1J5EO

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1j5eO00
2Z0AA 4K0KO 1HR0O 1XNRO 4LF8O 3RT3C 3J80N 2HHHO 2ZM6O 2E5LO 5FLXN 3J81N 3R66A 4DV3O 2UXBO 2UXCO 5IT9N 1I94O 1DK1A 2F4VO 1R6TA 4DR1O 1AILA 2VQEO 1XEQA 1D2DA 1XMOO 4LF7O 1AB3A 3OTOO 4JI4O 4B3MO 4DR7O 1NS1A 4X65O 2UUBO 4DR6O 1HNWO 4JI7O 2VQFO 4JI0O 1IBMO 1FYJA 2DJVA 1N33O 4JV5O 4A5UB 4B3SO 3J7AU 4JI1O 1IBKO 1IBLO 3SDLA 4OPHA 1X59A 4X64O 2UU9O 4DV2O 3T1HO 1N34O 2UUAO 4NXNO 2FKXA 4LF5O 4OX9O 4DV4O 5H5NA 5LL6Y 3O65A 1FJGO 4LFAO 4DR2O 2N74A 5BXZA 2UUCO 4YHHO 1R1BA 4GKJO 4JYAO 4JI6O 4NXMO 1J5EO 5IWAO 4DR5O 4DV0O 4GKKO 5LMNO 4JI3O 1F7YA 4LF4O 5LMUO 5BY1A 3T1YO 3JAMN 4LFCO 4JI2O 4B3TO 4DV7O 4DR4O 4LF9O 4B3RO 2LW7A 1HNZO 1HNXO 4DUYO 1YZBA 3F5TA 1KUQA 1XNQO 4DV5O 3M8AA 5A2QN 4JI8O 1FKAO 1N32O 2AGAA 1XMQO 4OPAA 4X66O 4LF6O 4DUZO 2DOSA 4LFBO 4YY3O 4KHPO 4DV6O 1N36O 5BR8O 4DR3O 1A32A 2ZKOA 4DV1O 2UXDO 2JRIA 4JI5O 4AQYO 1G1XB 4X62O
chains in the Genus database with same CATH superfamily
1IDSA 2AXTZ 2ZD9A 3RYFB 1H38A 1PL4A 3ABLB 1HNWB 2GTAA 5IT9N 2QR4A 3GWOA 3L73H 4KFMA 1QQCA 1VARA 2YC0A 2YI9A 4MVUA 1EFRG 2RQ6A 5LBQA 2F95B 2ZIOA 3K9AA 5A9GA 4LF7O 3E8GA 4BIZA 4JI0O 1QHTA 3L72H 1SQQH 2DJVA 5FPOA 2EINC 1R73A 3GVMA 3JAWA 3HKBA 3OD4A 2GV9A 4MSWC 4G27B 4MTFA 2GDSA 3I5DA 5KX5A 1N34O 4QE9A 3SYCA 1OCOB 1XOUA 4PA4A 1YITV 2PUSA 4B7EA 3GB7C 3OW2U 3FAVB 2A79B 1RPRA 2EIMB 1R1BA 4KL1A 4RWUA 4JF3A 5IWAO 1UPGA 2HVKC 2OCCB 5CA3A 2Q67A 2FB5A 5LMUO 3OUFA 3AG3B 4NR1A 1MNGA 1NBMG 2O57A 4DV7O 2JDIG 5K1XA 3CPWU 2ZE7A 2CTPA 1XILA 1HNXO 2B1GA 3DXRB 2RDCA 1HP8A 3B77A 3MHSC 1YI2V 4JI7B 4FVMA 1ORQC 2F43G 1GM9A 1WP7A 2ATKC 1GO3F 4W4LA 4X1IA 4DV3B 3UO3A 1OHHG 3AG1C 2UXNA 5GTHZ 4DV2B 4NXNB 3JAKA 2BE3A 1NH2B 3HKEA 5EBLC 4DR1B 5L3CA 3KKYA 1YSCA 1Q81W 1Q6HA 1XL4A 2PTMA 2XAJA 4Z1VA 1V54B 2QDOA 4I4TB 1V55C 5EBMC 5IY5C 1K9MW 4IL6Z 1ZLZA 5D5QA 5IYZA 1JMKC 3K04A 2BCCH 3C3SA 1D2DA 5KUMA 5JCOC 1PNKA 1KC8W 5LYJA 3KCYA 4X65O 1V9PA 3BABA 2ETNA 4ZBMA 5KLVH 1NT2B 4IYHA 1N33O 2WSSG 4TWKA 1BGYH 2OIGA 2QWRB 1S5HC 1PNLA 4TUYA 2Q0AA 3T1CA 5CB4B 4D6TH 3LSSA 1GN3A 1EN5A 2CH7A 3FKSG 4LF4B 2NN4A 3T1YB 2FL4A 2WWWA 4JI2B 3CCJV 2IJJA 1G8MA 3CWBH 3UQ8A 4GX1A 1YF2A 1GKFA 3CCLV 2P6JA 2QEXV 3IGAC 2QWPB 2YICA 2Q5ZA 2F4VB 4JYBA 3AG2B 1TA8A 3ZRSA 2X6BA 2DYSC 5BMVA 2LGQA 2AGAA 5IYDO 3W7TA 1PPJH 1FXKC 2LGWA 2GSMB 2NLJC 1SA0B 4JI1B 3K5OA 3JALA 1VF6C 3STZC 1YJWV 5DECA 2UXCB 3KZIZ 2UU9B 4TV9A 4O4IA 2HEPA 2Q69A 4X1YA 2EJRA 2Z3YA 4PELA 1XNRO 4PA3A 1S5JA 5CA0A 3ETQA 3J81N 3HKCA 1NTZH 3Q4HA 3IJ4A 4O4JB 2WA4A 4RUFA 4EFEA 1IBLB 1JOYA 4X64B 5FPRA 3L74H 2EJ7A 3ZRWA 4WFBV 4I0XA 3CMAV 1Z2GA 2AHZA 4PDMA 3N27A 3FB6C 1TAEA 3ABKB 4B3SO 2EIJC 4MTGA 4GKJB 1BQZA 2DYRC 1WJZA 3JD0A 2KG7A 3SYPA 5L3GA 5LGTA 3JATA 3DC5A 4JYCA 1YCIA 3BY6A 2Q7GA 2PZSA 1VF6A 4X20A 3RYCB 5K1PA 5LHHA 2DWDC 3G6BA 1ZUQA 