1J5EO

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1j5eO00
4JI3O 2UU9O 1KUQA 1X59A 2UXCO 5IWAO 4B3TO 4DV0O 2JRIA 2DJVA 4A5UB 4JI6O 1FJGO 4X64O 4JI4O 4LFAO 4DV6O 1I94O 4DV7O 1XNRO 4X66O 4LF8O 4DR1O 2E5LO 4DR7O 1FYJA 3M8AA 5IT9N 1XEQA 2HHHO 4OX9O 1HR0O 4YY3O 4DUZO 4DR2O 4JI5O 4JI7O 2LW7A 1R6TA 2UUBO 3J80N 2UXDO 4OPHA 3F5TA 3SDLA 1F7YA 1HNXO 2ZKOA 5LMUO 1N33O 4LFCO 1A32A 2FKXA 2UUCO 2VQEO 4LF7O 1AILA 1FKAO 4DV2O 5BXZA 4NXNO 4X62O 4OPAA 1XMQO 4DV5O 1N36O 3OTOO 5LMNO 2VQFO 3T1YO 4JYAO 4JI2O 4LFBO 2F4VO 1YZBA 4AQYO 5FLXN 5BY1A 4JI8O 5A2QN 1HNWO 1XNQO 4B3MO 4B3RO 2ZM6O 1IBKO 5BR8O 4DV3O 1G1XB 2UUAO 1IBLO 1IBMO 4K0KO 2DOSA 4NXMO 1AB3A 2Z0AA 1XMOO 3J7AU 1HNZO 3J81N 4DR5O 4X65O 4DV4O 4DV1O 2AGAA 1DK1A 4LF5O 1J5EO 4DR4O 2N74A 4DUYO 4LF6O 4DR6O 3T1HO 1N32O 2UXBO 4JV5O 4LF4O 4B3SO 4JI1O 1R1BA 4GKKO 4GKJO 3O65A 3RT3C 1N34O 3R66A 4DR3O 4LF9O 3JAMN 1NS1A 4YHHO 4KHPO 1D2DA 5LL6Y 4JI0O 5H5NA
chains in the Genus database with same CATH superfamily
4JI3O 3E22A 2ZE8A 2CDYA 1K9MW 1H38A 1S5HC 2JRIA 4A5UB 4I4TA 3SYOA 1WB8A 1B06A 2QTSA 3JARB 1FJGO 2EILC 5EIBD 2LFSA 1N0JA 3ABKC 4ZIBA 1S72V 5LA6B 1YJ9V 3EVKA 3O9OA 1M90W 3JAWB 3SPCA 2WWWA 1Q3EA 2AHZA 4ZHQB 1WP7A 1SETA 1AI6A 4WBNA 2UXDO 2D2CB 5D5QA 3LNNA 1MSDA 4OXSA 2GHYA 4TQDA 1PKXA 5E79Z 3WU2Z 2VQEO 3UM7A 3AG2B 1WJZA 2EZPA 4BIZA 5BXZA 3K57A 4YIOA 2E74B 4KHPB 5KA5A 3W7TA 1WPBA 1RM1C 1T5EA 1BQZA 3P32A 4LFBO 2XHBA 4FM1A 1K34A 2Q8VA 3C3SA 3ZIAG 3CS5A 5L3EA 4PDVA 3SPGA 1Z5VA 2YIBA 3SYPA 5B1AB 5H2FZ 3SJCC 1G1XB 4DR1B 1FXVA 1NBMG 3CRRA 1KB9F 1BCCH 1FFTB 4HYOA 2AGAA 1ZAUA 2PYJA 4J11A 2P4KA 2Q68A 2ODMA 4NR1A 4CH5A 1MZEA 1M9NA 2LGQA 4YJ3A 3T1YB 2VS0A 1M57C 4GKKO 1R6KA 2YXYA 5CMUA 1Y74B 4X20B 4JI8B 4PJ0Z 2X6CA 1HWYA 1Q6HA 3CCRV 3G6EV 4B3RB 4C7UA 3K5OA 2P06A 1WPXA 4MTGA 1E1QG 1SERA 5KX5A 2E5LO 1SQPH 1KP2A 4UV9A 4FMTA 4FFBB 4W4KA 2FMLA 3F5TA 3VOUA 4DR6B 3B4SA 3SDLA 4I9WA 1THZA 2NR5A 1S5LZ 4MTFA 2QR4A 4FJCC 3WB2A 3HKBA 1G8MA 4I9QA 4NXNO 1E1RG 2EIJB 3JYCA 5FL7G 5KX5B 3CMAV 5JJJB 3OAAG 2CE4A 4ZBMA 2Q67A 4X65B 2JS5A 1ZUQA 4GX0A 2Y69B 3THOA 5GW7A 3QO8A 2CTRA 3ZBHA 3AK2A 4JI6B 2Q73A 3HB3B 1IVSA 2EIKB 3FB7C 1JVMA 5IYZB 4LF8B 3HKBB 3PN1A 4GT1A 2E76B 4JYBA 2ZIOA 3OE7G 1IBMO 3AG4B 1YCIA 1P49A 3W7WA 2NN4A 3S3XA 1J5EO 3CHXA 1XQ8A 1GKFA 3JD4A 2Q5ZA 3CWBH 5LP6A 5DN6G 1LR1A 3FB8C 4UB6Z 3EFFK 1Q90D 3VQVA 2EIMC 1Q6UA 4GKJO 5CBGA 4GX5A 3AG3B 1IDSA 3T2MA 1K7DA 1SC5B 3FAVA 2F66C 1GMGA 4D6TH 2JDIG 1TGOA 4JYYA 3RYIA 4GLXA 2OCHA 4LF7B 1WNSA 4KP4A 2YIDA 1JQ0A 3N2KA 1GN3A 4LR3A 5LP6B 2UUAB 3X2QC 4Q20A 2QWRB 4EFBA 5LGTA 4EKWA 1QU7A 3FYIB 3WG7B 1UPGA 3B09A 1K3EA 2N04A 5DEDA 4TT3G 1EZJA 4L87A 4DW1A 3CC4V 4DV1B 2QSAA 4DR2O 5KUKA 5CA0A 2EX3A 1F7YA 5L3DA 4UCVA 1YDXA 5DECA 2RDCA 4CBCA 2FKXA 1SQBH 5KAIZ 4LWSB 4DV2O 3UT5A 4B7EA 2G38A 2PY5A 4JI0B 5KAFZ 2YS8A 1FAFA 2BSKA 3CXHF 3K79A 4DK1A 2EULA 5CA0B 2EINB 1Q8IA 2OT5A 5EYPB 4LNUB 4HNAA 1NR1A 1PNLA 1OZ0A 5CA1A 4MW8A 4JI7B 3UT5B 3JALA 3ZN0A 1BT8A 2DQ3A 3DSQA 3JASA 1XILA 3K3WA 3ASNB 4TV9A 1YITV 3A2FA 1VQ6V 4GX1A 2ETNA 4DV5B 2PZSA 4I7ZB 2P5OA 4R8CA 3OTOB 1KP3A 2VQFB 5FPOA 4JYAB 1R73A 2D3OW 1SKVA 5CA1B 5J9PC 4DR3O 4MSWC 1TAEA 4TV8A 3JATA 4FVMA 4TV9B 1XBLA 1K5SA 2ZM6B 1IBKB 5B1NA 2ZCEA 1B3QA 2CTQA 4X64O 4DV6O 3H1IH 3ZJZA 3ETGA 1PNMA 1NH2B 1OCOB 4X1KA 5GTIZ 3M8AA 4J7ZA 5BMVB 4EEQA 5JJNB 4OX9O 1CEZA 4DUZO 5L3CA 2XASA 2IM9A 4HZ3A 1GH6A 2XTAA 4KL1A 5J2TB 3ABUA 3CRCA 4DYLA 3STLC 1DF4A 1ZSPA 4X9QA 4CZZA 1H8EG 5JVDA 4X62O 4OPAA 1O9HA 4YJ2B 1SZTA 1XMQO 2DYRC 3OGCC 1QLEC 3QF7A 4X1KB 5LMNO 3ICXA 1SA0B 2F95B 3CD6V 2Y4UA 4G2KA 3W7SA 4HBNA 1KYOF 1K73W 3E2EA 5LYJA 4P9PA 3RWRD 5L3GA 4H44B 4LFAB 2B5UA 3CC7V 1SS3A 4XBFA 4JTCB 3CRQA 4MVMA 1BSMA 2EBOA 2WLLA 1NR7A 3MAQA 3BABA 4NKGB 1P84F 4I0XB 4RO2A 1YVWA 5LMUB 4FLZA 5B3SC 2H3OA 3L72H 1MNGA 1HDJA 4O4IB 4DUYO 1URFA 4O2AB 5LYJB 4ABMA 3HKEB 1H8HG 3IAYA 5LBQA 3CCMV 1Y6XA 1TUEB 3APOA 3K08A 4KXRA 2BOCC 2WLLB 4Z1MG 1ZX3A 2Q7EA 1NS1A 2UUBB 3NR7A 3JAKB 3U11A 1VQ5V 1KUQA 1X59A 5EC1C 1QHTA 1FXKC 4B3TO 3ZRWA 1N0NA 2ZT9B 4DV3B 1D5AA 1SQGA 1OV9A 3MHSC 1GAXA 1U96A 4JAVA 5EIBC 5IY5C 1YIJV 4O2BB 4DV7O 1UJWB 4X66O 1SF9A 1XMOB 3HKDA 2HVJC 5EZYB 2E3CA 4K3AA 3ZRVA 4JF3A 1V54B 2ARHA 4YY3O 4Z1VA 4DR4B 