMQL 5LMNW 3J81c 3ERQA 3KF8B 1H9MA 1I3QB 2EYMA 4LUVA 1ICWA 5GAEC 1BUVT 1EY0A 1WTHA 4DNIA 4IQZA 3A5UA 4WJ3M 4JBMA 1LTTD 1LYLA 5IGDA 1LTBD 4ULLA 3HGBA 2MHVA 5IP9H 3Q23A 1MI2A 4X3TA 1ET6A 5KYIA 1A3UA 4MHEA 1YEZA 4C2MB 4PZ8A 3H0GB 3OHXC 1SYDA 3EJIA 5I4DA 1DOKA 4Z9CB 1QB5D 1TWFB 5HGQA 1XNRQ 4QY7A 4EQ5A 4OIJA 4YCUA 1N8RC 4LFBL 3VR3A 5E7NA 4NXNL 1H9JA 2GVAA 3A55A 4FYDA 1N34L 3L9AX 2FJ2A 1TVXA 4G57A 4R4QA 2VUMH 1SMYC 1E0BA 5G3LF 2CH4W 3NBIA 4AQYQ 4LNQA 3HFZB 4A3JG 2F0SA 4XXEA 1U5KA 1YNJD 3TREA 2AUKA 3ZJYC 4UP9A 2R7ZB 4JI5Q 2K50A 1GUNA 4O1NA 2AMCB 1AE3A 3F1ZA 1PMRA 1MKHA 1B4OA 1B1ZA 1QILA 2E2DC 2EY2A 4J15A 1SYGA 5I6WA 3CMEA 5G3LD 2E75C 5CBAE 4GNXC 3T16A 4LF8L 5CYUA 1B53A 2X6LA 3GTMB 4WRDA 4P2CB 4A3MB 4J6HA 3PQIA
chains in the Genus database with same CATH topology
1PA6A 4LFAL 3A74A 2EQSA 2HHHQ 3E0EA 4ALPA 3HOVG 3S2HH 1WFQA 3MXNB 4DAMA 1PYBA 4NXML 1HR0Q 1VQ5A 3CC2A 1I6HH 2Z0SA 4OO1I 1VQ9A 1NE3A 2D0PA 4HJ9A 2UXDQ 4GOPA 1UE7A 3K0XA 2R7ZH 5IT9c 4B3MQ 4KHZA 2R7FA 1NMGA 4JI7L 5C0XJ 1YHQA 3EIVA 4LF7Q 1PH5A 5JEAG 1MIUA 4YCWA 1VQLA 1IXRA 1FGUA 2AHOB 4YWLA 4LFCQ 2LXKA 2BA0A 2A19A 1VQCA 5JJKA 4A3LG 2CFMA 4IJLA 5C3EG 2K14A 4RMFA 1B70B 4OXPA 3CMAA 5ELNA 1PVOA 5C4XG 1L0WA 2B63H 5C4JH 3CCMA 4DV7Q 1X54A 2PMZE 1D8LA 1DGSA 1YHBA 3RZDH 2N78A 1V9PA 1IZ6A 2N8NA 3FKIG 1CKNB 2Y0SE 3U50C 3L0OA 2UXBQ 5DLQE 3HOXH 4A3MH 2Q2UA 4DR6Q 1FL0A 1QUQA 1UE6A 5IYCH 1QZGA 3KDFB 4A75A 4O2DA 2Q2TA 4P73A 1EWIA 1XMOQ 4PMWA 4X65Q 2E5LQ 1KC8C 2F4VQ 2I5HA 3D31A 1PH9A 2YU9H 5JJIA 2DUDA 2GN5A 1P16A 3RLFA 4HIDA 1N32Q 3J81j 1OXTA 4POGA 1IBLL 2ZM6L 2JA5H 3K8AA 2CCZA 2Z6KA 3AFPA 3KFUA 3S1QH 1Q12A 4JI3L 1PYSB 1VS0A 2CWPA 3STBC 4GNXB 1YJ9A 2B63G 3BJUA 4X66Q 3AYHB 4R4TA 3HOUG 5FLMH 3JAMc 4UP7A 1EYGA 2JA6H 4WJ4A 4JI6L 4IPHA 1Q1BA 3HKZE 4YWMA 4HJ7A 1WI5A 4DV4Q 4BBRG 3CQZH 1VQDA 1L1OA 1SMXA 3PUYA 2WAQG 4DK3C 3PF5A 4KI0A 1E1TA 4DV3Q 3PO3G 1HNWQ 1BKBA 2A8VA 2L15A 1SFOH 1GD7A 4GOPC 2UXCQ 3RLOA 4DV2Q 3H3VI 2EIFA 3ER0A 1YJWA 5M3FG 5J3BA 1IBKL 4A3BH 2JA7G 1EQRA 3GD7A 3I2ZA 4DV0L 3RN2A 1VQNA 4QIWE 1Q86C 4IO9A 4IFDI 2UUBL 3U58A 1EUJA 1NJIC 4A3GG 1WCMH 1M1KC 4BXXG 1SN8A 3NENA 4GN3B 1Y1VG 3TS0A 1IBMQ 5IP7G 3CP0A 3M4OH 1U0LA 4BY1H 5M5YH 1W3SA 1E24A 4DUYL 2E8GA 4IOCA 2VS1A 2IX0A 3J80i 3GDEA 3OTOL 3F2CA 3RZOH 3GTGH 2GVBA 2FXQA 3S1RH 3HOZH 1KRTA 1HZAA 1KRSA 4QL5A 3ULPA 2JA8H 4JBWA 3S24A 2YTXA 4K0KL 1HNXL 1UEBA 1PH6A 5IP9G 4JOIA 3HOYG 1XPOA 1AE2A 2PNHA 1PH2A 1YNXA 4PZ7A 4JI2L 4JI4L 3KLWA 4DKAC 1XMQQ 1X9NA 3DM3A 4LF9Q 3W1BA 2JEBI 3PCOB 4DK6C 4C2MH 4A3KH 1XPRA 2AKWB 4A3FH 2PI2A 1I94Q 4HJAA 1X3EA 2JK8A 4OWXB 1HH2P 2YTVA 3PIPA 1O7IA 2UUCL 1ASYA 1Z47A 2IHFA 5M3MH 3UDFA 3PIOA 4DR4Q 3ULLA 1VQMA 4DV1Q 3GTOH 5BR8L 5AJ3Q 1Q46A 4JI1L 5LMNQ 4DR3Q 2B3GA 1I50H 2VUMG 4BY1G 4YY3L 3UDGA 5C0XI 3ICEA 1E22A 2K52A 1UE1A 2ZJRA 1XNQQ 1UE5A 3K80C 1TXYA 2JJQA 3PO2H 2R93G 2LXJA 1HZCA 4IPDA 1VQFA 5IYDH 1W2BA 5GAHC 1Q81C 3J7A5 1JJCB 2VY3A 4BY7H 4JYAL 1TWAH 2WP8J 1J6QA 1VQ4A 2UU9L 4DR1L 4DR2L 4LFBQ 2PI2E 1J5EQ 1JJ2A 1HNZL 3BZKA 4NPSA 4NXNQ 3I4MH 2UUAQ 3M3YH 4A76A 1N34Q 4APVA 3CCLA 4LF4Q 4OWWB 1N36L 3STBD 3RR5A 2CWAA 5M5WH 4YCVA 4GKJL 3H15A 4DR5Q 4JBKA 2XGTA 1N33L 3H0GG 1K83H 4IFDG 2R92H 1HZBA 4JI8L 4LF6L 1K73C 4Y7NH 1EQQA 3JC66 3W5OA 1LUZA 4A3CG 3EBEA 2KHIA 1K8GA 5IYBH 1VQ6A 3GTQH 2HIVA 2VZAA 1RL2A 3GO5A 1VQAA 4A3IH 1VQEA 3CCVA 2KCMA 3T1HQ 4LF5L 3J81i 1VQ7A 1X65A 4R1JA 1FJGL 3NBHB 4YHHQ 4TVAB 1QVGA 3GTMH 4YWKA 4JV5L 1S3OA 1T9HA 5ELOA 1PH8A 2NN6G 4UPAA 2KHJA 2AWNA 1YBYA 2MQHA 4IPGA 2XTIA 4DUZL 2R7DA 5LMUQ 1IL2A 3KYHC 2VW9A 1QZHA 1SRUA 1BBUA 4BY7G 1XJVA 2IHEA 4X62L 1GM5A 1JE5A 4GKKQ 3K81C 4KHPL 1YZ6A 4O0AA 2R7ZG 5M5XH 4JI0Q 1K8AC 4LF8Q 4JOIC 2MO1A 1N9WA 1TWHH 4DV5L 4OX9L 2WAQE 4LUZA 4B3SQ 2JA9A 3L7ZC 4IJHA 4LWCA 4PG3A 2QEXA 3TRZA 4DPGA 2V1CC 5IWAQ 4PZ6A 2OTLA 1XNRL 2ATWA 1YIJA 4LFAQ 2IX1A 4JBJA 3MEFA 5GQOA 1G51A 2NVTH 5C44H 3PV0A 3I56A 1OTCA 3Q8DA 4NXMQ 4B3TL 4R4CA 1A63A 4P72A 1JJGA 3KDFA 3KOJA 4IPCA 5C0XG 2MNAA 2Q2HA 1A62A 1BBWA 2PQAA 3OYYA 2WB1E 2D62A 2UU9Q 2HT1A 2JE6I 3NEMA 4AYBE 2ZTCA 4AQYL 2VL6A 3HKSA 3HOXG 3U4ZA 4JI7Q 4A3MG 1PV4A 2NZHA 1FVIA 2WFWA 1VQIA 3M9BA 3S16H 4OO1G 1Q1EA 1XPUA 4XTCS 5IYCG 4HIMA 1OXSC 3K7AH 4MNOA 3G4SA 1B8AA 4DR7L 4LF6Q 1WYDA 4JI5L 1YITA 2CKZB 1UWVA 3A5ZB 4A3EH 1S72A 1IYJB 2R93H 2KENA 1VQBA 2K5VA 3KJOA 3F2BA 4IOAA 3I4NH 3S15H 1GO3E 1OXVA 2EXDA 4B3RL 3CPWA 2OTJA 2BA1A 2NZOA 5HY6A 3SGIA 2JA5G 2WB1G 1Z9FA 4A3JH 4OONA 4X64L 4AYBG 3A0JA 3AEVA 1OXUA 1YJNA 4DAYB 3KF6A 4NB3A 1CKOA 2QA4A 1YI2A 1HR0W 1C9OA 5FLMG 1ASZA 3AQQA 4HIKA 2CQOA 4DV6L 2VQFL 2MO0A 3ERSX 2K4KA 2JA6G 3OW2A 2VQEL 4GLAC 2N3SA 4R4OA 4AH6A 4MTNA 3CCQA 2E2HH 2HHHL 3B6YA 4XIGS 4A93H 4HJ5A 2QGQA 1HR0L 1GVPA 1IBLQ 1I5FA 2ZM6Q 1KHIA 4R4IA 1S40A 1VQPA 3FHWA 2UXDL 5JJLA 4JI3Q 3EN2A 1P8LA 2RHQB 4B3ML 2KCTA 5GADC 1JB7A 1HZ9A 2RCNA 2E2IH 2IY5B 3RN5A 4LF7L 3T1YL 4A3BG 4MZ9A 1PFSA 3HOWH 4A3DH 1TWGH 4LFCL 4JI6Q 4L5SA 2YTYA 1Q7YC 2Z6KC 5JEAJ 3RLNA 1SROA 3HOVH 1WCMG 3VDYA 3BZCA 3W1GA 4DV7L 3F2DA 1XTDA 4X6AH 1V1QA 1G291 2ASBA 2JEAI 3AFQA 3M85A 2UXBL 2RHSB 3WWVA 4DR6L 4HIOA 4LUOA 1IBKQ 3CAMA 1NY4A 3HOZG 1K0RA 4DV0Q 1NTGA 1L1OC 4HJ8A 4A3LH 1X3FA 2A1AA 2UUBQ 2MFIA 2JA8G 1B7YB 4GOPB 4FDBA 1E1OA 1XMOL 1K9MC 1CSQA 4X65L 2E5LL 1HJPA 2F4VL 2BH2A 1SR3A 3PUXA 2I0QA 4GLXA 3S1NH 1CUKA 3CW2C 4A3KG 4DUYQ 1N32L 4C3IH 3FKIH 4A3FG 1G6PA 3G6EA 3CCEA 3E9HA 3PSIA 3OTOQ 3S14H 4UP8A 1X6OA 3J80c 3CC4A 5M3MG 2NVXH 1KL9A 2ALYB 2KBNA 4X66L 2OQ0A 3JAMi 2IT1A 1TWCH 1OXXK 4Y52H 4K0KQ 1HNXQ 3PGZA 4TQUS 3GTKH 3I55A 1KD1C 4JI2Q 4JI4Q 2R6GA 4AIMA 1JMCA 5IE8A 3GTLH 3TQYA 1VCIA 1QUQB 3PO2G 1RIPA 4DV4L 3T1YQ 2H5XA 1C0AA 2HQLA 4C3JH 2ZJQA 1PH3A 5IYDG 4DV3L 3CC7A 2YV5A 3FP9A 4JC0A 5GAGC 2UUCQ 4BBSH 1HNWL 2UXCL 1H95A 3HOUH 4DV2L 3I4MG 5BR8Q 3CPFA 4JI1Q 3U4VA 3NELA 2ID0A 1AH9A 2YYZA 4JG2A 3DLLA 3CD6A 3PUZA 4YY3Q 1CKNA 3KJPA 2R92G 2ZTDA 5GROA 2OCEA 1PH1A 3CCJA 2LSSA 1X55A 3CCSA 1NMFA 1LM0A 3BU2A 5IYBG 2F3IA 4BBRH 1D7QA 1Y1WH 3G48A 5FLXc 3PO3H 4A3IG 1VQJA 1IBML 4JYAQ 2NVQH 4POFA 1VQKA 3S2DH 5K36G 4DR1Q 1Y14B 4DR2Q 2PQAB 1HNZQ 4GN4B 3TS2A 2B29A 2AWOA 4H02A 3E9IA 2OWOA 4UY8C 1YVCA 1MJEA 5M3FH 1N36Q 1R9TH 4GKJQ 1N33Q 2JA7H 4GLVB 1L1OB 2DGYA 3UE0A 5IY0A 4P75A 4JI8Q 3K7UC 1EFWA 3UDIA 1EIFA 2Y0SG 4A4IA 4BBSG 1BVSA 1L2FA 4A3GH 4L5TA 3GTJH 4GNXA 4BXXH 1JT8A 2C35B 4KLKA 1X56A 1NBWA 1Y1VH 1XMQL 5IP7H 1WJJA 4LF5Q 4LF9L 5LMNW 1E7ZA 1I94L 1FJGQ 1QVFA 2K5NA 3J81c 3KF8B 1PH7A 4JV5Q 2F52A 4LUVA 1VQGA 2K75A 5GAEC 4DNIA 4DUZQ 4DR4L 5C44G 1CSPA 4DV1L 3KF6B 