3ZEDA 4MTXA 3UM7A 3K79A 1O9HA 2A0LA 1QR8A 5JQGB 5B1NA 3NR7A 5J9PC 2MW2B 1Y74A 3CSXA 2BTQB 3JAMN 1RPOA 5CA1B 3F7VC 3FD9A 4DRXA 2F93B 1SZXA 4XBFA 1JPXA 2DN9A 2JJ1G 2Q68A 3UT5A 4JTCB 4DW1A 5EC1C 1VQOV 1VP7A 4CH6A 1L8DA 4K0KB 2X6AA 2L35A 1HR0B 4QGPA 5B3SC 2P22C 2E3CA 2UXBB 4DR3O 4AQYO 2JEUA 5JJEB 3SJAC 1KB9F 1G1XB 4DO2A 1N0JA 2V4DA 1US6A 2OCHA 1P84F 2HVJC 2FMLA 2ZR2A 4CC5A 1M93A 3CJHB 5LGNA 4MVOA 2KSDA 3VQYA 2YXHA 1I5YA 3H1JH 1N0NA 2JK5C 4JI4O 1NS1A 4DV4B 4D7SA 5EIBC 1VQLV 2ZINA 1B3QA 4MS2A 4IIJB 1FJGB 3K03A 3K0GA 1KP2A 3J7AU 4KXRA 2XUMA 1H2NA 4NTYA 4UCOA 1LNQA 2WA3A 5CBHA 3K0DA 4OX9O 3WB1A 2DE0X 1IX9A 1VQNV 1WLEA 3K5MA 1UFIA 2LO1A 5LHIA 5LOVB 1VQ7V 1COWG 2JS5A 4DR2O 1DGSA 3QTCA 4JYAO 1H8HG 1Q6IA 1WA8A 3BRCA 3OMNB 3LSUA 4R6ZA 4MW8A 2QKAA 3ZHTA 4KP4A 1JA8A 1FPOA 2CDYA 4HNAB 4CH3A 4FJCC 2E76B 3EFFK 1YJNV 4PI0A 1M57C 2IBZH 3RYIA 2Q6AA 4LNUA 1EN6A 5A2QN 4X62B 4WFFA 1XMQO 2Q8VA 2WLNA 1QR9A 4KUMA 1Q82W 1YHQV 3CP1A 1KQSU 4I9WA 4P30A 1QVGU 1YXBA 3CXHF 4YXWG 4DK1A 1XREA 1YIJV 3UKMA 1K73W 1I08A 1HWYA 2F1MA 2PGGA 4R50A 4ZOLB 3RT3C 5KUKA 2LJ2A 1NZ6A 2XASA 4H44B 2KB1A 1I94O 4EB6A 4MVSA 2K1EA 4LWSA 2WLHA 1K4DC 1AB3A 2YS8A 1SQGA 3IC9A 5LP6A 2WLMA 3CC4V 2VQFO 4UV8A 5LGUA 1J95A 5TISZ 2KKWA 1XDCA 3VOUA 3SJBC 1NQTA 3L9DA 4DV0B 1WB7A 3CMEV 3ZN0A 5LMNB 5E1AC 4JAVA 3CYOA 4WBNB 1MA1A 1SRYA 4P9OA 4HAMA 4WF9V 2A06H 2QJ1A 3JARB 2LFRA 2KQXA 4UVAA 3RW0A 1VF5B 2DQ0A 5IDJA 2P4KA 2Y4TA 4TV8B 4WFGA 1L1FA 3IC7A 4FLXA 3W7XA 4LFCO 4YY3B 4KHPB 4UB6Z 4F6RB 3RYHA 1SQFA 1FFXA 5LA6B 1F23A 1CXZB 3ASNC 3M8AA 4DR6B 3DC6A 3SGIA 3SR2C 5KAIZ 3H1LH 2B5UA 4QPJA 1EBOA 3RYFA 1DTOA 3TJTA 5LHGA 2CTWA 1NH2D 4CH5A 1K34A 3FB5C 1FXHA 2Z0AA 1KU9A 3K08A 2IU0A 3QO5A 1OZ0A 2HP8A 2GUZA 3JCZA 1GK9A 5FLXN 1ENVA 2EZPA 5ITZA 4GX5A 1ZX3A 1DK1A 1Z5WA 3JSNA 3QO7A 4D7TA 4J41A 2ZNIA 1MZFA 4DR4B 1HNWO 2ZT9B 2IH1C 4K3AA 3FAVA 4H13B 1AVMA 4NB5A 1V54C 1IXMA 2BTOA 4CZZA 5B5EZ 5B1OA 3SJCC 4OGQB 4GKKB 3CXCU 5BR8B 3BAAA 2XAQA 5IYCO 4P2ZA 2N74A 2IJHA 4B3TB 4P9PA 1K8AW 4NTXA 4B3RB 1G6UA 2E74B 2V1DA 2YIDA 5J2TA 1HNZB 1YTFB 4MW3A 3DXRA 3ZMVA 1GRJA 3AG4B 1YJ9V 4QIWF 3JSLA 4B7KA 2EILC 1Q3EA 3AG7A 5BY1A 3S3WA 4LFBB 4DV6B 1QU7A 4WFEA 3JASB 4ZI7B 3PN1A 2XTAA 2JVDA 2QKSA 1H2LA 1GAXA 4WFHA 4MVRA 4CS3A 5J2UB 4JI0B 4NYKA 2GTSA 1P4RA 2YXYA 2AZ2A 3E8BA 4GX0A 1BL8A 2N04A 1FXVA 1FS0G 4I4TA 1N34B 5IJ0B 4JI5O 4J7JA 1BT8A 4J7ZA 4JZ2A 2IJKA 2VQEB 3CCEV 2QTSA 2OYQA 3OTOB 3K9SA 1WN7A 2UUBB 4DV3O 4DW0A 4JV5B 5LXTB 3CCMV 4PA7A 4AILC 4J9ZB 4O2BA 1IBKB 3GWKC 4DR1O 4BIUA 1XEQA 3L75H 2UUAB 1H2MA 2R70A 5L3DA 2Z5UA 5CB4A 1NR1A 1KMIZ 4X89A 2BOBC 3K59A 2QM4A 3I56V 4HZ3A 2MK3A 2ZXWB 3VQWA 1OCRB 1Y76B 2WLIB 2PI5A 4U3FH 3ASOC 1D5AA 3U10A 4MT8A 1R3LC 2YDEA 1VQMV 4JI3B 1M56B 2FYUH 2Y69C 1RSOA 3BPZA 4H37A 4GLXA 4JTDB 2ADPA 3CX5F 2HJFC 4NXMO 3B2EE 4W4KA 1SERA 1AJPA 1AROP 4BW9A 