1J5EL

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1j5eL00
4EQ5A 1HR0Q 4DR2L 4L5TA 1MJCA 4B3RL 1X9NA 4HJ9A 3FKIH 1K73C 3M3YH 1QUQB 1SE8A 3JC66 1HJPA 4DK3C 3DLLA 4B3SL 1EQRA 3PUWA 2RHQB 3AQQA 3D0FA 5HY6A 3U4ZA 1N33Q 4X64L 2UU9L 3M4QA 4GOPB 4KHPL 5C4XH 3HFZB 4X65L 1L1OB 5LMUQ 4JBKA 5IYDH 2NN6I 5LMNQ 4DR4Q 2PNHA 1Q82C 1IZ6A 4LUVA 4WJ4A 2NZOA 1HZAA 4JCVE 4L5QA 1WYDA 1IBMQ 3FHWA 4DV3L 3RN5A 3F2DA 1C9OA 4DV4L 5M3MH 1EUJA 2VZAA 4BY1G 1T9HA 2JA5G 4JI4L 4PZ8A 4JI8Q 5H1SE 4JI7Q 2OWOA 4P71A 4DR5L 2B63H 1IBKL 4DR2Q 1HZBA 4LFAL 4B3RQ 1WFQA 4A3CG 2I0QA 1UE7A 1OXUA 1YNXA 3AFQA 3RLOA 4B3SQ 3H0GG 1A8VA 4BXXH 1VQJA 4JG2A 4R4CA 4RMFA 3EN2A 2IX1A 5FJ8H 4X64Q 1MJEA 1V43A 2KHJA 3BJUA 4JI5L 1XJVA 2UU9Q 2R92G 1J6QA 3CMAA 3S1MH 1WOCA 4KHPQ 2MO1A 5M3FH 1X3GA 1HZCA 3H3VH 3I4MH 2NN6G 2YV5A 2EXDA 4OXPA 2ASBA 1CKNB 4IJLA 4YWLA 1JJCB 1PVOA 1HH2P 3TREA 2ZM6L 4AIMA 1JJ2A 1N32L 4KLKA 3ULPA 2WB1G 2RCNA 4LW1A 5IP7H 4J15A 4A3MG 1KD1C 4JI4Q 1GM5A 2UUCQ 2VUMG 3H15A 4BBRG 4LF5Q 4H02A 4OX9Q 5FLXc 4DR5Q 3GTKH 2I5HA 4LFAQ 3KDFB 1IBKQ 4A3JG 3MXNB 5IY0A 4LFCL 3F8TA 1VQEA 3HOVG 1X3EA 2JA6H 2K52A 4OWTB 4DPGA 4A3IG 1CKOA 2ZTCA 3CCUA 4JI5Q 5AJ3L 4DV5L 4UY8C 4PMWA 2NZHA 1LTLA 1D8LA 3L7ZC 4LF8Q 4DR6Q 4DK6C 3JAMc 4IOCA 3FKIG 4JI6L 4POGA 2ATWA 1N32Q 2N8NA 1W3SA 1I94L 5GAHC 1OXTA 1NJIC 2R93G 5LMNW 2D0OA 1QZHA 1NMFA 2DUDA 1PH1A 4A93H 2A1AA 5C4XG 4NXNL 2IT1A 2K50A 4PZ6A 3KF6A 4A3GH 1XMOL 5K36G 1U0LA 3GTQH 4LFCQ 3ERSX 4FDBA 2HIVA 1N36L 2GVBA 3NELA 2Q2HA 4C3HH 4MTNA 1UE6A 3NENA 3GTPH 4OO1I 2A19A 5AJ3Q 3CF5A 4DV5Q 2QGQA 4O2DA 2UXDL 2BA0A 3U50C 3L0OA 4YHHL 4JOIA 4IPGA 4YY3L 5GROA 1VQCA 3H0GH 4JI6Q 1QUQA 3HOWH 4A3BH 3M7NA 4LFBQ 1I94Q 1L2FA 4BXXG 4DV1Q 3K7UC 3ER0A 3IRBA 1IXRA 5FJ8G 3TS0A 4AQYL 3S14H 2VQFL 3GD7A 3JAMi 1KAWA 1I5FA 3GTJH 4GOPA 3UDGA 5M3FG 1XMOQ 3HOZG 3FP9A 4YCUA 3G4SA 3HKZG 1WI5A 1N36Q 2R6GA 1XPRA 1YHAA 4GKJQ 3PCOB 3PUYA 3KF8B 4JC0A 4A3MH 1PYBA 3HOUH 5IP7G 4QIWE 3M9BA 3PSIA 3HKSA 4JI2L 3UE0A 4OO1G 2QEXA 5FLMG 2UXDQ 5IWAL 3RLFA 1CKMA 4HIKA 2UXCL 2E2HH 4YHHQ 2CQOA 1FGUA 4GOPC 3RN2A 1TWGH 4JI1Q 4YY3Q 1L1OC 4A3EG 3G6EA 4A3DH 3W1BA 4YWKA 4A3IH 3J81j 3PIPA 2JA6G 1K8AC 4R4QA 2MNAA 1N34L 3K7AH 1CUKA 2HQLA 4BA1I 1VQ7A 5GQOA 4UP8A 4AQYQ 3KJPA 1W2BA 1KL9A 1K0RA 4HJ8A 3ULLA 3A5ZB 1JJGA 3EIVA 1AE3A 1PH4A 2MQHA 2D62A 3KLWA 2GN5A 4UP7A 4IPDA 4X62Q 1CKNA 1K3RA 1OXXK 4JYAL 2YTYA 3W5OA 1QZGA 2RHSB 2R93H 3B6YA 5GAGC 2OTJA 4JI2Q 1X54A 4OWXB 2JEBI 1VQFA 3CC7A 1K9MC 2UXCQ 4MZ9A 4A93G 3RZOH 1BVSA 4A3GG 3KDFA 1KRTA 2ZTDA 1VQ4A 2JEAI 4ME3A 1SN8A 2V1CC 1UE1A 3M4PA 1XMQL 3S1QH 4DR7L 4BBSH 4LUOA 3S16H 4O0AA 1BBWA 3T1YQ 2PMZE 1N34Q 3PUZA 1UEBA 1HNWL 1IL2A 4YCVA 3J80c 3HOXH 4DV7L 2CFMA 1QVGA 1VQLA 4IOAA 2H5XA 2GVAA 3NBHB 2VW9A 1M1KC 2FXQA 2VNUD 5M5WH 1J5EL 2R7DA 2CWAA 5ELOA 3CCEA 4DR3L 4LF7L 1KXLA 1SROA 2Z0SA 3AYHB 4JYAQ 3A5UA 1GD7A 1S3OA 4DUZL 1EYGA 3GTLH 3HOWG 4A3BG 1D7QA 4GLXA 1G51A 1RL2A 1JT8A 4X65Q 1KC8C 3LGJA 4DUYL 1S72A 2K5VA 2WP8J 3HOZH 1S40A 1KRSA 1VQBA 2JJQA 3CCQA 2N3SA 1LUZA 2Y0SE 3S24A 1SLJA 4NXML 1XMQQ 4PZ7A 2K75A 5DLQE 4DV0L 4DV3Q 4DV4Q 2I5LX 3J7ZC 4A75A 1VQMA 2WFWA 3HOUG 2OQ0A 5FLMH 1NE3A 3Q8DA 1KQSA 3EBEA 4LNQA 4DV7Q 1AE2A 5EAYA 1Q8KA 3S2DH 4A3EH 4NPSA 1PH6A 3TQYA 1Y1WG 1NMGA 1J5EQ 1CSQA 2K5HA 4DR3Q 5IP9H 4A3DG 3ICEA 3J80i 1VQ9A 3E9HA 4P75A 2C35B 1PHJA 5IYBH 1VQNA 4P74A 4DUYQ 1LYLA 3OW2A 1E1OA 1V1QA 5C0XJ 1KHIA 4NXMQ 1YIJA 3K8AA 2WAQG 4HIMA 4QQBX 2ZM6Q 4DV0Q 4KHZA 2NVXH 4OONA 3K81C 1C0AA 4YCWA 1Q1BA 4IFDJ 2IX0A 3ULJA 1HZ9A 4P73A 4TVAB 3ZJYC 3TEHB 4GS3A 1VQ6A 1O7IA 4QGUA 3KFUA 1PH2A 1BBUA 1I6HH 1MIUA 3G71A 3PGZA 3HOYH 4GLVB 3W1GA 3S2HH 1VS0A 1VCIA 2BH8A 5GADC 3CMEA 2EIFA 1R9TH 2PQAB 1Q46A 2AKWB 1VQOA 4BBSG 2UXBL 3AFPA 2YTXA 4BY7H 1SMXA 2IHFA 2E2IH 3L2PA 1A63A 5IE8A 3HOXG 4JV5L 4APVA 1PH8A 1PH9A 1YHQA 4QJFA 4X6AH 1TXYA 1Q81C 1CSPA 2R7ZH 2HHHL 3PO2H 5C4JH 2L15A 1PFSA 1N9WA 1X55A 1GVPA 2K14A 1Y1VH 1E3PA 4AYBE 2K4KA 1EFWA 1G291 1XNQL 1E22A 1PA6A 2Q2IA 4GLAC 4MNOA 3CCRA 1L1OA 4IJHA 4NXNQ 1HNXL 2PI2E 1Y14B 5C0XI 2KCMA 1YHBA 2JA9A 1YVCA 1NY4A 4UP9A 3TS2A 4BA2I 2UXBQ 3PO3G 4GN4B 1YITA 2OCEA 1OTCA 2Y0SG 1RIPA 2MFIA 5IT9c 3I4NH 2ZJPA 3I4OA 1QVFA 1Y1WH 4JV5Q 4HJAA 2XTIA 1EIFA 1IYJB 1MKHA 3K0XA 4DV6L 4IO9A 2A8VA 3GO5A 4LF6L 1FVIA 2AMCB 3OYYA 4GNXC 1VQ8A 2DGYA 5IP9G 2CCZA 2F4VL 3M4OH 2MO0A 2HHHQ 2WB1E 2AWOA 1HR0L 4JBWA 1XNQQ 2XGTA 3E0EA 2NVTH 1TWAH 2VQFQ 1VQHA 4KI0A 5IYBG 4HIDA 1XPUA 1VQGA 3CQZH 2LXKA 5ELNA 3I56A 1HNXQ 1N33L 3KOJA 3PIOA 4XTCS 1VQDA 3RLNA 5C0XG 4DAMA 4B3TL 2BH2A 1OXSC 4XIGS 1JE5A 2ZTEA 4UPAA 2JE6I 1PV4A 3S17H 4DKAC 4DR4L 1TWHH 4GN5A 2HIXA 2JQOA 2K5NA 5IWAQ 1UE5A 4IFDG 1PYSB 1QVCA 4DAYB 4GNXB 2ZJRA 3U58A 3UDFA 3OTOL 3WWVA 4DV6Q 1Z9FA 1Q7YC 4PG3A 3MEFA 3HOYG 2KHIA 1K83H 2CKZB 2CWPA 2IY5B 1X3FA 1WJJA 1YZ6A 2Z6KC 2QA4A 2I5MX 4BY7G 2HT1A 1GKHA 4X66L 4EX5A 4DNIA 1ASZA 4NB3A 4A3FH 1X56A 1XTDA 3NEMA 1VQAA 3CP0A 4P72A 4QL5A 3A74A 5J3BA 1NTGA 1I50H 1PH5A 4B3TQ 4LF9L 3BU2A 5BR8L 1EIYB 3T1HL 4POFA 2R7ZG 1YEZA 3PO2G 3CCVA 3F2CA 1Y1VG 5C3EH 1VQIA 5GAEC 2B3GA 2N78A 2OTLA 2OQKA 3OTOQ 5JEAJ 1WCMH 5M5XH 1PH3A 3CD6A 4DR7Q 4AYBG 4DV2L 4ALPA 1N8RC 2UUCL 4LF5L 2PQAA 2JA7H 4OX9L 3S1NH 3CXCA 4IPHA 2VQEL 4GN3B 4B3ML 3PV0A 1HNZL 4R4OA 1K8GA 1HNWQ 4X66Q 1P8LA 2LXJA 3K80C 3STBD 1VQ5A 2E2JH 4C3IH 3U4VA 3KJOA 3CCMA 3I4NG 1UWVA 1V9PA 4JI0L 4HJ5A 4QY7A 4LF7Q 3HKZE 4A3KH 3UDIA 5BR8Q 3M85A 4R4IA 4LF9Q 4DUZQ 2KBNA 3T1HQ 1IBLL 4YWMA 2R7FA 2E8GA 3E9IA 4LF8L 3J7A5 4DR6L 4C2MH 3GDEA 1GO3E 2KENA 5HGQA 3BZKA 1JB7A 2VY3A 4LUZA 3VDYA 1YJWA 1M90C 5C44H 2D0PA 4DV2Q 4R4TA 3RR5A 3F2BA 5JJKA 2JA8G 2VQEQ 1B8AA 1P16A 2VS1A 5IYCH 1HNZQ 4B3MQ 1BKBA 2PI2A 1X65A 4A3LH 3D31A 2AWNA 3STBC 1A62A 4JI0Q 2Q2TA 3PO3H 1HR0W 3DM3A 1Z47A 1YJNA 3A0JA 1IBLQ 4IPCA 1Q1EA 1TWCH 3I7FA 1B70B 4GKKL 3CCJA 1LM0A 2EQSA 1FJGL 3CCSA 3CPFA 2UUBL 5JJLA 1I3QH 2IHEA 4HIOA 3CPWA 1TWFH 4JI3L 4A3FG 1B7YB 4LFBL 2N49A 4DV1L 1Q86C 3SGIA 1E1TA 2F3IA 3BZCA 1XPOA 1XNRL 2YYZA 1ASYA 3J81c 1YJ9A 5E7NA 4A4IA 4L5RC 1G6PA 5IYDG 3H3VI 4K0KL 3CCLA 1YBYA 5C3EG 1L0WA 3RZDH 1C7YA 4LF4L 4GNXA 4GKJL 2NVYH 2JA5H 2E5LL 4BY1H 5M3MG 1YI2A 1Q12A 1WCMG 2B29A 5JEAG 4Y7NH 4R1JA 1A0IA 2JA7G 2B63G 4A3CH 1VQPA 3KYHC 3UDXA 2ES2A 2UUAL 4GKKQ 4JI1L 4LWCA 4IFDI 2KCTA 1FJGQ 3PUXA 1AH9A 2BA1A 3CW2C 2UUBQ 2YU9H 2NVQH 3CC4A 4JI3Q 4HJ7A 1EWIA 1X6OA 2ID0A 4JBMA 5JJIA 1SR3A 2F52A 2R92H 4DR1L 1XNRQ 4A3KG 3I55A 4Y52H 1NBWA 1U5KA 4OWWB 1PH7A 3AEVA 2YTVA 4L5SA 4K0KQ 3RNUA 1EQQA 2AHOB 3CAMA 4C3JH 3I4MG 3PUVA 2VL6A 1KIXA 1DGSA 4JOIC 5M5YH 4X62L 2ZJQA 3S15H 4LF4Q 3J81i 1JMCA 3TRZA 2E5LQ 3CC2A 1EOVA 1OXVA 2VUMH 3F1ZA 2Z6KA 4BBRH 3PF4A 4RG1A 5C44G 2JA8H 1E24A 5LMUL 3KF6B 2JK8A 4A76A 5LMNL 4A3JH 2LSSA 2UUAQ 1SRUA 4TQUS 3G48A 3HOVH 5IYCG 3S1RH 1E7ZA 1IBML 3UE1A 3GTGH 3I2ZA 4WJ3M 3T1YL 3PF5A 4A3LG 4JBJA 1FL0A 2Q2UA 1H95A 2ALYB 2WAQE 4AH6A 4DR1Q 1SFOH 4JI8L 1VQKA 4LF6Q 2F4VQ 3GTOH 4JI7L 2RF4A 3GTMH
chains in the Genus database with same CATH superfamily
1ILQA 2A6HD 4EQ5A 4RKBA 1MJCA 5CBAE 3PQIA 2EPBA 1HJPA 2WAQB 3LX0A 3OIQA 3PUWA 4MTKA 3U4ZA 3IKJA 1A15A 3M4QA 1EYDA 2VXWA 4KHPL 3HFZB 3A8JE 2NN6I 4FXGC 3R8BA 1Q82C 3EA6A 3VYTA 1IZ6A 1HXYD 1M8AA 2NZOA 4LUVA 5FOBB 3VA7A 4XQNA 1IBMQ 2WKCA 4BY1G 4JI4L 1D5ZC 1TIID 4PZ8A 3QR8A 2KEEA 4P71A 1IBKL 1HZBA 3HOXB 4N9TA 4A3CG 1V1PA 3H0GG 1HQMC 1VQJA 3DWAA 3HP3A 4DAPA 1V43A 2KHJA 4JI5L 3S1MH 1J6QA 4KK7A 4KHPQ 2MO1A 1LV9A 3SHLA 4C3JG 4IJLA 4YWLA 1PVOA 5ELBA 1N32L 4KLKA 2RCNA 4I7ZC 4JI4Q 1DCZA 2VUMG 4BBRG 5C5LA 4XT1B 1IBKQ 4ZK9B 4J6HA 1PZJD 2PQEA 5IY0A 3OWEB 2K52A 1WTRA 4OWTB 3UI2A 1CKOA 2RKSA 2HUGA 4JI5Q 3H94A 5AJ3L 4DV5L 4UY8C 2EVBA 2XWBB 5C6AA 1SNOA 2J4XA 3A7AB 3JAMc 4IOCA 3FKIG 2XWJB 2Q8RE 1SYDA 1N32Q 4HCEA 1AZPA 3C1FA 5EPLA 1NJIC 2R93G 2NVXB 1JC7A 1MGSA 4A93H 1ONLA 3NTHA 5FO9B 4NXNL 3VYSA 4A3GH 5K36G 3KF6A 4OIKA 4JK1C 3GTQH 1Q8IA 3ERSX 2HIVA 4K5XA 4DNTB 3S2HB 2Q2HA 3BG3A 4C1NK 4U673 2PZUA 3VYRA 4OO1I 2XRSD 5AJ3Q 4DV5Q 4G7OC 3MC0B 4JOIA 2FHTA 1VMPA 4RCOA 3J80E 5GROA 3H0GH 4EQOA 1NSNS 2XN9C 1L2FA 1PMRA 5CYUA 3ER0A 1IXRA 3QWNA 2ZXOA 5C4JB 3TS0A 1S5FD 2VQFL 4GOPA 3UDGA 1I5FA 5KEEA 1KDCA 2AUJD 3R93A 1TU2B 1BXTA 2EE1A 4YCUA 1HUNA 2RVLA 4AYBB 1LTID 4X3UA 3PCOB 3PUYA 4JC0A 5IP7G 1RF2D 2QEXA 1BCPD 4ULLA 2BOSA 3HGBA 4IUQA 2CQOA 3J7YW 1Y1WB 2FINB 3MA2B 3G6EA 4A3EG 2QDLA 2DY7A 2JA6G 4R4QA 1STAA 1PDQA 1E0BA 4BA1I 4FVMA 5C4HA 5BN3A 1KL9A 2NVTB 3I8ZA 2NTSA 3DEOA 3FPUB 3EIVA 2D62A 3CQZB 1CT1D 1CKNA 1QZGA 3J7AV 2R93H 3B6YA 1TR5A 1K9MC 3S17B 1VQFA 5K36H 4RGMA 5FO7B 3KDFA 1KRTA 1SN8A 3BDLA 4DU9A 1LTRD 1PTOH 2B2TC 2OT2A 2KOLA 2I46A 4DV7L 4CDCC 2H5XA 2GVAA 3PMFA 2VW9A 2R7DA 4IUVA 4DR3L 2PMZB 1TS2A 3HRZC 4MHEA 2F0KA 1F2ZA 4A3BG 1GD7A 1S3OA 1EYGA 1WVLA 1G51A 5CV7A 2F0HA 4X65Q 1G91A 1S72A 1S40A 2F0SA 3S24A 1SLJA 2O4XA 2NZ1D 5E3FA 3VR2A 5M5XB 4DV0L 2EYFA 3J7ZC 3FMCA 2JA7B 4X3TA 2OQ0A 2SNSA 3Q8DA 3EBEA 5L37A 4DV7Q 1AE2A 2E2JB 1JWMD 2AQ2B 1EY9A 4KKSA 2Q8TA 4C3IB 4A3EH 5IT9E 3VR5A 4DR3Q 1D5XC 2D5DA 3J80i 1MBYA 1F2MA 4JPBW 3E9HA 1CA6A 1NNXA 1H9SA 3SK6A 1VQNA 4CJ0B 1SXTA 4KJOA 1J9OA 1LYLA 3NBIA 1V1QA 1STBA 5C0XH 3CKIB 2WAQG 3A8IE 2JN4A 4DV0Q 1EIGA 4IURA 3K81C 1C0AA 1KDAA 3KF8A 1Q1BA 4K6DA 4IFDJ 2A69C 1D1IA 2IX0A 3J7AF 2EOTA 4LMQD 3DM1A 3KFUA 1MIUA 3G71A 4GLVB 3FRPB 4B08A 2QILA 2AKWB 2KCNA 2YTXA 