3GWOA 3VQYA 3QVNA 1TA8A 2JJ2G 3E83A 4LFCO 4LF4B 1H2LA 2BOBC 2CK3G 5CB4B 1WB7A 3FYEB 4U7NA 4YHHB 3HKDB 2GUZB 3IGAC 4JI3B 2F93B 3LNMB 1YJNV 1S3JA 1FJGB 2LW1A 2YI8A 1K92A 3T4DA 4MTXA 3ZEDA 4RUEA 4K0KO 3M7MX 3F7YC 3UO2A 2DOSA 4DXWA 3BRCA 1SQFA 1O9GA 2UXDB 3L9DA 5B1OA 3ETEA 2CH7A 2ZE5A 2WLIA 4PDRA 2VQEB 1Z2GA 3CRMA 2OWOA 2A3QA 2KQXA 3ZRSA 4X1YA 3DTUB 4MVOA 3H1LH 4B3SO 2R9AA 3CCJV 1PV0A 5LHHA 5ITZA 2RQ6A 3G4SV 4LFBB 2GBOA 3OTFA 1R3JC 4KUMA 1L1FA 1VQ9V 2V7QG 1AI7A 1SRYA 1GM7A 3E86A 2Y4TA 1KMIZ 4D7TA 4DV0O 2UUCB 2BTQA 2R72A 2QWOB 3ABMB 3P30A 1IXMA 4EFEA 3OMNB 1HR0O 5F2VO 1SQQH 3FFQA 2JGUA 4NVPA 1YI2V 1VQ4V 2ZKOA 2IJHA 5JQGA 3OM3B 1VQKV 3DGEA 3S3WA 2VRZA 1QCEA 2UXXA 1OCRC 4IYIA 4PA6A 1DGSA 2ZE6A 4IL6Z 4O4HA 3RW0A 1K4CC 3A0HZ 5BY1A 3E22B 1AR1B 1LNQA 4PI0A 4FPPA 2P22C 4RAIA 2IH1C 4Q6GA 2CGNA 4H0LB 4I4TB 1JJOA 4TQFA 2E5LB 3K04A 2YIAA 3I55V 3OR6C 2X6AA 2IJKA 4NXMO 4X8AA 2QDOA 3OGIB 3J7AU 2MK3A 2LFRA 1FXKA 2IU3A 4O4HB 1M5IA 1BGYH 3AG1B 4WBNB 3ZMZA 4KFMA 3HKCA 1JCHA 2XAHA 3BA8A 4NXNB 4QGPA 2RN9A 1B04A 2EZOA 1G6UA 3ETQA 3IFXA 1R3IC 4P9OA 5LL6Y 3K9AA 4MVQA 3CE2A 4R50A 4CH6A 1KECA 2UU9O 4N21A 2ZINA 1PD3A 1COWG 3C90A 2DJVA 2YEVA 1K4DC 1IBMB 1I94O 4UCUA 4G28B 1NTMH 5LGNA 2DN9A 3BEHA 4PHZA 1S0VA 1J5EB 3ASOB 3D36A 4H37A 3CCEV 4I5SA 4QE9A 1NVPD 5EBWC 1AILA 1ENVA 2A06H 2YEVB 4GKJB 3FKSG 2L6LA 4YJ3B 2JEXA 1W0JG 1OHHG 4XDKA 5CBHA 2WSSG 1UFIA 2WLMA 2X7RB 1WN7A 2OIEA 5IDJA 2NNUA 3JSLA 5CA3A 1QLNA 2YC0A 4PD4F 2ITCC 3GB7C 3ZRXA 2XNDG 1IBLO 4JTDB 1VF6C 4DR2B 1VEWA 2L35A 3F5WC 3SPHA 3OD4A 4MT8A 1VQNV 4J9ZB 1NVPB 4G27B 5K1XA 4ZI7A 4UCSA 2FL4A 2DYSB 4LF6O 4DV2B 3OMIB 1JOYA 2IH3C 3BPZA 4BR6A 1MMMA 1JPXA 4IHJA 1XL4A 3JAMN 4CS3A 5IJ9A 5H5NA 3E8BA 3LDEA 3RYHA 1OCZC 2EJ7A 4ZI7B 2QM7A 5LOVA 4CS4A 1YHQV 3UCSC 4LP8A 4JI4O 3BY6A 1JA8A 2M7WA 4JZ2A 5L3BA 4UV8A 1K97A 1NJIW 4ICGA 4IHJB 4JAAA 3CPWU 2CAZC 2ZD9A 1R6TA 4WFGA 4UCOA 3EHBB 5H6QA 4IIJA 3RYHB 2YI9A 4NTXA 1HNXO 1N33O 3B8MA 2EILB 3B8NA 3RYFA 2HFEC 4NTYA 3TETA 5JH7A 3K0GA 3ABKB 3IC7A 2OCCC 2QM4A 4BIUA 5GONA 4DR3B 2ZXWC 1MABG 4U7OA 1Y66A 1QQCA 4WFEA 1AI5A 1VQLV 4PDMA 4FLVA 1IXBA 2P4VA 1KBHA 3FAVB 2CGOA 2W6JG 3RYIB 2W0FC 4X64B 3G71V 2ZIMA 4LH6A 4DV6B 5JH7B 3H9VA 4PELA 1M4UA 3N2KB 2ZR2A 4O4LA 4J7JA 3IJ4A 4JI1B 5EBLC 1RM1B 5GONB 4PDLA 4OX9B 4DUZB 2HP8A 3SR2C 3K59A 1HNZO 2KB1A 3ZHVA 4TWKA 4X65O 1VQ8V 4J41A 3K5NA 2W0XA 3G80A 3QO5A 1EBOA 2CUGA 2XAFA 3T1HO 1Y4MA 4JV5O 4TOIA 4X62B 1XMQB 4IYHA 4O4LB 3FD9A 5B1BC 2JGDA 1R3KC 3L73H 5LMNB 1Q86W 3LUTB 4JI5B 2DW4A 1NH2D 4PI2A 4ZKIA 4FIPC 3ZMVA 2BSKB 4RQEA 1PP9H 2HR3A 1N8RW 4LBEC 1WLEA 1GM9A 1NTZH 1RSOA 3I5DA 1M57B 4HNAB 2C2AA 1I5YA 1XNRO 3ABLC 3OEHG 4J42A 1QVGU 1P7BA 4DR7O 3VBBA 1L8DA 5C8YA 2HHHO 3JALB 3K5LA 2LW7A 3BFRA 4E4EA 3OT7A 4DUYB 1V55C 3JASB 3B77A 4EB6A 1I5XA 1SZXA 5JCOC 3HPLC 2R9IA 1OCCC 2JEUA 2QTOA 2ZR3A 4CH4A 4LF7O 1VF6A 1RSOB 3OEEG 2VWKA 4B08A 3CCSV 1XDCA 2HLDG 1QNMA 5LGUA 3CRAA 1NTKH 1H2SB 5C8YB 1M56C 5LHGA 2QKSA 5IE9A 4TV8B 3U10A 4B3TB 1ZWIC 3JATB 2JS3A 1HNWO 1WA8A 2R9RB 1DF5A 4DV7B 4X66B 4B3MO 1YXBA 5BR8O 4I50A 5H9CA 2VWJA 1KQSU 2F23A 1VMGA 1AR5A 4YY3B 3CCQV 2Z0AA 2LQTA 3RVZA 1RPRA 2KSDA 2HJDA 5TISZ 4WF9V 4LF5O 4J7KA 2QM8A 1GM8A 2KG7A 2O57A 1N32O 2Z5UA 1WA8B 4DO2A 3SJAC 2ZE7A 5EBMC 1MSWD 4H33A 5JVDB 3JD3A 4JPRA 4LF9O 2QJ1A 3R65A 2DWEC 5JJEB 4MW3A 2IBZH 2R70A 2DWDC 4K0KB 2EIMB 3Q4HA 1WP8A 3CCUV 5CN0A 3IC9A 3ZHTA 4F4LA 3AG2C 4AHCA 4FLUA 4TUYA 1VARA 4JI2B 2WLJA 2ZQMA 1Y67A 2BE3A 4P2ZA 4OPHA 4JGSA 1K8AW 3BVOA 1G4YB 1ZL8A 2F1MA 3X2QB 2FYUH 2XAQA 2WLKA 1XOUA 4K35A 3ZMUA 1S5JA 5EK0A 2AHYA 4U3FH 1DTOA 5B1AC 1IX9A 3TXSA 1R6NA 1W2BU 1N36O 4TUYB 2HVKC 1CP9A 4AI8A 4BIOA 2ZDIC 1BE3H 4TSFG 4DV0B 4AQYO 3E35A 1VF5B 2QKCA 4O4JA 2K9PA 4WFFA 1ZL8B 1US6A 4IT5A 1XNQO 3ZRWB 2HKOA 5H6RA 1VQMV 2Q0AA 2IJJA 1YTFB 1JX9A 1HR0B 4U3JA 1EZVH 4BAYA 3NXSA 5L3FA 3D8CA 1AI4A 3FB6C 5B66Z 1VQPV 3QO7A 3U0ZA 4DR5O 5KMGA 4DV4O 3WB1A 3E8GA 1M93A 1ZTEA 1DK1A 4RQFA 2RMKB 2N74A 2F43G 4HAMA 2WLHA 4FM0A 1W59A 4PV1B 2YDEA 3PJSK 2PI4A 1M1KW 1NKDA 5IYDO 1FPOA 1NI8A 4B7KA 4R6ZA 3RT3C 2ATKC 2LGWA 4U3JB 4QPKA 5J2UA 3TXQA 4YIPA 5JCOA 4K8XA 1LUVA 4F6RA 3TJTA 2UXCO 5IWAO 1KC8W 3JD2A 3B2EE 1H2KA 2WA3A 3W7XA 5KUMA 4NXMB 2WPDG 4UUJC 4F6EA 