3E2EA 3IFXA 4QE7A 2VS0A 4B08A 4LF4O 4PI2A 3T1YO 4LF6B 4DUZB 4JI2O 1SA0A 1P7BA 1Q8IA 1B06A 1XHXA 2QA4V 2ITDC 1QVFU 1PV0A 1JX9A 1F51A 3AK2A 4L87A 3LDDA 1E79G 4X1IB 1AI7A 2F23A 1PNMA 4E4EA 2HHHB 3JD3A 1GN4A 1A32A 1SQXH 1NVPB 1KYOF 3FYIB 2E75B 1TUBB 3STLC 4YJ2B 4O4JA 2XAGA 1RM1B 5EYPB 1PD3A 4LH6A 4NVPA 2X7RB 4LC1A 4DR7B 4B3MB 3UCSC 4TQDA 3R65A 5B1AC 3WG7C 2CK3G 2UXCO 1EZVH 1PM9A 3HPLC 3A0BZ 4LR3A 4R8CA 1NTMH 1TVKA 3QO8A 2JGUA 3T1HB 1CPYA 4FLZA 3N2KB 4FK5C 3RWRD 5F2VO 1Q86W 1FYJA 4WFAV 1ZTEA 2UUCB 4YHHB 3RYCA 4FLTA 4H33A 2LW1A 1IBLO 3SYAA 1X59A 3P30A 4X64O 3ICXA 2CH7B 2FTKA 5KA5A 4U3JB 1OCCB 5JQGA 5L3EA 4FFKA 5FL7G 2GHYA 4O2AB 2BTQA 5L3BA 2R9RB 4GKJO 3BFRA 5KA6A 3OT7A 5KHGA 1XNRB 2HG5C 2Q4PA 2EIKB 1R6KA 2IH3C 1BHBA 5B66Z 3DSQA 4FM2A 1K3EA 1S5LZ 1WB8A 1M90W 3NXSA 2LP7A 2EX3A 1K7DA 2L6LA 4UVCA 5C93A 3L71H 3E35A 5KHHA 1GH6A 4QJFB 4X66O 2E5LB 4F6EA 4TV9B 3CJHA 3U0ZA 4X1YB 3F7YC 5CBFA 2ARHA 1JCHA 5IJ9A 3P3NA 4K0KO 3B4SA 1HR0O 4O4HB 3OTFA 4PDRA 4IIJA 1KKDA 3PJSK 2UXBO 3HKDB 4N23A 4PHZA 3ZHSA 1F4MA 3SJQC 4GX2A 4JGSA 3ZRWB 4I0XB 5GONB 1I7FA 5JH7A 2PY5A 3G67A 1SKVA 2BSKB 3T4ZA 3K58A 5LOVA 1IBMO 1MOFA 2CUGA 4PDVA 1JFFA 5H9CA 1M1KW 2A7WA 3MAQA 1FXKB 2FKXA 3C90A 4I55B 4DV4O 2D2CB 2YEVB 4DR3B 4I5SA 1FJGO 1Y67A 3WB0A 3BEHA 3THOA 4LP8A 3OFNG 2EZOA 2ZNJA 1AJNA 1CEZA 5C8YB 3E22B 4DR5O 2QSAA 2OWOA 1ZWIC 4UFZA 3VQVA 1QBZA 2ILMA 1EN4A 2X0LA 5CMUA 1N36B 4DXWA 4AI8A 4JI4B 1L0NH 1KUQA 3FB8C 3SPJA 2JGDB 3CS5A 4I50A 2EIJB 2OTJV 4ZOLA 1O9GA 3ZMSA 2ZM6B 2DYRB 3WFVA 1LR1A 3D3QA 2P4VA 5LP6C 3B40A 3OAAG 2H3OA 5KMGA 4MVQA 1NI8A 2W0FC 4X62O 1BE3H 3KG2A 4X1KB 1HDJA 3BA9A 4JAAA 3CEIA 4X8AA 4FFBB 3J80N 1W59A 4CS2A 1JVMA 3U11A 2Q7HA 1XMOO 3CB2A 2B1IA 5E79Z 1NU1H 3W7WA 4J7KA 2ODMA 4K35A 3BCCH 2ZIMA 3ABUA 4UXNA 1OCZB 2R9AA 4WBNA 3OGIB 3A8TA 2OTLV 3SYOA 2WAMA 3JARA 3T2MA 4OPHA 1BS3A 4JI6B 1XMQB 3JD4A 5AG2A 3M99B 1MSWD 4FM0A 4TV8A 1E1RG 3O65A 2D3OW 3OUSA 5IE9A 5BXZA 4F6RA 1IURA 3JD1A 2JS3A 3ABLC 1VQ8V 4K8ZA 3RVYA 4DUYB 1GMGA 1EM1A 5LA6A 4DV0O 3H9VA 2F66C 4NKGB 1Y66A 5LMNO 1SF9A 4JI8B 2VWJA 2WLLB 4FM1A 4AHCA 1I94B 2OT5A 2OIEA 3K5LA 4LF9O 2LW7A 2EBOA 4PDLA 1KBHA 3CCQV 4DV1B 4Z1MG 4ZHQB 4FPPA 5JWPA 3W7SA 3F5TA 1XUQA 1BQ0A 2QKCA 3A0HZ 3AG4C 1KD1W 5H6QA 1T5EA 1VMGA 4MTOA 5IYBO 1SQBH 4PA9A 4YY3O 4LF8B 4KHPO 1OCOC 5H2FZ 4UCUA 1QLEB 2W6JG 3E8FA 1FFTB 2EIMC 2K9PA 3G71V 1UJWB 3OEHG 2IW5A 4LCUC 1SESA 1DF4A 2RJZA 3QF7A 1BHAA 2P67A 4EB6B 5CBGA 2OCCC 2QWNB 2DWEC 2BOCC 3AG3C 3CCVV 1R6TA 3QG5A 3QNEA 3TXQA 5EZYB 2VWKA 5FNVB 2ZQMA 4EFBA 1F4NA 1S3JA 4LF5B 1SZTA 2H8PC 2QTOA 2Q73A 1M57B 3CD6V 4GZRB 3OE7G 3O9OA 1ZL8B 1AI4A 4LFAB 2JJ2G 3E86A 1PKXA 4IHJB 3K57A 3N2GB 3ZCCA 1K4CC 1J5EB 3KCXA 2LFSA 4ZKIA 1VQKV 2W0XA 1NR7A 4H0LB 4HBNA 3ZRXA 4BIOA 3OGCC 1HW7A 3EXAA 3SYQA 2ZXWC 2AW9A 4ZI7A 2PYJA 1OCRC 2R72A 2CTRA 2UXXA 1QCEA 1XNQB 