1A63A 1GOZA 3HOXG 4JV5L 4FNFA 3D4RA 1YHQA 4QJFA 1TXYA 3T16A 3PIO3 2R7ZH 3PO2H 3Q0AA 1Z7TA 1X55A 4AYBE 1B2TA 1PA6A 4MNOA 3ZYYX 1L1OA 4IJHA 4HR7B 2PI2E 3K0YA 2PPBC 4OEMB 1YVCA 4CDDC 2DNEA 4UP9A 1HHVA 1PRTB 5K5PA 1CA5A 2LS01 2CW0C 1RIPA 3I4NH 4JV5Q 3U9OA 2A8VA 1MKHA 2FJ2A 4LF6L 3K6OA 3OMCA 2Z8LA 2WB1E 1HR0L 1AW7A 4DXGA 3Q23A 1XPUA 3I56A 2IWHA 2O5IC 1EY6A 1VQDA 4NKLA 2BH2A 1OXSC 1I4XA 3P7JA 4PMCA 3N6RA 2KQ3A 2HIXA 1UE5A 1RTNA 4IFDG 5LL6X 3QB3A 1Q7YC 3WWVA 4A3IB 4PG3A 1GUSA 2KECA 1TS5A 2CKZB 1SFOB 1WJJA 3HS0C 5ELCA 2Z6KC 2HT1A 3TZDA 4EX5A 1ASZA 4NB3A 4A3FH 1X56A 4QL5A 3VR3A 1NTGA 1PH5A 3I90A 1ICWA 3BU2A 2K6AA 4NW2A 5C4ZA 5A2QE 2DJFC 4POFA 1YEZA 4OHJA 5T1IA 2LY7A 5EPJA 5C3EH 5EBCA 2NB0A 5GAEC 4L63B 1GUWA 3FVQA 1BF4A 3CD6A 4DR7Q 3MXPA 3LNNA 4AYBG 1WTOA 4DV2L 1N8RC 4LF5L 3D4WA 4OX9L 3S1NH 3MZ5A 3RMHA 1LTTD 4G7ZC 1HNWQ 1P8LA 3STBD 4HAEA 2IPKD 2SEBD 1F9PA 1DD2A 3ERQA 4A3KH 4DXFA 2K33A 4R4IA 1F77A 3S1MB 1FD7D 2E8GA 2F0WA 3SK8A 3GDEA 4G4KA 3BZKA 3K58A 3HKZB 2H4OA 5FK9C 4UHVA 4DV2Q 4R4TA 3F2BA 3QOJA 4MIUA 5IYCH 1BKBA 4IFDH 4A3LH 3R2IA 2F4IA 1JOOA 1Z47A 1YJNA 1IHZA 2H1EA 3I7FA 1B70B 4GKKL 3P1HA 3CCJA 2A6ED 1EY7A 1FJGL 3CPFA 5JJLA 1WTVA 3EQLC 2EZVA 4HIOA 1TWFH 2K32A 2N49A 4DV1L 3SGIA 1E1TA 5CMDA 4UAIA 3Q22A 2YYZA 1ASYA 2F1MA 4A4IA 1G6PA 3D6WA 4A93B 5IYDG 1Q3LA 4E6IA 3ONAB 4A3GB 1EIHA 3GTQB 3RZDH 5IIFA 2CVRA 4LF4L 2JA5H 1II3A 1Q12A 2B29A 2OF1A 4Y7NH 2KVMA 2JA7G 1X32A 1B53A 1VQPA 4GKKQ 4HMIA 4JI1L 4LWCA 4H0LC 1FJGQ 2BA1A 3H0GB 3TBIB 4C3IG 1BBXC 2ID0A 4RKLA 4JBMA 5JJIA 2F0NA 2R92H 4ME5A 1GUGA 2QDBA 1NBWA 3AEVA 2A68C 3I4MG 1MI2A 1SNCA 5M5YH 3S15H 4LF4Q 3J81i 1JMCA 3TRZA 5DNFA 3DWQA 1OXVA 4RG1A 2KUMA 5LMUL 2JK8A 3DMUA 1JWUD 1S5DD 2FMMA 3G48A 3OHXC 1HFGA 3S1RH 3GTGH 3OMGA 2XVSA 5KYLA 4QIWB 3T1YL 3PF5A 4JBJA 3C46A 2ALYB 3DWPA 2F4VQ 3GTOH 2JXMB 4JI7L 1XTCD 3GTMH 1VDZA 5CBEE 1PTOC 5ELEA 3GP7A 4DR2L 4FF3A 4WORA 4B3RL 2PYKA 4HJ9A 3C3LA 1FYCA 2EYLA 1K73C 3M3YH 2CHBD 3H91A 2RHQB 5HY6A 1N33Q 4CKCA 3JAME 4X64L 1GUTA 2UU9L 2R93B 2F0PA 1L1OB 5LMUQ 4JBKA 5IYDH 3X3MA 2C9OA 3MXGA 5CC4A 4DR4Q 2RDHA 4WJ4A 1SYBA 4L5QA 1Z6HA 1WYDA 5I9OA 3URYA 1C9OA 1EUJA 3NK9A 2EXZA 3K5NA 1PTOB 1T9HA 1GHJA 1F9QA 2VB2X 4JI7Q 2RSOA 4DR2Q 4LFAL 1CZWA 4B3RQ 1TKWB 1OXUA 1YNXA 2WIIB 1WD0A 4BXXH 4JG2A 1HA6A 3H09A 4R4CA 4NP5A 5FJ8H 5JJZA 4X64Q 2UU9Q 2F0JA 2MUYA 1EWCA 2QKIC 1LT3D 4K5WA 1X3GA 3I4MH 3IL8A 2EYOA 2EXDA 2ASBA 1TVXA 1JJCB 2K04A 1HH2P 3TSSA 2ZM6L 1JJ2A 4FF1A 3ULPA 1RDPD 3SEBA 4A3MG 1KD1C 5DM73 1GM5A 2Y0SB 3GTKH 4LFAQ 3NPPA 1EEID 4LFCL 3F8TA 4A3EB 4A3IG 4ILWA 2BCOA 4IN3A 5D3DA 2L5TA 2MPMA 3CHBD 1L0YB 2L4NA 2NZHA 4LF8Q 1KNAA 4DK6C 1ZEQX 2E75C 2N8NA 1W3SA 1BOSA 1B9MA 1D6EC 5GAHC 5LMNW 1NMFA 5CV8A 4ZUJA 1KDBA 1U0LA 4IUUA 1LTBD 4LFCQ 5I6YA 4FDBA 2GVBA 3TMEA 1K8MA 4MTNA 2PNRC 1CQVA 3U50C 5G3LF 1ICFB 5IOCA 4B9WA 1RKNA 1VQCA 4Q0FA 1QUQA 1CFMA 3IRBA 2R7ZB 3PO2B 3K5OA 3S14H 3JAMi 1KAWA 2X6LA 2XNAC 1SNPA 3HOZG 1ENAA 3HKZG 4GKJQ 3NP8A 4A3MH 1B3QA 3N52A 1D1KA 3M9BA 4IUTA 4QIWE 5EJWA 1PFNA 3RLFA 2E2HH 3I4NB 2RDGA 3RN2A 3VYUA 1QCBD 3W1BA 4A3IH 3PIPA 1M4VA 1K8AC 3K7AH 1CUKA 2HQLA 1VQ7A 3NWTA 2BDNA 4RGOS 1W2BA 1K0RA 4HJ8A 1ZKOA 1IW7D 1JJGA 1PTOF 1PH4A 4PNYA 3KLWA 4X62Q 4JYAL 2YTYA 4L8JA 3W5OA 5GAGC 3V05A 2OTJA 1X54A 4OWXB 2BE5D 4A93G 3RZOH 3K59A 4A3GG 1SEBD 4BBSH 4O0AA 1UEBA 4CDFC 1IL2A 1QVGA 4IOAA 4H44C 1M1KC 3LWUA 5M5WH 1CHPD 4A3FB 2F3WA 4LF7L 5HURA 4JYAQ 4RHSA 4KJNA 3GTLH 4R9WA 1D7QA 1RL2A 1KC8C 1HQRD 4QMGA 2K5VA 2WP8J 5C3EB 3HOZH 1VQBA 3CCQA 4P2CB 2N3SA 2N55A 2Y0SE 2B2UC 4PMBA 5DLQE 2I5LX 2K5QA 4KY7A 5CV9A 4A75A 1G2TA 2WFWA 2B63B 3S1NB 1NE3A 1KQSA 4LNQA 4CDEC 3I70A 3S2DH 1BNZA 2TMPA 1CSQA 1S5CD 1STEA 2J0TD 1QOHA 5IP9H 4EGVA 1HRJA 1VQ9A 4A3KB 4P75A 1SYFA 1UUPA 5IYBH 4Q5VA 5CV5A 1LT4D 4KN4C 5C0XJ 5C3XA 3ND8A 1EOTA 3K8AA 4HIMA 4YCWA 1KLUD 3V2TA 4FO2A 3QOLA 3TEHB 1B3AA 2R3ZA 1A6XA 4X3KA 1I6HH 3PGZA 3HOYH 5GADC 1R9TH 1VQOA 2Z6BA 4BY7H 1SMXA 3EFXD 1A3UA 2IHFA 3PIP3 3K57A 5EBDA 1RODA 2EYHA 2TSSA 2Z9HA 4APVA 1TWFB 4CHTB 2F0IA 1SE2A 3TP6A 1EFWA 1Y1VH 1E3PA 1E22A 4NXNQ 2GA4B 3RZDB 2KCMA 1YHBA 1W6KA 2JA5B 4DGZA 2F03A 1DJRD 3TS2A 2K5DA 4GN4B 4Y7NB 1YITA 2OCEA 4TRDA 4M8AA 2NWGA 1F9SA 2Y0SG 5E1FA 1EY0A 2MFIA 2XTIA 1IYJB 3V96A 3NBHA 4QUCA 3GO5A 1VQ8A 4DF7A 3M4OH 2R92B 4KN7C 3MXUA 3FPPA 1U9RA 1EQVA 5AFWA 1TWAH 2VQFQ 1VQHA 4KI0A 4HIDA 2M00A 5BN4A 3S15B 5M5YB 1O7YA 3PIOA 2WB1B 1O80A 5C0XG 1SE3A 4DAMA 2BDOA 1JE5A 5M9OA 1ML0D 5IGDA 1HUMA 1QVCA 4DAYB 2ZJRA 3S1RB 3GTGB 5IGGA 2PZWA 2CWPA 1CI3M 5JOBA 1QWYA 2ENBA 3GTOB 1YZ6A 1HTLD 2L12A 4O42A 3GTMB 1IKMA 4S3SA 1L0XB 3M3YB 1XTDA 2SDFA 3NEMA 1JR0D 1A3TA 1VQAA 2V4DA 4P72A 5J3BA 1HCZA 3A74A 5FLXL 4G7HC 1AP0A 1CK1A 4DNRB 4CKEA 1QE6A 5FO8B 1KTKA 2R7ZG 1Y8OB 2DNCA 3PO2G 1S5BD 5COYA 2N78A 2OTLA 2OQKA 4DAVA 4BS9A 5JEAH 2UUCL 2PQAA 5CORA 3G6JB 4FXDA 4R4OA 2LXJA 3R3OA 3U4VA 3KJOA 3I4NG 4K8JA 1SMYD 1UWVA 2J7ZA 2QW7A 1TS3A 1IBLL 1PFMA 3E9IA 4OGQC 3J7A5 4DR6L 1GO3E 3I4MB 4R8IA 2VY3A 1RHPA 2B2YA 1YJWA 3T13A 1Y8PB 5KGUA 1F2LA 1BUVT 3VR6A 2JA8G 2ICIA 2F0OA 3GTKB 1B4OA 1KAAA 4PQXA 4LAAA 3D31A 2AWNA 4KMUC 5IGBA 3X3NA 3TDQA 1XYIA 1IBLQ 2RA4A 1V1PB 1PRTC 2EQSA 3CCSA 1I3QH 4RWSC 4LFBL 4A3FG 1PLFA 2X6GA 1Q86C 2F3IA 1XNRL 1LTSD 5CV6A 5BN5A 3QIAA 5C3EG 1C7YA 4GZYC 4GNXA 1X3PA 4C56C 1HFNA 4RGNA 4R1JA 4ABNA 4FYDA 1A0IA 2B63G 3UDXA 2F0LA 5ELFA 1V1OA 2KCTA 2SNMA 3I3CA 2Z4IA 3TP7A 2HDLA 4DR1L 1XNRQ 1BQQT 4A3KG 2AUKA 3S14B 1U5KA 2NN6H 3RD4A 1CHQD 3WOFA 4L5SA 2AHOB 4OIJA 3T51B 4EVOA 1E2ZA 2VL6A 3OWFA 4JOIC 1KIXA 2WINB 4XXEA 3J80L 3F1ZA 4A3MB 5IGCA 3PF4A 1QG7A 3P20A 2JA8H 1E24A 3KF6B 2WACA 5LMNL 4A3JH 2LSSA 1SRUA 3HOVH 1R4PB 2E2HB 5IYCG 3UE1A 3I2ZA 4WJ3M 4U68A 4A3LG 4TKOB 3HG9A 2Q2UA 1H95A 4AH6A 4LF6Q 1W6JA 4DR1Q 4JI8L 4KD4A 1OO9B 1G8ZD 3K7AB 2SOBA 2D9UA 1U4LA 1HR0Q 4O1NA 1B44D 1SE8A 4B3SL 3DLLA 2L55A 3BZDB 3AQQA 3D0FA 4CGYB 4GOPB 4G57A 5C4XH 1Q90A 5LMNQ 2PNHA 4CJ2C 3RZOB 1J8IA 2IJ0A 1HZAA 1NAPA 4DV3L 1CTMA 4DV4L 4ZKCB 3ND9A 1A2UA 4BBSB 3KLSA 2JA5G 2G9DA 4JI8Q 1JOQA 1LLRD 2OWOA 2B63H 4DR5L 3C1EA 4QUFA 2A6HC 2KA7A 5C3WA 3DUZA 3RLOA 1WTHA 5M5WB 2B2VA 4K6LA 4B3SQ 4RMFA 3EN2A 4ZRZA 1MJEA 1XJVA 3BJUA 1Y69U 3GTLB 2R92G 3CMAA 2PO4A 5M3FH 3H3VH 4M1UB 3HOZB 1ET6A 4OXPA 2EY6A 1CKNB 4ODGA 3I73A 4XQJA 1SE4A 2WB1G 4J15A 4DK1A 4OO1H 3AMUA 3E6ZX 1E2VA 5FKAC 2K7VA 4LF5Q 4H02A 4OX9Q 2E74C 4DR5Q 4HEDA 5JVG3 3KDFB 2NTTA 2PCFB 2MHVA 3S2DB 1VQEA 1X3EA 4DPGA 2ZTCA 1MHWC 4EQPA 4EQNA 5EKKA 4PMWA 5I2XA 1LTLA 1D8LA 3L7ZC 1G6ZA 1BO0A 4JI6L 4UDUC 1PRTF 2QF7A 3BYYB 2ATWA 5ELDA 1OXTA 5IT9L 5CR3A 1WTPA 3T4AC 1PH1A 2A1AA 2DN8A 2IT1A 4PZ6A 2X69A 1XMOL 2R61A 2F0DA 3M4YA 2A74C 1I6HB 3HOYB 1N36L 2A73B 1R9TB 1TQOA 2A19A 3VR4A 3CF5A 4BY7B 2QGQA 2BA0A 1FGBD 3L0OA 3P75A 5EKIA 2F0TA 4WFN3 4H13C 4JI6Q 3HOWH 3M7NA 4YIJA 4BXXG 4DV1Q 3K7UC 5FJ8G 1H9SB 2PW5A 4AQYL 2JSOA 1Y1VB 1FNWA 1S4ZA 2RSNA 1XMOQ 3DHQA 3FP9A 2Q8IB 3MWYW 5EQ0A 2B39A 1WI5A 1N36Q 2R6GA 1MSGA 4IUPA 3KF8B 3HOUH 4ZAIA 3PSIA 4JI2L 2KCCA 1JICA 1PXUA 5IWAL 2UXCL 4WJWA 1NCVA 4HTHA 1FGUA 2G5DA 1TWGH 4JI1Q 1L1OC 4A3DH 1YNJC 4ZUIA 3J81j 4RFBA 1XWEA 3M4OB 5GQOA 4UP8A 4AQYQ 3KJPA 3QG1A 2L9HA 1TWAB 2EJGC 3ULLA 2GN5A 4UP7A 4IPDA 2F0QA 1SJED 1OXXK 5A35A 1GJXA 1ZYRC 2RHSB 1T5EA 4JI2Q 3CC7A 2UXCQ 4MZ9A 1EWHA 1BVSA 3D8GA 1BCPC 2ZTDA 4ME3A 3ITPA 2V1CC 3I72A 5J22A 3S1QH 3S16H 3T1YQ 3NTIA 3PUZA 4DFAA 3AU7A 2ZXPA 4YCVA 3S9WA 4RHRA 3EROA 3F2UA 5ELOA 3NSWA 1QJOA 1SROA 2Z0SA 3AYHB 3A5UA 4DUZL 1VF7A 1JT8A 1BCPB 3LGJA 3AB9A 5DM63 1KRSA 1LABA 2JJQA 4ID6A 4NXML 3CRKC 2RQXA 4F7XA 1EY5A 1FNUA 4PZ7A 4B9XA 2LFNA 3HEJA 1O7ZA 2A69D 1RD9D 1HA5A 5J39A 3KK7A 2JYOA 5EAYA 2L0CA 4NPSA 1PH6A 1NMGA 3J81L 4F8MA 2K5HA 1ZXTA 1I4PA 2CH4W 1DXMA 1U4RA 4XDXA 1PFBA 1EU3A 1PRTD 2C35B 5EGTA 4P74A 5LL6S 4WRDA 1E1OA 4NXMQ 2ZM6Q 4KHZA 3D6CA 1MSHA 4J1MA 1HZ9A 3TP8A 4GS3A 1O7IA 4QGUA 1PH2A 1BBUA 5J1ZA 5KNCA 1VS0A 2BH8A 2EIFA 1Q46A 4BBSG 4HCSA 3IAYA 5I6WA 2CW0D 2LKVA 2E2IH 3L2PA 1B9NA 3SDZA 3BVZA 1I3QB 4X3SA 1Q81C 1CSPA 2HHHL 5JVH3 2L15A 1PFSA 1DOLA 1GVPA 1XNQL 1G291 1SYEA 1ENFA 4GLAC 3CCRA 1GUOA 1KLGD 5C0XI 2JA9A 1SNDA 3KUPA 1NY4A 4BA2I 1IYVA 5C5MA 1STGA 3G7LA 2ZJPA 1QVFA 4HJAA 3K0XA 4DV6L 1G2SA 3OIPA 3OYYA 1LO5D 4XYOA 5IP9G 2CCZA 2HHHQ 3L3OC 2AWOA 1STHA 1XNQQ 3E0EA 3IFTA 1V8QA 5IYBG 1NUCA 1PZKD 1QB5D 1VQGA 3NHHA 3KOJA 2B2TA 4ZLTF 3SVMA 1SNMA 4XIGS 4IQZA 2K05A 3NTKA 4UPAA 3NQIA 3SK4A 2JA8B 1TWHH 4CKBA 4A3JB 3OPOA 2JQOA 2K5NA 1E2WA 1FR3A 3HOVB 2RDFA 1B1ZA 1SAPA 3UDFA 3OTOL 4DV6Q 1Z9FA 3MXNA 1BCPF 3HOYG 2KHIA 1K83H 2IY5B 4BY7G 4N8X1 3D4DA 3NUCA 4JW0A 2O5JC 1I50H 1EY8A 1HPCA 2MP1A 5C4XB 2EJMA 1Y1VG 1MD2D 1VQIA 1IL8A 3OTOQ 1DM0B 3H3VC 5JEAJ 1K28A 1WCMH 4ALPA 2RBMA 3JAML 3A54A 3CXCA 2VQEL 5IODA 4B3ML 1K8GA 2B2WC 1VQ5A 4L6TB 3CCMA 1UEAB 2IW3A 1TY2A 2L1BA 4HJ5A 4LF7Q 1NR4A 3M85A 2KBNA 4YWMA 2R7FA 5M3FB 1U4PA 2F0FA 1EY4A 4C2MH 1TY0A 5HGQA 1JB7A 3VDYA 4OL7A 3D3RA 2EYMA 2K01A 3SXHA 5C44H 2D0PA 4RH6A 2G9HD 4KTAA 2EY5A 3DXJC 3QJYA 2VQEQ 4KHVA 1P16A 2I07B 2VS1A 4B3MQ 4HN7A 1H9KA 5IGEA 3STBC 2Q2TA 3PO3H 1I6VC 5G3LD 3GQBA 2P5ZX 2PZTA 2HDMA 4IPCA 1Q1EA 2PW7A 1TWCH 1KABA 4KV6A 1I4GA 1LM0A 3KLSX 3OOCA 2EJFC 4LK1C 2UUBL 1X3QA 3I91A 1DONA 3CPWA 4JI3L 1B7YB 1EEFD 3BVGA 3BZCA 1XPOA 2HQEA 3MEHA 1YJ9A 5E7NA 2A68D 3IFDA 3H3VI 3CCLA 1YBYA 1L0WA 