4GN5A 1PHJA 1QVCA 5AJ3L 2VNUD 3A5UA 5LMNL 1KQSA 4WJ3M 4DR3L 4X62Q 1A8VA 1LYLA 2BH8A 4JBMA 3S17H 2NVYH 4KHPQ 4ME3A 5FJ8H 2Q2IA 5IP9H 1XNQL 3HOYH 4EX5A 1YEZA 4DV5Q 4PZ8A 4OX9Q 1K3RA 4C3HH 4QGUA 3GTPH 1VQOA 1XNRQ 5HGQA 2K5HA 1X3GA 4QY7A 3TEHB 4EQ5A 2I5LX 3S1MH 1MJCA 4YCUA 4A3EG 1N8RC 4LFBL 1VQHA 5E7NA 3M4PA 4NXNL 3RNUA 1M90C 1J5EL 4B3TQ 2UUAL 2GVAA 3HKZG 3PUVA 3PF4A 4BA2I 1N34L 2E2JH 1SLJA 4LF4L 3I4NG 1V43A 4R4QA 2VUMH 3LGJA 1EOVA 3D0FA 3M4QA 2HIXA 4DR5L 3UE1A 1LTLA 1WOCA 4GS3A 3J7ZC 2ES2A 4AQYQ 4LNQA 2N49A 1KAWA 4P74A 3HFZB 3G71A 1I3QH 4A3JG 3I7FA 1U5KA 1KIXA 3TREA 3ZJYC 2NN6I 3I4OA 3CXCA 4UP9A 1C7YA 4IFDJ 2RF4A 4P71A 5H1SE 4DR7Q 2D0OA 3F8TA 4OWTB 1PH4A 4JI5Q 3T1HL 1SE8A 2K50A 3IRBA 4QJFA 3H3VH 4QQBX 1Q82C 5FJ8G 2OQKA 4YHHL 2AMCB 1AE3A 1CKMA 3F1ZA 3CCRA 2I5MX 2ZTEA 4L5QA 1MKHA 1Y1WG 1GKHA 3UDXA 2JQOA 3PUWA 3CF5A 5LMUL 4B3RQ 4A93G 1EIYB 3H0GH 4BA1I 1YHAA 5C3EH 1KXLA 4RG1A 4J15A 4LW1A 1VQ8A 1E3PA 1TWFH 4X64Q 3CMEA 5C4XH 3M7NA 4GKKL 4A3CH 1Q8KA 4JCVE 4GNXC 4JI0L 4LF8L 2ZJPA 1A0IA 3L2PA 4B3SL 4DV6Q 5EAYA 4A3DG 2VQFQ 3CCUA 3HOWG 5IWAL 3ULJA 2VQEQ 4L5RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PA6 A;  4LFA L;  3A74 A;  2EQS A;  2HHH Q;  3E0E A;  4ALP A;  3HOV G;  3S2H H;  1WFQ A;  3MXN B;  4DAM A;  1PYB A;  4NXM L;  1HR0 Q;  1VQ5 A;  3CC2 A;  1I6H H;  2Z0S A;  4OO1 I;  1VQ9 A;  1NE3 A;  2D0P A;  4HJ9 A;  2UXD Q;  4GOP A;  1UE7 A;  3K0X A;  2R7Z H;  5IT9 c;  4B3M Q;  4KHZ A;  2R7F A;  1NMG A;  4JI7 L;  5C0X J;  1YHQ A;  3EIV A;  4LF7 Q;  1PH5 A;  5JEA G;  1MIU A;  4YCW A;  1VQL A;  1IXR A;  1FGU A;  2AHO B;  4YWL A;  4LFC Q;  2LXK A;  2BA0 A;  2A19 A;  1VQC A;  5JJK A;  4A3L G;  2CFM A;  4IJL A;  5C3E G;  2K14 A;  4RMF A;  1B70 B;  4OXP A;  3CMA A;  5ELN A;  1PVO A;  5C4X G;  1L0W A;  2B63 H;  5C4J H;  3CCM A;  4DV7 Q;  1X54 A;  2PMZ E;  1D8L A;  1DGS A;  1YHB A;  3RZD H;  2N78 A;  1V9P A;  1IZ6 A;  2N8N A;  3FKI G;  1CKN B;  2Y0S E;  3U50 C;  3L0O A;  2UXB Q;  5DLQ E;  3HOX H;  4A3M H;  2Q2U A;  4DR6 Q;  1FL0 A;  1QUQ A;  1UE6 A;  5IYC H;  1QZG A;  3KDF B;  4A75 A;  4O2D A;  2Q2T A;  4P73 A;  1EWI A;  1XMO Q;  4PMW A;  4X65 Q;  2E5L Q;  1KC8 C;  2F4V Q;  2I5H A;  3D31 A;  1PH9 A;  2YU9 H;  5JJI A;  2DUD A;  2GN5 A;  1P16 A;  3RLF A;  4HID A;  1N32 Q;  3J81 j;  1OXT A;  4POG A;  1IBL L;  2ZM6 L;  2JA5 H;  3K8A A;  2CCZ A;  2Z6K A;  3AFP A;  3KFU A;  3S1Q H;  1Q12 A;  4JI3 L;  1PYS B;  1VS0 A;  2CWP A;  3STB C;  4GNX B;  1YJ9 A;  2B63 G;  3BJU A;  4X66 Q;  3AYH B;  4R4T A;  3HOU G;  5FLM H;  3JAM c;  4UP7 A;  1EYG A;  2JA6 H;  4WJ4 A;  4JI6 L;  4IPH A;  1Q1B A;  3HKZ E;  4YWM A;  4HJ7 A;  1WI5 A;  4DV4 Q;  4BBR G;  3CQZ H;  1VQD A;  1L1O A;  1SMX A;  3PUY A;  2WAQ G;  4DK3 C;  3PF5 A;  4KI0 A;  1E1T A;  4DV3 Q;  3PO3 G;  1HNW Q;  1BKB A;  2A8V A;  2L15 A;  1SFO H;  1GD7 A;  4GOP C;  2UXC Q;  3RLO A;  4DV2 Q;  3H3V I;  2EIF A;  3ER0 A;  1YJW A;  5M3F G;  5J3B A;  1IBK L;  4A3B H;  2JA7 G;  1EQR A;  3GD7 A;  3I2Z A;  4DV0 L;  3RN2 A;  1VQN A;  4QIW E;  1Q86 C;  4IO9 A;  4IFD I;  2UUB L;  3U58 A;  1EUJ A;  1NJI C;  4A3G G;  1WCM H;  1M1K C;  4BXX G;  1SN8 A;  3NEN A;  4GN3 B;  1Y1V G;  3TS0 A;  1IBM Q;  5IP7 G;  3CP0 A;  3M4O H;  1U0L A;  4BY1 H;  5M5Y H;  1W3S A;  1E24 A;  4DUY L;  2E8G A;  4IOC A;  2VS1 A;  2IX0 A;  3J80 i;  3GDE A;  3OTO L;  3F2C A;  3RZO H;  3GTG H;  2GVB A;  2FXQ A;  3S1R H;  3HOZ H;  1KRT A;  1HZA A;  1KRS A;  4QL5 A;  3ULP A;  2JA8 H;  4JBW A;  3S24 A;  2YTX A;  4K0K L;  1HNX L;  1UEB A;  1PH6 A;  5IP9 G;  4JOI A;  3HOY G;  1XPO A;  1AE2 A;  2PNH A;  1PH2 A;  1YNX A;  4PZ7 A;  4JI2 L;  4JI4 L;  3KLW A;  4DKA C;  1XMQ Q;  1X9N A;  3DM3 A;  4LF9 Q;  3W1B A;  2JEB I;  3PCO B;  4DK6 C;  4C2M H;  4A3K H;  1XPR A;  2AKW B;  4A3F H;  2PI2 A;  1I94 Q;  4HJA A;  1X3E A;  2JK8 A;  4OWX B;  1HH2 P;  2YTV A;  3PIP A;  1O7I A;  2UUC L;  1ASY A;  1Z47 A;  2IHF A;  5M3M H;  3UDF A;  3PIO A;  4DR4 Q;  3ULL A;  1VQM A;  4DV1 Q;  3GTO H;  5BR8 L;  5AJ3 Q;  1Q46 A;  4JI1 L;  5LMN Q;  4DR3 Q;  2B3G A;  1I50 H;  2VUM G;  4BY1 G;  4YY3 L;  3UDG A;  5C0X I;  3ICE A;  1E22 A;  2K52 A;  1UE1 A;  2ZJR A;  1XNQ Q;  1UE5 A;  3K80 C;  1TXY A;  2JJQ A;  3PO2 H;  2R93 G;  2LXJ A;  1HZC A;  4IPD A;  1VQF A;  5IYD H;  1W2B A;  5GAH C;  1Q81 C;  3J7A 5;  1JJC B;  2VY3 A;  4BY7 H;  4JYA L;  1TWA H;  2WP8 J;  1J6Q A;  1VQ4 A;  2UU9 L;  4DR1 L;  4DR2 L;  4LFB Q;  2PI2 E;  1J5E Q;  1JJ2 A;  1HNZ L;  3BZK A;  4NPS A;  4NXN Q;  3I4M H;  2UUA Q;  3M3Y H;  4A76 A;  1N34 Q;  4APV A;  3CCL A;  4LF4 Q;  4OWW B;  1N36 L;  3STB D;  3RR5 A;  2CWA A;  5M5W H;  4YCV A;  4GKJ L;  3H15 A;  4DR5 Q;  4JBK A;  2XGT A;  1N33 L;  3H0G G;  1K83 H;  4IFD G;  2R92 H;  1HZB A;  4JI8 L;  4LF6 L;  1K73 C;  4Y7N H;  1EQQ A;  3JC6 6;  3W5O A;  1LUZ A;  4A3C G;  3EBE A;  2KHI A;  1K8G A;  5IYB H;  1VQ6 A;  3GTQ H;  2HIV A;  2VZA A;  1RL2 A;  3GO5 A;  1VQA A;  4A3I H;  1VQE A;  3CCV A;  2KCM A;  3T1H Q;  4LF5 L;  3J81 i;  1VQ7 A;  1X65 A;  4R1J A;  1FJG L;  3NBH B;  4YHH Q;  4TVA B;  1QVG A;  3GTM H;  4YWK A;  4JV5 L;  1S3O A;  1T9H A;  5ELO A;  1PH8 A;  2NN6 G;  4UPA A;  2KHJ A;  2AWN A;  1YBY A;  2MQH A;  4IPG A;  2XTI A;  4DUZ L;  2R7D A;  5LMU Q;  1IL2 A;  3KYH C;  2VW9 A;  1QZH A;  1SRU A;  1BBU A;  4BY7 G;  1XJV A;  2IHE A;  4X62 L;  1GM5 A;  1JE5 A;  4GKK Q;  3K81 C;  4KHP L;  1YZ6 A;  4O0A A;  2R7Z G;  5M5X H;  4JI0 Q;  1K8A C;  4LF8 Q;  4JOI C;  2MO1 A;  1N9W A;  1TWH H;  4DV5 L;  4OX9 L;  2WAQ E;  4LUZ A;  4B3S Q;  2JA9 A;  3L7Z C;  4IJH A;  4LWC A;  4PG3 A;  2QEX A;  3TRZ A;  4DPG A;  2V1C C;  5IWA Q;  4PZ6 A;  2OTL A;  1XNR L;  2ATW A;  1YIJ A;  4LFA Q;  2IX1 A;  4JBJ A;  3MEF A;  5GQO A;  1G51 A;  2NVT H;  5C44 H;  3PV0 A;  3I56 A;  1OTC A;  3Q8D A;  4NXM Q;  4B3T L;  4R4C A;  1A63 A;  4P72 A;  1JJG A;  3KDF A;  3KOJ A;  4IPC A;  5C0X G;  2MNA A;  2Q2H A;  1A62 A;  1BBW A;  2PQA A;  3OYY A;  2WB1 E;  2D62 A;  2UU9 Q;  2HT1 A;  2JE6 I;  3NEM A;  4AYB E;  2ZTC A;  4AQY L;  2VL6 A;  3HKS A;  3HOX G;  3U4Z A;  4JI7 Q;  4A3M G;  1PV4 A;  2NZH A;  1FVI A;  2WFW A;  1VQI A;  3M9B A;  3S16 H;  4OO1 G;  1Q1E A;  1XPU A;  4XTC S;  5IYC G;  4HIM A;  1OXS C;  3K7A H;  4MNO A;  3G4S A;  1B8A A;  4DR7 L;  4LF6 Q;  1WYD A;  4JI5 L;  1YIT A;  2CKZ B;  1UWV A;  3A5Z B;  4A3E H;  1S72 A;  1IYJ B;  2R93 H;  2KEN A;  1VQB A;  2K5V A;  3KJO A;  3F2B A;  4IOA A;  3I4N H;  3S15 H;  1GO3 E;  1OXV A;  2EXD A;  