4RAIA 4GKKO 4DV5B 1B6QA 1MMMA 1XQ8A 5BZBA 1N32B 1DF5A 1SQPH 5J2UA 1KKCA 4UCVA 3OM3B 2Y0PA 2YSUB 3VBBA 1ZAUA 4B3TO 4B3RO 1OJHA 3B09A 1HNZO 4RO2A 5IJ0A 2UXDB 5CN0A 2Q0OC 1BSMA 4UVBA 4YIPA 1GTOA 5JVDB 1SS3A 3JCUZ 1G4YB 1VEWA 3MD0A 1GM7A 2CGNA 4OPAA 2P7TC 4LFBO 4IYIA 2DMXA 1WP8A 4DV6O 1S76D 1NVPD 3QVNA 5JJJB 5LXTA 4YJ3B 3X2QB 3E83A 3T4DA 1XBLA 2GUZB 2HFEC 4LF7B 3OR7C 3HB3B 5ITZB 2XHBA 2XNDG 4N21A 2QGNA 2XAFA 2WLIA 1Y76A 3BVOA 2VQEO 2M6YA 1RM1C 3K06A 4O4LB 5B1BB 3OTOO 3AG2C 2UUBO 4JI7O 3CRQA 1Q43A 4JV5O 3ASNB 4XDLA 1LUWA 1IBKO 3APQA 3ZMTA 1OV9A 4RQEA 4J10A 2R9IA 2IJIA 4DV2O 4UUJC 2UUAO 4NXNO 5IWAB 2ZDIC 3S3XA 3ZX6A 5L3FA 5LL6Y 5J2TB 4UB8Z 5LMUB 3CRAA 3JYCA 4X9QA 4JI5B 3MDSA 3JAWB 3HKBB 4DV7B 4J9YB 1Y4MA 2HJDA 1HNXB 1IZ3A 3ABMB 4G28B 4UV9A 5KX5B 4DYLA 2ADQB 4CH4A 1OCCC 4JI3O 4BAYA 3TGUH 4CBCA 2ZCEA 3OMAB 1NKDA 1TUBA 4TOIA 4YJ2A 1AP6A 5EYPA 2YI8A 3ABKC 2EIKC 2ZE5A 3CC7V 1NTKH 4LF6O 4DUZO 4GT1A 4JPRA 2H94A 3AK3A 1X4TA 5DEDA 1VIBA 3MHHC 4FZ0A 2ZDIA 1E1QG 4PD4F 1BMFG 3N2KA 4X65B 2HHHO 4O2BB 4X88A 2RN9A 3R66A 3I55V 2EINB 4GCZA 1S72V 5GW7A 1N8RW 3CE2A 3D36C 1VQ5V 1WAZA 4NXMB 1N33B 3RGBA 3ABTA 3JAKB 2EILB 3HKEB 2F4VO 3ZHRA 4LH7A 2A3QA 1M9NA 3CHXA 2X6CA 3EHBB 4DR7O 4B3MO 4U3JA 1R6NA 2QWOB 3RFRA 3FYEB 5HFMA 4O2AA 3ZN1A 3OMIB 4ASUG 2PYLA 3CCRV 3ZHUA 4JI1O 1TGOA 4E2LA 2AHYA 5IYZB 4BW5A 3B8MA 2UU9O 3T1HO 1U97A 4I7ZB 5LYJB 3DTUB 1RSOB 5KHIA 2NR5A 1JQ0A 3FB7C 2DW4A 4BWAA 3CC2V 4J11A 1H2SB 2UUCO 4YHHO 5DM6V 3SPGA 5JCOA 1U96A 4TUYB 3FFQA 4EKWA 3WB2A 1RP3B 3TK1A 3W7UA 3D36A 3AG1B 1JJ2U 3HR0A 5CA1A 4I9QA 1YZBA 4PA6A 1L0LH 1VQ4V 1FKAO 3M7MX 1M5IA 2CGOA 4O4HA 1YDXA 2EULA 3TXSA 3ASOB 3A2FA 1V55B 3HKDA 3OEEG 2ZKOA 5IY5B 2ZE6A 3SPHA 2CE4A 4G2KA 5GONA 4TT3G 3CRMA 5BMVB 1BCCH 5KHJA 1Q90D 2Y69B 2BSKA 4C7UA 2RCVA 2E5LO 1WNSA 3JALB 4HYOA 1TVKB 2NNUA 4B3SB 1AJQA 4O4IB 4TQFA 3ZMUA 1EZJA 1AILA 3APOA 3CCUV 1FXKA 2RMKB 2Y48A 1URFA 3G4SV 4I55A 2HLDG 5CA0B 2YEVA 3HKCB 1Z5VA 3AK1A 3Q4HB 5H6RA 4FMTA 3ZHVA 1IVSA 4K8XA 3SDLA 3G6EV 5C8YA 3E22A 4X66B 5H5NA 1GN2A 1W0KG 1H2GA 1OCZC 1AI5A 4IT5A 3G80A 3B8NA 4JAUA 1PL0A 4YIOA 4F4LA 4JTAB 4CS4A 2DYSB 2Q9LA 2JEXA 2KG7B 4OXSA 5B1AB 3WG7B 2YUAA 3ZMZA 3JATB 4UCSA 4JYYA 4FZ1A 1F7YA 3P3PA 2JGDA 2A9HA 3CRRA 2AZ0A 4PJ0Z 1AR1B 4X20B 2WLKA 1M4UA 5EC2C 4HNAA 4UCRA 5EIBD 4ABMA 1Q5OA 2C2AA 3E89A 4XDKA 2QWQB 4AQYB 3LNNA 2P90A 1W0JG 3LUTB 4X1KA 1Y74B 2PI4A 1IBMB 2ITCC 1P7GA 2DOSA 4FFBA 4UCTA 1N36O 4DRXB 1H2KA 5IJ9B 2JRIA 3RBZA 2Q7EA 1VQ9V 3ETGA 3UT5B 1FD9A 1KECA 3ZJZA 1PP9H 1QLNA 3H1IH 2W6IG 2ZM6O 4Q6GA 2LQTA 3K3WA 4JASA 5JH7B 4DR5B 2YIBD 3ETEA 1QLEC 1W2BU 4FLYA 2QM8A 2RNBA 4FLUA 1K92A 4LBEC 1P49A 2M7WA 4OX9B 3BHPA 3ZBHA 2ZR3A 1JFFB 3H1HH 3H1KH 3OR6C 1DLBA 3E8HA 5EK0A 4DR2B 4A5UB 1B04A 5GTIZ 4JYAB 1KP3A 2WLJA 4QPKA 3ZRVA 3A0RA 3TETA 2WLLA 3FX7A 1VF7A 2Y0IA 4QNHB 4U7OA 1WPXA 