3A7LA 2K03A 2NVYH 4BY1H 1C48A 1CZGA 5M3MG 1YI2A 1JCKB 2OXPA 5JEAG 5KYIA 3I4LA 1C4QA 4A3CH 2ES2A 1YNJD 4IFDI 1AH9A 3PUXA 3RUZA 2A6EC 2UUBQ 2YU9H 3EJIA 2NVQH 1A2TA 4JI3Q 4ZCKA 3HOWB 1X6OA 2K28A 2F52A 4HSPA 1PTOD 1EU4A 3I55A 4Y52H 2HD3A 1PH7A 1C8CA 2YTVA 4K5VA 3RNUA 1EL0A 4KD3A 4C3JH 3PUVA 4QCLA 2ZJQA 1T5XD 3NQTA 1JE4A 1ZYRD 3CC2A 2VUMH 4BBRH 2Z6KA 3HOUB 1GXDC 3TP5A 4IUNA 1DOKA 3KBGA 4TQUS 3QO2A 3NWSA 1TWGB 4A3DB 3MHBA 1QNUA 1S5ED 4IALA 2WAQE 4FF2A 3HZXA 5KIXA 2FMCA 4L5TA 3Q6SA 1X9NA 2NYZD 3FKIH 1QUQB 3JC66 4DK3C 1EQRA 4C1NI 2QEJC 4X65L 1GUNA 2N88A 1EYCA 4JCVE 3FHWA 3S1QB 3RN5A 3F2DA 1GHKA 5M3MH 2VZAA 3S16B 4C3HG 3NE5B 5H1SE 4K14A 2RCFA 1WFQA 2I0QA 1UE7A 3AFQA 2AQ3B 1A8VA 1BDOA 2IX1A 4OELB 1SDFA 1WOCA 1LTAD 1HZCA 2NN6G 2YV5A 2E2DC 3TREA 4AIMA 4DN4M 5NUCA 5T1GA 4LW1A 5IP7H 1F9RA 5CV4A 3VA5A 1AN8A 4KY6A 2UUCQ 3H15A 5FLXc 2I5HA 1HTPA 4A3JG 3MXNB 3HOVG 2JA6H 1IKLA 3SR1A 3CCUA 3MTSA 1WTWA 1TS4A 2HCIA 1AZQA 4DR6Q 5DAUA 2L11A 4FP5D 1Y8NB 4XT3B 2Z1CA 4POGA 1I94L 1I4QA 2K5WA 2D0OA 2E76C 1QZHA 2DUDA 4Z9CB 3BVMA 1SNQA 5C4XG 2K50A 3E0JA 3NELA 1CM9A 1I4HA 4C3HH 1PZID 1UE6A 3NENA 3GTPH 1O7LA 3TN2A 4O2DA 2UXDL 2E2IB 2DY8A 4YHHL 4IPGA 4YY3L 4A3BH 2M2LA 4LFBQ 1I94Q 3OSOA 5I2YA 2QCPX 4XYQA 3GD7A 2HCCA 3GTJH 5M3FG 1LACA 1D2BA 1NR2A 3G4SA 3T56B 1XPRA 1YHAA 5KNDA 3GV3A 1PYBA 4I7AA 3BS1A 4H7BA 3HKSA 4OO1G 3UE0A 1YNNC 5FLMG 2UXDQ 4HIKA 1CKMA 1KNEA 1UNSA 4YHHQ 4GOPC 1SSOA 4MN3A 4YY3Q 3A55A 4YWKA 5D3IB 1RCVD 3FEWX 2MNAA 1N34L 4F87A 4K2KA 2KEDA 2Z4HA 3A5ZB 1AE3A 2MQHA 1K3RA 2JEBI 4K2LA 1TWHB 4BWGB 2EY2A 3K5LA 1VQ4A 2JEAI 3M4PA 1UE1A 2K1BA 1XMQL 4DR7L 4LUOA 1BBWA 1EZ8A 1K83B 2PMZE 2A5HA 2F3VA 1N34Q 1VF5C 1WTXA 4CJ1B 1HNWL 4RAUC 3HOXH 3J80c 2CFMA 1VQLA 3NBHB 2VNUD 2FXQA 1J5EL 1IW7C 2CWAA 3SE0A 3CCEA 1KXLA 1I50B 3HOWG 1QNKA 4CBVA 4GLXA 2CQAA 3J81E 1F2YA 4DUYL 3M7GA 2BE5C 1LUZA 1UAPA 5JAVA 4N9PA 1SBBB 1XMQQ 2K75A 1WCMB 4DV3Q 4DV4Q 5E4XA 3FDTA 1VQMA 3HOUG 5EKLA 5FLMH 1EQTA 1PYWD 5CGKA 1Q8KA 2CH4A 3TQYA 1Y1WG 1J5EQ 5DEHA 5KRUA 4A3DG 3ICEA 3NXWA 1WTQA 1PHJA 1RTOA 1QILA 4DUYQ 4C2MB 3OW2A 1KHIA 1FNVA 1YIJA 4FF4A 2KJXA 3MAQA 4QQBX 2NVXH 4OONA 5C44B 4NDXA 1AEXA 4LJZC 3OW7A 5E4WC 3MFGA 1ESFA 4P73A 4TVAB 3ULJA 3ZJYC 1VQ6A 2JP1A 1DOMA 1H9MA 2B2YC 3W1GA 2ZXRA 3S2HH 1VCIA 1DYQA 3CMEA 3C2PA 3PO3B 3A8KE 2PQAB 2UXBL 3BDCA 3AFPA 1JOKA 2FFKB 1A3VA 1TWCB 1STYA 5IE8A 4DK0A 1ILPA 2EYJA 1PH8A 1PH9A 4X6AH 3WDNA 3BYTB 2EDGA 4JVZA 3SK5A 2MJ8A 1LTGD 5C4JH 1N9WA 2EYPA 3R2TA 2K14A 5IGFA 2K4KA 3EVQA 2F0EA 2Q2IA 1SJHD 1HNXL 1D5MC 1Y14B 1I4RA 3T53B 2NVYB 5HGTA 4HMJA 4BY1B 3A56A 2UXBQ 4TSSA 3DEPA 1AFPA 1OTCA 2IX3A 5IT9c 3I4OA 1Y1WH 4RGTA 1EIFA 1JORA 4IO9A 2YU9B 4KY5A 2NVQB 1FVIA 2AMCB 3WOEA 4GNXC 2F4VL 2DGYA 2MO0A 1DZ1A 4ZQ3A 4KKUA 4JBWA 5TSSA 2XGTA 2NVTH 1K3BC 4XQQA 4V0BA 4C3JB 1HNXQ 3CQZH 2LXKA 2KHSA 3H6MA 5ELNA 1N33L 4XTCS 3RLNA 4B3TL 4ZYSA 1EYAA 2VUMB 1CQFA 4BBRB 2ZTEA 2JE6I 1PV4A 3S17H 1XX8A 4DKAC 4DR4L 4GN5A 5D65A 5KNBA 5IWAQ 1PYSB 1JB3A 4GNXB 3U58A 1LT6D 2D2CC 3MEFA 1X3FA 3GV6A 2QA4A 2F0GA 2I5MX 1GKHA 4X66L 2ICEC 2XIWA 2XSCA 4DNIA 3LWEA 3FKIB 2B2UA 3CP0A 2IL8A 3BDOA 3O13A 4B3TQ 4LF9L 5BR8L 1EIYB 3T1HL 2B2WA 3CCVA 4QB4A 3F2CA 1H9JA 2VB3X 4NMZA 2B3GA 1EFID 1XXGA 2NBFA 4ZKBB 4F88A 5M5XH 1PH3A 5JPNC 5M3MB 1B50A 2AQ1B 5F2DA 2JA7H 4IPHA 3MFYA 3CRLC 4GN3B 3PV0A 1HNZL 3W3AA 4R8NA 4X66Q 3W2DA 3KBXA 2WKDA 3K80C 5A2QL 2E2JH 4C3IH 1RJTA 2B8GA 1V9PA 4JI0L 4QY7A 3TZUA 3HKZE 5ISRA 1WD1A 4LF9Q 3UDIA 3CU7A 5BR8Q 1SYCA 2WV6D 1H9RA 5D14A 4DUZQ 3T1HQ 1JQYD 3K5MA 4LF8L 1VMCA 2KENA 3U9SA 4LUZA 2C5CA 4DA2A 5LHY1 2B2VC 1JWSD 1M90C 4QF4A 2LMCB 1TT2A 3RR5A 5JJKA 1B8AA 1HNZQ 1ENCA 2PI2A 4KKTA 1X65A 5I4DA 1A62A 4JI0Q 2JA6B 1SMYC 2EY1A 1HR0W 3DM3A 4I65A 1K8OA 2DJGC 3A0JA 1R4QB 1SYGA 2F0VA 2B8FA 4RCNA 2ZT9C 4RA8A 2IHEA 4V190 3KLRA 1BR9A 3J81c 4IZ8A 4L5RC 4K0KL 3E5SA 2F0UA 4DAYA 4GKJL 4J8QA 2E5LL 4PV1C 2OEOA 4C3HB 1YNND 1WCMG 3GTPB 1EZ6A 1ESRA 3KYHC 2UUAL 1K0SA 2NUCA 1U4MA 3CW2C 3CC4A 2O2LD 4HJ7A 1EWIA 4A3BB 1SR3A 3L9AX 1STNA 2XRQD 4OWWB 3MVVA 3GTJB 4K0KQ 1EQQA 3CAMA 3Q24A 1O78A 1DGSA 5EPKA 2M9VA 4X62L 1IYUA 2E5LQ 5JPMC 1EOVA 5C44G 2MGSA 4N8FA 4A76A 4FXKC 1ET9A 2UUAQ 5FLXE 1E7ZA 1IBML 2F0MA 4K8IA 1FL0A 1LT5D 1SFOH 1VQKA 3E3XA 4HSVA 5I9PA 3PO3G 2RF4A
chains in the Genus database with same CATH topology
4EQ5A 1HR0Q 4DR2L 4L5TA 1MJCA 4B3RL 1X9NA 4HJ9A 3FKIH 1K73C 3M3YH 1QUQB 1SE8A 3JC66 1HJPA 4DK3C 3DLLA 4B3SL 1EQRA 3PUWA 2RHQB 3AQQA 3D0FA 5HY6A 3U4ZA 1N33Q 4X64L 2UU9L 3M4QA 4GOPB 4KHPL 5C4XH 3HFZB 4X65L 1L1OB 5LMUQ 4JBKA 5IYDH 2NN6I 5LMNQ 4DR4Q 2PNHA 1Q82C 1IZ6A 4LUVA 4WJ4A 2NZOA 1HZAA 4JCVE 4L5QA 1WYDA 1IBMQ 3FHWA 4DV3L 3RN5A 3F2DA 1C9OA 4DV4L 5M3MH 1EUJA 2VZAA 4BY1G 1T9HA 2JA5G 4JI4L 4PZ8A 4JI8Q 5H1SE 4JI7Q 2OWOA 4P71A 4DR5L 2B63H 1IBKL 4DR2Q 1HZBA 4LFAL 4B3RQ 1WFQA 4A3CG 2I0QA 1UE7A 1OXUA 1YNXA 3AFQA 3RLOA 4B3SQ 3H0GG 1A8VA 4BXXH 1VQJA 4JG2A 4R4CA 4RMFA 3EN2A 2IX1A 5FJ8H 4X64Q 1MJEA 1V43A 2KHJA 3BJUA 4JI5L 1XJVA 2UU9Q 2R92G 1J6QA 3CMAA 3S1MH 1WOCA 4KHPQ 2MO1A 5M3FH 1X3GA 1HZCA 3H3VH 3I4MH 2NN6G 2YV5A 2EXDA 4OXPA 2ASBA 1CKNB 4IJLA 4YWLA 1JJCB 1PVOA 1HH2P 3TREA 2ZM6L 4AIMA 1JJ2A 1N32L 4KLKA 3ULPA 2WB1G 2RCNA 4LW1A 5IP7H 4J15A 4A3MG 1KD1C 4JI4Q 1GM5A 2UUCQ 2VUMG 3H15A 4BBRG 4LF5Q 4H02A 4OX9Q 5FLXc 4DR5Q 3GTKH 2I5HA 4LFAQ 3KDFB 1IBKQ 4A3JG 3MXNB 5IY0A 4LFCL 3F8TA 1VQEA 3HOVG 1X3EA 2JA6H 2K52A 4OWTB 4DPGA 4A3IG 1CKOA 2ZTCA 3CCUA 4JI5Q 5AJ3L 4DV5L 4UY8C 4PMWA 2NZHA 1LTLA 1D8LA 3L7ZC 4LF8Q 4DR6Q 4DK6C 3JAMc 4IOCA 3FKIG 4JI6L 4POGA 2ATWA 1N32Q 2N8NA 1W3SA 1I94L 5GAHC 1OXTA 1NJIC 2R93G 5LMNW 2D0OA 1QZHA 1NMFA 2DUDA 1PH1A 4A93H 2A1AA 5C4XG 4NXNL 2IT1A 2K50A 4PZ6A 3KF6A 4A3GH 1XMOL 5K36G 1U0LA 3GTQH 4LFCQ 3ERSX 4FDBA 2HIVA 1N36L 2GVBA 3NELA 2Q2HA 4C3HH 4MTNA 1UE6A 3NENA 3GTPH 4OO1I 2A19A 5AJ3Q 3CF5A 4DV5Q 2QGQA 4O2DA 2UXDL 2BA0A 3U50C 3L0OA 4YHHL 4JOIA 4IPGA 4YY3L 5GROA 1VQCA 3H0GH 4JI6Q 1QUQA 3HOWH 4A3BH 3M7NA 4LFBQ 1I94Q 1L2FA 4BXXG 4DV1Q 3K7UC 3ER0A 3IRBA 1IXRA 5FJ8G 3TS0A 4AQYL 3S14H 2VQFL 3GD7A 3JAMi 1KAWA 1I5FA 3GTJH 4GOPA 3UDGA 5M3FG 1XMOQ 3HOZG 3FP9A 4YCUA 3G4SA 3HKZG 1WI5A 1N36Q 2R6GA 1XPRA 1YHAA 4GKJQ 3PCOB 3PUYA 3KF8B 4JC0A 4A3MH 1PYBA 3HOUH 5IP7G 4QIWE 3M9BA 3PSIA 3HKSA 4JI2L 3UE0A 4OO1G 2QEXA 5FLMG 2UXDQ 5IWAL 3RLFA 1CKMA 4HIKA 2UXCL 2E2HH 4YHHQ 2CQOA 1FGUA 4GOPC 3RN2A 1TWGH 4JI1Q 4YY3Q 1L1OC 4A3EG 3G6EA 4A3DH 3W1BA 4YWKA 4A3IH 3J81j 3PIPA 2JA6G 1K8AC 4R4QA 2MNAA 1N34L 3K7AH 1CUKA 2HQLA 4BA1I 1VQ7A 5GQOA 4UP8A 4AQYQ 3KJPA 1W2BA 1KL9A 1K0RA 4HJ8A 3ULLA 3A5ZB 1JJGA 3EIVA 1AE3A 1PH4A 2MQHA 2D62A 3KLWA 2GN5A 4UP7A 4IPDA 4X62Q 1CKNA 1K3RA 1OXXK 4JYAL 2YTYA 3W5OA 1QZGA 2RHSB 2R93H 3B6YA 5GAGC 2OTJA 4JI2Q 1X54A 4OWXB 2JEBI 1VQFA 3CC7A 1K9MC 2UXCQ 4MZ9A 4A93G 3RZOH 1BVSA 4A3GG 3KDFA 1KRTA 2ZTDA 1VQ4A 2JEAI 4ME3A 1SN8A 2V1CC 1UE1A 3M4PA 1XMQL 3S1QH 4DR7L 4BBSH 4LUOA 3S16H 4O0AA 1BBWA 3T1YQ 2PMZE 1N34Q 3PUZA 1UEBA 1HNWL 1IL2A 4YCVA 3J80c 3HOXH 4DV7L 2CFMA 1QVGA 1VQLA 4IOAA 2H5XA 2GVAA 3NBHB 2VW9A 1M1KC 2FXQA 2VNUD 5M5WH 1J5EL 2R7DA 2CWAA 5ELOA 3CCEA 4DR3L 4LF7L 1KXLA 1SROA 2Z0SA 3AYHB 4JYAQ 3A5UA 1GD7A 1S3OA 4DUZL 1EYGA 3GTLH 3HOWG 4A3BG 1D7QA 4GLXA 1G51A 1RL2A 1JT8A 4X65Q 1KC8C 3LGJA 4DUYL 1S72A 2K5VA 2WP8J 3HOZH 1S40A 1KRSA 1VQBA 2JJQA 3CCQA 2N3SA 1LUZA 2Y0SE 3S24A 1SLJA 4NXML 1XMQQ 4PZ7A 2K75A 5DLQE 4DV0L 4DV3Q 4DV4Q 2I5LX 3J7ZC 4A75A 1VQMA 2WFWA 3HOUG 2OQ0A 5FLMH 1NE3A 3Q8DA 1KQSA 3EBEA 4LNQA 4DV7Q 1AE2A 5EAYA 1Q8KA 3S2DH 4A3EH 4NPSA 1PH6A 3TQYA 1Y1WG 1NMGA 1J5EQ 1CSQA 2K5HA 4DR3Q 5IP9H 4A3DG 3ICEA 3J80i 1VQ9A 3E9HA 4P75A 2C35B 1PHJA 5IYBH 1VQNA 4P74A 4DUYQ 1LYLA 3OW2A 1E1OA 1V1QA 5C0XJ 1KHIA 4NXMQ 1YIJA 3K8AA 2WAQG 4HIMA 4QQBX 2ZM6Q 4DV0Q 4KHZA 2NVXH 4OONA 3K81C 1C0AA 4YCWA 1Q1BA 4IFDJ 2IX0A 3ULJA 1HZ9A 4P73A 4TVAB 3ZJYC 3TEHB 4GS3A 1VQ6A 1O7IA 4QGUA 3KFUA 1PH2A 1BBUA 1I6HH 1MIUA 3G71A 3PGZA 3HOYH 4GLVB 3W1GA 3S2HH 1VS0A 1VCIA 2BH8A 5GADC 3CMEA 2EIFA 1R9TH 2PQAB 1Q46A 2AKWB 1VQOA 4BBSG 2UXBL 3AFPA 2YTXA 4BY7H 1SMXA 2IHFA 2E2IH 3L2PA 1A63A 5IE8A 3HOXG 4JV5L 4APVA 1PH8A 1PH9A 1YHQA 4QJFA 4X6AH 1TXYA 1Q81C 1CSPA 2R7ZH 2HHHL 3PO2H 5C4JH 2L15A 1PFSA 1N9WA 1X55A 1GVPA 2K14A 1Y1VH 1E3PA 4AYBE 2K4KA 1EFWA 1G291 1XNQL 1E22A 1PA6A 2Q2IA 4GLAC 4MNOA 3CCRA 1L1OA 4IJHA 4NXNQ 1HNXL 2PI2E 1Y14B 5C0XI 2KCMA 1YHBA 2JA9A 1YVCA 1NY4A 4UP9A 3TS2A 4BA2I 2UXBQ 3PO3G 4GN4B 1YITA 2OCEA 1OTCA 2Y0SG 1RIPA 2MFIA 5IT9c 3I4NH 2ZJPA 3I4OA 1QVFA 1Y1WH 4JV5Q 4HJAA 2XTIA 1EIFA 1IYJB 1MKHA 3K0XA 4DV6L 4IO9A 2A8VA 3GO5A 4LF6L 1FVIA 2AMCB 3OYYA 4GNXC 1VQ8A 2DGYA 5IP9G 2CCZA 2F4VL 3M4OH 2MO0A 2HHHQ 2WB1E 2AWOA 1HR0L 4JBWA 1XNQQ 2XGTA 3E0EA 2NVTH 1TWAH 2VQFQ 1VQHA 4KI0A 5IYBG 4HIDA 1XPUA 1VQGA 3CQZH 2LXKA 5ELNA 3I56A 1HNXQ 1N33L 3KOJA 3PIOA 4XTCS 1VQDA 3RLNA 5C0XG 4DAMA 4B3TL 2BH2A 1OXSC 4XIGS 1JE5A 2ZTEA 4UPAA 2JE6I 1PV4A 3S17H 4DKAC 4DR4L 1TWHH 4GN5A 2HIXA 2JQOA 2K5NA 5IWAQ 1UE5A 4IFDG 1PYSB 1QVCA 4DAYB 4GNXB 2ZJRA 3U58A 3UDFA 3OTOL 3WWVA 4DV6Q 1Z9FA 1Q7YC 4PG3A 3MEFA 3HOYG 2KHIA 1K83H 2CKZB 2CWPA 2IY5B 1X3FA 1WJJA 1YZ6A 2Z6KC 2QA4A 2I5MX 4BY7G 2HT1A 1GKHA 4X66L 4EX5A 4DNIA 1ASZA 4NB3A 4A3FH 1X56A 1XTDA 3NEMA 1VQAA 3CP0A 4P72A 4QL5A 3A74A 5J3BA 1NTGA 1I50H 1PH5A 4B3TQ 4LF9L 3BU2A 5BR8L 1EIYB 3T1HL 4POFA 2R7ZG 1YEZA 3PO2G 3CCVA 3F2CA 1Y1VG 