4B3R L;  3CPW A;  2OTJ A;  2BA1 A;  2NZO A;  5HY6 A;  3SGI A;  2JA5 G;  2WB1 G;  1Z9F A;  4A3J H;  4OON A;  4X64 L;  4AYB G;  3A0J A;  3AEV A;  1OXU A;  1YJN A;  4DAY B;  3KF6 A;  4NB3 A;  1CKO A;  2QA4 A;  1YI2 A;  1HR0 W;  1C9O A;  5FLM G;  1ASZ A;  3AQQ A;  4HIK A;  2CQO A;  4DV6 L;  2VQF L;  2MO0 A;  3ERS X;  2K4K A;  2JA6 G;  3OW2 A;  2VQE L;  4GLA C;  2N3S A;  4R4O A;  4AH6 A;  4MTN A;  3CCQ A;  2E2H H;  2HHH L;  3B6Y A;  4XIG S;  4A93 H;  4HJ5 A;  2QGQ A;  1HR0 L;  1GVP A;  1IBL Q;  1I5F A;  2ZM6 Q;  1KHI A;  4R4I A;  1S40 A;  1VQP A;  3FHW A;  2UXD L;  5JJL A;  4JI3 Q;  3EN2 A;  1P8L A;  2RHQ B;  4B3M L;  2KCT A;  5GAD C;  1JB7 A;  1HZ9 A;  2RCN A;  2E2I H;  2IY5 B;  3RN5 A;  4LF7 L;  3T1Y L;  4A3B G;  4MZ9 A;  1PFS A;  3HOW H;  4A3D H;  1TWG H;  4LFC L;  4JI6 Q;  4L5S A;  2YTY A;  1Q7Y C;  2Z6K C;  5JEA J;  3RLN A;  1SRO A;  3HOV H;  1WCM G;  3VDY A;  3BZC A;  3W1G A;  4DV7 L;  3F2D A;  1XTD A;  4X6A H;  1V1Q A;  1G29 1;  2ASB A;  2JEA I;  3AFQ A;  3M85 A;  2UXB L;  2RHS B;  3WWV A;  4DR6 L;  4HIO A;  4LUO A;  1IBK Q;  3CAM A;  1NY4 A;  3HOZ G;  1K0R A;  4DV0 Q;  1NTG A;  1L1O C;  4HJ8 A;  4A3L H;  1X3F A;  2A1A A;  2UUB Q;  2MFI A;  2JA8 G;  1B7Y B;  4GOP B;  4FDB A;  1E1O A;  1XMO L;  1K9M C;  1CSQ A;  4X65 L;  2E5L L;  1HJP A;  2F4V L;  2BH2 A;  1SR3 A;  3PUX A;  2I0Q A;  4GLX A;  3S1N H;  1CUK A;  3CW2 C;  4A3K G;  4DUY Q;  1N32 L;  4C3I H;  3FKI H;  4A3F G;  1G6P A;  3G6E A;  3CCE A;  3E9H A;  3PSI A;  3OTO Q;  3S14 H;  4UP8 A;  1X6O A;  3J80 c;  3CC4 A;  5M3M G;  2NVX H;  1KL9 A;  2ALY B;  2KBN A;  4X66 L;  2OQ0 A;  3JAM i;  2IT1 A;  1TWC H;  1OXX K;  4Y52 H;  4K0K Q;  1HNX Q;  3PGZ A;  4TQU S;  3GTK H;  3I55 A;  1KD1 C;  4JI2 Q;  4JI4 Q;  2R6G A;  4AIM A;  1JMC A;  5IE8 A;  3GTL H;  3TQY A;  1VCI A;  1QUQ B;  3PO2 G;  1RIP A;  4DV4 L;  3T1Y Q;  2H5X A;  1C0A A;  2HQL A;  4C3J H;  2ZJQ A;  1PH3 A;  5IYD G;  4DV3 L;  3CC7 A;  2YV5 A;  3FP9 A;  4JC0 A;  5GAG C;  2UUC Q;  4BBS H;  1HNW L;  2UXC L;  1H95 A;  3HOU H;  4DV2 L;  3I4M G;  5BR8 Q;  3CPF A;  4JI1 Q;  3U4V A;  3NEL A;  2ID0 A;  1AH9 A;  2YYZ A;  4JG2 A;  3DLL A;  3CD6 A;  3PUZ A;  4YY3 Q;  1CKN A;  3KJP A;  2R92 G;  2ZTD A;  5GRO A;  2OCE A;  1PH1 A;  3CCJ A;  2LSS A;  1X55 A;  3CCS A;  1NMF A;  1LM0 A;  3BU2 A;  5IYB G;  2F3I A;  4BBR H;  1D7Q A;  1Y1W H;  3G48 A;  5FLX c;  3PO3 H;  4A3I G;  1VQJ A;  1IBM L;  4JYA Q;  2NVQ H;  4POF A;  1VQK A;  3S2D H;  5K36 G;  4DR1 Q;  1Y14 B;  4DR2 Q;  2PQA B;  1HNZ Q;  4GN4 B;  3TS2 A;  2B29 A;  2AWO A;  4H02 A;  3E9I A;  2OWO A;  4UY8 C;  1YVC A;  1MJE A;  5M3F H;  1N36 Q;  1R9T H;  4GKJ Q;  1N33 Q;  2JA7 H;  4GLV B;  1L1O B;  2DGY A;  3UE0 A;  5IY0 A;  4P75 A;  4JI8 Q;  3K7U C;  1EFW A;  3UDI A;  1EIF A;  2Y0S G;  4A4I A;  4BBS G;  1BVS A;  1L2F A;  4A3G H;  4L5T A;  3GTJ H;  4GNX A;  4BXX H;  1JT8 A;  2C35 B;  4KLK A;  1X56 A;  1NBW A;  1Y1V H;  1XMQ L;  5IP7 H;  1WJJ A;  4LF5 Q;  4LF9 L;  5LMN W;  1E7Z A;  1I94 L;  1FJG Q;  1QVF A;  2K5N A;  3J81 c;  3KF8 B;  1PH7 A;  4JV5 Q;  2F52 A;  4LUV A;  1VQG A;  2K75 A;  5GAE C;  4DNI A;  4DUZ Q;  4DR4 L;  5C44 G;  1CSP A;  4DV1 L;  3KF6 B;  4GN5 A;  1PHJ A;  1QVC A;  5AJ3 L;  2VNU D;  3A5U A;  5LMN L;  1KQS A;  4WJ3 M;  4DR3 L;  4X62 Q;  1A8V A;  1LYL A;  2BH8 A;  4JBM A;  3S17 H;  2NVY H;  4KHP Q;  4ME3 A;  5FJ8 H;  2Q2I A;  5IP9 H;  1XNQ L;  3HOY H;  4EX5 A;  1YEZ A;  4DV5 Q;  4PZ8 A;  4OX9 Q;  1K3R A;  4C3H H;  4QGU A;  3GTP H;  1VQO A;  1XNR Q;  5HGQ A;  2K5H A;  1X3G A;  4QY7 A;  3TEH B;  4EQ5 A;  2I5L X;  3S1M H;  1MJC A;  4YCU A;  4A3E G;  1N8R C;  4LFB L;  1VQH A;  5E7N A;  3M4P A;  4NXN L;  3RNU A;  1M90 C;  1J5E L;  4B3T Q;  2UUA L;  2GVA A;  3HKZ G;  3PUV A;  3PF4 A;  4BA2 I;  1N34 L;  2E2J H;  1SLJ A;  4LF4 L;  3I4N G;  1V43 A;  4R4Q A;  2VUM H;  3LGJ A;  1EOV A;  3D0F A;  3M4Q A;  2HIX A;  4DR5 L;  3UE1 A;  1LTL A;  1WOC A;  4GS3 A;  3J7Z C;  2ES2 A;  4AQY Q;  4LNQ A;  2N49 A;  1KAW A;  4P74 A;  3HFZ B;  3G71 A;  1I3Q H;  4A3J G;  3I7F A;  1U5K A;  1KIX A;  3TRE A;  3ZJY C;  2NN6 I;  3I4O A;  3CXC A;  4UP9 A;  1C7Y A;  4IFD J;  2RF4 A;  4P71 A;  5H1S E;  4DR7 Q;  2D0O A;  3F8T A;  4OWT B;  1PH4 A;  4JI5 Q;  3T1H L;  1SE8 A;  2K50 A;  3IRB A;  4QJF A;  3H3V H;  4QQB X;  1Q82 C;  5FJ8 G;  2OQK A;  4YHH L;  2AMC B;  1AE3 A;  1CKM A;  3F1Z A;  3CCR A;  2I5M X;  2ZTE A;  4L5Q A;  1MKH A;  1Y1W G;  1GKH A;  3UDX A;  2JQO A;  3PUW A;  3CF5 A;  5LMU L;  4B3R Q;  4A93 G;  1EIY B;  3H0G H;  4BA1 I;  1YHA A;  5C3E H;  1KXL A;  4RG1 A;  4J15 A;  4LW1 A;  1VQ8 A;  1E3P A;  1TWF H;  4X64 Q;  3CME A;  5C4X H;  3M7N A;  4GKK L;  4A3C H;  1Q8K A;  4JCV E;  4GNX C;  4JI0 L;  4LF8 L;  2ZJP A;  1A0I A;  3L2P A;  4B3S L;  4DV6 Q;  5EAY A;  4A3D G;  2VQF Q;  3CCU A;  3HOW G;  5IWA L;  3ULJ A;  2VQE Q;  4L5R C; 
#chains in the Genus database with same CATH topology
 1VF5 C;  2NN6 H;  4LFA L;  2HHH Q;  2B39 A;  4UHV A;  3S2H H;  2F0W A;  4DAM A;  5C6A A;  4NXM L;  1VQ5 A;  3CC2 A;  2Z0S A;  1Y8N B;  1RKN A;  2D0P A;  3MC0 B;  1S4Z A;  4ILW A;  2J0T D;  4KHZ A;  1NMG A;  3J7Y W;  4JI7 L;  1YHQ A;  3EIV A;  4LF7 Q;  4YCW A;  4J1M A;  4LFC Q;  5JJK A;  2BA0 A;  5C4Z A;  1RTO A;  4IJL A;  3FDT A;  1EOT A;  4KY7 A;  3FEW X;  3NP8 A;  1JC7 A;  3BVG A;  4DV7 Q;  4CKC A;  1D8L A;  3IFD A;  5C0X H;  1DGS A;  2JA6 B;  2N78 A;  2B2W C;  2AQ2 B;  1I4H A;  3FKI G;  1C4Q A;  2Y0S E;  3CRK C;  3L0O A;  1SJH D;  2Q2U A;  3QOJ A;  1JOO A;  4K2L A;  5IYC H;  3M7G A;  5EJW A;  4O2D A;  2B8F A;  1IW7 D;  3DHQ A;  1GHK A;  4QF4 A;  4RGO S;  4RGM A;  1EWI A;  3DMU A;  4A3B B;  3D31 A;  3EA6 A;  5JJI A;  4DA2 A;  2GN5 A;  2Q8I B;  2F4I A;  4HID A;  2M9V A;  1OXT A;  2IW3 A;  4POG A;  1IBL L;  1PFN A;  4EGV A;  3K8A A;  3TDQ A;  2Z6K A;  3AFP A;  1EL0 A;  1Q12 A;  3DWA A;  4GNX B;  3AYH B;  4R4T A;  3VA7 A;  4XYQ A;  5FLM H;  3VYU A;  2A6E C;  1JOQ A;  3RZO B;  4IUV A;  3MTS A;  2A74 C;  1S5B D;  5CV5 A;  1A3T A;  2G5D A;  4YWM A;  5KEE A;  4DV4 Q;  4RGN A;  1SMX A;  4KI0 A;  2A8V A;  2LFN A;  4H44 C;  3F2U A;  3RLO A;  5I9O A;  1NR4 A;  4KKS A;  1KDC A;  3NTI A;  5J3B A;  3I72 A;  1IBK L;  1EQR A;  1VQN A;  4DV0 L;  1I4G A;  1DM0 B;  1JR0 D;  5CR3 A;  4QIW E;  1TKW B;  3U58 A;  1PTO H;  2JSO A;  3OWE B;  4BXX G;  2XRQ D;  1SN8 A;  3T4A C;  2L12 A;  1I50 B;  1K8O A;  5M5Y H;  3NSW A;  1W3S A;  4DUY L;  5CGK A;  3MHB A;  3K5L A;  