4JI6O 4NTWA 4ZHQA 3ETDA 2P06A 4MVZA 1H8EG 1CP9A 3RN4A 2N05A 3EVKA 5B3SB 5EBWC 2GBOA 1LUVA 3F5WC 2VRZA 1GM8A 2IU3A 3ZIAG 1JR9A 4RQFA 1WA8B 2YIAA 1XMOB 5KAFZ 4DUYO 5DN6G 1TUEB 4I50B 4XDJA 1Q7YW 4R7CA 1YTFD 3DGEA 4JI8O 1SETA 2HKOA 1JJOA 1MSDA 3C3TA 1N4CA 5D5PA 3L70H 4TSFG 3SPIA 3CRCA 2XT9A 3WU2Z 1K5SA 4DK0A 5KMGB 4WCEV 5HFLA 4RUEA 4DV1O 2DQ3A 3RYIB 1FAFA 4FLVA 1ZSPA 5KHKA 4JZGA 2YIBA 2CTQA 4LNUB 5EZYA 3TCUA 4Z2WA 5FNVA 2XOKG 1MZEA 1IXBA 1VQ6V 1NJIW 4LF8O 3ZS8C 2VQFB 4ICGA 1ZL8A 4GYCB 1I0HA 1RFYA 2V7QG 4IHJA 4J80A 3X2QC 3N2GA 3ZHQA 1S77D 2IM9A 4Q20A 3LDEA 3JD2A 4PV1B 4DR6O 1YEWA 3ML0A 3D3IA 2B9ZA 4LF9B 1XI1A 4IGGA 1SC5B 4U7NA 2PF4E 1R3IC 4BR6A 1WPBA 2XAHA 4LWSB 4LF5O 3H01A 5B1BC 1XL6A 2JIZG 5LP6B 3CCSV 4FIPC 1ROPA 4LFAO 1YVWA 4LFCB 1K97A 1K5QA 1MABG 3IAYA 1R3JC 2HR3A 3UO2A 1J5EO 2G38A 1I5XA 1XHZA 5JVDA 1AI6A 4CC6A 2ZE8A 1S0VA 4J42A 3LDCA 4L8JA 3D8CA 1AP5A 1THZA 2YXLA 2WPDG 3BA8A 1D5NA 1MG1A 4DR4O 3LSQA 2QM7A 1K33A 1Q6UA 1Y6XA 1AR5A 1SQVH 4YJ3A 1VQPV 3P32A 1QNMA 4ZIBA 1BZKA 1XNQO 3ABMC 4DV5O 2QE7G 2Y4UA 4EEQA 3JASA 1AR4A 1N32O 4FLWA 4GUNA 3K5NA 3LNMB 3SPCA 3RVZA 5BR8O 2P5OA 3RYHB 1GN6A 1FFXB 2UXDO 5JJNB 1M56C 4MVMA 3AEIA 1R3KC 2CAZC 3VQXA 4O4LA
chains in the Genus database with same CATH topology
2Z0AA 4K0KO 1HR0O 1XNRO 4LF8O 3RT3C 3J80N 2HHHO 2ZM6O 2E5LO 5FLXN 3J81N 3R66A 4DV3O 2UXBO 2UXCO 5IT9N 1I94O 1DK1A 2F4VO 1R6TA 4DR1O 1AILA 2VQEO 1XEQA 1D2DA 1XMOO 4LF7O 1AB3A 3OTOO 4JI4O 4B3MO 4DR7O 1NS1A 4X65O 2UUBO 4DR6O 1HNWO 4JI7O 2VQFO 4JI0O 1IBMO 1FYJA 2DJVA 1N33O 4JV5O 4A5UB 4B3SO 3J7AU 4JI1O 1IBKO 1IBLO 3SDLA 4OPHA 1X59A 4X64O 2UU9O 4DV2O 3T1HO 1N34O 2UUAO 4NXNO 2FKXA 4LF5O 4OX9O 4DV4O 5H5NA 5LL6Y 3O65A 1FJGO 4LFAO 4DR2O 2N74A 5BXZA 2UUCO 4YHHO 1R1BA 4GKJO 4JYAO 4JI6O 4NXMO 1J5EO 5IWAO 4DR5O 4DV0O 4GKKO 5LMNO 4JI3O 1F7YA 4LF4O 5LMUO 5BY1A 3T1YO 3JAMN 4LFCO 4JI2O 4B3TO 4DV7O 4DR4O 4LF9O 4B3RO 2LW7A 1HNZO 1HNXO 4DUYO 1YZBA 3F5TA 1KUQA 1XNQO 4DV5O 3M8AA 5A2QN 4JI8O 1FKAO 1N32O 2AGAA 1XMQO 4OPAA 4X66O 4LF6O 4DUZO 2DOSA 4LFBO 4YY3O 4KHPO 4DV6O 1N36O 5BR8O 4DR3O 1A32A 2ZKOA 4DV1O 2UXDO 2JRIA 4JI5O 4AQYO 1G1XB 4X62O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0A A;  4K0K O;  1HR0 O;  1XNR O;  4LF8 O;  3RT3 C;  3J80 N;  2HHH O;  2ZM6 O;  2E5L O;  5FLX N;  3J81 N;  3R66 A;  4DV3 O;  2UXB O;  2UXC O;  5IT9 N;  1I94 O;  1DK1 A;  2F4V O;  1R6T A;  4DR1 O;  1AIL A;  2VQE O;  1XEQ A;  1D2D A;  1XMO O;  4LF7 O;  1AB3 A;  3OTO O;  4JI4 O;  4B3M O;  4DR7 O;  1NS1 A;  4X65 O;  2UUB O;  4DR6 O;  1HNW O;  4JI7 O;  2VQF O;  4JI0 O;  1IBM O;  1FYJ A;  2DJV A;  1N33 O;  4JV5 O;  4A5U B;  4B3S O;  3J7A U;  4JI1 O;  1IBK O;  1IBL O;  3SDL A;  4OPH A;  1X59 A;  4X64 O;  2UU9 O;  4DV2 O;  3T1H O;  1N34 O;  2UUA O;  4NXN O;  2FKX A;  4LF5 O;  4OX9 O;  4DV4 O;  5H5N A;  5LL6 Y;  3O65 