5C3EH 1VQIA 5GAEC 2B3GA 2N78A 2OTLA 2OQKA 3OTOQ 5JEAJ 1WCMH 5M5XH 1PH3A 3CD6A 4DR7Q 4AYBG 4DV2L 4ALPA 1N8RC 2UUCL 4LF5L 2PQAA 2JA7H 4OX9L 3S1NH 3CXCA 4IPHA 2VQEL 4GN3B 4B3ML 3PV0A 1HNZL 4R4OA 1K8GA 1HNWQ 4X66Q 1P8LA 2LXJA 3K80C 3STBD 1VQ5A 2E2JH 4C3IH 3U4VA 3KJOA 3CCMA 3I4NG 1UWVA 1V9PA 4JI0L 4HJ5A 4QY7A 4LF7Q 3HKZE 4A3KH 3UDIA 5BR8Q 3M85A 4R4IA 4LF9Q 4DUZQ 2KBNA 3T1HQ 1IBLL 4YWMA 2R7FA 2E8GA 3E9IA 4LF8L 3J7A5 4DR6L 4C2MH 3GDEA 1GO3E 2KENA 5HGQA 3BZKA 1JB7A 2VY3A 4LUZA 3VDYA 1YJWA 1M90C 5C44H 2D0PA 4DV2Q 4R4TA 3RR5A 3F2BA 5JJKA 2JA8G 2VQEQ 1B8AA 1P16A 2VS1A 5IYCH 1HNZQ 4B3MQ 1BKBA 2PI2A 1X65A 4A3LH 3D31A 2AWNA 3STBC 1A62A 4JI0Q 2Q2TA 3PO3H 1HR0W 3DM3A 1Z47A 1YJNA 3A0JA 1IBLQ 4IPCA 1Q1EA 1TWCH 3I7FA 1B70B 4GKKL 3CCJA 1LM0A 2EQSA 1FJGL 3CCSA 3CPFA 2UUBL 5JJLA 1I3QH 2IHEA 4HIOA 3CPWA 1TWFH 4JI3L 4A3FG 1B7YB 4LFBL 2N49A 4DV1L 1Q86C 3SGIA 1E1TA 2F3IA 3BZCA 1XPOA 1XNRL 2YYZA 1ASYA 3J81c 1YJ9A 5E7NA 4A4IA 4L5RC 1G6PA 5IYDG 3H3VI 4K0KL 3CCLA 1YBYA 5C3EG 1L0WA 3RZDH 1C7YA 4LF4L 4GNXA 4GKJL 2NVYH 2JA5H 2E5LL 4BY1H 5M3MG 1YI2A 1Q12A 1WCMG 2B29A 5JEAG 4Y7NH 4R1JA 1A0IA 2JA7G 2B63G 4A3CH 1VQPA 3KYHC 3UDXA 2ES2A 2UUAL 4GKKQ 4JI1L 4LWCA 4IFDI 2KCTA 1FJGQ 3PUXA 1AH9A 2BA1A 3CW2C 2UUBQ 2YU9H 2NVQH 3CC4A 4JI3Q 4HJ7A 1EWIA 1X6OA 2ID0A 4JBMA 5JJIA 1SR3A 2F52A 2R92H 4DR1L 1XNRQ 4A3KG 3I55A 4Y52H 1NBWA 1U5KA 4OWWB 1PH7A 3AEVA 2YTVA 4L5SA 4K0KQ 3RNUA 1EQQA 2AHOB 3CAMA 4C3JH 3I4MG 3PUVA 2VL6A 1KIXA 1DGSA 4JOIC 5M5YH 4X62L 2ZJQA 3S15H 4LF4Q 3J81i 1JMCA 3TRZA 2E5LQ 3CC2A 1EOVA 1OXVA 2VUMH 3F1ZA 2Z6KA 4BBRH 3PF4A 4RG1A 5C44G 2JA8H 1E24A 5LMUL 3KF6B 2JK8A 4A76A 5LMNL 4A3JH 2LSSA 2UUAQ 1SRUA 4TQUS 3G48A 3HOVH 5IYCG 3S1RH 1E7ZA 1IBML 3UE1A 3GTGH 3I2ZA 4WJ3M 3T1YL 3PF5A 4A3LG 4JBJA 1FL0A 2Q2UA 1H95A 2ALYB 2WAQE 4AH6A 4DR1Q 1SFOH 4JI8L 1VQKA 4LF6Q 2F4VQ 3GTOH 4JI7L 2RF4A 3GTMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ5 A;  1HR0 Q;  4DR2 L;  4L5T A;  1MJC A;  4B3R L;  1X9N A;  4HJ9 A;  3FKI H;  1K73 C;  3M3Y H;  1QUQ B;  1SE8 A;  3JC6 6;  1HJP A;  4DK3 C;  3DLL A;  4B3S L;  1EQR A;  3PUW A;  2RHQ B;  3AQQ A;  3D0F A;  5HY6 A;  3U4Z A;  1N33 Q;  4X64 L;  2UU9 L;  3M4Q A;  4GOP B;  4KHP L;  5C4X H;  3HFZ B;  4X65 L;  1L1O B;  5LMU Q;  4JBK A;  5IYD H;  2NN6 I;  5LMN Q;  4DR4 Q;  2PNH A;  1Q82 C;  1IZ6 A;  4LUV A;  4WJ4 A;  2NZO A;  1HZA A;  4JCV E;  4L5Q A;  1WYD A;  1IBM Q;  3FHW A;  4DV3 L;  3RN5 A;  3F2D A;  1C9O A;  4DV4 L;  5M3M H;  1EUJ A;  2VZA A;  4BY1 G;  1T9H A;  2JA5 G;  4JI4 L;  4PZ8 A;  4JI8 Q;  5H1S E;  4JI7 Q;  2OWO A;  4P71 A;  4DR5 L;  2B63 H;  1IBK L;  4DR2 Q;  1HZB A;  4LFA L;  4B3R Q;  1WFQ A;  4A3C G;  2I0Q A;  1UE7 A;  1OXU A;  1YNX A;  3AFQ A;  3RLO A;  4B3S Q;  3H0G G;  1A8V A;  4BXX H;  1VQJ A;  4JG2 A;  4R4C A;  4RMF A;  3EN2 A;  2IX1 A;  5FJ8 H;  4X64 Q;  1MJE A;  1V43 A;  2KHJ A;  3BJU A;  4JI5 L;  1XJV A;  2UU9 Q;  2R92 G;  1J6Q A;  3CMA A;  3S1M H;  1WOC A;  4KHP Q;  2MO1 A;  5M3F H;  1X3G A;  1HZC A;  3H3V H;  3I4M H;  2NN6 G;  2YV5 A;  2EXD A;  4OXP A;  2ASB A;  1CKN B;  4IJL A;  4YWL A;  1JJC B;  1PVO A;  1HH2 P;  3TRE A;  2ZM6 L;  4AIM A;  1JJ2 A;  1N32 L;  4KLK A;  3ULP A;  2WB1 G;  2RCN A;  4LW1 A;  5IP7 H;  4J15 A;  4A3M G;  1KD1 C;  4JI4 Q;  1GM5 A;  2UUC Q;  2VUM G;  3H15 A;  4BBR G;  4LF5 Q;  4H02 A;  4OX9 Q;  5FLX c;  4DR5 Q;  3GTK H;  2I5H A;  4LFA Q;  3KDF B;  1IBK Q;  4A3J G;  3MXN B;  5IY0 A;  4LFC L;  3F8T A;  1VQE A;  3HOV G;  1X3E A;  2JA6 H;  2K52 A;  4OWT B;  4DPG A;  4A3I G;  1CKO A;  2ZTC A;  3CCU A;  4JI5 Q;  5AJ3 L;  4DV5 L;  4UY8 C;  4PMW A;  2NZH A;  1LTL A;  1D8L A;  3L7Z C;  4LF8 Q;  4DR6 Q;  4DK6 C;  3JAM c;  4IOC A;  3FKI G;  4JI6 L;  4POG A;  2ATW A;  1N32 Q;  2N8N A;  1W3S A;  1I94 L;  5GAH C;  1OXT A;  1NJI C;  2R93 G;  5LMN W;  2D0O A;  1QZH A;  1NMF A;  2DUD A;  1PH1 A;  4A93 H;  2A1A A;  5C4X G;  4NXN L;  2IT1 A;  2K50 A;  4PZ6 A;  3KF6 A;  4A3G H;  1XMO L;  5K36 G;  1U0L A;  3GTQ H;  4LFC Q;  3ERS X;  4FDB A;  2HIV A;  1N36 L;  2GVB A;  3NEL A;  2Q2H A;  4C3H H;  4MTN A;  1UE6 A;  3NEN A;  3GTP H;  4OO1 I;  2A19 A;  5AJ3 Q;  3CF5 A;  4DV5 Q;  2QGQ A;  4O2D A;  2UXD L;  2BA0 A;  3U50 C;  3L0O A;  4YHH L;  4JOI A;  4IPG A;  4YY3 L;  5GRO A;  1VQC A;  3H0G H;  4JI6 Q;  1QUQ A;  3HOW H;  4A3B H;  3M7N A;  4LFB Q;  1I94 Q;  1L2F A;  4BXX G;  4DV1 Q;  3K7U C;  3ER0 A;  3IRB A;  1IXR A;  5FJ8 G;  3TS0 A;  4AQY L;  3S14 H;  2VQF L;  3GD7 A;  3JAM i;  1KAW A;  1I5F A;  3GTJ H;  4GOP A;  3UDG A;  5M3F G;  1XMO Q;  3HOZ G;  3FP9 A;  4YCU A;  3G4S A;  3HKZ G;  1WI5 A;  1N36 Q;  2R6G A;  1XPR A;  1YHA A;  4GKJ Q;  3PCO B;  3PUY A;  3KF8 B;  4JC0 A;  4A3M H;  1PYB A;  3HOU H;  5IP7 G;  4QIW E;  3M9B A;  3PSI A;  3HKS A;  4JI2 L;  3UE0 A;  4OO1 G;  2QEX A;  5FLM G;  2UXD Q;  5IWA L;  3RLF A;  1CKM A;  4HIK A;  2UXC L;  2E2H H;  4YHH Q;  2CQO A;  1FGU A;  4GOP C;  3RN2 A;  1TWG H;  4JI1 Q;  4YY3 Q;  1L1O C;  4A3E G;  3G6E A;  4A3D H;  3W1B A;  4YWK A;  4A3I H;  3J81 j;  3PIP A;  2JA6 G;  1K8A C;  4R4Q A;  2MNA A;  1N34 L;  3K7A H;  1CUK A;  2HQL A;  4BA1 I;  1VQ7 A;  5GQO A;  4UP8 A;  4AQY Q;  3KJP A;  1W2B A;  1KL9 A;  1K0R A;  4HJ8 A;  3ULL A;  3A5Z B;  1JJG A;  3EIV A;  1AE3 A;  1PH4 A;  2MQH A;  2D62 A;  3KLW A;  2GN5 A;  4UP7 A;  4IPD A;  4X62 Q;  1CKN A;  1K3R A;  1OXX K;  4JYA L;  2YTY A;  3W5O A;  1QZG A;  2RHS B;  2R93 H;  3B6Y A;  5GAG C;  2OTJ A;  4JI2 Q;  1X54 A;  4OWX B;  2JEB I;  1VQF A;  3CC7 A;  1K9M C;  2UXC Q;  4MZ9 A;  4A93 G;  3RZO H;  1BVS A;  4A3G G;  3KDF A;  1KRT A;  2ZTD A;  1VQ4 A;  2JEA I;  4ME3 A;  1SN8 A;  2V1C C;  1UE1 A;  3M4P A;  1XMQ L;  3S1Q H;  4DR7 L;  4BBS H;  4LUO A;  3S16 H;  4O0A A;  1BBW A;  3T1Y Q;  2PMZ E;  1N34 Q;  3PUZ A;  1UEB A;  1HNW L;  1IL2 A;  4YCV A;  3J80 c;  3HOX H;  4DV7 L;  2CFM A;  1QVG A;  1VQL A;  4IOA A;  2H5X A;  2GVA A;  3NBH B;  2VW9 A;  1M1K C;  2FXQ A;  2VNU D;  5M5W H;  1J5E L;  2R7D A;  2CWA A;  5ELO A;  3CCE A;  4DR3 L;  4LF7 L;  1KXL A;  1SRO A;  2Z0S A;  3AYH B;  4JYA Q;  3A5U A;  1GD7 A;  1S3O A;  4DUZ L;  1EYG A;  3GTL H;  3HOW G;  4A3B G;  1D7Q A;  4GLX A;  1G51 A;  1RL2 A;  1JT8 A;  4X65 Q;  1KC8 C;  3LGJ A;  4DUY L;  1S72 A;  2K5V A;  2WP8 J;  3HOZ H;  1S40 A;  1KRS A;  1VQB A;  2JJQ A;  3CCQ A;  2N3S A;  1LUZ A;  2Y0S E;  3S24 A;  1SLJ A;  4NXM L;  1XMQ Q;  4PZ7 A;  2K75 A;  5DLQ E;  4DV0 L;  4DV3 Q;  4DV4 Q;  2I5L X;  3J7Z C;  4A75 A;  1VQM A;  2WFW A;  3HOU G;  2OQ0 A;  5FLM H;  1NE3 A;  3Q8D A;  1KQS A;  3EBE A;  4LNQ A;  4DV7 Q;  1AE2 A;  5EAY A;  1Q8K A;  3S2D H;  4A3E H;  4NPS A;  1PH6 A;  3TQY A;  1Y1W G;  1NMG A;  1J5E Q;  1CSQ A;  2K5H A;  4DR3 Q;  5IP9 H;  4A3D G;  3ICE A;  3J80 i;  1VQ9 A;  3E9H A;  4P75 A;  2C35 B;  1PHJ A;  5IYB H;  1VQN A;  4P74 A;  4DUY Q;  1LYL A;  3OW2 A;  1E1O A;  1V1Q A;  5C0X J;  1KHI A;  4NXM Q;  1YIJ A;  3K8A A;  2WAQ G;  4HIM A;  4QQB X;  2ZM6 Q;  4DV0 Q;  4KHZ A;  2NVX H;  4OON A;  3K81 C;  1C0A A;  4YCW A;  1Q1B A;  4IFD J;  2IX0 A;  3ULJ A;  1HZ9 A;  4P73 A;  4TVA B;  3ZJY C;  3TEH B;  4GS3 A;  1VQ6 A;  1O7I A;  4QGU A;  3KFU A;  1PH2 A;  1BBU A;  1I6H H;  1MIU A;  3G71 A;  3PGZ A;  3HOY H;  4GLV B;  3W1G A;  3S2H H;  1VS0 A;  1VCI A;  2BH8 A;  5GAD C;  3CME A;  2EIF A;  1R9T H;  2PQA B;  1Q46 A;  2AKW B;  1VQO A;  4BBS G;  2UXB L;  3AFP A;  2YTX A;  4BY7 H;  1SMX A;  2IHF A;  2E2I H;  3L2P A;  1A63 A;  5IE8 A;  3HOX G;  4JV5 L;  4APV A;  1PH8 A;  1PH9 A;  1YHQ A;  4QJF A;  4X6A H;  1TXY A;  1Q81 C;  1CSP A;  2R7Z H;  2HHH L;  3PO2 H;  5C4J H;  2L15 A;  1PFS A;  1N9W A;  1X55 A;  1GVP A;  2K14 A;  1Y1V H;  1E3P A;  4AYB E;  2K4K A;  1EFW A;  1G29 1;  1XNQ L;  1E22 A;  1PA6 A;  2Q2I A;  4GLA C;  4MNO A;  3CCR A;  1L1O A;  4IJH A;  4NXN Q;  1HNX L;  2PI2 E;  1Y14 B;  5C0X I;  2KCM A;  1YHB A;  2JA9 A;  1YVC A;  1NY4 A;  4UP9 A;  3TS2 A;  4BA2 I;  2UXB Q;  3PO3 G;  4GN4 B;  1YIT A;  2OCE A;  1OTC A;  2Y0S G;  1RIP A;  2MFI A;  5IT9 c;  3I4N H;  2ZJP A;  3I4O A;  1QVF A;  1Y1W H;  4JV5 Q;  4HJA A;  2XTI A;  1EIF A;  1IYJ B;  1MKH A;  3K0X A;  4DV6 L;  4IO9 A;  2A8V A;  3GO5 A;  4LF6 L;  1FVI A;  2AMC B;  3OYY A;  4GNX C;  1VQ8 A;  2DGY A;  5IP9 G;  2CCZ A;  2F4V L;  3M4O H;  2MO0 A;  2HHH Q;  2WB1 E;  2AWO A;  1HR0 L;  4JBW A;  1XNQ Q;  2XGT A;  3E0E A;  2NVT H;  1TWA H;  2VQF Q;  1VQH A;  4KI0 A;  5IYB G;  4HID A;  1XPU A;  1VQG A;  3CQZ H;  2LXK A;  5ELN A;  3I56 A;  1HNX Q;  1N33 L;  3KOJ A;  3PIO A;  4XTC S;  1VQD A;  3RLN A;  5C0X G;  4DAM A;  4B3T L;  2BH2 A;  1OXS C;  4XIG S;  1JE5 A;  2ZTE A;  4UPA A;  2JE6 I;  1PV4 A;  3S17 H;  4DKA C;  4DR4 L;  1TWH H;  4GN5 A;  2HIX A;  2JQO A;  2K5N A;  5IWA Q;  1UE5 A;  4IFD G;  1PYS B;  1QVC A;  4DAY B;  4GNX B;  2ZJR A;  3U58 A;  3UDF A;  3OTO L;  3WWV A;  4DV6 Q;  1Z9F A;  1Q7Y C;  4PG3 A;  3MEF A;  3HOY G;  2KHI A;  1K83 H;  2CKZ B;  2CWP A;  2IY5 B;  1X3F A;  1WJJ A;  1YZ6 A;  2Z6K C;  2QA4 A;  2I5M X;  4BY7 G;  2HT1 A;  1GKH A;  4X66 L;  4EX5 A;  4DNI A;  1ASZ A;  4NB3 A;  4A3F H;  1X56 A;  1XTD A;  3NEM A;  1VQA A;  3CP0 A;  4P72 A;  4QL5 A;  3A74 A;  5J3B A;  1NTG A;  1I50 H;  1PH5 A;  4B3T Q;  4LF9 L;  3BU2 A;  5BR8 