4IOC A;  2VS1 A;  1TQO A;  2HCI A;  5D3I B;  1SYC A;  3PIO 3;  2FXQ A;  1TU2 B;  4XT3 B;  1TWA B;  1QOH A;  4KTA A;  3T13 A;  4JBW A;  3K5N A;  3S24 A;  2YTX A;  2F0U A;  3CKI B;  3HOY G;  1XPO A;  1PH2 A;  4JI4 L;  3KLW A;  1XMQ Q;  2QEJ C;  1K83 B;  4DK6 C;  3PCO B;  4C2M H;  4EQP A;  4A3F H;  2PI2 A;  4IFD H;  5JOB A;  1LV9 A;  1X3E A;  2JK8 A;  4OWX B;  3PIP A;  1Q90 A;  2UUC L;  4A3I B;  3ULL A;  4RA8 A;  5BR8 L;  4JI1 L;  4DXF A;  4QB4 A;  3H6M A;  1AFP A;  2B3G A;  1CFM A;  4BY1 G;  1ZEQ X;  2HDL A;  1E22 A;  1GUT A;  1UE5 A;  4NKL A;  3K80 C;  4RCN A;  1J9O A;  4M8A A;  2PMZ B;  1VQF A;  3V05 A;  1W2B A;  1BR9 A;  2VY3 A;  4IUN A;  5IIF A;  2UU9 L;  4DR1 L;  4LFB Q;  4NXN Q;  1TWH B;  1B3A A;  3A8K E;  2MPM A;  1N34 Q;  1D1K A;  3X3M A;  1N36 L;  5M5W H;  1BF4 A;  5A35 A;  3H15 A;  1N33 L;  5KGU A;  1F2M A;  2NVT B;  4LF6 L;  1ILQ A;  2DY7 A;  3C1F A;  5C44 B;  4A3C G;  2KHI A;  4XT1 B;  2FFK B;  5IOC A;  1RL2 A;  3CCV A;  4LF5 L;  3NBH B;  1TY0 A;  4TVA B;  3GTM H;  4YWK A;  4JV5 L;  5ELO A;  3S16 B;  4KJO A;  3R93 A;  4IPG A;  2AWN A;  3OSO A;  1I4P A;  1IL2 A;  2R7D A;  3K57 A;  1QWY A;  2RDF A;  4A3E B;  5ELB A;  1XJV A;  1GM5 A;  1JE5 A;  3K81 C;  1WVL A;  1HUN A;  1YZ6 A;  2BE5 C;  4CKB A;  4FXG C;  1NSN S;  3MXP A;  4LF8 Q;  3I4N B;  4JOI C;  2MO1 A;  1L0Y B;  3L7Z C;  2QEX A;  4LJZ C;  2V1C C;  2SNM A;  4DPG A;  3OOC A;  1YIJ A;  4LFA Q;  1GJX A;  5GQO A;  3P7J A;  4NXM Q;  4DF7 A;  2EOT A;  1JJG A;  3KDF A;  3KOJ A;  1A2U A;  4IPC A;  1K3B C;  1HQM C;  1BBW A;  2WB1 E;  2D62 A;  2VL6 A;  3HKS A;  3HOX G;  4JI7 Q;  4A93 B;  1BOS A;  1FVI A;  2WFW A;  1LLR D;  3M9B A;  5KRU A;  1SBB B;  4XTC S;  5BN3 A;  1QCB D;  2Q8R E;  3I90 A;  5COY A;  1WYD A;  2R93 H;  1UWV A;  1M8A A;  1IYJ B;  1NCV A;  2KEN A;  4FF2 A;  3F2B A;  1WD0 A;  3FVQ A;  3HOW B;  5FLX L;  4KMU C;  1TWG B;  1OXV A;  2A5H A;  2EXD A;  1VMP A;  3S9W A;  3CPW A;  4TRD A;  4H0L C;  2LMC B;  1YI2 A;  2NTT A;  1EY6 A;  4X3U A;  2RQX A;  2KJX A;  1C9O A;  3AQQ A;  4HIK A;  1VF7 A;  1TS4 A;  5EBD A;  5J1Z A;  4DV6 L;  2VQF L;  2MO0 A;  3MFG A;  2VQE L;  5J22 A;  1FD7 D;  2N3S A;  1CHP D;  2NYZ D;  4MTN A;  4XIG S;  1KAA A;  5FO9 B;  4HJ5 A;  2QGQ A;  1FR3 A;  1GVP A;  1HR0 L;  1IBL Q;  2R61 A;  1VQP A;  5EBC A;  3FHW A;  3AU7 A;  3EN2 A;  2NTS A;  2RHQ B;  4RCO A;  2OT2 A;  3SR1 A;  1TS2 A;  1AW7 A;  2IY5 B;  3RN5 A;  3S14 B;  3A7A B;  4EQO A;  2Z6K C;  3CU7 A;  1SXT A;  3HOV H;  3VDY A;  1CZG A;  3W1G A;  3GTK B;  2ASB A;  2RHS B;  3WWV A;  4DR6 L;  2PNR C;  1IBK Q;  4DV0 Q;  4HJ8 A;  2JA8 G;  1LAB A;  4BWG B;  2B63 B;  1TII D;  3MEH A;  4FDB A;  1E1O A;  2E5L L;  3BYT B;  5BN4 A;  4RKL A;  1SE2 A;  4ABN A;  2I0Q A;  3S1N H;  4DUY Q;  3G6E A;  3G7L A;  4UP8 A;  2A69 C;  4BBR B;  1SNQ A;  2ALY B;  2ICI A;  2NVQ B;  2Z1C A;  4CGY B;  5C5M A;  5M3F B;  4JI4 Q;  1H9S A;  4IUQ A;  1GUS A;  1EY5 A;  1MHW C;  4UDU C;  2ZJQ A;  4A3G B;  2QDB A;  5I2X A;  3I73 A;  4DV3 L;  4JC0 A;  5GAG C;  1ML0 D;  2UUC Q;  1DCZ A;  3E6Z X;  5BR8 Q;  1F9P A;  4JI1 Q;  2ID0 A;  2XN9 C;  1JB3 A;  2R92 G;  5GRO A;  4DNT B;  5KND A;  3CQZ B;  1NMF A;  3CCS A;  5T1G A;  5IYB G;  3Q24 A;  1Y1W H;  2DNC A;  3PO3 H;  1IBM L;  2RDH A;  2ENB A;  2GA4 B;  3S2D H;  5K36 G;  4DR1 Q;  1Y14 B;  3TS2 A;  2QCP X;  4GN4 B;  5ISR A;  2AWO A;  3SE0 A;  4K6D A;  1N36 Q;  1MJE A;  1R9T H;  1X3Q A;  1N33 Q;  4GLV B;  2L5T A;  5IGF A;  3K7U C;  4A4I A;  3C1E A;  3D8G A;  4L5T A;  4GNX A;  1JT8 A;  3TP8 A;  2C35 B;  1JCK B;  3EQL C;  1SYF A;  3HG9 A;  2VUM B;  1Y1V H;  2X6G A;  2IPK D;  4LF5 Q;  3ND9 A;  1Y8O B;  4LF9 L;  1I94 L;  4JV5 Q;  3GTG B;  4F7X A;  4RHR A;  1XYI A;  1CSP A;  2CQA A;  4DV1 L;  3P20 A;  1QVC A;  2VNU D;  1A8V A;  1W6J A;  2Q2I A;  1GXD C;  4C3H H;  4Q0F A;  1IW7 C;  4OEL B;  1FGB D;  1CA6 A;  5E3F A;  2L55 A;  2K5H A;  1X3G A;  5IOD A;  3S1M H;  2Q8T A;  4ZRZ A;  4DAY A;  2RCF A;  2UUA L;  3PF4 A;  1O7Y A;  1JE4 A;  2RVL A;  5E4W C;  4F8M A;  5FO8 B;  1SLJ A;  2TMP A;  4LF4 L;  5EKK A;  2B2W A;  4G4K A;  4J8Q A;  1LTL A;  3SK4 A;  3PO2 B;  1I4R A;  3S2H B;  4P74 A;  3BZD B;  3G71 A;  1O80 A;  3MXU A;  3I4O A;  3AMU A;  2RF4 A;  4OWT B;  1PH4 A;  1SE8 A;  1Q82 C;  2OQK A;  1CKM A;  3SK5 A;  3CCR A;  3CHB D;  1BO0 A;  4ODG A;  1D5Z C;  2JQO A;  4BA1 I;  1YHA A;  1PTO C;  5CV6 A;  1C48 A;  1FYC A;  4ZKB B;  1Q8I A;  1K0S A;  1Q8K A;  4JI0 L;  4E6I A;  4B3S L;  3IAY A;  2JN4 A;  4DV6 Q;  4A3D G;  2VQF Q;  3KBX A;  3IL8 A;  2VQE Q;  1PA6 A;  2OXP A;  1F9Q A;  3MXN B;  1PYB A;  3VA5 A;  1HR0 Q;  1BCP C;  3D4R A;  1RF2 D;  4HJ9 A;  3K0X A;  1LTA D;  1MSG A;  4C1N K;  2QF7 A;  4ZYS A;  5I2Y A;  3NUC A;  4F87 A;  1IXR A;  2AHO B;  2HUG A;  2LXK A;  1VQC A;  3MAQ A;  4RMF A;  5ELN A;  1L0W A;  2B63 H;  2A6H D;  1WTQ A;  4ZUJ A;  4HN7 A;  1IZ6 A;  1SE3 A;  2N8N A;  2A73 B;  3NBH A;  4C3I G;  4HTH A;  5IT9 L;  4IUP A;  5DLQ E;  4DR6 Q;  1U4M A;  3R3O A;  3K7A B;  1X32 A;  4OO1 H;  1BQQ T;  3O13 A;  2K5D A;  3KDF B;  2FMC A;  1TY2 A;  2SNS A;  2E5L Q;  5D3D A;  4OL7 A;  2YU9 H;  3U9S A;  3M4Y A;  1PTO B;  4OEM B;  4C3J G;  2JA5 H;  2KEC A;  3S1Q H;  2KQ3 A;  1PYS B;  3HOU G;  2KCN A;  1EIG A;  1F9R A;  5M5Y B;  1G6Z A;  1Q3L A;  3JAM c;  2G9D A;  1Y69 U;  4NMZ A;  4UP7 A;  4WJ4 A;  4JI6 L;  2FIN B;  4IPH A;  2K5W A;  4WJW A;  1WI5 A;  3CQZ H;  1VQD A;  1L1O A;  1BCP B;  4DK3 C;  2WAQ G;  3BS1 A;  1QVG A;  1HRJ A;  4DV3 Q;  4K8J A;  3BVZ A;  1GD7 A;  4GOP C;  3H3V I;  2F3W A;  3ER0 A;  4A3F B;  1T5X D;  3VYS A;  4DK0 A;  4M1U B;  2JA7 G;  1II3 A;  4TSS A;  3RN2 A;  3DEP A;  4IO9 A;  1Q86 C;  1WCM H;  1RHP A;  4K5W A;  4GN3 B;  3K6O A;  3TS0 A;  1IBM Q;  5IP7 G;  3M4O H;  1WTR A;  1U4L A;  1E24 A;  2IX0 A;  3J80 i;  3GDE A;  3F2C A;  1TR5 A;  3PIP 3;  5LHY 1;  3GTG H;  1ICF B;  3HOZ H;  3KLR A;  1HZA A;  4QL5 A;  1RDP D;  3ULP A;  3NTH A;  1UEB A;  1PH6 A;  2J7Z A;  4JOI A;  2F0F A;  2SEB D;  2PNH A;  5CBE E;  5M5W B;  3H94 A;  3TZU A;  1X9N A;  4LF9 Q;  3C46 A;  1AP0 A;  5DM7 3;  4A3K H;  2M00 A;  4RGT A;  1VMC A;  1XPR A;  1I94 Q;  2EYF A;  3KUP A;  3FPP A;  3D4W A;  1ZYR D;  4ZUI A;  3VR4 A;  2YTV A;  1O7I A;  1PLF A;  5M3M H;  3UDF A;  2XRS D;  1VQM A;  4DV1 Q;  2HCC A;  1LT4 D;  1BXT A;  1PZK D;  3ICE A;  2ZJR A;  1HA6 A;  4CDD C;  3PO2 H;  1HZC A;  4ZQ3 A;  1SAP A;  2J4X A;  5IYD H;  3J7A 5;  2WIN B;  4NDX A;  1CQF