3KKYA 2DMXA 2EIJC 2WAMA 1BZKA 1QVFU 4X88A 1N4CA 2UUBO 1GN6A 4I55A 3OR7C 3ZHUA 2CH7B 2JVDA 2Y69C 3GVMA 1VIBA 2WLIB 5A9GA 2A79B 4JASA 1FKAO 3ZHQA 2GV9A 2EIKC 2LJ2A 2YSUB 4CH3A 4X1YB 2QWPB 2HJFC 5ITZB 3AG4C 2UU9B 3ZHSA 3CXCU 4JTAB 5A2QN 4AILC 3SGIA 3LSSA 1I94B 2BTQB 2H8PC 1EN6A 3LSUA 2DYRB 3OW2U 1QLEB 4GKKB 5LA6A 4FLTA 2P67A 1HP8A 5C93A 1KKDA 3T1CA 1YEWA 3J81N 4JZGA 3AG3C 2ADPA 3D3IA 2N05A 4MVZA 4YXWG 2IU0A 3D3QA 3QG5A 2UXBO 1JJ2U 1GN2A 2B9ZA 4LH7A 3SYCA 3H01A 5JQGB 5LP6C 3FX7A 2QA4V 1JR9A 3F7VC 2PYLA 1NU1H 2YIBD 1R1BA 1V9PA 3ZMSA 4FK5C 3R66A 3T4ZA 1N34O 3WG7C 5B3SB 1D2DA 4BWAA 3K0DA 3LSQA 1H2GA 4PA7A 3K06A 2AZ0A 2V4DA 1IBLB 3I56V 2JJ1G 2QGNA 2ZDIA 2MW2B 1XHZA 1TUBA 5IT9N 4IGGA 4JAUA 1AJNA 4K8ZA 2RCVA 4FLXA 4CC5A 2Y0IA 1FXKB 4MTOA 4LF6B 1CXZB 1YSCA 5IY5B 2EINC 1XREA 2IW5A 2UUCO 5B5EZ 1XUQA 2YUAA 4ZOLA 3HKCB 1MOFA 1VP7A 1LUWA 4N23A 3JSNA 1Y74A 2NLJC 2QWNB 1TUBB 4X20A 1AP5A 1Q6IA 1SQVH 2H94A 2X6BA 2F4VO 1H2MA 3KZIZ 1SESA 3TGUH 4NYKA 3CEIA 5E1AC 3ASNC 2FB5A 1MA1A 5K1PA 1D5NA 5HFLA 4JI4B 1L0NH 2V1DA 1FXHA 4WCEV 4ZOLB 1S76D 3AG7A 1FFXA 1B6QA 3H1KH 3KCXA 3MD0A 3HR0A 2W6IG 5LHIA 4FFBA 2Y48A 1XI1A 1HNXB 1N33B 4FFKA 4FM2A 1R3LC 3A0BZ 3G6BA 3ZHRA 3WFVA 4QE7A 1KKCA 4FLWA 3ETDA 2A7WA 3TCUA 2JK5C 3JD1A 1FFXB 2PUSA 4CC6A 3O65A 4X1IA 3BA9A 1QR9A 4D7SA 4KHPO 1OCOC 1ORQC 4DW0A 3SJQC 5IYCO 5IYZA 3SPIA 4JYCA 1H2NA 1MG1A 3WB0A 2DQ0A 2P90A 2E75B 1X4TA 1HNZB 4DR1O 2Y0PA 1S77D 4PA3A 2OTLV 4X1IB 2Q0OC 3UKMA 2GTSA 1IZ3A 1GO3F 4RWUA 3J80N 3LDDA 3T1HB 2K1EA 4JV5B 1J95A 2EJRA 3E8FA 3SYAA 1L0LH 3KG2A 1BHBA 3OFNG 3T1YO 3QTCA 3K58A 2CTPA 4UVBA 4UCTA 5IJ9B 1VQ7V 1I08A 3W7UA 2AZ2A 3OMAB 4JI8O 4MVRA 3RVYA 5CBFA 3RGBA 1F4MA 5LOVB 1XNRB 2GDSA 4B3RO 1PM9A 4P30A 1KD1W 4DR7B 3H1HH 1F23A 1OCRB 2HHHB 2KKWA 4MS2A 2HG5C 4QIWF 5LXTA 4J9YB 3OUFA 4CS2A 3ZX6A 2YICA 1XL6A 1YF2A 4IIJB 2XT9A 4DR6O 4LWSA 5DM6V 1Q43A 2FTKA 3K9SA 2WLNA 3CMEV 3RYFB 3H1JH 3ZS8C 4J10A 3EXAA 3MDSA 5LXTB 1EN5A 1V54C 4BW5A 1HNWB 2A9HA 5EYPA 1FS0G 4LNUA 1NQTA 4B3MB 1Z5WA 2GTAA 5BR8B 4X89A 4JI6O 2B1IA 1RP3B 2P7TC 4Z2WA 2YXLA 2YXHA 4LF8O 3BAAA 3RYCA 1FYJA 2PGGA 4LF5B 1BL8A 1Y76A 3CP1A 5IYBO 5D5PA 2Z3YA 4GCZA 3P3NA 2X0LA 1N32B 5EC2C 2UXNA 1A32A 3STZC 1BQ0A 2LO1A 1TVKA 2BCCH 4QJFB 2BTOA 2XOKG 1NT2B 4LF9B 2JGDB 3ML0A 4L8JA 3RYCB 4NB5A 1F4NA 3CCLV 1F51A 5FPRA 1PPJH 1GRJA 1Y76B 5FLXN 1VF7A 1QR8A 1SQXH 3OUSA 4WFAV 1BMFG 1TVKB 3K03A 2UUAO 4XDLA 3CYOA 1GN4A 1I0HA 5BMVA 3JD0A 1IURA 5KA6A 1PL0A 1AB3A 1JMKC 3VQWA 4DV1O 5J2TA 1YJWV 3JCUZ 4LC1A 3CJHA 3CC2V 3QNEA 4EB6B 5KHGA 1RPOA 4GX2A 4WFHA 3L74H 4YJ2A 3RFRA 1N36B 2PI5A 4JI1O 3ABMC 1GTOA 3L75H 3TK1A 1SA0A 1AJPA 2AXTZ 4AQYB 4JI0O 4BW9A 4WFBV 1XHXA 4UVCA 1EN4A 1XNQB 1KU9A 4LFCB 3CJHB 4UFZA 2P6JA 3M99B 4W4LA 1Q7YW 1E79G 4XDJA 1BHAA 3FB5C 2WA4A 2OYQA 2HEPA 2LP7A 1PNKA 4I50B 3SJBC 4FLYA 3A0RA 3P3PA 4RUFA 4DR5B 4I0XA 4DV4B 1Q81W 1OCZB 5JWPA 4JI5O 4JI7O 2ZNIA 4MVSA 4O4IA 2M6YA 2QWQB 4O2AA 3HKEA 2Q69A 3BHPA 3CSXA 3N2GA 2KG7B 2A0LA 3B40A 3K5MA 5KHKA 3CCVV 1P7GA 5HFMA 4DV5O 2CTWA 2ITDC 4LCUC 3OTOO 2VQFO 4JYAO 2PTMA 1YTFD 4DRXA 3JAKA 2ADQB 3C3TA 3L71H 2UXCB 5IWAB 3ZN1A 1OJHA 3GWKC 3G67A 2RNBA 4GZRB 5GTHZ 3AG1C 2OCCB 4DK0A 1ROPA 3UQ8A 3N2GB 2ZXWB 1W0KG 4O2BA 2ZM6O 1IBKO 4B3SB 2GSMB 5EZYA 1AR4A 3Q4HB 3JCZA 1P4RA 3ZCCA 2JIZG 3ABTA 4DRXB 1U97A 2Q9LA 3ZMTA 2Q7HA 4ASUG 1EM1A 2IJIA 4GUNA 5CB4A 5FNVA 2ILMA 5KHHA 4J80A 2GUZA 1Q82W 1QBZA 3LDCA 4FZ0A 3AEIA 3RBZA 5AG2A 2DE0X 3SPJA 4FZ1A 3ASOC 4UXNA 3SYQA 4O4JB 2RJZA 2XAJA 5B1BB 3CX5F 2QKAA 3DXRA 3MHHC 5FNVB 4LFAO 4OGQB 3CB2A 2ZNJA 1FD9A 2B1GA 4GYCB 1HW7A 1XEQA 2PF4E 4PA4A 2XAGA 2Q6AA 3E8HA 1DLBA 3APQA 1GK9A 5KMGB 1BS3A 4UVAA 1RFYA 3AK3A 5LMUO 4R7CA 2UXBB 1AROP 3DC5A 1ZLZA 3D36C 1MZFA 3ABLB 1JFFA 1Q5OA 1NZ6A 1PL4A 1WAZA 3DXRB 4H13B 3RN4A 1N34B 2AW9A 3A8TA 4JI2O 1V55B 5J2UB 4MVUA 1YZBA 4F6RB 4QNHB 1AP6A 1OCCB 5IJ0A 2Q4PA 3E89A 4UB8Z 3DC6A 5KHJA 4E2LA 1AJQA 3KCYA 5BZBA 2QE7G 3L70H 2XUMA 1VQOV 2DYSC 4QPJA 1JFFB 4DV3O 1EFRG 4PA9A 3UO3A 1K5QA 1I7FA 4NTWA 1M56B 1XMOO 2Q7GA 2QEXV 4DR4O 4I55B 5IJ0B 5KLVH 3AK1A 3JARA 3BCCH 2OTJV 5KHIA 1CPYA 4LF4O 3N27A 4UCRA 1K33A 2F4VB 3JAWA 4YHHO 2OIGA 3VQXA 4ZHQA 1AVMA
chains in the Genus database with same CATH topology