A;  1FJG O;  4LFA O;  4DR2 O;  2N74 A;  5BXZ A;  2UUC O;  4YHH O;  1R1B A;  4GKJ O;  4JYA O;  4JI6 O;  4NXM O;  1J5E O;  5IWA O;  4DR5 O;  4DV0 O;  4GKK O;  5LMN O;  4JI3 O;  1F7Y A;  4LF4 O;  5LMU O;  5BY1 A;  3T1Y O;  3JAM N;  4LFC O;  4JI2 O;  4B3T O;  4DV7 O;  4DR4 O;  4LF9 O;  4B3R O;  2LW7 A;  1HNZ O;  1HNX O;  4DUY O;  1YZB A;  3F5T A;  1KUQ A;  1XNQ O;  4DV5 O;  3M8A A;  5A2Q N;  4JI8 O;  1FKA O;  1N32 O;  2AGA A;  1XMQ O;  4OPA A;  4X66 O;  4LF6 O;  4DUZ O;  2DOS A;  4LFB O;  4YY3 O;  4KHP O;  4DV6 O;  1N36 O;  5BR8 O;  4DR3 O;  1A32 A;  2ZKO A;  4DV1 O;  2UXD O;  2JRI A;  4JI5 O;  4AQY O;  1G1X B;  4X62 O; 
#chains in the Genus database with same CATH topology
 1IDS A;  2AXT Z;  2ZD9 A;  3RYF B;  1H38 A;  1PL4 A;  3ABL B;  1HNW B;  2GTA A;  5IT9 N;  2QR4 A;  3GWO A;  3L73 H;  4KFM A;  1QQC A;  1VAR A;  2YC0 A;  2YI9 A;  4MVU A;  1EFR G;  2RQ6 A;  5LBQ A;  2F95 B;  2ZIO A;  3K9A A;  5A9G A;  4LF7 O;  3E8G A;  4BIZ A;  4JI0 O;  1QHT A;  3L72 H;  1SQQ H;  2DJV A;  5FPO A;  2EIN C;  1R73 A;  3GVM A;  3JAW A;  3HKB A;  3OD4 A;  2GV9 A;  4MSW C;  4G27 B;  4MTF A;  2GDS A;  3I5D A;  5KX5 A;  1N34 O;  4QE9 A;  3SYC A;  1OCO B;  1XOU A;  4PA4 A;  1YIT V;  2PUS A;  4B7E A;  3GB7 C;  3OW2 U;  3FAV B;  2A79 B;  1RPR A;  2EIM B;  1R1B A;  4KL1 A;  4RWU A;  4JF3 A;  5IWA O;  1UPG A;  2HVK C;  2OCC B;  5CA3 A;  2Q67 A;  2FB5 A;  5LMU O;  3OUF A;  3AG3 B;  4NR1 A;  1MNG A;  1NBM G;  2O57 A;  4DV7 O;  2JDI G;  5K1X A;  3CPW U;  2ZE7 A;  2CTP A;  1XIL A;  1HNX O;  2B1G A;  3DXR B;  2RDC A;  1HP8 A;  3B77 A;  3MHS C;  1YI2 V;  4JI7 B;  4FVM A;  1ORQ C;  2F43 G;  1GM9 A;  1WP7 A;  2ATK C;  1GO3 F;  4W4L A;  4X1I A;  4DV3 B;  3UO3 A;  1OHH G;  3AG1 C;  2UXN A;  5GTH Z;  4DV2 B;  4NXN B;  3JAK A;  2BE3 A;  1NH2 B;  3HKE A;  5EBL C;  4DR1 B;  5L3C A;  3KKY A;  1YSC A;  1Q81 W;  1Q6H A;  1XL4 A;  2PTM A;  2XAJ A;  4Z1V A;  1V54 B;  2QDO A;  4I4T B;  1V55 C;  5EBM C;  5IY5 C;  1K9M W;  4IL6 Z;  1ZLZ A;  5D5Q A;  5IYZ A;  1JMK C;  3K04 A;  2BCC H;  3C3S A;  1D2D A;  5KUM A;  5JCO C;  1PNK A;  1KC8 W;  5LYJ A;  3KCY A;  4X65 O;  1V9P A;  3BAB A;  2ETN A;  4ZBM A;  5KLV H;  1NT2 B;  4IYH A;  1N33 O;  2WSS G;  4TWK A;  1BGY H;  2OIG A;  2QWR B;  1S5H C;  1PNL A;  4TUY A;  2Q0A A;  3T1C A;  5CB4 B;  4D6T H;  3LSS A;  1GN3 A;  1EN5 A;  2CH7 A;  3FKS G;  4LF4 B;  2NN4 A;  3T1Y B;  2FL4 A;  2WWW A;  4JI2 B;  3CCJ V;  2IJJ A;  1G8M A;  3CWB H;  3UQ8 A;  4GX1 A;  1YF2 A;  1GKF A;  3CCL V;  2P6J A;  2QEX V;  3IGA C;  2QWP B;  2YIC A;  2Q5Z A;  2F4V B;  4JYB A;  3AG2 B;  1TA8 A;  3ZRS A;  2X6B A;  2DYS C;  5BMV A;  2LGQ A;  2AGA A;  5IYD O;  3W7T A;  1PPJ H;  1FXK C;  2LGW A;  2GSM B;  2NLJ C;  1SA0 B;  4JI1 B;  3K5O A;  3JAL A;  1VF6 C;  3STZ C;  1YJW V;  5DEC A;  2UXC B;  3KZI Z;  