A;  2WP8 J;  1J6Q A;  4FXK C;  2O5I C;  2PI2 E;  1IYU A;  3I4M H;  1WD1 A;  2UUA Q;  2EJG C;  4X3S A;  4LF4 Q;  3J7A F;  3STB D;  3RR5 A;  1H9S B;  2EYJ A;  4YCV A;  4GKJ L;  2QDL A;  2XGT A;  3H0G G;  4IFD G;  1HZB A;  1EEI D;  4Y7N H;  3GTQ H;  2HIV A;  2VZA A;  5D14 A;  1VQE A;  2KCM A;  2EY5 A;  3J81 i;  1VQ7 A;  3GP7 A;  1X65 A;  4R1J A;  2XWB B;  2F0L A;  1HTL D;  1D1I A;  2RDG A;  1T9H A;  1EEF D;  1S5C D;  4K5V A;  3KYH C;  2R93 B;  1SRU A;  1XWE A;  4KHP L;  3HKZ B;  5T1I A;  2LY7 A;  4O0A A;  2R7Z G;  3D3R A;  4JI0 Q;  1K8A C;  1AN8 A;  4CJ2 C;  4KN4 C;  2WAQ E;  4B3S Q;  1R4P B;  4LWC A;  1UAP A;  2EZV A;  2OTL A;  4NP5 A;  1XTC D;  3K5M A;  2IX1 A;  1OTC A;  5KNB A;  4HMI A;  4P72 A;  3X3N A;  4FF4 A;  4DK1 A;  2B2Y C;  1U4P A;  4PMC A;  4HSV A;  2JE6 I;  2OF1 A;  3NEM A;  3U4Z A;  4A3M G;  2NZH A;  4H13 C;  1ZXT A;  1Z6H A;  1Q1E A;  1XPU A;  3K7A H;  2EYO A;  2WKC A;  4DR7 L;  4HMJ A;  1YIT A;  3A5Z B;  2XWJ B;  2C9O A;  5AFW A;  1BBX C;  1HCZ A;  2F0G A;  3S15 H;  4B3R L;  1W6K A;  3SGI A;  3HOV B;  2WB1 G;  4A3J H;  3HP3 A;  1OXU A;  3AEV A;  4DAY B;  4S3S A;  2QA4 A;  1WTX A;  1RCV D;  1HR0 W;  1KNA A;  1ASZ A;  4KKT A;  1UUP A;  1JWU D;  2A68 D;  4ZKC B;  2JA6 G;  3OW2 A;  1SE4 A;  1CA5 A;  2QKI C;  4QUC A;  5C3E B;  1CZW A;  1I5F A;  1IL8 A;  5C4X B;  4R4I A;  2UXD L;  2JP1 A;  1PDQ A;  1RJT A;  4B3M L;  5GAD C;  3S1N B;  1JB7 A;  3BDL A;  2PCF B;  4A3B G;  4V0B A;  4JI6 Q;  4L5S A;  2YTY A;  2NB0 A;  3RLN A;  1UNS A;  2LS0 1;  2WAC A;  3BZC A;  4BS9 A;  1XTD A;  2B2T C;  1PXU A;  4FNF A;  1PFB A;  3BDO A;  3AFQ A;  2UXB L;  1GUW A;  3ZYY X;  1MGS A;  4HSP A;  1CM9 A;  1L1O C;  2K03 A;  3QWN A;  1B7Y B;  2F0M A;  1K9M C;  2BH2 A;  3PUX A;  1CUK A;  3V2T A;  2NUC A;  1G6P A;  2FHT A;  3FKI H;  4L8J A;  4DU9 A;  2PZU A;  3CCE A;  3PSI A;  1X6O A;  1Y1W B;  2DJF C;  3MXN A;  3PO3 B;  2NVX H;  1KL9 A;  2KBN A;  2EVB A;  4X66 L;  4XQQ A;  3S2D B;  1TWC H;  2Z6B A;  5DAU A;  3P75 A;  1KD1 C;  1R9T B;  2DN8 A;  1JMC A;  5IE8 A;  2JYO A;  4CJ1 B;  1RIP A;  3KBG A;  2HQL A;  1PH3 A;  2F0H A;  3H09 A;  2YV5 A;  3TZD A;  4KY5 A;  3H91 A;  3J80 L;  1A15 A;  1Y1V B;  3HS0 C;  4U68 A;  2UXC L;  4DV2 L;  3MWY W;  4K2K A;  4HCE A;  1EZ8 A;  2YYZ A;  4JG2 A;  1ILP A;  3C3L A;  2F03 A;  2ZTD A;  5M9O A;  1PH1 A;  3CCJ A;  2Z4I A;  3W2D A;  3DUZ A;  1EZ6 A;  2F3I A;  2L0C A;  4FXD A;  4A3I G;  2EYP A;  2V4D A;  1SYB A;  3L3O C;  4H02 A;  4C3H B;  4UY8 C;  4PNY A;  1KLG D;  1HTP A;  1BDO A;  4GKJ Q;  1HFN A;  1L1O B;  2DGY A;  3S1M B;  1XXG A;  3UDI A;  1OO9 B;  5ELE A;  4BXX H;  5DNF A;  3D4D A;  2WV6 D;  1GOZ A;  3LWE A;  1WJJ A;  1E7Z A;  1QVF A;  2K5N A;  1E2V A;  2PYK A;  2F52 A;  1VQG A;  2K75 A;  1BNZ A;  5C44 G;  1PHJ A;  4GN5 A;  4B08 A;  5AJ3 L;  3UI2 A;  2BH8 A;  4OGQ C;  1SNM A;  4KHP Q;  5FJ8 H;  4PV1 C;  3D6W A;  2F0N A;  1XNQ L;  1T5E A;  2H4O A;  3HOY H;  4L63 B;  3QJY A;  2DY8 A;  1K3R A;  2EY6 A;  3JAM L;  1PRT F;  2NBF A;  3VR6 A;  1I4Q A;  3J81 L;  2D9U A;  3TEH B;  2VB2 X;  2I5L X;  4HR7 B;  1MJC A;  4I65 A;  2IWH A;  4A3E G;  2F3V A;  1VQH A;  1STE A;  3M4P A;  3RNU A;  1J5E L;  1F9S A;  3RUZ A;  4BA2 I;  3GV6 A;  3I4N G;  1V43 A;  3LGJ A;  1EOV A;  3D0F A;  1D6E C;  2HIX A;  3M4Q A;  3UE1 A;  1WOC A;  4GS3 A;  4DR5 L;  2ES2 A;  2X69 A;  3NQT A;  2N49 A;  3I91 A;  3I7F A;  5D65 A;  1GUG A;  1KIX A;  2IL8 A;  2F0E A;  2NN6 I;  4BY7 B;  1Z7T A;  4IFD J;  4DAP A;  4DR7 Q;  2D0O A;  1ESR A;  4QQB X;  1PRT D;  3IRB A;  3H3V H;  1NR2 A;  5IGC A;  4NW2 A;  1WTO A;  4F88 A;  2I5M X;  4L5Q A;  1LAC A;  1GKH A;  2KHS A;  1O7L A;  3A56 A;  3K0Y A;  3LX0 A;  3PUW A;  1R4Q B;  3UDX A;  4B3R Q;  4A93 G;  2R92 B;  5C5L A;  5C3E H;  4RG1 A;  4GKK L;  4LW1 A;  4A3C H;  1E3P A;  3BDC A;  5C4X H;  3G6J B;  3RD4 A;  1STA A;  1A0I A;  5NUC A;  4PMB A;  3HOW G;  1IHZ A;  3FPU B;  2XVS A;  3A74 A;  2EQS A;  5EPK A;  5JPM C;  3E0E A;  4YIJ A;  1S5F D;  2AQ1 B;  4ALP A;  4L6T B;  3FMC A;  1I6H H;  1F2Y A;  3NQI A;  1NE3 A;  3KLS A;  2UXD Q;  4GOP A;  1HXY D;  1YNJ C;  3QIA A;  2F0V A;  2F0O A;  3A8I E;  4N8F A;  4B3M Q;  3A54 A;  4K6L A;  2YU9 B;  1SJE D;  5JEA G;  1FGU A;  2JA5 B;  3S1Q B;  4AYB B;  4A3L G;  2K14 A;  1B70 B;  3CMA A;  2O4X A;  1PVO A;  4O42 A;  5C4J H;  3E3X A;  5FK9 C;  2PMZ E;  1ZYR C;  1YHB A;  3RZD H;  1CKN B;  3BVM A;  1JWS D;  3U50 C;  2UXB Q;  3HOX H;  5JVG 3;  2BCO A;  4I7Z C;  1QUQ A;  1UE6 A;  1EQT A;  3I8Z A;  4KD4 A;  1QZG A;  1V1P B;  4A75 A;  1NNX A;  1SNC A;  4FO2 A;  2Q2T A;  4P73 A;  4KD3 A;  3J80 E;  2B2U A;  1KC8 C;  2I5H A;  2KCC A;  3NWT A;  4JK1 C;  4C1N I;  2DUD A;  1P16 A;  1KLU D;  2CW0 D;  3VYR A;  1WCM B;  4JI3 L;  2CWP A;  3STB C;  2B63 G;  3BJU A;  4X66 Q;  3M4O B;  4RH6 A;  3R2T A;  3TP5 A;  4G7H C;  1EYG A;  2E2H B;  3MVV A;  2MGS A;  3HOZ B;  4HJ7 A;  1NAP A;  4BBR G;  3PF5 A;  1E1T A;  1HA5 A;  1BKB A;  2L15 A;  1SFO H;  3URY A;  1STH A;  2UXC Q;  2DNE A;  4XDX A;  4DV2 Q;  4A3K B;  2EIF A;  2F0Q A;  4ZCK A;  1YJW A;  5M3F G;  1LTG D;  5FLX E;  3Q22 A;  3NK9 A;  2B2V C;  5M3M B;  3QOL A;  4IFD I;  2UUB L;  1NJI C;  4K5X A;  4A3G G;  4WFN 3;  3A7L A;  3CP0 A;  1U0L A;  4ZAI A;  1DOM A;  3FRP B;  1ZKO A;  5EKI A;  2N55 A;  3S1R H;  3SVM A;  3TME A;  4QCL A;  1H9R A;  3W3A A;  2CH4 A;  2JA8 H;  3I4M B;  3TBI B;  2KUM A;  5IP9 G;  5K5P A;  4HED A;  4ZLT F;  3NHH A;  4JI2 L;  5JJZ A;  2G9H D;  1B9M A;  4DKA C;  1V8Q A;  2JEB I;  5CV4 A;  2AKW B;  4Y7N B;  4HJA A;  3E0J A;  3GTQ B;  3R2I A;  1FNV A;  1HH2 P;  1B2T A;  1ASY A;  5JPN C;  1Z47 A;  4IUT A;  3GTO H;  5AJ3 Q;  3HEJ A;  3SEB A;  4KV6 A;  4MTK A;  2B2Y A;  5L37 A;  2VUM G;  4YY3 L;  1UE1 A;  1XNQ Q;  2MP1 A;  1TXY A;  3TSS A;  5IGB A;  4B9X A;  2LXJ A;  1HHV A;  4IPD A;  1STN A;  2Y0S B;  4BBS B;  2A68 C;  4RWS C;  5GAH C;  4RFB A;  1JJC B;  4BY7 H;  3QO2 A;  4DR2 L;  2ZXR A;  1J5E Q;  3M3Y H;  4NPS A;  2KEE A;  1FNU A;  4A76 A;  4APV A;  3CCL A;  1LO5 D;  2CWA A;  4DR5 Q;  4K14 A;  2BOS A;  2R92 H;  1G2T A;  3W5O A;  1LUZ A;  3EBE A;  1K8G A;  5IYB H;  1QG7 A;  3N52 A;  3MA2 B;  3SK8 A;  1VQA A;  3DXJ C;  2H1E A;  5K36 H;  1FJG L;  3MFY A;  5EGT A;  2NN6 G;  2KHJ A;  3IFT A;  4DUZ L;  3SK6 A;  2VW9 A;  1QZH A;  1X3P A;  3HRZ C;  3GTJ B;  4GKK Q;  2IHE A;  4X62 L;  3R8B A;  5M5X H;  3S15 B;  4DV5 L;  4OX9 L;  2Z4H A;  4LUZ A;  2JA9 A;  4IJH A;  1GHJ A;  