L;  1EIY B;  3T1H L;  4POF A;  2R7Z G;  1YEZ A;  3PO2 G;  3CCV A;  3F2C A;  1Y1V G;  5C3E H;  1VQI A;  5GAE C;  2B3G A;  2N78 A;  2OTL A;  2OQK A;  3OTO Q;  5JEA J;  1WCM H;  5M5X H;  1PH3 A;  3CD6 A;  4DR7 Q;  4AYB G;  4DV2 L;  4ALP A;  1N8R C;  2UUC L;  4LF5 L;  2PQA A;  2JA7 H;  4OX9 L;  3S1N H;  3CXC A;  4IPH A;  2VQE L;  4GN3 B;  4B3M L;  3PV0 A;  1HNZ L;  4R4O A;  1K8G A;  1HNW Q;  4X66 Q;  1P8L A;  2LXJ A;  3K80 C;  3STB D;  1VQ5 A;  2E2J H;  4C3I H;  3U4V A;  3KJO A;  3CCM A;  3I4N G;  1UWV A;  1V9P A;  4JI0 L;  4HJ5 A;  4QY7 A;  4LF7 Q;  3HKZ E;  4A3K H;  3UDI A;  5BR8 Q;  3M85 A;  4R4I A;  4LF9 Q;  4DUZ Q;  2KBN A;  3T1H Q;  1IBL L;  4YWM A;  2R7F A;  2E8G A;  3E9I A;  4LF8 L;  3J7A 5;  4DR6 L;  4C2M H;  3GDE A;  1GO3 E;  2KEN A;  5HGQ A;  3BZK A;  1JB7 A;  2VY3 A;  4LUZ A;  3VDY A;  1YJW A;  1M90 C;  5C44 H;  2D0P A;  4DV2 Q;  4R4T A;  3RR5 A;  3F2B A;  5JJK A;  2JA8 G;  2VQE Q;  1B8A A;  1P16 A;  2VS1 A;  5IYC H;  1HNZ Q;  4B3M Q;  1BKB A;  2PI2 A;  1X65 A;  4A3L H;  3D31 A;  2AWN A;  3STB C;  1A62 A;  4JI0 Q;  2Q2T A;  3PO3 H;  1HR0 W;  3DM3 A;  1Z47 A;  1YJN A;  3A0J A;  1IBL Q;  4IPC A;  1Q1E A;  1TWC H;  3I7F A;  1B70 B;  4GKK L;  3CCJ A;  1LM0 A;  2EQS A;  1FJG L;  3CCS A;  3CPF A;  2UUB L;  5JJL A;  1I3Q H;  2IHE A;  4HIO A;  3CPW A;  1TWF H;  4JI3 L;  4A3F G;  1B7Y B;  4LFB L;  2N49 A;  4DV1 L;  1Q86 C;  3SGI A;  1E1T A;  2F3I A;  3BZC A;  1XPO A;  1XNR L;  2YYZ A;  1ASY A;  3J81 c;  1YJ9 A;  5E7N A;  4A4I A;  4L5R C;  1G6P A;  5IYD G;  3H3V I;  4K0K L;  3CCL A;  1YBY A;  5C3E G;  1L0W A;  3RZD H;  1C7Y A;  4LF4 L;  4GNX A;  4GKJ L;  2NVY H;  2JA5 H;  2E5L L;  4BY1 H;  5M3M G;  1YI2 A;  1Q12 A;  1WCM G;  2B29 A;  5JEA G;  4Y7N H;  4R1J A;  1A0I A;  2JA7 G;  2B63 G;  4A3C H;  1VQP A;  3KYH C;  3UDX A;  2ES2 A;  2UUA L;  4GKK Q;  4JI1 L;  4LWC A;  4IFD I;  2KCT A;  1FJG Q;  3PUX A;  1AH9 A;  2BA1 A;  3CW2 C;  2UUB Q;  2YU9 H;  2NVQ H;  3CC4 A;  4JI3 Q;  4HJ7 A;  1EWI A;  1X6O A;  2ID0 A;  4JBM A;  5JJI A;  1SR3 A;  2F52 A;  2R92 H;  4DR1 L;  1XNR Q;  4A3K G;  3I55 A;  4Y52 H;  1NBW A;  1U5K A;  4OWW B;  1PH7 A;  3AEV A;  2YTV A;  4L5S A;  4K0K Q;  3RNU A;  1EQQ A;  2AHO B;  3CAM A;  4C3J H;  3I4M G;  3PUV A;  2VL6 A;  1KIX A;  1DGS A;  4JOI C;  5M5Y H;  4X62 L;  2ZJQ A;  3S15 H;  4LF4 Q;  3J81 i;  1JMC A;  3TRZ A;  2E5L Q;  3CC2 A;  1EOV A;  1OXV A;  2VUM H;  3F1Z A;  2Z6K A;  4BBR H;  3PF4 A;  4RG1 A;  5C44 G;  2JA8 H;  1E24 A;  5LMU L;  3KF6 B;  2JK8 A;  4A76 A;  5LMN L;  4A3J H;  2LSS A;  2UUA Q;  1SRU A;  4TQU S;  3G48 A;  3HOV H;  5IYC G;  3S1R H;  1E7Z A;  1IBM L;  3UE1 A;  3GTG H;  3I2Z A;  4WJ3 M;  3T1Y L;  3PF5 A;  4A3L G;  4JBJ A;  1FL0 A;  2Q2U A;  1H95 A;  2ALY B;  2WAQ E;  4AH6 A;  4DR1 Q;  1SFO H;  4JI8 L;  1VQK A;  4LF6 Q;  2F4V Q;  3GTO H;  4JI7 L;  2RF4 A;  3GTM H; 
#chains in the Genus database with same CATH topology
 1ILQ A;  2A6H D;  4EQ5 A;  4RKB A;  1MJC A;  5CBA E;  3PQI A;  2EPB A;  1HJP A;  2WAQ B;  3LX0 A;  3OIQ A;  3PUW A;  4MTK A;  3U4Z A;  3IKJ A;  1A15 A;  3M4Q A;  1EYD A;  2VXW A;  4KHP L;  3HFZ B;  3A8J E;  2NN6 I;  4FXG C;  3R8B A;  1Q82 C;  3EA6 A;  3VYT A;  1IZ6 A;  1HXY D;  1M8A A;  2NZO A;  4LUV A;  5FOB B;  3VA7 A;  4XQN A;  1IBM Q;  2WKC A;  4BY1 G;  4JI4 L;  1D5Z C;  1TII D;  4PZ8 A;  3QR8 A;  2KEE A;  4P71 A;  1IBK L;  1HZB A;  3HOX B;  4N9T A;  4A3C G;  1V1P A;  3H0G G;  1HQM C;  1VQJ A;  3DWA A;  3HP3 A;  4DAP A;  1V43 A;  2KHJ A;  4JI5 L;  3S1M H;  1J6Q A;  4KK7 A;  4KHP Q;  2MO1 A;  1LV9 A;  3SHL A;  4C3J G;  4IJL A;  4YWL A;  1PVO A;  5ELB A;  1N32 L;  4KLK A;  2RCN A;  4I7Z C;  4JI4 Q;  1DCZ A;  2VUM G;  4BBR G;  5C5L A;  4XT1 B;  1IBK Q;  4ZK9 B;  4J6H A;  1PZJ D;  2PQE A;  5IY0 A;  3OWE B;  2K52 A;  1WTR A;  4OWT B;  3UI2 A;  1CKO A;  2RKS A;  2HUG A;  4JI5 Q;  3H94 A;  5AJ3 L;  4DV5 L;  4UY8 C;  2EVB A;  2XWB B;  5C6A A;  1SNO A;  2J4X A;  3A7A B;  3JAM c;  4IOC A;  3FKI G;  2XWJ B;  2Q8R E;  1SYD A;  1N32 Q;  4HCE A;  1AZP A;  3C1F A;  5EPL A;  1NJI C;  2R93 G;  2NVX B;  1JC7 A;  1MGS A;  4A93 H;  1ONL A;  3NTH A;  5FO9 B;  4NXN L;  3VYS A;  4A3G H;  5K36 G;  3KF6 A;  4OIK A;  4JK1 C;  3GTQ H;  1Q8I A;  3ERS X;  2HIV A;  4K5X A;  4DNT B;  3S2H B;  2Q2H A;  3BG3 A;  4C1N K;  4U67 3;  2PZU A;  3VYR A;  4OO1 I;  2XRS D;  5AJ3 Q;  4DV5 Q;  4G7O C;  3MC0 B;  4JOI A;  2FHT A;  1VMP A;  4RCO A;  3J80 E;  5GRO A;  3H0G H;  4EQO A;  1NSN S;  2XN9 C;  1L2F A;  1PMR A;  5CYU A;  3ER0 A;  1IXR A;  3QWN A;  2ZXO A;  5C4J B;  3TS0 A;  1S5F D;  2VQF L;  4GOP A;  3UDG A;  1I5F A;  5KEE A;  1KDC A;  2AUJ D;  3R93 A;  1TU2 B;  1BXT A;  2EE1 A;  4YCU A;  1HUN A;  2RVL A;  4AYB B;  1LTI D;  4X3U A;  3PCO B;  3PUY A;  4JC0 A;  5IP7 G;  1RF2 D;  2QEX A;  1BCP D;  4ULL A;  2BOS A;  3HGB A;  4IUQ A;  2CQO A;  3J7Y W;  1Y1W B;  2FIN B;  3MA2 B;  3G6E A;  4A3E G;  2QDL A;  2DY7 A;  2JA6 G;  4R4Q A;  1STA A;  1PDQ A;  1E0B A;  4BA1 I;  4FVM A;  5C4H A;  5BN3 A;  1KL9 A;  2NVT B;  3I8Z A;  2NTS A;  3DEO A;  3FPU B;  3EIV A;  2D62 A;  3CQZ B;  1CT1 D;  1CKN A;  1QZG A;  3J7A V;  2R93 H;  3B6Y A;  1TR5 A;  1K9M C;  3S17 B;  1VQF A;  5K36 H;  4RGM A;  5FO7 B;  3KDF A;  1KRT A;  1SN8 A;  3BDL A;  4DU9 A;  1LTR D;  1PTO H;  2B2T C;  2OT2 A;  2KOL A;  2I46 A;  4DV7 L;  4CDC C;  2H5X A;  2GVA A;  3PMF A;  2VW9 A;  2R7D A;  4IUV A;  4DR3 L;  2PMZ B;  1TS2 A;  3HRZ C;  4MHE A;  2F0K A;  1F2Z A;  4A3B G;  1GD7 A;  1S3O A;  1EYG A;  1WVL A;  1G51 A;  5CV7 A;  2F0H A;  4X65 Q;  1G91 A;  1S72 A;  1S40 A;  2F0S A;  3S24 A;  1SLJ A;  2O4X A;  2NZ1 D;  5E3F A;  3VR2 A;  5M5X B;  4DV0 L;  2EYF A;  3J7Z C;  3FMC A;  2JA7 B;  4X3T A;  2OQ0 A;  2SNS A;  3Q8D A;  3EBE A;  5L37 A;  4DV7 Q;  1AE2 A;  2E2J B;  1JWM D;  2AQ2 B;  1EY9 A;  4KKS A;  2Q8T A;  4C3I B;  4A3E H;  5IT9 E;  3VR5 A;  4DR3 Q;  1D5X C;  2D5D A;  3J80 i;  1MBY A;  1F2M A;  4JPB W;  3E9H A;  1CA6 A;  1NNX A;  1H9S A;  3SK6 A;  1VQN A;  4CJ0 B;  1SXT A;  4KJO A;  1J9O A;  1LYL A;  3NBI A;  1V1Q A;  1STB A;  5C0X H;  3CKI B;  2WAQ G;  3A8I E;  2JN4 A;  4DV0 Q;  1EIG A;  4IUR A;  3K81 C;  1C0A A;  1KDA A;  3KF8 A;  1Q1B A;  4K6D A;  4IFD J;  2A69 C;  1D1I A;  2IX0 A;  3J7A F;  2EOT A;  4LMQ D;  3DM1 A;  3KFU A;  1MIU A;  3G71 A;  4GLV B;  3FRP B;  4B08 A;  2QIL A;  2AKW B;  2KCN A;  2YTX A;  1A63 A;  1GOZ A;  3HOX G;  4JV5 L;  4FNF A;  3D4R A;  1YHQ A;  4QJF A;  1TXY A;  3T16 A;  3PIO 3;  2R7Z H;  3PO2 H;  3Q0A A;  1Z7T A;  1X55 A;  4AYB E;  1B2T A;  1PA6 A;  4MNO A;  3ZYY X;  1L1O A;  4IJH A;  4HR7 B;  2PI2 E;  3K0Y A;  2PPB C;  4OEM B;  1YVC A;  4CDD C;  2DNE A;  4UP9 A;  1HHV A;  1PRT B;  5K5P A;  1CA5 A;  2LS0 1;  2CW0 C;  1RIP A;  3I4N H;  4JV5 Q;  3U9O A;  2A8V A;  1MKH A;  2FJ2 A;  4LF6 L;  3K6O A;  3OMC A;  2Z8L A;  2WB1 E;  1HR0 L;  1AW7 A;  4DXG A;  3Q23 A;  1XPU A;  3I56 A;  2IWH A;  2O5I C;  1EY6 A;  1VQD A;  4NKL A;  2BH2 A;  1OXS C;  1I4X A;  3P7J A;  4PMC A;  3N6R A;  2KQ3 A;  2HIX A;  1UE5 A;  1RTN A;  4IFD G;  5LL6 X;  3QB3 A;  1Q7Y C;  3WWV A;  4A3I B;  4PG3 A;  1GUS A;  2KEC A;  1TS5 A;  2CKZ B;  1SFO B;  1WJJ A;  3HS0 C;  5ELC A;  2Z6K C;  2HT1 A;  3TZD A;  4EX5 A;  1ASZ A;  4NB3 A;  4A3F H;  1X56 A;  4QL5 A;  3VR3 A;  1NTG A;  1PH5 A;  3I90 A;  1ICW A;  3BU2 A;  2K6A A;  4NW2 A;  5C4Z A;  5A2Q E;  2DJF C;  4POF A;  1YEZ A;  4OHJ A;  5T1I A;  2LY7 A;  5EPJ A;  5C3E H;  5EBC A;  2NB0 A;  5GAE C;  4L63 B;  1GUW A;  3FVQ A;  1BF4 A;  3CD6 A;  4DR7 Q;  3MXP A;  3LNN A;  4AYB G;  1WTO A;  4DV2 L;  1N8R C;  4LF5 L;  3D4W A;  4OX9 L;  3S1N H;  3MZ5 A;  3RMH A;  1LTT D;  4G7Z C;  1HNW Q;  1P8L A;  3STB D;  4HAE A;  2IPK D;  2SEB D;  1F9P A;  1DD2 A;  3ERQ A;  4A3K H;  4DXF A;  2K33 A;  4R4I A;  1F77 A;  3S1M B;  1FD7 D;  2E8G A;  2F0W A;  3SK8 A;  3GDE A;  4G4K A;  3BZK A;  3K58 A;  3HKZ B;  2H4O A;  5FK9 C;  4UHV A;  4DV2 Q;  4R4T A;  3F2B A;  3QOJ A;  4MIU A;  5IYC H;  1BKB A;  4IFD H;  4A3L H;  3R2I A;  2F4I A;  1JOO A;  1Z47 A;  1YJN A;  1IHZ A;  2H1E A;  3I7F A;  1B70 B;  4GKK L;  3P1H A;  3CCJ A;  2A6E D;  1EY7 A;  1FJG L;  3CPF A;  5JJL A;  1WTV A;  3EQL C;  2EZV A;  4HIO A;  1TWF H;  2K32 A;  2N49 A;  4DV1 L;  3SGI A;  1E1T A;  5CMD A;  4UAI A;  3Q22 A;  2YYZ A;  1ASY A;  2F1M A;  4A4I A;  1G6P A;  3D6W A;  4A93 B;  5IYD G;  1Q3L A;  4E6I A;  3ONA B;  4A3G B;  1EIH A;  3GTQ B;  3RZD H;  5IIF A;  2CVR A;  4LF4 L;  2JA5 H;  1II3 A;  1Q12 A;  2B29 A;  2OF1 A;  4Y7N H;  2KVM A;  2JA7 G;  1X32 A;  1B53 A;  1VQP A;  4GKK Q;  4HMI A;  4JI1 L;  4LWC A;  4H0L C;  1FJG Q;  2BA1 A;  3H0G B;  3TBI B;  4C3I G;  1BBX C;  2ID0 A;  4RKL A;  4JBM A;  5JJI A;  2F0N A;  2R92 H;  4ME5 A;  1GUG A;  2QDB A;  1NBW A;  3AEV A;  2A68 C;  3I4M G;  1MI2 A;  1SNC A;  5M5Y H;  3S15 H;  4LF4 Q;  3J81 i;  1JMC A;  3TRZ A;  5DNF A;  3DWQ A;  1OXV A;  4RG1 A;  2KUM A;  5LMU L;  2JK8 A;  3DMU A;  1JWU D;  1S5D D;  2FMM A;  3G48 A;  3OHX C;  1HFG A;  3S1R H;  3GTG H;  3OMG A;  2XVS A;  5KYL A;  4QIW B;  3T1Y L;  3PF5 A;  4JBJ A;  3C46 A;  2ALY B;  3DWP A;  2F4V Q;  3GTO H;  2JXM B;  4JI7 L;  1XTC D;  3GTM H;  1VDZ A;  5CBE E;  1PTO C;  5ELE A;  