4JI3O 2UU9O 1KUQA 1X59A 2UXCO 5IWAO 4B3TO 4DV0O 2JRIA 2DJVA 4A5UB 4JI6O 1FJGO 4X64O 4JI4O 4LFAO 4DV6O 1I94O 4DV7O 1XNRO 4X66O 4LF8O 4DR1O 2E5LO 4DR7O 1FYJA 3M8AA 5IT9N 1XEQA 2HHHO 4OX9O 1HR0O 4YY3O 4DUZO 4DR2O 4JI5O 4JI7O 2LW7A 1R6TA 2UUBO 3J80N 2UXDO 4OPHA 3F5TA 3SDLA 1F7YA 1HNXO 2ZKOA 5LMUO 1N33O 4LFCO 1A32A 2FKXA 2UUCO 2VQEO 4LF7O 1AILA 1FKAO 4DV2O 5BXZA 4NXNO 4X62O 4OPAA 1XMQO 4DV5O 1N36O 3OTOO 5LMNO 2VQFO 3T1YO 4JYAO 4JI2O 4LFBO 2F4VO 1YZBA 4AQYO 5FLXN 5BY1A 4JI8O 5A2QN 1HNWO 1XNQO 4B3MO 4B3RO 2ZM6O 1IBKO 5BR8O 4DV3O 1G1XB 2UUAO 1IBLO 1IBMO 4K0KO 2DOSA 4NXMO 1AB3A 2Z0AA 1XMOO 3J7AU 1HNZO 3J81N 4DR5O 4X65O 4DV4O 4DV1O 2AGAA 1DK1A 4LF5O 1J5EO 4DR4O 2N74A 4DUYO 4LF6O 4DR6O 3T1HO 1N32O 2UXBO 4JV5O 4LF4O 4B3SO 4JI1O 1R1BA 4GKKO 4GKJO 3O65A 3RT3C 1N34O 3R66A 4DR3O 4LF9O 3JAMN 1NS1A 4YHHO 4KHPO 1D2DA 5LL6Y 4JI0O 5H5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 O;  2UU9 O;  1KUQ A;  1X59 A;  2UXC O;  5IWA O;  4B3T O;  4DV0 O;  2JRI A;  2DJV A;  4A5U B;  4JI6 O;  1FJG O;  4X64 O;  4JI4 O;  4LFA O;  4DV6 O;  1I94 O;  4DV7 O;  1XNR O;  4X66 O;  4LF8 O;  4DR1 O;  2E5L O;  4DR7 O;  1FYJ A;  3M8A A;  5IT9 N;  1XEQ A;  2HHH O;  4OX9 O;  1HR0 O;  4YY3 O;  4DUZ O;  4DR2 O;  4JI5 O;  4JI7 O;  2LW7 A;  1R6T A;  2UUB O;  3J80 N;  2UXD O;  4OPH A;  3F5T A;  3SDL A;  1F7Y A;  1HNX O;  2ZKO A;  5LMU O;  1N33 O;  4LFC O;  1A32 A;  2FKX A;  2UUC O;  2VQE O;  4LF7 O;  1AIL A;  1FKA O;  4DV2 O;  5BXZ A;  4NXN O;  4X62 O;  4OPA A;  1XMQ O;  4DV5 O;  1N36 O;  3OTO O;  5LMN O;  2VQF O;  3T1Y O;  4JYA O;  4JI2 O;  4LFB O;  2F4V O;  1YZB A;  4AQY O;  5FLX N;  5BY1 A;  4JI8 O;  5A2Q N;  1HNW O;  1XNQ O;  4B3M O;  4B3R O;  2ZM6 O;  1IBK O;  5BR8 O;  4DV3 O;  1G1X B;  2UUA O;  1IBL O;  1IBM O;  4K0K O;  2DOS A;  4NXM O;  1AB3 A;  2Z0A A;  1XMO O;  3J7A U;  1HNZ O;  3J81 N;  4DR5 O;  4X65 O;  4DV4 O;  4DV1 O;  2AGA A;  1DK1 A;  4LF5 O;  1J5E O;  4DR4 O;  2N74 A;  4DUY O;  4LF6 O;  4DR6 O;  3T1H O;  1N32 O;  2UXB O;  4JV5 O;  4LF4 O;  4B3S O;  4JI1 O;  1R1B A;  4GKK O;  4GKJ O;  3O65 A;  3RT3 C;  1N34 O;  3R66 A;  4DR3 O;  4LF9 O;  3JAM N;  1NS1 A;  4YHH O;  4KHP O;  1D2D A;  5LL6 Y;  4JI0 O;  5H5N A; 
#chains in the Genus database with same CATH topology
 4JI3 O;  3E22 A;  2ZE8 A;  2CDY A;  1K9M W;  1H38 A;  1S5H C;  2JRI A;  4A5U B;  4I4T A;  3SYO A;  1WB8 A;  1B06 A;  2QTS A;  3JAR B;  1FJG O;  2EIL C;  5EIB D;  2LFS A;  1N0J A;  3ABK C;  4ZIB A;  1S72 V;  5LA6 B;  1YJ9 V;  3EVK A;  3O9O A;  1M90 W;  3JAW B;  3SPC A;  2WWW A;  1Q3E A;  2AHZ A;  4ZHQ B;  1WP7 A;  1SET A;  1AI6 A;  4WBN A;  2UXD O;  2D2C B;  5D5Q A;  3LNN A;  1MSD A;  4OXS A;  2GHY A;  4TQD A;  1PKX A;  5E79 Z;  3WU2 Z;  2VQE O;  3UM7 A;  3AG2 B;  1WJZ A;  2EZP A;  4BIZ A;  5BXZ A;  3K57 A;  4YIO A;  2E74 B;  4KHP B;  5KA5 A;  3W7T A;  1WPB A;  1RM1 C;  1T5E A;  1BQZ A;  3P32 A;  4LFB O;  2XHB A;  4FM1 A;  1K34 A;  2Q8V A;  3C3S A;  3ZIA G;  3CS5 A;  5L3E A;  4PDV A;  3SPG A;  1Z5V A;  2YIB A;  3SYP A;  5B1A B;  5H2F Z;  3SJC C;  1G1X B;  4DR1 B;  1FXV A;  1NBM G;  3CRR A;  1KB9 F;  1BCC H;  1FFT B;  4HYO A;  2AGA A;  1ZAU A;  2PYJ A;  4J11 A;  2P4K A;  2Q68 A;  2ODM A;  4NR1 A;  4CH5 A;  1MZE A;  1M9N A;  2LGQ A;  4YJ3 A;  3T1Y B;  2VS0 A;  1M57 C;  4GKK O;  1R6K A;  2YXY A;  5CMU A;  1Y74 B;  4X20 B;  4JI8 B;  4PJ0 Z;  2X6C A;  1HWY A;  1Q6H A;  3CCR V;  3G6E V;  4B3R B;  4C7U A;  3K5O A;  2P06 A;  1WPX A;  4MTG A;  1E1Q G;  1SER A;  5KX5 A;  2E5L O;  1SQP H;  1KP2 A;  4UV9 A;  4FMT A;  4FFB B;  4W4K A;  2FML A;  3F5T A;  3VOU A;  4DR6 B;  3B4S A;  3SDL A;  4I9W A;  1THZ A;  2NR5 A;  1S5L Z;  4MTF A;  2QR4 A;  4FJC C;  3WB2 A;  3HKB A;  1G8M A;  4I9Q A;  4NXN O;  1E1R G;  2EIJ B;  3JYC A;  5FL7 G;  5KX5 B;  3CMA V;  5JJJ B;  3OAA G;  2CE4 A;  4ZBM A;  2Q67 A;  4X65 B;  2JS5 A;  1ZUQ A;  4GX0 A;  2Y69 B;  3THO A;  5GW7 A;  3QO8 A;  2CTR A;  3ZBH A;  3AK2 A;  4JI6 B;  2Q73 A;  3HB3 B;  1IVS A;  2EIK B;  3FB7 C;  1JVM A;  5IYZ B;  4LF8 B;  3HKB B;  3PN1 A;  4GT1 A;  2E76 B;  4JYB A;  2ZIO A;  3OE7 G;  1IBM O;  3AG4 B;  1YCI A;  1P49 A;  3W7W A;  2NN4 A;  3S3X A;  1J5E O;  3CHX A;  1XQ8 A;  1GKF