4A3J B;  4PZ6 A;  3OWF A;  3N6R A;  1STB A;  2XSC A;  3I56 A;  1JWM D;  4B3T L;  1A63 A;  3DM1 A;  3P1H A;  4RAU C;  2B2T A;  4QIW B;  5C0X G;  2MJ8 A;  3OYY A;  4AYB E;  4KJN A;  1PV4 A;  1GUO A;  4JVZ A;  1TT2 A;  5IYC G;  4HIM A;  4MIU A;  1TS5 A;  2CKZ B;  1S72 A;  1XX8 A;  5FOB B;  1VQB A;  3KJO A;  3ND8 A;  2P5Z X;  1M4V A;  4CJ0 B;  4HCS A;  1GO3 E;  2E76 C;  3RMH A;  5J39 A;  4FVM A;  2NZO A;  2O2L D;  4OON A;  4X64 L;  1SSO A;  1QE6 A;  1YJN A;  4WOR A;  5HGT A;  1E2Z A;  1KDB A;  5FLM G;  2K05 A;  3ERS X;  2K4K A;  5LL6 S;  5TSS A;  1CK1 A;  1EYC A;  1EWC A;  2D5D A;  4AH6 A;  1SYE A;  2E2H H;  2EE1 A;  4R8N A;  4XQN A;  1KHI A;  1S40 A;  1JOR A;  4PQX A;  4JI3 Q;  1G2S A;  5HUR A;  1P8L A;  5COR A;  1NUC A;  2B2U C;  1EY9 A;  2A69 D;  2RSN A;  3OMG A;  1HZ9 A;  3FKI B;  2E2I H;  1A6X A;  1ESF A;  3EFX D;  1PFS A;  4A3D H;  4QUF A;  2K04 A;  1Q7Y C;  4UAI A;  2NVX B;  5JEA J;  4K8I A;  1TWC B;  5KNC A;  3F2D A;  4X6A H;  1AEX A;  5FKA C;  1G29 1;  3T51 B;  4ID6 A;  4DNR B;  3KK7 A;  1ONL A;  1NY4 A;  1K0R A;  4IUU A;  2MUY A;  2UUB Q;  5KYL A;  2MFI A;  4GOP B;  3SXH A;  1XMO L;  1SEB D;  4X65 L;  2XIW A;  2F4V L;  1SR3 A;  1J8I A;  2HDM A;  4GLX A;  3CW2 C;  1A2T A;  1N32 L;  4C3I H;  4A3F G;  1WTV A;  2O5J C;  5CV9 A;  1E2W A;  4IUR A;  3OMC A;  2IJ0 A;  3VR5 A;  3H3V C;  2OQ0 A;  3JAM i;  2IT1 A;  4FP5 D;  1RD9 D;  3AB9 A;  3OIQ A;  4Y52 H;  1HPC A;  2I07 B;  4JI2 Q;  2R6G A;  4TKO B;  4AIM A;  3GTL H;  1QUQ B;  2TSS A;  3T1Y Q;  1PRT C;  2WB1 B;  1C0A A;  4C3J H;  1U9R A;  4BBS H;  1HNW L;  1RTN A;  2CHB D;  1PYW D;  1H95 A;  3HOU H;  2EXZ A;  1B44 D;  2XNA C;  3U4V A;  5EQ0 A;  1AH9 A;  3PUZ A;  4YY3 Q;  4G7O C;  1CKN A;  1ENF A;  3DWP A;  3KJP A;  3ERO A;  1VDZ A;  2AUJ D;  2OCE A;  5IT9 E;  2LSS A;  3SHL A;  1DOL A;  3BYY B;  1D7Q A;  1V1P A;  3G48 A;  2K6A A;  1C8C A;  1YNN D;  5ELC A;  1K28 A;  4POF A;  3HOY B;  2QW7 A;  4DR2 Q;  2PQA B;  4GZY C;  2B29 A;  2ICE C;  3E9I A;  2OWO A;  2LKV A;  4EVO A;  1PFM A;  2JA7 H;  2SDF A;  2F0I A;  3UE0 A;  1EWH A;  4P75 A;  1PTO F;  1EFW A;  2K28 A;  2PO4 A;  2PZW A;  1L2F A;  3GTJ H;  1CHQ D;  5CV8 A;  1X56 A;  2R3Z A;  1NBW A;  4BY1 B;  5IP7 H;  1FJG Q;  2KVM A;  1PH7 A;  2B8G A;  1EFI D;  4DUZ Q;  4DR4 L;  4DN4 M;  3KF6 B;  3DEO A;  1BCP F;  1ENC A;  5LMN L;  1KQS A;  4DR3 L;  4X62 Q;  3S17 H;  2NVY H;  4ME3 A;  5F2D A;  1PTO D;  4EX5 A;  1O78 A;  4DV5 Q;  4OX9 Q;  4QGU A;  1PRT B;  4DGZ A;  3GTP H;  1VQO A;  1EU4 A;  3GQB A;  5E4X A;  4KK7 A;  2R93 G;  4CDE C;  1M90 C;  1I4X A;  4B3T Q;  3BG3 A;  3PUV A;  3HKZ G;  1QNK A;  2CW0 C;  2E2J H;  2K01 A;  4KN7 C;  3J7Z C;  1BCP D;  2VXW A;  3MZ5 A;  1JQY D;  1KAW A;  2EDG A;  3Q6S A;  1KDA A;  1I3Q H;  3U9O A;  2EPB A;  1I6H B;  3CXC A;  1C7Y A;  5H1S E;  1LTR D;  4P71 A;  3F8T A;  3T1H L;  4QJF A;  5FJ8 G;  4YHH L;  2ZTE A;  3NTK A;  4G7Z C;  5ELF A;  3CF5 A;  5LMU L;  1EIY B;  3H0G H;  4CHT B;  1KXL A;  3MXG A;  5C4J B;  1VQ8 A;  2HQE A;  4X64 Q;  1TWF H;  1LT6 D;  3M7N A;  4JCV E;  3RZD B;  2ZJP A;  3L2P A;  2M2L A;  2IX3 A;  1Y8P B;  1SDF A;  5EAY A;  3CCU A;  3HOX B;  5IWA L;  3ULJ A;  4L5R C;  1D5X C;  5ELD A;  2PW5 A;  3HOV G;  1WFQ A;  3K58 A;  4OO1 I;  1KNE A;  1VQ9 A;  2NZ1 D;  1UE7 A;  2R7Z H;  2N88 A;  5EKL A;  5IT9 c;  3TP6 A;  2R7F A;  2K7V A;  1EY8 A;  5C0X J;  1PH5 A;  1MIU A;  1VQL A;  3EVQ A;  4YWL A;  2B2V A;  1LT3 D;  2A19 A;  2CFM A;  4XQJ A;  4ZK9 B;  5C3E G;  4V19 0;  4OXP A;  5JVH 3;  5C4X G;  2BDO A;  3CCM A;  1HFG A;  1X54 A;  1HUM A;  1STG A;  1V9P A;  2F0K A;  2PQE A;  5KIX A;  3I4L A;  1JOK A;  1MD2 D;  4A3M H;  1FL0 A;  4IAL A;  3T56 B;  2F0D A;  2PPB C;  1SFO B;  3ONA B;  1DZ1 A;  1XMO Q;  2I46 A;  4KHV A;  4PMW A;  4X65 Q;  2F4V Q;  1PH9 A;  3NXW A;  4JPB W;  4H7B A;  3IKJ A;  2F0P A;  2OEO A;  3RLF A;  1N32 Q;  3J81 j;  3SDZ A;  3D6C A;  3QG1 A;  2ZM6 L;  1HQR D;  1SMY D;  2K5Q A;  1WTP A;  2CCZ A;  3KFU A;  1VS0 A;  1YJ9 A;  3NPP A;  1S5E D;  4CDF C;  2D2C C;  2PW7 A;  1ENA A;  2EY1 A;  4JW0 A;  2JA6 H;  3S1R B;  1Q1B A;  2A6H C;  1SNP A;  3HKZ E;  3DWQ A;  5FO7 B;  2JA8 B;  1FNW A;  1Y1W G;  3PUY A;  3PO3 G;  1HNW Q;  4N9P A;  1B9N A;  5BN5 A;  1EIH A;  4U67 3;  4A3B H;  3GD7 A;  3I2Z A;  3KF8 A;  3V96 A;  1AZP A;  1SNO A;  3GTO B;  1EUJ A;  4R8I A;  1M1K C;  3NEN A;  1TS3 A;  2EJF C;  1Y1V G;  3OIP A;  1K8M A;  4BY1 H;  2E8G A;  2AQ3 B;  3RZO H;  3OTO L;  2HD3 A;  4MN3 A;  4N8X 1;  2K33 A;  2GVB A;  2ZXO A;  1KRT A;  2KED A;  1S5D D;  1KRS A;  1V1O A;  3Q0A A;  3M3Y B;  4K0K L;  5LL6 X;  1HNX L;  3NE5 B;  5IGG A;  1AE2 A;  1YNX A;  4PZ7 A;  1L0X B;  3DM3 A;  3W1B A;  4C3H G;  2WII B;  1CI3 M;  4KKU A;  4IZ8 A;  2IHF A;  4DR4 Q;  1D5M C;  1F2L A;  5DEH A;  3PIO A;  1PZJ D;  2L1B A;  1IYV A;  1Q46 A;  1MSH A;  5LMN Q;  4DR3 Q;  4EQN A;  1I50 H;  3UDG A;  5C0X I;  4OIK A;  2K52 A;  5EPL A;  3T53 B;  1EU3 A;  3QB3 A;  2JJQ A;  1LTI D;  1KTK A;  4C56 C;  1ROD A;  1Q81 C;  4X3K A;  4JYA L;  2KA7 A;  5M5X B;  1TWA H;  1VQ4 A;  1CTM A;  1ET9 A;  1JJ2 A;  1HNZ L;  3BZK A;  3CRL C;  2Z9H A;  4OWW B;  1DXM A;  2F1M A;  4JBK A;  1K83 H;  4JI8 L;  2A6E D;  4DAV A;  1K73 C;  1EQQ A;  3JC6 6;  3WDN A;  1SND A;  1CT1 D;  1VQ6 A;  3LNN A;  2L9H A;  1U4R A;  3GO5 A;  4A3I H;  2FMM A;  3VYT A;  1EYA A;  2RA4 A;  3T1H Q;  2NWG A;  4YHH Q;  1S3O A;  1PH8 A;  4UPA A;  1YBY A;  2MQH A;  2XTI A;  5LMU Q;  3HZX A;  4Q5V A;  4LAA A;  4DFA A;  1EQV A;  3TP7 A;  1BBU A;  5I9P A;  5CMD A;  4BY7 G;  4I7A A;  5EPJ A;  1UEA B;  2RKS A;  3TN2 A;  1N9W A;  1TWH H;  1IKL A;  2VB3 X;  4CKE A;  5A2Q L;  4PG3 A;  3TRZ A;  5CC4 A;  2ZT9 C;  5IWA Q;  1XNR L;  2ATW A;  1EYD A;  4FF1 A;  4JBJ A;  3MEF A;  1G51 A;  2NVT H;  5C44 H;  3PV0 A;  3VR2 A;  3Q8D A;  4R4C A;  1I6V C;  1IKM A;  5IGE A;  2Q2H A;  2MNA A;  1A62 A;  2PQA A;  2UU9 Q;  4XYO A;  2HT1 A;  2RBM A;  2ZTC A;  4AQY L;  5C3X A;  1AZQ A;  1VQI A;  3S16 H;  4OO1 G;  4RKB A;  5DM6 3;  1OXS C;  2Z8L A;  3OW7 A;  4MNO A;  3G4S A;  1B8A A;  4LF6 Q;  5CV7 A;  4JI5 L;  1D2B A;  1DJR D;  4A3E H;  1STY A;  3K5O A;  2QIL A;  3C2P A;  2E2I B;  1O7Z A;  2K5V A;  4IOA A;  2F0T A;  3KLS X;  4A3D B;  3I4N H;  1LT5 D;  2OTJ A;  2BA1 A;  4R9W A;  2WKD A;  5HY6 A;  2JA5 G;  1B3Q A;  1Z9F A;  1QNU A;  4AYB G;  3A0J A;  4B9W A;  3KF6 A;  4NB3 A;  1CKO A;  4LMQ D;  3J7A V;  1QJO A;  2JXM B;  2CQO A;  1KAB A;  2F0J