2UU9 B;  4TV9 A;  4O4I A;  2HEP A;  2Q69 A;  4X1Y A;  2EJR A;  2Z3Y A;  4PEL A;  1XNR O;  4PA3 A;  1S5J A;  5CA0 A;  3ETQ A;  3J81 N;  3HKC A;  1NTZ H;  3Q4H A;  3IJ4 A;  4O4J B;  2WA4 A;  4RUF A;  4EFE A;  1IBL B;  1JOY A;  4X64 B;  5FPR A;  3L74 H;  2EJ7 A;  3ZRW A;  4WFB V;  4I0X A;  3CMA V;  1Z2G A;  2AHZ A;  4PDM A;  3N27 A;  3FB6 C;  1TAE A;  3ABK B;  4B3S O;  2EIJ C;  4MTG A;  4GKJ B;  1BQZ A;  2DYR C;  1WJZ A;  3JD0 A;  2KG7 A;  3SYP A;  5L3G A;  5LGT A;  3JAT A;  3DC5 A;  4JYC A;  1YCI A;  3BY6 A;  2Q7G A;  2PZS A;  1VF6 A;  4X20 A;  3RYC B;  5K1P A;  5LHH A;  2DWD C;  3G6B A;  1ZUQ A;  3ZED A;  4MTX A;  3UM7 A;  3K79 A;  1O9H A;  2A0L A;  1QR8 A;  5JQG B;  5B1N A;  3NR7 A;  5J9P C;  2MW2 B;  1Y74 A;  3CSX A;  2BTQ B;  3JAM N;  1RPO A;  5CA1 B;  3F7V C;  3FD9 A;  4DRX A;  2F93 B;  1SZX A;  4XBF A;  1JPX A;  2DN9 A;  2JJ1 G;  2Q68 A;  3UT5 A;  4JTC B;  4DW1 A;  5EC1 C;  1VQO V;  1VP7 A;  4CH6 A;  1L8D A;  4K0K B;  2X6A A;  2L35 A;  1HR0 B;  4QGP A;  5B3S C;  2P22 C;  2E3C A;  2UXB B;  4DR3 O;  4AQY O;  2JEU A;  5JJE B;  3SJA C;  1KB9 F;  1G1X B;  4DO2 A;  1N0J A;  2V4D A;  1US6 A;  2OCH A;  1P84 F;  2HVJ C;  2FML A;  2ZR2 A;  4CC5 A;  1M93 A;  3CJH B;  5LGN A;  4MVO A;  2KSD A;  3VQY A;  2YXH A;  1I5Y A;  3H1J H;  1N0N A;  2JK5 C;  4JI4 O;  1NS1 A;  4DV4 B;  4D7S A;  5EIB C;  1VQL V;  2ZIN A;  1B3Q A;  4MS2 A;  4IIJ B;  1FJG B;  3K03 A;  3K0G A;  1KP2 A;  3J7A U;  4KXR A;  2XUM A;  1H2N A;  4NTY A;  4UCO A;  1LNQ A;  2WA3 A;  5CBH A;  3K0D A;  4OX9 O;  3WB1 A;  2DE0 X;  1IX9 A;  1VQN V;  1WLE A;  3K5M A;  1UFI A;  2LO1 A;  5LHI A;  5LOV B;  1VQ7 V;  1COW G;  2JS5 A;  4DR2 O;  1DGS A;  3QTC A;  4JYA O;  1H8H G;  1Q6I A;  1WA8 A;  3BRC A;  3OMN B;  3LSU A;  4R6Z A;  4MW8 A;  2QKA A;  3ZHT A;  4KP4 A;  1JA8 A;  1FPO A;  2CDY A;  4HNA B;  4CH3 A;  4FJC C;  2E76 B;  3EFF K;  1YJN V;  4PI0 A;  1M57 C;  2IBZ H;  3RYI A;  2Q6A A;  4LNU A;  1EN6 A;  5A2Q N;  4X62 B;  4WFF A;  1XMQ O;  2Q8V A;  2WLN A;  1QR9 A;  4KUM A;  1Q82 W;  1YHQ V;  3CP1 A;  1KQS U;  4I9W A;  4P30 A;  1QVG U;  1YXB A;  3CXH F;  4YXW G;  4DK1 A;  1XRE A;  1YIJ V;  3UKM A;  1K73 W;  1I08 A;  1HWY A;  2F1M A;  2PGG A;  4R50 A;  4ZOL B;  3RT3 C;  5KUK A;  2LJ2 A;  1NZ6 A;  2XAS A;  4H44 B;  2KB1 A;  1I94 O;  4EB6 A;  4MVS A;  2K1E A;  4LWS A;  2WLH A;  1K4D C;  1AB3 A;  2YS8 A;  1SQG A;  3IC9 A;  5LP6 A;  2WLM A;  3CC4 V;  2VQF O;  4UV8 A;  5LGU A;  1J95 A;  5TIS Z;  2KKW A;  1XDC A;  3VOU A;  3SJB C;  1NQT A;  3L9D A;  4DV0 B;  1WB7 A;  3CME V;  3ZN0 A;  5LMN B;  5E1A C;  4JAV A;  3CYO A;  4WBN B;  1MA1 A;  1SRY A;  4P9O A;  4HAM A;  4WF9 V;  2A06 H;  2QJ1 A;  3JAR B;  2LFR A;  2KQX A;  4UVA A;  3RW0 A;  1VF5 B;  2DQ0 A;  5IDJ A;  2P4K A;  2Y4T A;  4TV8 B;  4WFG A;  1L1F A;  3IC7 A;  4FLX A;  