A;  3JD4 A;  2Q5Z A;  3CWB H;  5LP6 A;  5DN6 G;  1LR1 A;  3FB8 C;  4UB6 Z;  3EFF K;  1Q90 D;  3VQV A;  2EIM C;  1Q6U A;  4GKJ O;  5CBG A;  4GX5 A;  3AG3 B;  1IDS A;  3T2M A;  1K7D A;  1SC5 B;  3FAV A;  2F66 C;  1GMG A;  4D6T H;  2JDI G;  1TGO A;  4JYY A;  3RYI A;  4GLX A;  2OCH A;  4LF7 B;  1WNS A;  4KP4 A;  2YID A;  1JQ0 A;  3N2K A;  1GN3 A;  4LR3 A;  5LP6 B;  2UUA B;  3X2Q C;  4Q20 A;  2QWR B;  4EFB A;  5LGT A;  4EKW A;  1QU7 A;  3FYI B;  3WG7 B;  1UPG A;  3B09 A;  1K3E A;  2N04 A;  5DED A;  4TT3 G;  1EZJ A;  4L87 A;  4DW1 A;  3CC4 V;  4DV1 B;  2QSA A;  4DR2 O;  5KUK A;  5CA0 A;  2EX3 A;  1F7Y A;  5L3D A;  4UCV A;  1YDX A;  5DEC A;  2RDC A;  4CBC A;  2FKX A;  1SQB H;  5KAI Z;  4LWS B;  4DV2 O;  3UT5 A;  4B7E A;  2G38 A;  2PY5 A;  4JI0 B;  5KAF Z;  2YS8 A;  1FAF A;  2BSK A;  3CXH F;  3K79 A;  4DK1 A;  2EUL A;  5CA0 B;  2EIN B;  1Q8I A;  2OT5 A;  5EYP B;  4LNU B;  4HNA A;  1NR1 A;  1PNL A;  1OZ0 A;  5CA1 A;  4MW8 A;  4JI7 B;  3UT5 B;  3JAL A;  3ZN0 A;  1BT8 A;  2DQ3 A;  3DSQ A;  3JAS A;  1XIL A;  3K3W A;  3ASN B;  4TV9 A;  1YIT V;  3A2F A;  1VQ6 V;  4GX1 A;  2ETN A;  4DV5 B;  2PZS A;  4I7Z B;  2P5O A;  4R8C A;  3OTO B;  1KP3 A;  2VQF B;  5FPO A;  4JYA B;  1R73 A;  2D3O W;  1SKV A;  5CA1 B;  5J9P C;  4DR3 O;  4MSW C;  1TAE A;  4TV8 A;  3JAT A;  4FVM A;  4TV9 B;  1XBL A;  1K5S A;  2ZM6 B;  1IBK B;  5B1N A;  2ZCE A;  1B3Q A;  2CTQ A;  4X64 O;  4DV6 O;  3H1I H;  3ZJZ A;  3ETG A;  1PNM A;  1NH2 B;  1OCO B;  4X1K A;  5GTI Z;  3M8A A;  4J7Z A;  5BMV B;  4EEQ A;  5JJN B;  4OX9 O;  1CEZ A;  4DUZ O;  5L3C A;  2XAS A;  2IM9 A;  4HZ3 A;  1GH6 A;  2XTA A;  4KL1 A;  5J2T B;  3ABU A;  3CRC A;  4DYL A;  3STL C;  1DF4 A;  1ZSP A;  4X9Q A;  4CZZ A;  1H8E G;  5JVD A;  4X62 O;  4OPA A;  1O9H A;  4YJ2 B;  1SZT A;  1XMQ O;  2DYR C;  3OGC C;  1QLE C;  3QF7 A;  4X1K B;  5LMN O;  3ICX A;  1SA0 B;  2F95 B;  3CD6 V;  2Y4U A;  4G2K A;  3W7S A;  4HBN A;  1KYO F;  1K73 W;  3E2E A;  5LYJ A;  4P9P A;  3RWR D;  5L3G A;  4H44 B;  4LFA B;  2B5U A;  3CC7 V;  1SS3 A;  4XBF A;  4JTC B;  3CRQ A;  4MVM A;  1BSM A;  2EBO A;  2WLL A;  1NR7 A;  3MAQ A;  3BAB A;  4NKG B;  1P84 F;  4I0X B;  4RO2 A;  1YVW A;  5LMU B;  4FLZ A;  5B3S C;  2H3O A;  3L72 H;  1MNG A;  1HDJ A;  4O4I B;  4DUY O;  1URF A;  4O2A B;  5LYJ B;  4ABM A;  3HKE B;  1H8H G;  3IAY A;  5LBQ A;  3CCM V;  1Y6X A;  1TUE B;  3APO A;  3K08 A;  4KXR A;  2BOC C;  2WLL B;  4Z1M G;  1ZX3 A;  2Q7E A;  1NS1 A;  2UUB B;  3NR7 A;  3JAK B;  3U11 A;  1VQ5 V;  1KUQ A;  1X59 A;  5EC1 C;  1QHT A;  1FXK C;  4B3T O;  3ZRW A;  1N0N A;  2ZT9 B;  4DV3 B;  1D5A A;  1SQG A;  1OV9 A;  3MHS C;  1GAX A;  1U96 A;  4JAV A;  5EIB C;  5IY5 C;  1YIJ V;  4O2B B;  4DV7 O;  1UJW B;  4X66 O;  1SF9 A;  1XMO B;  3HKD A;  2HVJ C;  5EZY B;  2E3C A;  4K3A A;  3ZRV A;  4JF3 A;  1V54 B;  2ARH A;  4YY3 O;  4Z1V A;  4DR4 B;  3GWO A;  3VQY A;  3QVN A;  1TA8 A;  2JJ2 G;  3E83 A;  4LFC O;  4LF4 B;  1H2L A;  2BOB C;  2CK3 G;  5CB4 B;  1WB7 A;  3FYE B;  4U7N A;  4YHH B;  3HKD B;  2GUZ B;  3IGA C;  4JI3 B;  2F93 B;  3LNM B;  1YJN V;  1S3J A;  1FJG B;  2LW1 A;  2YI8 A;  1K92 A;  3T4D A;  4MTX A;  3ZED A;  4RUE A;  4K0K O;  3M7M X;  3F7Y C;  3UO2 A;  2DOS A;  4DXW A;  3BRC A;  1SQF A;  1O9G A;  2UXD B;  3L9D A;  5B1O A;  3ETE A;  2CH7 A;  2ZE5 A;  2WLI A;  4PDR A;  2VQE B;  1Z2G A;  3CRM A;  2OWO A;  2A3Q A;  2KQX A;  3ZRS A;  4X1Y A;  3DTU B;  4MVO A;  3H1L H;  4B3S O;  2R9A A;  3CCJ V;  1PV0 A;  5LHH A;  5ITZ A;  2RQ6 A;  3G4S V;  4LFB B;  2GBO A;  3OTF A;  1R3J C;  4KUM A;  1L1F A;  1VQ9 V;  2V7Q G;  1AI7 A;  1SRY A;  1GM7 A;  3E86 A;  2Y4T A;  1KMI Z;  4D7T A;  4DV0 O;  2UUC B;  2BTQ A;  2R72 A;  2QWO B;  3ABM B;  3P30 A;  1IXM A;  4EFE A;  3OMN B;  1HR0 O;  5F2V O;  1SQQ H;  3FFQ A;  2JGU A;  4NVP A;  1YI2 V;  1VQ4 V;  2ZKO A;  2IJH A;  5JQG A;  3OM3 B;  1VQK V;  3DGE A;  3S3W A;  2VRZ A;  1QCE A;  2UXX A;  1OCR C;  4IYI A;  4PA6 A;  1DGS A;  2ZE6 A;  4IL6 Z;  4O4H A;  3RW0 A;  1K4C C;  3A0H Z;  5BY1 A;  3E22 B;  1AR1 B;  1LNQ A;  4PI0 A;  4FPP A;  2P22 C;  4RAI A;  2IH1 C;  4Q6G A;  2CGN A;  4H0L B;  4I4T B;  1JJO A;  4TQF A;  2E5L B;  3K04 A;  2YIA A;  3I55 V;  3OR6 