A;  3WOE A;  3E5S A;  4GLA C;  4OHJ A;  4R4O A;  3CCQ A;  2HHH L;  1F2Z A;  3B6Y A;  1YNN C;  4A93 H;  3JAM E;  2ZM6 Q;  3J81 E;  5JJL A;  1MBY A;  2KCT A;  4C3I B;  2RCN A;  4LF7 L;  3T1Y L;  4MZ9 A;  3HOW H;  1EY7 A;  3GV3 A;  1TWG H;  4LFC L;  4RHS A;  1SRO A;  1PZI D;  1WCM G;  1A3V A;  5I6Y A;  4DV7 L;  4FF3 A;  4CDC C;  1V1Q A;  1G91 A;  3GTL B;  2JEA I;  2K1B A;  3M85 A;  3OPO A;  3A8J E;  2C5C A;  2BE5 D;  4LUO A;  5JEA H;  4HIO A;  4C3J B;  3CAM A;  3HOZ G;  1CQV A;  1NTG A;  4DXG A;  2EYL A;  3K59 A;  4A3L H;  1WTW A;  1X3F A;  2A1A A;  3HOU B;  1DD2 A;  1CSQ A;  4ME5 A;  3WOF A;  1HJP A;  1DYQ A;  5C3W A;  1EY4 A;  2CVR A;  3ITP A;  1LTS D;  4A3K G;  3LWU A;  4N9T A;  5C4H A;  2ZXP A;  2PZT A;  4HAE A;  3E9H A;  4IN3 A;  3OTO Q;  3S14 H;  3J80 c;  3CC4 A;  2WAQ B;  5M3M G;  2RSO A;  1DON A;  4KY6 A;  1OXX K;  4K0K Q;  4QMG A;  1HNX Q;  3PGZ A;  4TQU S;  3GTK H;  3I55 A;  4LK1 C;  2BDN A;  2JA7 B;  3I70 A;  1VCI A;  3I3C A;  3TQY A;  3PO2 G;  4DV4 L;  2H5X A;  2K32 A;  2L4N A;  5IYD G;  2KOL A;  3CC7 A;  3FP9 A;  5JAV A;  3I4M G;  2EJM A;  3CPF A;  2L11 A;  3NEL A;  3DLL A;  3CD6 A;  1G8Z D;  1X55 A;  1LM0 A;  3BU2 A;  1H9K A;  4BBR H;  3S17 B;  5FLX c;  2SOB A;  2NVY B;  1VQJ A;  4JYA Q;  1B50 A;  2NVQ H;  1VQK A;  1HNZ Q;  2E74 C;  3GTP B;  1YVC A;  3QR8 A;  5M3F H;  1F77 A;  5E1F A;  2DJG C;  3NWS A;  3PMF A;  5IY0 A;  4JI8 Q;  5A2Q E;  2EYH A;  1JIC A;  1EIF A;  2Y0S G;  4BBS G;  1BVS A;  4A3G H;  4CBV A;  2E2J B;  4KLK A;  1XMQ L;  5LMN W;  3J81 c;  3ERQ A;  3KF8 B;  1H9M A;  1I3Q B;  2EYM A;  4LUV A;  1ICW A;  5GAE C;  1BUV T;  1EY0 A;  1WTH A;  4DNI A;  4IQZ A;  3A5U A;  4WJ3 M;  4JBM A;  1LTT D;  1LYL A;  5IGD A;  1LTB D;  4ULL A;  3HGB A;  2MHV A;  5IP9 H;  3Q23 A;  1MI2 A;  4X3T A;  1ET6 A;  5KYI A;  1A3U A;  4MHE A;  1YEZ A;  4C2M B;  4PZ8 A;  3H0G B;  3OHX C;  1SYD A;  3EJI A;  5I4D A;  1DOK A;  4Z9C B;  1QB5 D;  1TWF B;  5HGQ A;  1XNR Q;  4QY7 A;  4EQ5 A;  4OIJ A;  4YCU A;  1N8R C;  4LFB L;  3VR3 A;  5E7N A;  4NXN L;  1H9J A;  2GVA A;  3A55 A;  4FYD A;  1N34 L;  3L9A X;  2FJ2 A;  1TVX A;  4G57 A;  4R4Q A;  2VUM H;  1SMY C;  1E0B A;  5G3L F;  2CH4 W;  3NBI A;  4AQY Q;  4LNQ A;  3HFZ B;  4A3J G;  2F0S A;  4XXE A;  1U5K A;  1YNJ D;  3TRE A;  2AUK A;  3ZJY C;  4UP9 A;  2R7Z B;  4JI5 Q;  2K50 A;  1GUN A;  4O1N A;  2AMC B;  1AE3 A;  3F1Z A;  1PMR A;  1MKH A;  1B4O A;  1B1Z A;  1QIL A;  2E2D C;  2EY2 A;  4J15 A;  1SYG A;  5I6W A;  3CME A;  5G3L D;  2E75 C;  5CBA E;  4GNX C;  3T16 A;  4LF8 L;  5CYU A;  1B53 A;  2X6L A;  3GTM B;  4WRD A;  4P2C B;  4A3M B;  4J6H A;  3PQI A; 
#chains in the Genus database with same CATH homology
 1PA6 A;  4LFA L;  3A74 A;  2EQS A;  2HHH Q;  3E0E A;  4ALP A;  3HOV G;  3S2H H;  1WFQ A;  3MXN B;  4DAM A;  1PYB A;  4NXM L;  1HR0 Q;  1VQ5 A;  3CC2 A;  1I6H H;  2Z0S A;  4OO1 I;  1VQ9 A;  1NE3 A;  2D0P A;  4HJ9 A;  2UXD Q;  4GOP A;  1UE7 A;  3K0X A;  2R7Z H;  5IT9 c;  4B3M Q;  4KHZ A;  2R7F A;  1NMG A;  4JI7 L;  5C0X J;  1YHQ A;  3EIV A;  4LF7 Q;  1PH5 A;  5JEA G;  1MIU A;  4YCW A;  1VQL A;  1IXR A;  1FGU A;  2AHO B;  4YWL A;  4LFC Q;  2LXK A;  2BA0 A;  2A19 A;  1VQC A;  5JJK A;  4A3L G;  2CFM A;  4IJL A;  5C3E G;  2K14 A;  4RMF A;  1B70 B;  4OXP A;  3CMA A;  5ELN A;  1PVO A;  5C4X G;  1L0W A;  2B63 H;  5C4J H;  3CCM A;  4DV7 Q;  1X54 A;  2PMZ E;  1D8L A;  1DGS A;  1YHB A;  3RZD H;  2N78 A;  1V9P A;  1IZ6 A;  2N8N A;  3FKI G;  1CKN B;  2Y0S E;  3U50 C;  3L0O A;  2UXB Q;  5DLQ E;  3HOX H;  4A3M H;  2Q2U A;  4DR6 Q;  1FL0 A;  1QUQ A;  1UE6 A;  5IYC H;  1QZG A;  3KDF B;  4A75 A;  4O2D A;  2Q2T A;  4P73 A;  1EWI A;  1XMO Q;  4PMW A;  4X65 Q;  2E5L Q;  1KC8 C;  2F4V Q;  2I5H A;  3D31 A;  1PH9 A;  2YU9 H;  5JJI A;  2DUD A;  2GN5 A;  1P16 A;  3RLF A;  4HID A;  1N32 Q;  3J81 j;  1OXT A;  4POG A;  1IBL L;  2ZM6 L;  2JA5 H;  3K8A A;  2CCZ A;  2Z6K A;  3AFP A;  3KFU A;  3S1Q H;  1Q12 A;  4JI3 L;  1PYS B;  1VS0 A;  2CWP A;  3STB C;  4GNX B;  1YJ9 A;  2B63 G;  3BJU A;  4X66 Q;  3AYH B;  4R4T A;  3HOU G;  5FLM H;  3JAM c;  4UP7 A;  1EYG A;  2JA6 H;  4WJ4 A;  4JI6 L;  4IPH A;  1Q1B A;  3HKZ E;  4YWM A;  4HJ7 A;  1WI5 A;  4DV4 Q;  4BBR G;  3CQZ H;  1VQD A;  1L1O A;  1SMX A;  3PUY A;  2WAQ G;  4DK3 C;  3PF5 A;  4KI0 A;  1E1T A;  4DV3 Q;  3PO3 G;  1HNW Q;  1BKB A;  2A8V A;  2L15 A;  1SFO H;  1GD7 A;  4GOP C;  2UXC Q;  3RLO A;  4DV2 Q;  3H3V I;  2EIF A;  3ER0 A;  1YJW A;  5M3F G;  5J3B A;  1IBK L;  4A3B H;  2JA7 G;  1EQR A;  3GD7 A;  3I2Z A;  4DV0 L;  3RN2 A;  1VQN A;  4QIW E;  1Q86 C;  4IO9 A;  4IFD I;  2UUB L;  3U58 A;  1EUJ A;  1NJI C;  4A3G G;  1WCM H;  1M1K C;  4BXX G;  1SN8 A;  3NEN A;  4GN3 B;  1Y1V G;  3TS0 A;  1IBM Q;  5IP7 G;  3CP0 A;  3M4O H;  1U0L A;  4BY1 H;  5M5Y H;  1W3S A;  1E24 A;  4DUY L;  2E8G A;  4IOC A;  2VS1 A;  2IX0 A;  3J80 i;  3GDE A;  3OTO L;  3F2C A;  3RZO H;  3GTG H;  2GVB A;  2FXQ A;  3S1R H;  3HOZ H;  1KRT A;  1HZA A;  1KRS A;  4QL5 A;  3ULP A;  2JA8 H;  4JBW A;  3S24 A;  2YTX A;  4K0K L;  1HNX L;  1UEB A;  1PH6 A;  5IP9 G;  4JOI A;  3HOY G;  1XPO A;  1AE2 A;  2PNH A;  1PH2 A;  1YNX A;  4PZ7 A;  4JI2 L;  4JI4 L;  3KLW A;  4DKA C;  1XMQ Q;  1X9N A;  3DM3 A;  4LF9 Q;  3W1B A;  2JEB I;  3PCO B;  4DK6 C;  4C2M H;  4A3K H;  1XPR A;  2AKW B;  4A3F H;  2PI2 A;  1I94 Q;  4HJA A;  1X3E A;  2JK8 A;  4OWX B;  1HH2 P;  2YTV A;  3PIP A;  1O7I A;  2UUC L;  1ASY A;  1Z47 A;  2IHF A;  5M3M H;  3UDF A;  3PIO A;  4DR4 Q;  3ULL A;  1VQM A;  4DV1 Q;  3GTO H;  5BR8 L;  5AJ3 Q;  1Q46 A;  4JI1 L;  5LMN Q;  4DR3 Q;  2B3G A;  1I50 H;  2VUM G;  4BY1 G;  4YY3 L;  3UDG A;  5C0X I;  3ICE A;  1E22 A;  2K52 A;  1UE1 A;  2ZJR A;  1XNQ Q;  1UE5 A;  3K80 C;  1TXY A;  2JJQ A;  3PO2 H;  2R93 G;  2LXJ A;  1HZC A;  4IPD A;  1VQF A;  5IYD H;  1W2B A;  5GAH C;  1Q81 C;  3J7A 5;  1JJC B;  2VY3 A;  4BY7 H;  4JYA L;  1TWA H;  2WP8 J;  1J6Q A;  1VQ4 A;  2UU9 L;  4DR1 L;  4DR2 L;  4LFB Q;  2PI2 E;  1J5E Q;  1JJ2 A;  1HNZ L;  3BZK A;  4NPS A;  4NXN Q;  3I4M H;  2UUA Q;  3M3Y H;  4A76 A;  1N34 Q;  4APV A;  3CCL A;  4LF4 Q;  4OWW B;  1N36 L;  3STB D;  3RR5 A;  2CWA A;  5M5W H;  4YCV A;  4GKJ L;  3H15 A;  4DR5 Q;  4JBK A;  2XGT A;  1N33 L;  3H0G G;  1K83 H;  4IFD G;  2R92 H;  1HZB A;  4JI8 L;  4LF6 L;  1K73 C;  4Y7N H;  1EQQ A;  3JC6 6;  3W5O A;  1LUZ A;  4A3C G;  3EBE A;  2KHI A;  1K8G A;  5IYB H;  1VQ6 A;  3GTQ H;  2HIV A;  2VZA A;  1RL2 A;  3GO5 A;  