3GP7 A;  4DR2 L;  4FF3 A;  4WOR A;  4B3R L;  2PYK A;  4HJ9 A;  3C3L A;  1FYC A;  2EYL A;  1K73 C;  3M3Y H;  2CHB D;  3H91 A;  2RHQ B;  5HY6 A;  1N33 Q;  4CKC A;  3JAM E;  4X64 L;  1GUT A;  2UU9 L;  2R93 B;  2F0P A;  1L1O B;  5LMU Q;  4JBK A;  5IYD H;  3X3M A;  2C9O A;  3MXG A;  5CC4 A;  4DR4 Q;  2RDH A;  4WJ4 A;  1SYB A;  4L5Q A;  1Z6H A;  1WYD A;  5I9O A;  3URY A;  1C9O A;  1EUJ A;  3NK9 A;  2EXZ A;  3K5N A;  1PTO B;  1T9H A;  1GHJ A;  1F9Q A;  2VB2 X;  4JI7 Q;  2RSO A;  4DR2 Q;  4LFA L;  1CZW A;  4B3R Q;  1TKW B;  1OXU A;  1YNX A;  2WII B;  1WD0 A;  4BXX H;  4JG2 A;  1HA6 A;  3H09 A;  4R4C A;  4NP5 A;  5FJ8 H;  5JJZ A;  4X64 Q;  2UU9 Q;  2F0J A;  2MUY A;  1EWC A;  2QKI C;  1LT3 D;  4K5W A;  1X3G A;  3I4M H;  3IL8 A;  2EYO A;  2EXD A;  2ASB A;  1TVX A;  1JJC B;  2K04 A;  1HH2 P;  3TSS A;  2ZM6 L;  1JJ2 A;  4FF1 A;  3ULP A;  1RDP D;  3SEB A;  4A3M G;  1KD1 C;  5DM7 3;  1GM5 A;  2Y0S B;  3GTK H;  4LFA Q;  3NPP A;  1EEI D;  4LFC L;  3F8T A;  4A3E B;  4A3I G;  4ILW A;  2BCO A;  4IN3 A;  5D3D A;  2L5T A;  2MPM A;  3CHB D;  1L0Y B;  2L4N A;  2NZH A;  4LF8 Q;  1KNA A;  4DK6 C;  1ZEQ X;  2E75 C;  2N8N A;  1W3S A;  1BOS A;  1B9M A;  1D6E C;  5GAH C;  5LMN W;  1NMF A;  5CV8 A;  4ZUJ A;  1KDB A;  1U0L A;  4IUU A;  1LTB D;  4LFC Q;  5I6Y A;  4FDB A;  2GVB A;  3TME A;  1K8M A;  4MTN A;  2PNR C;  1CQV A;  3U50 C;  5G3L F;  1ICF B;  5IOC A;  4B9W A;  1RKN A;  1VQC A;  4Q0F A;  1QUQ A;  1CFM A;  3IRB A;  2R7Z B;  3PO2 B;  3K5O A;  3S14 H;  3JAM i;  1KAW A;  2X6L A;  2XNA C;  1SNP A;  3HOZ G;  1ENA A;  3HKZ G;  4GKJ Q;  3NP8 A;  4A3M H;  1B3Q A;  3N52 A;  1D1K A;  3M9B A;  4IUT A;  4QIW E;  5EJW A;  1PFN A;  3RLF A;  2E2H H;  3I4N B;  2RDG A;  3RN2 A;  3VYU A;  1QCB D;  3W1B A;  4A3I H;  3PIP A;  1M4V A;  1K8A C;  3K7A H;  1CUK A;  2HQL A;  1VQ7 A;  3NWT A;  2BDN A;  4RGO S;  1W2B A;  1K0R A;  4HJ8 A;  1ZKO A;  1IW7 D;  1JJG A;  1PTO F;  1PH4 A;  4PNY A;  3KLW A;  4X62 Q;  4JYA L;  2YTY A;  4L8J A;  3W5O A;  5GAG C;  3V05 A;  2OTJ A;  1X54 A;  4OWX B;  2BE5 D;  4A93 G;  3RZO H;  3K59 A;  4A3G G;  1SEB D;  4BBS H;  4O0A A;  1UEB A;  4CDF C;  1IL2 A;  1QVG A;  4IOA A;  4H44 C;  1M1K C;  3LWU A;  5M5W H;  1CHP D;  4A3F B;  2F3W A;  4LF7 L;  5HUR A;  4JYA Q;  4RHS A;  4KJN A;  3GTL H;  4R9W A;  1D7Q A;  1RL2 A;  1KC8 C;  1HQR D;  4QMG A;  2K5V A;  2WP8 J;  5C3E B;  3HOZ H;  1VQB A;  3CCQ A;  4P2C B;  2N3S A;  2N55 A;  2Y0S E;  2B2U C;  4PMB A;  5DLQ E;  2I5L X;  2K5Q A;  4KY7 A;  5CV9 A;  4A75 A;  1G2T A;  2WFW A;  2B63 B;  3S1N B;  1NE3 A;  1KQS A;  4LNQ A;  4CDE C;  3I70 A;  3S2D H;  1BNZ A;  2TMP A;  1CSQ A;  1S5C D;  1STE A;  2J0T D;  1QOH A;  5IP9 H;  4EGV A;  1HRJ A;  1VQ9 A;  4A3K B;  4P75 A;  1SYF A;  1UUP A;  5IYB H;  4Q5V A;  5CV5 A;  1LT4 D;  4KN4 C;  5C0X J;  5C3X A;  3ND8 A;  1EOT A;  3K8A A;  4HIM A;  4YCW A;  1KLU D;  3V2T A;  4FO2 A;  3QOL A;  3TEH B;  1B3A A;  2R3Z A;  1A6X A;  4X3K A;  1I6H H;  3PGZ A;  3HOY H;  5GAD C;  1R9T H;  1VQO A;  2Z6B A;  4BY7 H;  1SMX A;  3EFX D;  1A3U A;  2IHF A;  3PIP 3;  3K57 A;  5EBD A;  1ROD A;  2EYH A;  2TSS A;  2Z9H A;  4APV A;  1TWF B;  4CHT B;  2F0I A;  1SE2 A;  3TP6 A;  1EFW A;  1Y1V H;  1E3P A;  1E22 A;  4NXN Q;  2GA4 B;  3RZD B;  2KCM A;  1YHB A;  1W6K A;  2JA5 B;  4DGZ A;  2F03 A;  1DJR D;  3TS2 A;  2K5D A;  4GN4 B;  4Y7N B;  1YIT A;  2OCE A;  4TRD A;  4M8A A;  2NWG A;  1F9S A;  2Y0S G;  5E1F A;  1EY0 A;  2MFI A;  2XTI A;  1IYJ B;  3V96 A;  3NBH A;  4QUC A;  3GO5 A;  1VQ8 A;  4DF7 A;  3M4O H;  2R92 B;  4KN7 C;  3MXU A;  3FPP A;  1U9R A;  1EQV A;  5AFW A;  1TWA H;  2VQF Q;  1VQH A;  4KI0 A;  4HID A;  2M00 A;  5BN4 A;  3S15 B;  5M5Y B;  1O7Y A;  3PIO A;  2WB1 B;  1O80 A;  5C0X G;  1SE3 A;  4DAM A;  2BDO A;  1JE5 A;  5M9O A;  1ML0 D;  5IGD A;  1HUM A;  1QVC A;  4DAY B;  2ZJR A;  3S1R B;  3GTG B;  5IGG A;  2PZW A;  2CWP A;  1CI3 M;  5JOB A;  1QWY A;  2ENB A;  3GTO B;  1YZ6 A;  1HTL D;  2L12 A;  4O42 A;  3GTM B;  1IKM A;  4S3S A;  1L0X B;  3M3Y B;  1XTD A;  2SDF A;  3NEM A;  1JR0 D;  1A3T A;  1VQA A;  2V4D A;  4P72 A;  5J3B A;  1HCZ A;  3A74 A;  5FLX L;  4G7H C;  1AP0 A;  1CK1 A;  4DNR B;  4CKE A;  1QE6 A;  5FO8 B;  1KTK A;  2R7Z G;  1Y8O B;  2DNC A;  3PO2 G;  1S5B D;  5COY A;  2N78 A;  2OTL A;  2OQK A;  4DAV A;  4BS9 A;  5JEA H;  2UUC L;  2PQA A;  5COR A;  3G6J B;  4FXD A;  4R4O A;  2LXJ A;  3R3O A;  3U4V A;  3KJO A;  3I4N G;  4K8J A;  1SMY D;  1UWV A;  2J7Z A;  2QW7 A;  1TS3 A;  1IBL L;  1PFM A;  3E9I A;  4OGQ C;  3J7A 5;  4DR6 L;  1GO3 E;  3I4M B;  4R8I A;  2VY3 A;  1RHP A;  2B2Y A;  1YJW A;  3T13 A;  1Y8P B;  5KGU A;  1F2L A;  1BUV T;  3VR6 A;  2JA8 G;  2ICI A;  2F0O A;  3GTK B;  1B4O A;  1KAA A;  4PQX A;  4LAA A;  3D31 A;  2AWN A;  4KMU C;  5IGB A;  3X3N A;  3TDQ A;  1XYI A;  1IBL Q;  2RA4 A;  1V1P B;  1PRT C;  2EQS A;  3CCS A;  1I3Q H;  4RWS C;  4LFB L;  4A3F G;  1PLF A;  2X6G A;  1Q86 C;  2F3I A;  1XNR L;  1LTS D;  5CV6 A;  5BN5 A;  3QIA A;  5C3E G;  1C7Y A;  4GZY C;  4GNX A;  1X3P A;  4C56 C;  1HFN A;  4RGN A;  4R1J A;  4ABN A;  4FYD A;  1A0I A;  2B63 G;  3UDX A;  2F0L A;  5ELF A;  1V1O A;  2KCT A;  2SNM A;  3I3C A;  2Z4I A;  3TP7 A;  2HDL A;  4DR1 L;  1XNR Q;  1BQQ T;  4A3K G;  2AUK A;  3S14 B;  1U5K A;  2NN6 H;  3RD4 A;  1CHQ D;  3WOF A;  4L5S A;  2AHO B;  4OIJ A;  3T51 B;  4EVO A;  1E2Z A;  2VL6 A;  3OWF A;  4JOI C;  1KIX A;  2WIN B;  4XXE A;  3J80 L;  3F1Z A;  4A3M B;  5IGC A;  3PF4 A;  1QG7 A;  3P20 A;  2JA8 H;  1E24 A;  3KF6 B;  2WAC A;  5LMN L;  4A3J H;  2LSS A;  1SRU A;  3HOV H;  1R4P B;  2E2H B;  5IYC G;  3UE1 A;  3I2Z A;  4WJ3 M;  4U68 A;  4A3L G;  4TKO B;  3HG9 A;  2Q2U A;  1H95 A;  4AH6 A;  4LF6 Q;  1W6J A;  4DR1 Q;  4JI8 L;  4KD4 A;  1OO9 B;  1G8Z D;  3K7A B;  2SOB A;  2D9U A;  1U4L A;  1HR0 Q;  4O1N A;  1B44 D;  1SE8 A;  4B3S L;  3DLL A;  2L55 A;  3BZD B;  3AQQ A;  3D0F A;  4CGY B;  4GOP B;  4G57 A;  5C4X H;  1Q90 A;  5LMN Q;  2PNH A;  4CJ2 C;  3RZO B;  1J8I A;  2IJ0 A;  1HZA A;  1NAP A;  4DV3 L;  1CTM A;  4DV4 L;  4ZKC B;  3ND9 A;  1A2U A;  4BBS B;  3KLS A;  2JA5 G;  2G9D A;  4JI8 Q;  1JOQ A;  1LLR D;  2OWO A;  2B63 H;  4DR5 L;  3C1E A;  4QUF A;  2A6H C;  2KA7 A;  5C3W A;  3DUZ A;  3RLO A;  1WTH A;  5M5W B;  2B2V A;  4K6L A;  4B3S Q;  4RMF A;  3EN2 A;  4ZRZ A;  1MJE A;  1XJV A;  3BJU A;  1Y69 U;  3GTL B;  2R92 G;  3CMA A;  2PO4 A;  5M3F H;  3H3V H;  4M1U B;  3HOZ B;  1ET6 A;  4OXP A;  2EY6 A;  1CKN B;  4ODG A;  3I73 A;  4XQJ A;  1SE4 A;  2WB1 G;  4J15 A;  4DK1 A;  4OO1 H;  3AMU A;  3E6Z X;  1E2V A;  5FKA C;  2K7V A;  4LF5 Q;  4H02 A;  4OX9 Q;  2E74 C;  4DR5 Q;  4HED A;  5JVG 3;  3KDF B;  2NTT A;  2PCF B;  2MHV A;  3S2D B;  1VQE A;  1X3E A;  4DPG A;  2ZTC A;  1MHW C;  4EQP A;  4EQN A;  5EKK A;  4PMW A;  5I2X A;  1LTL A;  1D8L A;  3L7Z C;  1G6Z A;  1BO0 A;  4JI6 L;  4UDU C;  1PRT F;  2QF7 A;  3BYY B;  2ATW A;  5ELD A;  1OXT A;  5IT9 L;  5CR3 A;  1WTP A;  3T4A C;  1PH1 A;  2A1A A;  2DN8 A;  2IT1 A;  4PZ6 A;  2X69 A;  1XMO L;  2R61 A;  2F0D A;  3M4Y A;  2A74 C;  1I6H B;  3HOY B;  1N36 L;  2A73 B;  1R9T B;  1TQO A;  2A19 A;  3VR4 A;  3CF5 A;  4BY7 B;  2QGQ A;  2BA0 A;  1FGB D;  3L0O A;  3P75 A;  5EKI A;  2F0T A;  4WFN 3;  4H13 C;  4JI6 Q;  3HOW H;  3M7N A;  4YIJ A;  4BXX G;  4DV1 Q;  3K7U C;  5FJ8 G;  1H9S B;  2PW5 A;  4AQY L;  2JSO A;  1Y1V B;  1FNW A;  1S4Z A;  2RSN A;  1XMO Q;  3DHQ A;  3FP9 A;  2Q8I B;  3MWY W;  5EQ0 A;  2B39 A;  1WI5 A;  1N36 Q;  2R6G A;  1MSG A;  4IUP A;  3KF8 B;  3HOU H;  4ZAI A;  3PSI A;  4JI2 L;  2KCC A;  1JIC A;  1PXU A;  5IWA L;  2UXC L;  4WJW A;  1NCV A;  4HTH A;  1FGU A;  2G5D A;  1TWG H;  4JI1 Q;  1L1O C;  4A3D H;  1YNJ C;  4ZUI A;  3J81 j;  4RFB A;  1XWE A;  3M4O B;  5GQO A;  4UP8 A;  4AQY Q;  3KJP A;  3QG1 A;  2L9H A;  1TWA B;  2EJG C;  3ULL A;  2GN5 A;  4UP7 A;  4IPD A;  2F0Q A;  1SJE D;  1OXX K;  5A35 A;  1GJX A;  1ZYR C;  2RHS B;  1T5E A;  4JI2 Q;  3CC7 A;  2UXC Q;  4MZ9 A;  1EWH A;  1BVS A;  3D8G A;  1BCP C;  2ZTD A;  4ME3 A;  3ITP A;  2V1C C;  3I72 A;  5J22 A;  3S1Q H;  3S16 H;  3T1Y Q;  3NTI A;  3PUZ A;  4DFA A;  3AU7 A;  2ZXP A;  4YCV A;  3S9W A;  4RHR A;  3ERO A;  3F2U A;  5ELO A;  3NSW A;  1QJO A;  1SRO A;  2Z0S A;  3AYH B;  3A5U A;  4DUZ L;  1VF7 A;  1JT8 A;  1BCP B;  3LGJ A;  3AB9 A;  5DM6 3;  1KRS A;  1LAB A;  2JJQ A;  4ID6 A;  4NXM L;  3CRK C;  2RQX A;  4F7X A;  1EY5 A;  1FNU A;  4PZ7 A;  4B9X A;  2LFN A;  3HEJ A;  1O7Z A;  2A69 D;  1RD9 D;  1HA5 A;  5J39 A;  3KK7 A;  2JYO A;  5EAY A;  2L0C A;  4NPS A;  1PH6 A;  1NMG A;  3J81 L;  4F8M A;  2K5H A;  1ZXT A;  1I4P A;  2CH4 W;  1DXM A;  1U4R A;  4XDX A;  1PFB A;  1EU3 A;  1PRT D;  2C35 B;  5EGT A;  4P74 A;  5LL6 S;  4WRD A;  1E1O A;  4NXM Q;  2ZM6 Q;  4KHZ A;  3D6C A;  1MSH A;  4J1M A;  1HZ9 A;  3TP8 A;  4GS3 A;  1O7I A;  4QGU A;  1PH2 A;  1BBU A;  5J1Z A;  5KNC A;  1VS0 A;  2BH8 A;  2EIF A;  1Q46 A;  4BBS G;  4HCS A;  3IAY A;  5I6W A;  2CW0 D;  2LKV A;  2E2I H;  3L2P A;  1B9N A;  3SDZ A;  3BVZ A;  1I3Q B;  4X3S A;  1Q81 C;  1CSP A;  2HHH L;  5JVH 3;  2L15 A;  1PFS A;  1DOL A;  1GVP A;  1XNQ L;  1G29 1;  1SYE A;  1ENF A;  4GLA C;  3CCR A;  1GUO A;  1KLG D;  5C0X I;  2JA9 