C;  2X6A A;  2IJK A;  4NXM O;  4X8A A;  2QDO A;  3OGI B;  3J7A U;  2MK3 A;  2LFR A;  1FXK A;  2IU3 A;  4O4H B;  1M5I A;  1BGY H;  3AG1 B;  4WBN B;  3ZMZ A;  4KFM A;  3HKC A;  1JCH A;  2XAH A;  3BA8 A;  4NXN B;  4QGP A;  2RN9 A;  1B04 A;  2EZO A;  1G6U A;  3ETQ A;  3IFX A;  1R3I C;  4P9O A;  5LL6 Y;  3K9A A;  4MVQ A;  3CE2 A;  4R50 A;  4CH6 A;  1KEC A;  2UU9 O;  4N21 A;  2ZIN A;  1PD3 A;  1COW G;  3C90 A;  2DJV A;  2YEV A;  1K4D C;  1IBM B;  1I94 O;  4UCU A;  4G28 B;  1NTM H;  5LGN A;  2DN9 A;  3BEH A;  4PHZ A;  1S0V A;  1J5E B;  3ASO B;  3D36 A;  4H37 A;  3CCE V;  4I5S A;  4QE9 A;  1NVP D;  5EBW C;  1AIL A;  1ENV A;  2A06 H;  2YEV B;  4GKJ B;  3FKS G;  2L6L A;  4YJ3 B;  2JEX A;  1W0J G;  1OHH G;  4XDK A;  5CBH A;  2WSS G;  1UFI A;  2WLM A;  2X7R B;  1WN7 A;  2OIE A;  5IDJ A;  2NNU A;  3JSL A;  5CA3 A;  1QLN A;  2YC0 A;  4PD4 F;  2ITC C;  3GB7 C;  3ZRX A;  2XND G;  1IBL O;  4JTD B;  1VF6 C;  4DR2 B;  1VEW A;  2L35 A;  3F5W C;  3SPH A;  3OD4 A;  4MT8 A;  1VQN V;  4J9Z B;  1NVP B;  4G27 B;  5K1X A;  4ZI7 A;  4UCS A;  2FL4 A;  2DYS B;  4LF6 O;  4DV2 B;  3OMI B;  1JOY A;  2IH3 C;  3BPZ A;  4BR6 A;  1MMM A;  1JPX A;  4IHJ A;  1XL4 A;  3JAM N;  4CS3 A;  5IJ9 A;  5H5N A;  3E8B A;  3LDE A;  3RYH A;  1OCZ C;  2EJ7 A;  4ZI7 B;  2QM7 A;  5LOV A;  4CS4 A;  1YHQ V;  3UCS C;  4LP8 A;  4JI4 O;  3BY6 A;  1JA8 A;  2M7W A;  4JZ2 A;  5L3B A;  4UV8 A;  1K97 A;  1NJI W;  4ICG A;  4IHJ B;  4JAA A;  3CPW U;  2CAZ C;  2ZD9 A;  1R6T A;  4WFG A;  4UCO A;  3EHB B;  5H6Q A;  4IIJ A;  3RYH B;  2YI9 A;  4NTX A;  1HNX O;  1N33 O;  3B8M A;  2EIL B;  3B8N A;  3RYF A;  2HFE C;  4NTY A;  3TET A;  5JH7 A;  3K0G A;  3ABK B;  3IC7 A;  2OCC C;  2QM4 A;  4BIU A;  5GON A;  4DR3 B;  2ZXW C;  1MAB G;  4U7O A;  1Y66 A;  1QQC A;  4WFE A;  1AI5 A;  1VQL V;  4PDM A;  4FLV A;  1IXB A;  2P4V A;  1KBH A;  3FAV B;  2CGO A;  2W6J G;  3RYI B;  2W0F C;  4X64 B;  3G71 V;  2ZIM A;  4LH6 A;  4DV6 B;  5JH7 B;  3H9V A;  4PEL A;  1M4U A;  3N2K B;  2ZR2 A;  4O4L A;  4J7J A;  3IJ4 A;  4JI1 B;  5EBL C;  1RM1 B;  5GON B;  4PDL A;  4OX9 B;  4DUZ B;  2HP8 A;  3SR2 C;  3K59 A;  1HNZ O;  2KB1 A;  3ZHV A;  4TWK A;  4X65 O;  1VQ8 V;  4J41 A;  3K5N A;  2W0X A;  3G80 A;  3QO5 A;  1EBO A;  2CUG A;  2XAF A;  3T1H O;  1Y4M A;  4JV5 O;  4TOI A;  4X62 B;  1XMQ B;  4IYH A;  4O4L B;  3FD9 A;  5B1B C;  2JGD A;  1R3K C;  3L73 H;  5LMN B;  1Q86 W;  3LUT B;  4JI5 B;  2DW4 A;  1NH2 D;  4PI2 A;  4ZKI A;  4FIP C;  3ZMV A;  2BSK B;  4RQE A;  1PP9 H;  2HR3 A;  1N8R W;  4LBE C;  1WLE A;  1GM9 A;  1NTZ H;  1RSO A;  3I5D A;  1M57 B;  4HNA B;  2C2A A;  1I5Y A;  1XNR O;  3ABL C;  3OEH G;  4J42 A;  1QVG U;  1P7B A;  4DR7 O;  3VBB A;  1L8D A;  5C8Y A;  2HHH O;  3JAL B;  3K5L A;  2LW7 A;  3BFR A;  4E4E A;  3OT7 A;  4DUY B;  1V55 C;  3JAS B;  3B77 A;  4EB6 A;  1I5X A;  1SZX A;  5JCO C;  3HPL C;  2R9I A;  1OCC C;  2JEU A;  2QTO A;  2ZR3 A;  4CH4 A;  4LF7 O;  1VF6 A;  1RSO B;  3OEE G;  2VWK A;  4B08 A;  3CCS V;  1XDC A;  2HLD G;  1QNM A;  5LGU A;  3CRA A;  1NTK H;  1H2S B;  5C8Y B;  1M56 C;  5LHG A;  2QKS A;  5IE9 A;  4TV8 B;  3U10 A;  4B3T B;  1ZWI C;  3JAT B;  2JS3 A;  1HNW O;  1WA8 A;  2R9R B;  1DF5 A;  4DV7 B;  4X66 B;  4B3M O;  1YXB A;  5BR8 O;  4I50 A;  5H9C A;  2VWJ A;  1KQS U;  2F23 A;  1VMG A;  1AR5 A;  4YY3 B;  3CCQ V;  2Z0A A;  2LQT A;  3RVZ A;  1RPR A;  2KSD A;  2HJD A;  5TIS Z;  4WF9 V;  4LF5 O;  4J7K A;  2QM8 A;  1GM8 A;  2KG7 A;  2O57 A;  1N32 O;  2Z5U A;  1WA8 B;  4DO2 A;  3SJA C;  2ZE7 A;  5EBM C;  1MSW D;  4H33 A;  5JVD B;  3JD3 A;  4JPR A;  4LF9 O;  2QJ1 A;  3R65 A;  2DWE C;  5JJE B;  4MW3 A;  2IBZ H;  2R70 A;  2DWD C;  4K0K B;  2EIM B;  3Q4H A;  1WP8 A;  3CCU V;  5CN0 A;  3IC9 A;  3ZHT A;  4F4L A;  3AG2 C;  4AHC A;  4FLU A;  4TUY A;  1VAR A;  4JI2 B;  2WLJ A;  2ZQM A;  1Y67 A;  2BE3 A;  4P2Z A;  4OPH A;  4JGS A;  1K8A W;  3BVO A;  1G4Y B;  1ZL8 A;  2F1M A;  3X2Q B;  2FYU H;  2XAQ A;  2WLK A;  1XOU A;  4K35 A;  3ZMU A;  1S5J A;  5EK0 A;  2AHY A;  4U3F H;  1DTO A;  5B1A C;  1IX9 A;  3TXS A;  1R6N A;  1W2B U;  1N36 O;  4TUY B;  2HVK C;  1CP9 A;  4AI8 A;  4BIO A;  2ZDI C;  1BE3 H;  4TSF G;  4DV0 B;  4AQY O;  3E35 A;  