1VQA A;  4A3I H;  1VQE A;  3CCV A;  2KCM A;  3T1H Q;  4LF5 L;  3J81 i;  1VQ7 A;  1X65 A;  4R1J A;  1FJG L;  3NBH B;  4YHH Q;  4TVA B;  1QVG A;  3GTM H;  4YWK A;  4JV5 L;  1S3O A;  1T9H A;  5ELO A;  1PH8 A;  2NN6 G;  4UPA A;  2KHJ A;  2AWN A;  1YBY A;  2MQH A;  4IPG A;  2XTI A;  4DUZ L;  2R7D A;  5LMU Q;  1IL2 A;  3KYH C;  2VW9 A;  1QZH A;  1SRU A;  1BBU A;  4BY7 G;  1XJV A;  2IHE A;  4X62 L;  1GM5 A;  1JE5 A;  4GKK Q;  3K81 C;  4KHP L;  1YZ6 A;  4O0A A;  2R7Z G;  5M5X H;  4JI0 Q;  1K8A C;  4LF8 Q;  4JOI C;  2MO1 A;  1N9W A;  1TWH H;  4DV5 L;  4OX9 L;  2WAQ E;  4LUZ A;  4B3S Q;  2JA9 A;  3L7Z C;  4IJH A;  4LWC A;  4PG3 A;  2QEX A;  3TRZ A;  4DPG A;  2V1C C;  5IWA Q;  4PZ6 A;  2OTL A;  1XNR L;  2ATW A;  1YIJ A;  4LFA Q;  2IX1 A;  4JBJ A;  3MEF A;  5GQO A;  1G51 A;  2NVT H;  5C44 H;  3PV0 A;  3I56 A;  1OTC A;  3Q8D A;  4NXM Q;  4B3T L;  4R4C A;  1A63 A;  4P72 A;  1JJG A;  3KDF A;  3KOJ A;  4IPC A;  5C0X G;  2MNA A;  2Q2H A;  1A62 A;  1BBW A;  2PQA A;  3OYY A;  2WB1 E;  2D62 A;  2UU9 Q;  2HT1 A;  2JE6 I;  3NEM A;  4AYB E;  2ZTC A;  4AQY L;  2VL6 A;  3HKS A;  3HOX G;  3U4Z A;  4JI7 Q;  4A3M G;  1PV4 A;  2NZH A;  1FVI A;  2WFW A;  1VQI A;  3M9B A;  3S16 H;  4OO1 G;  1Q1E A;  1XPU A;  4XTC S;  5IYC G;  4HIM A;  1OXS C;  3K7A H;  4MNO A;  3G4S A;  1B8A A;  4DR7 L;  4LF6 Q;  1WYD A;  4JI5 L;  1YIT A;  2CKZ B;  1UWV A;  3A5Z B;  4A3E H;  1S72 A;  1IYJ B;  2R93 H;  2KEN A;  1VQB A;  2K5V A;  3KJO A;  3F2B A;  4IOA A;  3I4N H;  3S15 H;  1GO3 E;  1OXV A;  2EXD A;  4B3R L;  3CPW A;  2OTJ A;  2BA1 A;  2NZO A;  5HY6 A;  3SGI A;  2JA5 G;  2WB1 G;  1Z9F A;  4A3J H;  4OON A;  4X64 L;  4AYB G;  3A0J A;  3AEV A;  1OXU A;  1YJN A;  4DAY B;  3KF6 A;  4NB3 A;  1CKO A;  2QA4 A;  1YI2 A;  1HR0 W;  1C9O A;  5FLM G;  1ASZ A;  3AQQ A;  4HIK A;  2CQO A;  4DV6 L;  2VQF L;  2MO0 A;  3ERS X;  2K4K A;  2JA6 G;  3OW2 A;  2VQE L;  4GLA C;  2N3S A;  4R4O A;  4AH6 A;  4MTN A;  3CCQ A;  2E2H H;  2HHH L;  3B6Y A;  4XIG S;  4A93 H;  4HJ5 A;  2QGQ A;  1HR0 L;  1GVP A;  1IBL Q;  1I5F A;  2ZM6 Q;  1KHI A;  4R4I A;  1S40 A;  1VQP A;  3FHW A;  2UXD L;  5JJL A;  4JI3 Q;  3EN2 A;  1P8L A;  2RHQ B;  4B3M L;  2KCT A;  5GAD C;  1JB7 A;  1HZ9 A;  2RCN A;  2E2I H;  2IY5 B;  3RN5 A;  4LF7 L;  3T1Y L;  4A3B G;  4MZ9 A;  1PFS A;  3HOW H;  4A3D H;  1TWG H;  4LFC L;  4JI6 Q;  4L5S A;  2YTY A;  1Q7Y C;  2Z6K C;  5JEA J;  3RLN A;  1SRO A;  3HOV H;  1WCM G;  3VDY A;  3BZC A;  3W1G A;  4DV7 L;  3F2D A;  1XTD A;  4X6A H;  1V1Q A;  1G29 1;  2ASB A;  2JEA I;  3AFQ A;  3M85 A;  2UXB L;  2RHS B;  3WWV A;  4DR6 L;  4HIO A;  4LUO A;  1IBK Q;  3CAM A;  1NY4 A;  3HOZ G;  1K0R A;  4DV0 Q;  1NTG A;  1L1O C;  4HJ8 A;  4A3L H;  1X3F A;  2A1A A;  2UUB Q;  2MFI A;  2JA8 G;  1B7Y B;  4GOP B;  4FDB A;  1E1O A;  1XMO L;  1K9M C;  1CSQ A;  4X65 L;  2E5L L;  1HJP A;  2F4V L;  2BH2 A;  1SR3 A;  3PUX A;  2I0Q A;  4GLX A;  3S1N H;  1CUK A;  3CW2 C;  4A3K G;  4DUY Q;  1N32 L;  4C3I H;  3FKI H;  4A3F G;  1G6P A;  3G6E A;  3CCE A;  3E9H A;  3PSI A;  3OTO Q;  3S14 H;  4UP8 A;  1X6O A;  3J80 c;  3CC4 A;  5M3M G;  2NVX H;  1KL9 A;  2ALY B;  2KBN A;  4X66 L;  2OQ0 A;  3JAM i;  2IT1 A;  1TWC H;  1OXX K;  4Y52 H;  4K0K Q;  1HNX Q;  3PGZ A;  4TQU S;  3GTK H;  3I55 A;  1KD1 C;  4JI2 Q;  4JI4 Q;  2R6G A;  4AIM A;  1JMC A;  5IE8 A;  3GTL H;  3TQY A;  1VCI A;  1QUQ B;  3PO2 G;  1RIP A;  4DV4 L;  3T1Y Q;  2H5X A;  1C0A A;  2HQL A;  4C3J H;  2ZJQ A;  1PH3 A;  5IYD G;  4DV3 L;  3CC7 A;  2YV5 A;  3FP9 A;  4JC0 A;  5GAG C;  2UUC Q;  4BBS H;  1HNW L;  2UXC L;  1H95 A;  3HOU H;  4DV2 L;  3I4M G;  5BR8 Q;  3CPF A;  4JI1 Q;  3U4V A;  3NEL A;  2ID0 A;  1AH9 A;  2YYZ A;  4JG2 A;  3DLL A;  3CD6 A;  3PUZ A;  4YY3 Q;  1CKN A;  3KJP A;  2R92 G;  2ZTD A;  5GRO A;  2OCE A;  1PH1 A;  3CCJ A;  2LSS A;  1X55 A;  3CCS A;  1NMF A;  1LM0 A;  3BU2 A;  5IYB G;  2F3I A;  4BBR H;  1D7Q A;  1Y1W H;  3G48 A;  5FLX c;  3PO3 H;  4A3I G;  1VQJ A;  1IBM L;  4JYA Q;  2NVQ H;  4POF A;  1VQK A;  3S2D H;  5K36 G;  4DR1 Q;  1Y14 B;  4DR2 Q;  2PQA B;  1HNZ Q;  4GN4 B;  3TS2 A;  2B29 A;  2AWO A;  4H02 A;  3E9I A;  2OWO A;  4UY8 C;  1YVC A;  1MJE A;  5M3F H;  1N36 Q;  1R9T H;  4GKJ Q;  1N33 Q;  2JA7 H;  4GLV B;  1L1O B;  2DGY A;  3UE0 A;  5IY0 A;  4P75 A;  4JI8 Q;  3K7U C;  1EFW A;  3UDI A;  1EIF A;  2Y0S G;  4A4I A;  4BBS G;  1BVS A;  1L2F A;  4A3G H;  4L5T A;  3GTJ H;  4GNX A;  4BXX H;  1JT8 A;  2C35 B;  4KLK A;  1X56 A;  1NBW A;  1Y1V H;  1XMQ L;  5IP7 H;  1WJJ A;  4LF5 Q;  4LF9 L;  5LMN W;  1E7Z A;  1I94 L;  1FJG Q;  1QVF A;  2K5N A;  3J81 c;  3KF8 B;  1PH7 A;  4JV5 Q;  2F52 A;  4LUV A;  1VQG A;  2K75 A;  5GAE C;  4DNI A;  4DUZ Q;  4DR4 L;  5C44 G;  1CSP A;  4DV1 L;  3KF6 B;  4GN5 A;  1PHJ A;  1QVC A;  5AJ3 L;  2VNU D;  3A5U A;  5LMN L;  1KQS A;  4WJ3 M;  4DR3 L;  4X62 Q;  1A8V A;  1LYL A;  2BH8 A;  4JBM A;  3S17 H;  2NVY H;  4KHP Q;  4ME3 A;  5FJ8 H;  2Q2I A;  5IP9 H;  1XNQ L;  3HOY H;  4EX5 A;  1YEZ A;  4DV5 Q;  4PZ8 A;  4OX9 Q;  1K3R A;  4C3H H;  4QGU A;  3GTP H;  1VQO A;  1XNR Q;  5HGQ A;  2K5H A;  1X3G A;  4QY7 A;  3TEH B;  4EQ5 A;  2I5L X;  3S1M H;  1MJC A;  4YCU A;  4A3E G;  1N8R C;  4LFB L;  1VQH A;  5E7N A;  3M4P A;  4NXN L;  3RNU A;  1M90 C;  1J5E L;  4B3T Q;  2UUA L;  2GVA A;  3HKZ G;  3PUV A;  3PF4 A;  4BA2 I;  1N34 L;  2E2J H;  1SLJ A;  4LF4 L;  3I4N G;  1V43 A;  4R4Q A;  2VUM H;  3LGJ A;  1EOV A;  3D0F A;  3M4Q A;  2HIX A;  4DR5 L;  3UE1 A;  1LTL A;  1WOC A;  4GS3 A;  3J7Z C;  2ES2 A;  4AQY Q;  4LNQ A;  2N49 A;  1KAW A;  4P74 A;  3HFZ B;  3G71 A;  1I3Q H;  4A3J G;  3I7F A;  1U5K A;  1KIX A;  3TRE A;  3ZJY C;  2NN6 I;  3I4O A;  3CXC A;  4UP9 A;  1C7Y A;  4IFD J;  2RF4 A;  4P71 A;  5H1S E;  4DR7 Q;  2D0O A;  3F8T A;  4OWT B;  1PH4 A;  4JI5 Q;  3T1H L;  1SE8 A;  2K50 A;  3IRB A;  4QJF A;  3H3V H;  4QQB X;  1Q82 C;  5FJ8 G;  2OQK A;  4YHH L;  2AMC B;  1AE3 A;  1CKM A;  3F1Z A;  3CCR A;  2I5M X;  2ZTE A;  4L5Q A;  1MKH A;  1Y1W G;  1GKH A;  3UDX A;  2JQO A;  3PUW A;  3CF5 A;  5LMU L;  4B3R Q;  4A93 G;  1EIY B;  3H0G H;  4BA1 I;  1YHA A;  5C3E H;  1KXL A;  4RG1 A;  4J15 A;  4LW1 A;  1VQ8 A;  1E3P A;  1TWF H;  4X64 Q;  3CME A;  5C4X H;  3M7N A;  4GKK L;  4A3C H;  1Q8K A;  4JCV E;  4GNX C;  4JI0 L;  4LF8 L;  2ZJP A;  1A0I A;  3L2P A;  4B3S L;  4DV6 Q;  5EAY A;  4A3D G;  2VQF Q;  3CCU A;  3HOW G;  5IWA L;  3ULJ A;  2VQE Q;  4L5R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...