A;  1SND A;  3KUP A;  1NY4 A;  4BA2 I;  1IYV A;  5C5M A;  1STG A;  3G7L A;  2ZJP A;  1QVF A;  4HJA A;  3K0X A;  4DV6 L;  1G2S A;  3OIP A;  3OYY A;  1LO5 D;  4XYO A;  5IP9 G;  2CCZ A;  2HHH Q;  3L3O C;  2AWO A;  1STH A;  1XNQ Q;  3E0E A;  3IFT A;  1V8Q A;  5IYB G;  1NUC A;  1PZK D;  1QB5 D;  1VQG A;  3NHH A;  3KOJ A;  2B2T A;  4ZLT F;  3SVM A;  1SNM A;  4XIG S;  4IQZ A;  2K05 A;  3NTK A;  4UPA A;  3NQI A;  3SK4 A;  2JA8 B;  1TWH H;  4CKB A;  4A3J B;  3OPO A;  2JQO A;  2K5N A;  1E2W A;  1FR3 A;  3HOV B;  2RDF A;  1B1Z A;  1SAP A;  3UDF A;  3OTO L;  4DV6 Q;  1Z9F A;  3MXN A;  1BCP F;  3HOY G;  2KHI A;  1K83 H;  2IY5 B;  4BY7 G;  4N8X 1;  3D4D A;  3NUC A;  4JW0 A;  2O5J C;  1I50 H;  1EY8 A;  1HPC A;  2MP1 A;  5C4X B;  2EJM A;  1Y1V G;  1MD2 D;  1VQI A;  1IL8 A;  3OTO Q;  1DM0 B;  3H3V C;  5JEA J;  1K28 A;  1WCM H;  4ALP A;  2RBM A;  3JAM L;  3A54 A;  3CXC A;  2VQE L;  5IOD A;  4B3M L;  1K8G A;  2B2W C;  1VQ5 A;  4L6T B;  3CCM A;  1UEA B;  2IW3 A;  1TY2 A;  2L1B A;  4HJ5 A;  4LF7 Q;  1NR4 A;  3M85 A;  2KBN A;  4YWM A;  2R7F A;  5M3F B;  1U4P A;  2F0F A;  1EY4 A;  4C2M H;  1TY0 A;  5HGQ A;  1JB7 A;  3VDY A;  4OL7 A;  3D3R A;  2EYM A;  2K01 A;  3SXH A;  5C44 H;  2D0P A;  4RH6 A;  2G9H D;  4KTA A;  2EY5 A;  3DXJ C;  3QJY A;  2VQE Q;  4KHV A;  1P16 A;  2I07 B;  2VS1 A;  4B3M Q;  4HN7 A;  1H9K A;  5IGE A;  3STB C;  2Q2T A;  3PO3 H;  1I6V C;  5G3L D;  3GQB A;  2P5Z X;  2PZT A;  2HDM A;  4IPC A;  1Q1E A;  2PW7 A;  1TWC H;  1KAB A;  4KV6 A;  1I4G A;  1LM0 A;  3KLS X;  3OOC A;  2EJF C;  4LK1 C;  2UUB L;  1X3Q A;  3I91 A;  1DON A;  3CPW A;  4JI3 L;  1B7Y B;  1EEF D;  3BVG A;  3BZC A;  1XPO A;  2HQE A;  3MEH A;  1YJ9 A;  5E7N A;  2A68 D;  3IFD A;  3H3V I;  3CCL A;  1YBY A;  1L0W A;  3A7L A;  2K03 A;  2NVY H;  4BY1 H;  1C48 A;  1CZG A;  5M3M G;  1YI2 A;  1JCK B;  2OXP A;  5JEA G;  5KYI A;  3I4L A;  1C4Q A;  4A3C H;  2ES2 A;  1YNJ D;  4IFD I;  1AH9 A;  3PUX A;  3RUZ A;  2A6E C;  2UUB Q;  2YU9 H;  3EJI A;  2NVQ H;  1A2T A;  4JI3 Q;  4ZCK A;  3HOW B;  1X6O A;  2K28 A;  2F52 A;  4HSP A;  1PTO D;  1EU4 A;  3I55 A;  4Y52 H;  2HD3 A;  1PH7 A;  1C8C A;  2YTV A;  4K5V A;  3RNU A;  1EL0 A;  4KD3 A;  4C3J H;  3PUV A;  4QCL A;  2ZJQ A;  1T5X D;  3NQT A;  1JE4 A;  1ZYR D;  3CC2 A;  2VUM H;  4BBR H;  2Z6K A;  3HOU B;  1GXD C;  3TP5 A;  4IUN A;  1DOK A;  3KBG A;  4TQU S;  3QO2 A;  3NWS A;  1TWG B;  4A3D B;  3MHB A;  1QNU A;  1S5E D;  4IAL A;  2WAQ E;  4FF2 A;  3HZX A;  5KIX A;  2FMC A;  4L5T A;  3Q6S A;  1X9N A;  2NYZ D;  3FKI H;  1QUQ B;  3JC6 6;  4DK3 C;  1EQR A;  4C1N I;  2QEJ C;  4X65 L;  1GUN A;  2N88 A;  1EYC A;  4JCV E;  3FHW A;  3S1Q B;  3RN5 A;  3F2D A;  1GHK A;  5M3M H;  2VZA A;  3S16 B;  4C3H G;  3NE5 B;  5H1S E;  4K14 A;  2RCF A;  1WFQ A;  2I0Q A;  1UE7 A;  3AFQ A;  2AQ3 B;  1A8V A;  1BDO A;  2IX1 A;  4OEL B;  1SDF A;  1WOC A;  1LTA D;  1HZC A;  2NN6 G;  2YV5 A;  2E2D C;  3TRE A;  4AIM A;  4DN4 M;  5NUC A;  5T1G A;  4LW1 A;  5IP7 H;  1F9R A;  5CV4 A;  3VA5 A;  1AN8 A;  4KY6 A;  2UUC Q;  3H15 A;  5FLX c;  2I5H A;  1HTP A;  4A3J G;  3MXN B;  3HOV G;  2JA6 H;  1IKL A;  3SR1 A;  3CCU A;  3MTS A;  1WTW A;  1TS4 A;  2HCI A;  1AZQ A;  4DR6 Q;  5DAU A;  2L11 A;  4FP5 D;  1Y8N B;  4XT3 B;  2Z1C A;  4POG A;  1I94 L;  1I4Q A;  2K5W A;  2D0O A;  2E76 C;  1QZH A;  2DUD A;  4Z9C B;  3BVM A;  1SNQ A;  5C4X G;  2K50 A;  3E0J A;  3NEL A;  1CM9 A;  1I4H A;  4C3H H;  1PZI D;  1UE6 A;  3NEN A;  3GTP H;  1O7L A;  3TN2 A;  4O2D A;  2UXD L;  2E2I B;  2DY8 A;  4YHH L;  4IPG A;  4YY3 L;  4A3B H;  2M2L A;  4LFB Q;  1I94 Q;  3OSO A;  5I2Y A;  2QCP X;  4XYQ A;  3GD7 A;  2HCC A;  3GTJ H;  5M3F G;  1LAC A;  1D2B A;  1NR2 A;  3G4S A;  3T56 B;  1XPR A;  1YHA A;  5KND A;  3GV3 A;  1PYB A;  4I7A A;  3BS1 A;  4H7B A;  3HKS A;  4OO1 G;  3UE0 A;  1YNN C;  5FLM G;  2UXD Q;  4HIK A;  1CKM A;  1KNE A;  1UNS A;  4YHH Q;  4GOP C;  1SSO A;  4MN3 A;  4YY3 Q;  3A55 A;  4YWK A;  5D3I B;  1RCV D;  3FEW X;  2MNA A;  1N34 L;  4F87 A;  4K2K A;  2KED A;  2Z4H A;  3A5Z B;  1AE3 A;  2MQH A;  1K3R A;  2JEB I;  4K2L A;  1TWH B;  4BWG B;  2EY2 A;  3K5L A;  1VQ4 A;  2JEA I;  3M4P A;  1UE1 A;  2K1B A;  1XMQ L;  4DR7 L;  4LUO A;  1BBW A;  1EZ8 A;  1K83 B;  2PMZ E;  2A5H A;  2F3V A;  1N34 Q;  1VF5 C;  1WTX A;  4CJ1 B;  1HNW L;  4RAU C;  3HOX H;  3J80 c;  2CFM A;  1VQL A;  3NBH B;  2VNU D;  2FXQ A;  1J5E L;  1IW7 C;  2CWA A;  3SE0 A;  3CCE A;  1KXL A;  1I50 B;  3HOW G;  1QNK A;  4CBV A;  4GLX A;  2CQA A;  3J81 E;  1F2Y A;  4DUY L;  3M7G A;  2BE5 C;  1LUZ A;  1UAP A;  5JAV A;  4N9P A;  1SBB B;  1XMQ Q;  2K75 A;  1WCM B;  4DV3 Q;  4DV4 Q;  5E4X A;  3FDT A;  1VQM A;  3HOU G;  5EKL A;  5FLM H;  1EQT A;  1PYW D;  5CGK A;  1Q8K A;  2CH4 A;  3TQY A;  1Y1W G;  1J5E Q;  5DEH A;  5KRU A;  4A3D G;  3ICE A;  3NXW A;  1WTQ A;  1PHJ A;  1RTO A;  1QIL A;  4DUY Q;  4C2M B;  3OW2 A;  1KHI A;  1FNV A;  1YIJ A;  4FF4 A;  2KJX A;  3MAQ A;  4QQB X;  2NVX H;  4OON A;  5C44 B;  4NDX A;  1AEX A;  4LJZ C;  3OW7 A;  5E4W C;  3MFG A;  1ESF A;  4P73 A;  4TVA B;  3ULJ A;  3ZJY C;  1VQ6 A;  2JP1 A;  1DOM A;  1H9M A;  2B2Y C;  3W1G A;  2ZXR A;  3S2H H;  1VCI A;  1DYQ A;  3CME A;  3C2P A;  3PO3 B;  3A8K E;  2PQA B;  2UXB L;  3BDC A;  3AFP A;  1JOK A;  2FFK B;  1A3V A;  1TWC B;  1STY A;  5IE8 A;  4DK0 A;  1ILP A;  2EYJ A;  1PH8 A;  1PH9 A;  4X6A H;  3WDN A;  3BYT B;  2EDG A;  4JVZ A;  3SK5 A;  2MJ8 A;  1LTG D;  5C4J H;  1N9W A;  2EYP A;  3R2T A;  2K14 A;  5IGF A;  2K4K A;  3EVQ A;  2F0E A;  2Q2I A;  1SJH D;  1HNX L;  1D5M C;  1Y14 B;  1I4R A;  3T53 B;  2NVY B;  5HGT A;  4HMJ A;  4BY1 B;  3A56 A;  2UXB Q;  4TSS A;  3DEP A;  1AFP A;  1OTC A;  2IX3 A;  5IT9 c;  3I4O A;  1Y1W H;  4RGT A;  1EIF A;  1JOR A;  4IO9 A;  2YU9 B;  4KY5 A;  2NVQ B;  1FVI A;  2AMC B;  3WOE A;  4GNX C;  2F4V L;  2DGY A;  2MO0 A;  1DZ1 A;  4ZQ3 A;  4KKU A;  4JBW A;  5TSS A;  2XGT A;  2NVT H;  1K3B C;  4XQQ A;  4V0B A;  4C3J B;  1HNX Q;  3CQZ H;  2LXK A;  2KHS A;  3H6M A;  5ELN A;  1N33 L;  4XTC S;  3RLN A;  4B3T L;  4ZYS A;  1EYA A;  2VUM B;  1CQF A;  4BBR B;  2ZTE A;  2JE6 I;  1PV4 A;  3S17 H;  1XX8 A;  4DKA C;  4DR4 L;  4GN5 A;  5D65 A;  5KNB A;  5IWA Q;  1PYS B;  1JB3 A;  4GNX B;  3U58 A;  1LT6 D;  2D2C C;  3MEF A;  1X3F A;  3GV6 A;  2QA4 A;  2F0G A;  2I5M X;  1GKH A;  4X66 L;  2ICE C;  2XIW A;  2XSC A;  4DNI A;  3LWE A;  3FKI B;  2B2U A;  3CP0 A;  2IL8 A;  3BDO A;  3O13 A;  4B3T Q;  4LF9 L;  5BR8 L;  1EIY B;  3T1H L;  2B2W A;  3CCV A;  4QB4 A;  3F2C A;  1H9J A;  2VB3 X;  4NMZ A;  2B3G A;  1EFI D;  1XXG A;  2NBF A;  4ZKB B;  4F88 A;  5M5X H;  1PH3 A;  5JPN C;  5M3M B;  1B50 A;  2AQ1 B;  5F2D A;  2JA7 H;  4IPH A;  3MFY A;  3CRL C;  4GN3 B;  3PV0 A;  1HNZ L;  3W3A A;  4R8N A;  4X66 Q;  3W2D A;  3KBX A;  2WKD A;  3K80 C;  5A2Q L;  2E2J H;  4C3I H;  1RJT A;  2B8G A;  1V9P A;  4JI0 L;  4QY7 A;  3TZU A;  3HKZ E;  5ISR A;  1WD1 A;  4LF9 Q;  3UDI A;  3CU7 A;  5BR8 Q;  1SYC A;  2WV6 D;  1H9R A;  5D14 A;  4DUZ Q;  3T1H Q;  1JQY D;  3K5M A;  4LF8 L;  1VMC A;  2KEN A;  3U9S A;  4LUZ A;  2C5C A;  4DA2 A;  5LHY 1;  2B2V C;  1JWS D;  1M90 C;  4QF4 A;  2LMC B;  1TT2 A;  3RR5 A;  5JJK A;  1B8A A;  1HNZ Q;  1ENC A;  2PI2 A;  4KKT A;  1X65 A;  5I4D A;  1A62 A;  4JI0 Q;  2JA6 B;  1SMY C;  2EY1 A;  1HR0 W;  3DM3 A;  4I65 A;  1K8O A;  2DJG C;  3A0J A;  1R4Q B;  1SYG A;  2F0V A;  2B8F A;  4RCN A;  2ZT9 C;  4RA8 A;  2IHE A;  4V19 0;  3KLR A;  1BR9 A;  3J81 c;  4IZ8 A;  4L5R C;  4K0K L;  3E5S A;  2F0U A;  4DAY A;  4GKJ L;  4J8Q A;  2E5L L;  4PV1 C;  2OEO A;  4C3H B;  1YNN D;  1WCM G;  3GTP B;  1EZ6 A;  1ESR A;  3KYH C;  2UUA L;  1K0S A;  2NUC A;  1U4M A;  3CW2 C;  3CC4 A;  2O2L D;  4HJ7 A;  1EWI A;  4A3B B;  1SR3 A;  3L9A X;  1STN A;  2XRQ D;  4OWW B;  3MVV A;  3GTJ B;  4K0K Q;  1EQQ A;  3CAM A;  3Q24 A;  1O78 A;  1DGS A;  5EPK A;  2M9V A;  4X62 L;  1IYU A;  2E5L Q;  5JPM C;  1EOV A;  5C44 G;  2MGS A;  4N8F A;  4A76 A;  4FXK C;  1ET9 A;  2UUA Q;  5FLX E;  1E7Z A;  1IBM L;  2F0M A;  4K8I A;  1FL0 A;  1LT5 D;  1SFO H;  1VQK A;  3E3X A;  4HSV A;  5I9P A;  3PO3 G;  2RF4 A; 
#chains in the Genus database with same CATH homology