1VF5 B;  2QKC A;  4O4J A;  2K9P A;  4WFF A;  1ZL8 B;  1US6 A;  4IT5 A;  1XNQ O;  3ZRW B;  2HKO A;  5H6R A;  1VQM V;  2Q0A A;  2IJJ A;  1YTF B;  1JX9 A;  1HR0 B;  4U3J A;  1EZV H;  4BAY A;  3NXS A;  5L3F A;  3D8C A;  1AI4 A;  3FB6 C;  5B66 Z;  1VQP V;  3QO7 A;  3U0Z A;  4DR5 O;  5KMG A;  4DV4 O;  3WB1 A;  3E8G A;  1M93 A;  1ZTE A;  1DK1 A;  4RQF A;  2RMK B;  2N74 A;  2F43 G;  4HAM A;  2WLH A;  4FM0 A;  1W59 A;  4PV1 B;  2YDE A;  3PJS K;  2PI4 A;  1M1K W;  1NKD A;  5IYD O;  1FPO A;  1NI8 A;  4B7K A;  4R6Z A;  3RT3 C;  2ATK C;  2LGW A;  4U3J B;  4QPK A;  5J2U A;  3TXQ A;  4YIP A;  5JCO A;  4K8X A;  1LUV A;  4F6R A;  3TJT A;  2UXC O;  5IWA O;  1KC8 W;  3JD2 A;  3B2E E;  1H2K A;  2WA3 A;  3W7X A;  5KUM A;  4NXM B;  2WPD G;  4UUJ C;  4F6E A;  3KKY A;  2DMX A;  2EIJ C;  2WAM A;  1BZK A;  1QVF U;  4X88 A;  1N4C A;  2UUB O;  1GN6 A;  4I55 A;  3OR7 C;  3ZHU A;  2CH7 B;  2JVD A;  2Y69 C;  3GVM A;  1VIB A;  2WLI B;  5A9G A;  2A79 B;  4JAS A;  1FKA O;  3ZHQ A;  2GV9 A;  2EIK C;  2LJ2 A;  2YSU B;  4CH3 A;  4X1Y B;  2QWP B;  2HJF C;  5ITZ B;  3AG4 C;  2UU9 B;  3ZHS A;  3CXC U;  4JTA B;  5A2Q N;  4AIL C;  3SGI A;  3LSS A;  1I94 B;  2BTQ B;  2H8P C;  1EN6 A;  3LSU A;  2DYR B;  3OW2 U;  1QLE B;  4GKK B;  5LA6 A;  4FLT A;  2P67 A;  1HP8 A;  5C93 A;  1KKD A;  3T1C A;  1YEW A;  3J81 N;  4JZG A;  3AG3 C;  2ADP A;  3D3I A;  2N05 A;  4MVZ A;  4YXW G;  2IU0 A;  3D3Q A;  3QG5 A;  2UXB O;  1JJ2 U;  1GN2 A;  2B9Z A;  4LH7 A;  3SYC A;  3H01 A;  5JQG B;  5LP6 C;  3FX7 A;  2QA4 V;  1JR9 A;  3F7V C;  2PYL A;  1NU1 H;  2YIB D;  1R1B A;  1V9P A;  3ZMS A;  4FK5 C;  3R66 A;  3T4Z A;  1N34 O;  3WG7 C;  5B3S B;  1D2D A;  4BWA A;  3K0D A;  3LSQ A;  1H2G A;  4PA7 A;  3K06 A;  2AZ0 A;  2V4D A;  1IBL B;  3I56 V;  2JJ1 G;  2QGN A;  2ZDI A;  2MW2 B;  1XHZ A;  1TUB A;  5IT9 N;  4IGG A;  4JAU A;  1AJN A;  4K8Z A;  2RCV A;  4FLX A;  4CC5 A;  2Y0I A;  1FXK B;  4MTO A;  4LF6 B;  1CXZ B;  1YSC A;  5IY5 B;  2EIN C;  1XRE A;  2IW5 A;  2UUC O;  5B5E Z;  1XUQ A;  2YUA A;  4ZOL A;  3HKC B;  1MOF A;  1VP7 A;  1LUW A;  4N23 A;  3JSN A;  1Y74 A;  2NLJ C;  2QWN B;  1TUB B;  4X20 A;  1AP5 A;  1Q6I A;  1SQV H;  2H94 A;  2X6B A;  2F4V O;  1H2M A;  3KZI Z;  1SES A;  3TGU H;  4NYK A;  3CEI A;  5E1A C;  3ASN C;  2FB5 A;  1MA1 A;  5K1P A;  1D5N A;  5HFL A;  4JI4 B;  1L0N H;  2V1D A;  1FXH A;  4WCE V;  4ZOL B;  1S76 D;  3AG7 A;  1FFX A;  1B6Q A;  3H1K H;  3KCX A;  3MD0 A;  3HR0 A;  2W6I G;  5LHI A;  4FFB A;  2Y48 A;  1XI1 A;  1HNX B;  1N33 B;  4FFK A;  4FM2 A;  1R3L C;  3A0B Z;  3G6B A;  3ZHR A;  3WFV A;  4QE7 A;  1KKC A;  4FLW A;  3ETD A;  2A7W A;  3TCU A;  2JK5 C;  3JD1 A;  1FFX B;  2PUS A;  4CC6 A;  3O65 A;  4X1I A;  3BA9 A;  1QR9 A;  4D7S A;  4KHP O;  1OCO C;  1ORQ C;  4DW0 A;  3SJQ C;  5IYC O;  5IYZ A;  3SPI A;  4JYC A;  1H2N A;  1MG1 A;  3WB0 A;  2DQ0 A;  2P90 A;  2E75 B;  1X4T A;  1HNZ B;  4DR1 O;  2Y0P A;  1S77 D;  4PA3 A;  2OTL V;  4X1I B;  2Q0O C;  3UKM A;  2GTS A;  1IZ3 A;  1GO3 F;  4RWU A;  3J80 N;  3LDD A;  3T1H B;  2K1E A;  4JV5 B;  1J95 A;  2EJR A;  3E8F A;  3SYA A;  1L0L H;  3KG2 A;  1BHB A;  3OFN G;  3T1Y O;  3QTC A;  3K58 A;  2CTP A;  4UVB A;  4UCT A;  5IJ9 B;  1VQ7 V;  1I08 A;  3W7U A;  2AZ2 A;  3OMA B;  4JI8 O;  4MVR A;  3RVY A;  5CBF A;  3RGB A;  1F4M A;  5LOV B;  1XNR B;  2GDS A;  4B3R O;  1PM9 A;  4P30 A;  1KD1 W;  4DR7 B;  3H1H H;  1F23 A;  1OCR B;  2HHH B;  2KKW A;  4MS2 A;  2HG5 C;  4QIW F;  5LXT A;  4J9Y B;  3OUF A;  4CS2 A;  3ZX6 A;  2YIC A;  1XL6 A;  1YF2 A;  4IIJ B;  2XT9 A;  4DR6 O;  4LWS A;  5DM6 V;  1Q43 A;  2FTK A;  3K9S A;  2WLN A;  3CME V;  3RYF B;  3H1J H;  3ZS8 C;  4J10 A;  3EXA A;  3MDS A;  5LXT B;  1EN5 A;  1V54 C;  4BW5 A;  1HNW B;  2A9H A;  5EYP A;  1FS0 G;  4LNU A;  1NQT A;  4B3M B;  1Z5W A;  2GTA A;  5BR8 B;  4X89 A;  4JI6 O;  2B1I A;  1RP3 B;  2P7T C;  4Z2W A;  2YXL A;  2YXH A;  4LF8 O;  3BAA A;  3RYC A;  1FYJ A;  2PGG A;  4LF5 B;  1BL8 A;  1Y76 A;  3CP1 A;  5IYB O;  5D5P A;  2Z3Y A;  4GCZ A;  3P3N A;  2X0L A;  1N32 B;  5EC2 C;  2UXN A;  1A32 A;  3STZ C;  1BQ0 A;  2LO1 A;  1TVK A;  2BCC H;  4QJF B;  2BTO A;  2XOK G;  1NT2 B;  4LF9 B;  2JGD B;  3ML0 A;  4L8J A;  3RYC B;  4NB5 A;  1F4N A;  3CCL V;  1F51 A;  5FPR A;  1PPJ H;  1GRJ A;  1Y76 B;  5FLX N;  1VF7 A;  1QR8 A;  1SQX H;  3OUS A;  4WFA V;  1BMF G;  1TVK B;  3K03 A;  2UUA O;  4XDL A;  3CYO A;  1GN4 A;  1I0H A;  5BMV A;  3JD0 A;  1IUR A;  5KA6 A;  1PL0 A;  1AB3 A;  1JMK C;  3VQW A;  4DV1 O;  5J2T A;  1YJW V;  3JCU Z;  4LC1 A;  3CJH A;  3CC2 V;  3QNE A;  4EB6 B;  5KHG A;  1RPO A;  4GX2 A;  4WFH A;  3L74 H;  4YJ2 A;  3RFR A;  1N36 B;  2PI5 A;  4JI1 O;  3ABM C;  1GTO A;  3L75 H;  3TK1 A;  1SA0 A;  1AJP A;  2AXT Z;  4AQY B;  4JI0 O;  4BW9 A;  4WFB V;  1XHX A;  4UVC A;  1EN4 A;  1XNQ B;  1KU9 A;  4LFC B;  3CJH B;  4UFZ A;  2P6J A;  3M99 B;  4W4L A;  1Q7Y W;  1E79 G;  4XDJ A;  1BHA A;  3FB5 C;  2WA4 A;  2OYQ A;  2HEP A;  2LP7 A;  1PNK A;  4I50 B;  3SJB C;  4FLY A;  3A0R A;  3P3P A;  4RUF A;  4DR5 B;  4I0X A;  4DV4 B;  1Q81 W;  1OCZ B;  5JWP A;  4JI5 O;  4JI7 O;  2ZNI A;  4MVS A;  4O4I A;  2M6Y A;  2QWQ B;  4O2A A;  3HKE A;  2Q69 A;  3BHP A;  3CSX A;  3N2G A;  2KG7 B;  2A0L A;  3B40 A;  3K5M A;  5KHK A;  3CCV V;  1P7G A;  5HFM A;  4DV5 O;  2CTW A;  2ITD C;  4LCU C;  3OTO O;  2VQF O;  4JYA O;  2PTM A;  1YTF D;  4DRX A;  3JAK A;  2ADQ B;  3C3T A;  3L71 H;  2UXC B;  5IWA B;  3ZN1 A;  1OJH A;  3GWK C;  3G67 A;  2RNB A;  4GZR B;  5GTH Z;  3AG1 C;  2OCC B;  4DK0 A;  1ROP A;  3UQ8 A;  3N2G B;  2ZXW B;  1W0K G;  4O2B A;  2ZM6 O;  1IBK O;  4B3S B;  2GSM B;  5EZY A;  1AR4 A;  3Q4H B;  3JCZ A;  1P4R A;  3ZCC A;  2JIZ G;  3ABT A;  4DRX B;  1U97 A;  2Q9L A;  3ZMT A;  2Q7H A;  4ASU G;  1EM1 A;  2IJI A;  4GUN A;  5CB4 A;  5FNV A;  2ILM A;  5KHH A;  4J80 A;  2GUZ A;  1Q82 W;  1QBZ A;  3LDC A;  4FZ0 A;  3AEI A;  3RBZ A;  5AG2 A;  2DE0 X;  3SPJ A;  4FZ1 A;  3ASO C;  4UXN A;  3SYQ A;  4O4J B;  2RJZ A;  2XAJ A;  5B1B B;  3CX5 F;  2QKA A;  3DXR A;  3MHH C;  5FNV B;  4LFA O;  4OGQ B;  3CB2 A;  2ZNJ A;  1FD9 A;  2B1G A;  4GYC B;  1HW7 A;  1XEQ A;  2PF4 E;  4PA4 A;  2XAG A;  2Q6A A;  3E8H A;  1DLB A;  3APQ A;  1GK9 A;  5KMG B;  1BS3 A;  4UVA A;  1RFY A;  3AK3 A;  5LMU O;  4R7C A;  2UXB B;  1ARO P;  3DC5 A;  1ZLZ A;  3D36 C;  1MZF A;  3ABL B;  1JFF A;  1Q5O A;  1NZ6 A;  1PL4 A;  1WAZ A;  3DXR B;  4H13 B;  3RN4 A;  1N34 B;  2AW9 A;  3A8T A;  4JI2 O;  1V55 B;  5J2U B;  4MVU A;  1YZB A;  4F6R B;  4QNH B;  1AP6 A;  1OCC B;  5IJ0 A;  2Q4P A;  3E89 A;  4UB8 Z;  3DC6 A;  5KHJ A;  4E2L A;  1AJQ A;  3KCY A;  5BZB A;  2QE7 G;  3L70 H;  2XUM A;  1VQO V;  2DYS C;  4QPJ A;  1JFF B;  4DV3 O;  1EFR G;  4PA9 A;  3UO3 A;  1K5Q A;  1I7F A;  4NTW A;  1M56 B;  1XMO O;  2Q7G A;  2QEX V;  4DR4 O;  4I55 B;  5IJ0 B;  5KLV H;  3AK1 A;  3JAR A;  3BCC H;  2OTJ V;  5KHI A;  1CPY A;  4LF4 O;  3N27 A;  4UCR A;  1K33 A;  2F4V B;  3JAW A;  4YHH O;  2OIG A;  3VQX A;  4ZHQ A;  1AVM A; 
#chains in the Genus database with same CATH homology
 4JI3 O;  2UU9 O;  1KUQ A;  1X59 A;  2UXC O;  5IWA O;  4B3T O;  4DV0 O;  2JRI A;  2DJV A;  4A5U B;  4JI6 O;  1FJG O;  4X64 O;  4JI4 O;  4LFA O;  4DV6 O;  1I94 O;  4DV7 O;  1XNR O;  4X66 O;  4LF8 O;  4DR1 O;  2E5L O;  4DR7 O;  1FYJ A;  3M8A A;  5IT9 N;  1XEQ A;  2HHH O;  4OX9 O;  1HR0 O;  4YY3 O;  4DUZ O;  4DR2 O;  4JI5 O;  4JI7 O;  2LW7 A;  1R6T A;  2UUB O;  3J80 N;  2UXD O;  4OPH A;  3F5T A;  3SDL A;  1F7Y A;  1HNX O;  2ZKO A;  5LMU O;  1N33 O;  4LFC O;  1A32 A;  2FKX A;  2UUC O;  2VQE O;  4LF7 O;  1AIL A;  1FKA O;  4DV2 O;  5BXZ A;  4NXN O;  4X62 O;  4OPA A;  1XMQ O;  4DV5 O;  1N36 O;  3OTO O;  5LMN O;  2VQF O;  3T1Y O;  4JYA O;  4JI2 O;  4LFB O;  2F4V O;  1YZB A;  4AQY O;  5FLX N;  5BY1 A;  4JI8 O;  5A2Q N;  1HNW O;  1XNQ O;  4B3M O;  4B3R O;  2ZM6 O;  1IBK O;  5BR8 O;  4DV3 O;  1G1X B;  2UUA O;  1IBL O;  1IBM O;  4K0K O;  2DOS A;  4NXM O;  1AB3 A;  2Z0A A;  1XMO O;  3J7A U;  1HNZ O;  3J81 N;  4DR5 O;  4X65 O;  4DV4 O;  4DV1 O;  2AGA A;  1DK1 A;  4LF5 O;  1J5E O;  4DR4 O;  2N74 A;  4DUY O;  4LF6 O;  4DR6 O;  3T1H O;  1N32 O;  2UXB O;  4JV5 O;  4LF4 O;  4B3S O;  4JI1 O;  1R1B A;  4GKK O;  4GKJ O;  3O65 A;  3RT3 C;  1N34 O;  3R66 A;  4DR3 O;  4LF9 O;  3JAM N;  1NS1 A;  4YHH O;  4KHP O;  1D2D A;  5LL6 Y;  4JI0 O;  5H5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...