 4EQ5 A;  1HR0 Q;  4DR2 L;  4L5T A;  1MJC A;  4B3R L;  1X9N A;  4HJ9 A;  3FKI H;  1K73 C;  3M3Y H;  1QUQ B;  1SE8 A;  3JC6 6;  1HJP A;  4DK3 C;  3DLL A;  4B3S L;  1EQR A;  3PUW A;  2RHQ B;  3AQQ A;  3D0F A;  5HY6 A;  3U4Z A;  1N33 Q;  4X64 L;  2UU9 L;  3M4Q A;  4GOP B;  4KHP L;  5C4X H;  3HFZ B;  4X65 L;  1L1O B;  5LMU Q;  4JBK A;  5IYD H;  2NN6 I;  5LMN Q;  4DR4 Q;  2PNH A;  1Q82 C;  1IZ6 A;  4LUV A;  4WJ4 A;  2NZO A;  1HZA A;  4JCV E;  4L5Q A;  1WYD A;  1IBM Q;  3FHW A;  4DV3 L;  3RN5 A;  3F2D A;  1C9O A;  4DV4 L;  5M3M H;  1EUJ A;  2VZA A;  4BY1 G;  1T9H A;  2JA5 G;  4JI4 L;  4PZ8 A;  4JI8 Q;  5H1S E;  4JI7 Q;  2OWO A;  4P71 A;  4DR5 L;  2B63 H;  1IBK L;  4DR2 Q;  1HZB A;  4LFA L;  4B3R Q;  1WFQ A;  4A3C G;  2I0Q A;  1UE7 A;  1OXU A;  1YNX A;  3AFQ A;  3RLO A;  4B3S Q;  3H0G G;  1A8V A;  4BXX H;  1VQJ A;  4JG2 A;  4R4C A;  4RMF A;  3EN2 A;  2IX1 A;  5FJ8 H;  4X64 Q;  1MJE A;  1V43 A;  2KHJ A;  3BJU A;  4JI5 L;  1XJV A;  2UU9 Q;  2R92 G;  1J6Q A;  3CMA A;  3S1M H;  1WOC A;  4KHP Q;  2MO1 A;  5M3F H;  1X3G A;  1HZC A;  3H3V H;  3I4M H;  2NN6 G;  2YV5 A;  2EXD A;  4OXP A;  2ASB A;  1CKN B;  4IJL A;  4YWL A;  1JJC B;  1PVO A;  1HH2 P;  3TRE A;  2ZM6 L;  4AIM A;  1JJ2 A;  1N32 L;  4KLK A;  3ULP A;  2WB1 G;  2RCN A;  4LW1 A;  5IP7 H;  4J15 A;  4A3M G;  1KD1 C;  4JI4 Q;  1GM5 A;  2UUC Q;  2VUM G;  3H15 A;  4BBR G;  4LF5 Q;  4H02 A;  4OX9 Q;  5FLX c;  4DR5 Q;  3GTK H;  2I5H A;  4LFA Q;  3KDF B;  1IBK Q;  4A3J G;  3MXN B;  5IY0 A;  4LFC L;  3F8T A;  1VQE A;  3HOV G;  1X3E A;  2JA6 H;  2K52 A;  4OWT B;  4DPG A;  4A3I G;  1CKO A;  2ZTC A;  3CCU A;  4JI5 Q;  5AJ3 L;  4DV5 L;  4UY8 C;  4PMW A;  2NZH A;  1LTL A;  1D8L A;  3L7Z C;  4LF8 Q;  4DR6 Q;  4DK6 C;  3JAM c;  4IOC A;  3FKI G;  4JI6 L;  4POG A;  2ATW A;  1N32 Q;  2N8N A;  1W3S A;  1I94 L;  5GAH C;  1OXT A;  1NJI C;  2R93 G;  5LMN W;  2D0O A;  1QZH A;  1NMF A;  2DUD A;  1PH1 A;  4A93 H;  2A1A A;  5C4X G;  4NXN L;  2IT1 A;  2K50 A;  4PZ6 A;  3KF6 A;  4A3G H;  1XMO L;  5K36 G;  1U0L A;  3GTQ H;  4LFC Q;  3ERS X;  4FDB A;  2HIV A;  1N36 L;  2GVB A;  3NEL A;  2Q2H A;  4C3H H;  4MTN A;  1UE6 A;  3NEN A;  3GTP H;  4OO1 I;  2A19 A;  5AJ3 Q;  3CF5 A;  4DV5 Q;  2QGQ A;  4O2D A;  2UXD L;  2BA0 A;  3U50 C;  3L0O A;  4YHH L;  4JOI A;  4IPG A;  4YY3 L;  5GRO A;  1VQC A;  3H0G H;  4JI6 Q;  1QUQ A;  3HOW H;  4A3B H;  3M7N A;  4LFB Q;  1I94 Q;  1L2F A;  4BXX G;  4DV1 Q;  3K7U C;  3ER0 A;  3IRB A;  1IXR A;  5FJ8 G;  3TS0 A;  4AQY L;  3S14 H;  2VQF L;  3GD7 A;  3JAM i;  1KAW A;  1I5F A;  3GTJ H;  4GOP A;  3UDG A;  5M3F G;  1XMO Q;  3HOZ G;  3FP9 A;  4YCU A;  3G4S A;  3HKZ G;  1WI5 A;  1N36 Q;  2R6G A;  1XPR A;  1YHA A;  4GKJ Q;  3PCO B;  3PUY A;  3KF8 B;  4JC0 A;  4A3M H;  1PYB A;  3HOU H;  5IP7 G;  4QIW E;  3M9B A;  3PSI A;  3HKS A;  4JI2 L;  3UE0 A;  4OO1 G;  2QEX A;  5FLM G;  2UXD Q;  5IWA L;  3RLF A;  1CKM A;  4HIK A;  2UXC L;  2E2H H;  4YHH Q;  2CQO A;  1FGU A;  4GOP C;  3RN2 A;  1TWG H;  4JI1 Q;  4YY3 Q;  1L1O C;  4A3E G;  3G6E A;  4A3D H;  3W1B A;  4YWK A;  4A3I H;  3J81 j;  3PIP A;  2JA6 G;  1K8A C;  4R4Q A;  2MNA A;  1N34 L;  3K7A H;  1CUK A;  2HQL A;  4BA1 I;  1VQ7 A;  5GQO A;  4UP8 A;  4AQY Q;  3KJP A;  1W2B A;  1KL9 A;  1K0R A;  4HJ8 A;  3ULL A;  3A5Z B;  1JJG A;  3EIV A;  1AE3 A;  1PH4 A;  2MQH A;  2D62 A;  3KLW A;  2GN5 A;  4UP7 A;  4IPD A;  4X62 Q;  1CKN A;  1K3R A;  1OXX K;  4JYA L;  2YTY A;  3W5O A;  1QZG A;  2RHS B;  2R93 H;  3B6Y A;  5GAG C;  2OTJ A;  4JI2 Q;  1X54 A;  4OWX B;  2JEB I;  1VQF A;  3CC7 A;  1K9M C;  2UXC Q;  4MZ9 A;  4A93 G;  3RZO H;  1BVS A;  4A3G G;  3KDF A;  1KRT A;  2ZTD A;  1VQ4 A;  2JEA I;  4ME3 A;  1SN8 A;  2V1C C;  1UE1 A;  3M4P A;  1XMQ L;  3S1Q H;  4DR7 L;  4BBS H;  4LUO A;  3S16 H;  4O0A A;  1BBW A;  3T1Y Q;  2PMZ E;  1N34 Q;  3PUZ A;  1UEB A;  1HNW L;  1IL2 A;  4YCV A;  3J80 c;  3HOX H;  4DV7 L;  2CFM A;  1QVG A;  1VQL A;  4IOA A;  2H5X A;  2GVA A;  3NBH B;  2VW9 A;  1M1K C;  2FXQ A;  2VNU D;  5M5W H;  1J5E L;  2R7D A;  2CWA A;  5ELO A;  3CCE A;  4DR3 L;  4LF7 L;  1KXL A;  1SRO A;  2Z0S A;  3AYH B;  4JYA Q;  3A5U A;  1GD7 A;  1S3O A;  4DUZ L;  1EYG A;  3GTL H;  3HOW G;  4A3B G;  1D7Q A;  4GLX A;  1G51 A;  1RL2 A;  1JT8 A;  4X65 Q;  1KC8 C;  3LGJ A;  4DUY L;  1S72 A;  2K5V A;  2WP8 J;  3HOZ H;  1S40 A;  1KRS A;  1VQB A;  2JJQ A;  3CCQ A;  2N3S A;  1LUZ A;  2Y0S E;  3S24 A;  1SLJ A;  4NXM L;  1XMQ Q;  4PZ7 A;  2K75 A;  5DLQ E;  4DV0 L;  4DV3 Q;  4DV4 Q;  2I5L X;  3J7Z C;  4A75 A;  1VQM A;  2WFW A;  3HOU G;  2OQ0 A;  5FLM H;  1NE3 A;  3Q8D A;  1KQS A;  3EBE A;  4LNQ A;  4DV7 Q;  1AE2 A;  5EAY A;  1Q8K A;  3S2D H;  4A3E H;  4NPS A;  1PH6 A;  3TQY A;  1Y1W G;  1NMG A;  1J5E Q;  1CSQ A;  2K5H A;  4DR3 Q;  5IP9 H;  4A3D G;  3ICE A;  3J80 i;  1VQ9 A;  3E9H A;  4P75 A;  2C35 B;  1PHJ A;  5IYB H;  1VQN A;  4P74 A;  4DUY Q;  1LYL A;  3OW2 A;  1E1O A;  1V1Q A;  5C0X J;  1KHI A;  4NXM Q;  1YIJ A;  3K8A A;  2WAQ G;  4HIM A;  4QQB X;  2ZM6 Q;  4DV0 Q;  4KHZ A;  2NVX H;  4OON A;  3K81 C;  1C0A A;  4YCW A;  1Q1B A;  4IFD J;  2IX0 A;  3ULJ A;  1HZ9 A;  4P73 A;  4TVA B;  3ZJY C;  3TEH B;  4GS3 A;  1VQ6 A;  1O7I A;  4QGU A;  3KFU A;  1PH2 A;  1BBU A;  1I6H H;  1MIU A;  3G71 A;  3PGZ A;  3HOY H;  4GLV B;  3W1G A;  3S2H H;  1VS0 A;  1VCI A;  2BH8 A;  5GAD C;  3CME A;  2EIF A;  1R9T H;  2PQA B;  1Q46 A;  2AKW B;  1VQO A;  4BBS G;  2UXB L;  3AFP A;  2YTX A;  4BY7 H;  1SMX A;  2IHF A;  2E2I H;  3L2P A;  1A63 A;  5IE8 A;  3HOX G;  4JV5 L;  4APV A;  1PH8 A;  1PH9 A;  1YHQ A;  4QJF A;  4X6A H;  1TXY A;  1Q81 C;  1CSP A;  2R7Z H;  2HHH L;  3PO2 H;  5C4J H;  2L15 A;  1PFS A;  1N9W A;  1X55 A;  1GVP A;  2K14 A;  1Y1V H;  1E3P A;  4AYB E;  2K4K A;  1EFW A;  1G29 1;  1XNQ L;  1E22 A;  1PA6 A;  2Q2I A;  4GLA C;  4MNO A;  3CCR A;  1L1O A;  4IJH A;  4NXN Q;  1HNX L;  2PI2 E;  1Y14 B;  5C0X I;  2KCM A;  1YHB A;  2JA9 A;  1YVC A;  1NY4 A;  4UP9 A;  3TS2 A;  4BA2 I;  2UXB Q;  3PO3 G;  4GN4 B;  1YIT A;  2OCE A;  1OTC A;  2Y0S G;  1RIP A;  2MFI A;  5IT9 c;  3I4N H;  2ZJP A;  3I4O A;  1QVF A;  1Y1W H;  4JV5 Q;  4HJA A;  2XTI A;  1EIF A;  1IYJ B;  1MKH A;  3K0X A;  4DV6 L;  4IO9 A;  2A8V A;  3GO5 A;  4LF6 L;  1FVI A;  2AMC B;  3OYY A;  4GNX C;  1VQ8 A;  2DGY A;  5IP9 G;  2CCZ A;  2F4V L;  3M4O H;  2MO0 A;  2HHH Q;  2WB1 E;  2AWO A;  1HR0 L;  4JBW A;  1XNQ Q;  2XGT A;  3E0E A;  2NVT H;  1TWA H;  2VQF Q;  1VQH A;  4KI0 A;  5IYB G;  4HID A;  1XPU A;  1VQG A;  3CQZ H;  2LXK A;  5ELN A;  3I56 A;  1HNX Q;  1N33 L;  3KOJ A;  3PIO A;  4XTC S;  1VQD A;  3RLN A;  5C0X G;  4DAM A;  4B3T L;  2BH2 A;  1OXS C;  4XIG S;  1JE5 A;  2ZTE A;  4UPA A;  2JE6 I;  1PV4 A;  3S17 H;  4DKA C;  4DR4 L;  1TWH H;  4GN5 A;  2HIX A;  2JQO A;  2K5N A;  5IWA Q;  1UE5 A;  4IFD G;  1PYS B;  1QVC A;  4DAY B;  4GNX B;  2ZJR A;  3U58 A;  3UDF A;  3OTO L;  3WWV A;  4DV6 Q;  1Z9F A;  1Q7Y C;  4PG3 A;  3MEF A;  3HOY G;  2KHI A;  1K83 H;  2CKZ B;  2CWP A;  2IY5 B;  1X3F A;  1WJJ A;  1YZ6 A;  2Z6K C;  2QA4 A;  2I5M X;  4BY7 G;  2HT1 A;  1GKH A;  4X66 L;  4EX5 A;  4DNI A;  1ASZ A;  4NB3 A;  4A3F H;  1X56 A;  1XTD A;  3NEM A;  1VQA A;  3CP0 A;  4P72 A;  4QL5 A;  3A74 A;  5J3B A;  1NTG A;  1I50 H;  1PH5 A;  4B3T Q;  4LF9 L;  3BU2 A;  5BR8 L;  1EIY B;  3T1H L;  4POF A;  2R7Z G;  1YEZ A;  3PO2 G;  3CCV A;  3F2C A;  1Y1V G;  5C3E H;  1VQI A;  5GAE C;  2B3G A;  2N78 A;  2OTL A;  2OQK A;  3OTO Q;  5JEA J;  1WCM H;  5M5X H;  1PH3 A;  3CD6 A;  4DR7 Q;  4AYB G;  4DV2 L;  4ALP A;  1N8R C;  2UUC L;  4LF5 L;  2PQA A;  2JA7 H;  4OX9 L;  3S1N H;  3CXC A;  4IPH A;  2VQE L;  4GN3 B;  4B3M L;  3PV0 A;  1HNZ L;  4R4O A;  1K8G A;  1HNW Q;  4X66 Q;  1P8L A;  2LXJ A;  3K80 C;  3STB D;  1VQ5 A;  2E2J H;  4C3I H;  3U4V A;  3KJO A;  3CCM A;  3I4N G;  1UWV A;  1V9P A;  4JI0 L;  4HJ5 A;  4QY7 A;  4LF7 Q;  3HKZ E;  4A3K H;  3UDI A;  5BR8 Q;  3M85 A;  4R4I A;  4LF9 Q;  4DUZ Q;  2KBN A;  3T1H Q;  1IBL L;  4YWM A;  2R7F A;  2E8G A;  3E9I A;  4LF8 L;  3J7A 5;  4DR6 L;  4C2M H;  3GDE A;  1GO3 E;  2KEN A;  5HGQ A;  3BZK A;  1JB7 A;  2VY3 A;  4LUZ A;  3VDY A;  1YJW A;  1M90 C;  5C44 H;  2D0P A;  4DV2 Q;  4R4T A;  3RR5 A;  3F2B A;  5JJK A;  2JA8 G;  2VQE Q;  1B8A A;  1P16 A;  2VS1 A;  5IYC H;  1HNZ Q;  4B3M Q;  1BKB A;  2PI2 A;  1X65 A;  4A3L H;  3D31 A;  2AWN A;  3STB C;  1A62 A;  4JI0 Q;  2Q2T A;  3PO3 H;  1HR0 W;  3DM3 A;  1Z47 A;  1YJN A;  3A0J A;  1IBL Q;  4IPC A;  1Q1E A;  1TWC H;  3I7F A;  1B70 B;  4GKK L;  3CCJ A;  1LM0 A;  2EQS A;  1FJG L;  3CCS A;  3CPF A;  2UUB L;  5JJL A;  1I3Q H;  2IHE A;  4HIO A;  3CPW A;  1TWF H;  4JI3 L;  4A3F G;  1B7Y B;  4LFB L;  2N49 A;  4DV1 L;  1Q86 C;  3SGI A;  1E1T A;  2F3I A;  3BZC A;  1XPO A;  1XNR L;  2YYZ A;  1ASY A;  3J81 c;  1YJ9 A;  5E7N A;  4A4I A;  4L5R C;  1G6P A;  5IYD G;  3H3V I;  4K0K L;  3CCL A;  1YBY A;  5C3E G;  1L0W A;  3RZD H;  1C7Y A;  4LF4 L;  4GNX A;  4GKJ L;  2NVY H;  2JA5 H;  2E5L L;  4BY1 H;  5M3M G;  1YI2 A;  1Q12 A;  1WCM G;  2B29 A;  5JEA G;  4Y7N H;  4R1J A;  1A0I A;  2JA7 G;  2B63 G;  4A3C H;  1VQP A;  3KYH C;  3UDX A;  2ES2 A;  2UUA L;  4GKK Q;  4JI1 L;  4LWC A;  4IFD I;  2KCT A;  1FJG Q;  3PUX A;  1AH9 A;  2BA1 A;  3CW2 C;  2UUB Q;  2YU9 H;  2NVQ H;  3CC4 A;  4JI3 Q;  4HJ7 A;  1EWI A;  1X6O A;  2ID0 A;  4JBM A;  5JJI A;  1SR3 A;  2F52 A;  2R92 H;  4DR1 L;  1XNR Q;  4A3K G;  3I55 A;  4Y52 H;  1NBW A;  1U5K A;  4OWW B;  1PH7 A;  3AEV A;  2YTV A;  4L5S A;  4K0K Q;  3RNU A;  1EQQ A;  2AHO B;  3CAM A;  4C3J H;  3I4M G;  3PUV A;  2VL6 A;  1KIX A;  1DGS A;  4JOI C;  5M5Y H;  4X62 L;  2ZJQ A;  3S15 H;  4LF4 Q;  3J81 i;  1JMC A;  3TRZ A;  2E5L Q;  3CC2 A;  1EOV A;  1OXV A;  2VUM H;  3F1Z A;  2Z6K A;  4BBR H;  3PF4 A;  4RG1 A;  5C44 G;  2JA8 H;  1E24 A;  5LMU L;  3KF6 B;  2JK8 A;  4A76 A;  5LMN L;  4A3J H;  2LSS A;  2UUA Q;  1SRU A;  4TQU S;  3G48 A;  3HOV H;  5IYC G;  3S1R H;  1E7Z A;  1IBM L;  3UE1 A;  3GTG H;  3I2Z A;  4WJ3 M;  3T1Y L;  3PF5 A;  4A3L G;  4JBJ A;  1FL0 A;  2Q2U A;  1H95 A;  2ALY B;  2WAQ E;  4AH6 A;  4DR1 Q;  1SFO H;  4JI8 L;  1VQK A;  4LF6 Q;  2F4V Q;  3GTO H;  4JI7 L;  2RF4 A;  3GTM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...