3W7X A;  4LFC O;  4YY3 B;  4KHP B;  4UB6 Z;  4F6R B;  3RYH A;  1SQF A;  1FFX A;  5LA6 B;  1F23 A;  1CXZ B;  3ASN C;  3M8A A;  4DR6 B;  3DC6 A;  3SGI A;  3SR2 C;  5KAI Z;  3H1L H;  2B5U A;  4QPJ A;  1EBO A;  3RYF A;  1DTO A;  3TJT A;  5LHG A;  2CTW A;  1NH2 D;  4CH5 A;  1K34 A;  3FB5 C;  1FXH A;  2Z0A A;  1KU9 A;  3K08 A;  2IU0 A;  3QO5 A;  1OZ0 A;  2HP8 A;  2GUZ A;  3JCZ A;  1GK9 A;  5FLX N;  1ENV A;  2EZP A;  5ITZ A;  4GX5 A;  1ZX3 A;  1DK1 A;  1Z5W A;  3JSN A;  3QO7 A;  4D7T A;  4J41 A;  2ZNI A;  1MZF A;  4DR4 B;  1HNW O;  2ZT9 B;  2IH1 C;  4K3A A;  3FAV A;  4H13 B;  1AVM A;  4NB5 A;  1V54 C;  1IXM A;  2BTO A;  4CZZ A;  5B5E Z;  5B1O A;  3SJC C;  4OGQ B;  4GKK B;  3CXC U;  5BR8 B;  3BAA A;  2XAQ A;  5IYC O;  4P2Z A;  2N74 A;  2IJH A;  4B3T B;  4P9P A;  1K8A W;  4NTX A;  4B3R B;  1G6U A;  2E74 B;  2V1D A;  2YID A;  5J2T A;  1HNZ B;  1YTF B;  4MW3 A;  3DXR A;  3ZMV A;  1GRJ A;  3AG4 B;  1YJ9 V;  4QIW F;  3JSL A;  4B7K A;  2EIL C;  1Q3E A;  3AG7 A;  5BY1 A;  3S3W A;  4LFB B;  4DV6 B;  1QU7 A;  4WFE A;  3JAS B;  4ZI7 B;  3PN1 A;  2XTA A;  2JVD A;  2QKS A;  1H2L A;  1GAX A;  4WFH A;  4MVR A;  4CS3 A;  5J2U B;  4JI0 B;  4NYK A;  2GTS A;  1P4R A;  2YXY A;  2AZ2 A;  3E8B A;  4GX0 A;  1BL8 A;  2N04 A;  1FXV A;  1FS0 G;  4I4T A;  1N34 B;  5IJ0 B;  4JI5 O;  4J7J A;  1BT8 A;  4J7Z A;  4JZ2 A;  2IJK A;  2VQE B;  3CCE V;  2QTS A;  2OYQ A;  3OTO B;  3K9S A;  1WN7 A;  2UUB B;  4DV3 O;  4DW0 A;  4JV5 B;  5LXT B;  3CCM V;  4PA7 A;  4AIL C;  4J9Z B;  4O2B A;  1IBK B;  3GWK C;  4DR1 O;  4BIU A;  1XEQ A;  3L75 H;  2UUA B;  1H2M A;  2R70 A;  5L3D A;  2Z5U A;  5CB4 A;  1NR1 A;  1KMI Z;  4X89 A;  2BOB C;  3K59 A;  2QM4 A;  3I56 V;  4HZ3 A;  2MK3 A;  2ZXW B;  3VQW A;  1OCR B;  1Y76 B;  2WLI B;  2PI5 A;  4U3F H;  3ASO C;  1D5A A;  3U10 A;  4MT8 A;  1R3L C;  2YDE A;  1VQM V;  4JI3 B;  1M56 B;  2FYU H;  2Y69 C;  1RSO A;  3BPZ A;  4H37 A;  4GLX A;  4JTD B;  2ADP A;  3CX5 F;  2HJF C;  4NXM O;  3B2E E;  4W4K A;  1SER A;  1AJP A;  1ARO P;  4BW9 A;  3E2E A;  3IFX A;  4QE7 A;  2VS0 A;  4B08 A;  4LF4 O;  4PI2 A;  3T1Y O;  4LF6 B;  4DUZ B;  4JI2 O;  1SA0 A;  1P7B A;  1Q8I A;  1B06 A;  1XHX A;  2QA4 V;  2ITD C;  1QVF U;  1PV0 A;  1JX9 A;  1F51 A;  3AK2 A;  4L87 A;  3LDD A;  1E79 G;  4X1I B;  1AI7 A;  2F23 A;  1PNM A;  4E4E A;  2HHH B;  3JD3 A;  1GN4 A;  1A32 A;  1SQX H;  1NVP B;  1KYO F;  3FYI B;  2E75 B;  1TUB B;  3STL C;  4YJ2 B;  4O4J A;  2XAG A;  1RM1 B;  5EYP B;  1PD3 A;  4LH6 A;  4NVP A;  2X7R B;  4LC1 A;  4DR7 B;  4B3M B;  3UCS C;  4TQD A;  3R65 A;  5B1A C;  3WG7 C;  2CK3 G;  2UXC O;  1EZV H;  1PM9 A;  3HPL C;  3A0B Z;  4LR3 A;  4R8C A;  1NTM H;  1TVK A;  3QO8 A;  2JGU A;  3T1H B;  1CPY A;  4FLZ A;  3N2K B;  4FK5 C;  3RWR D;  5F2V O;  1Q86 W;  1FYJ A;  4WFA V;  1ZTE A;  2UUC B;  4YHH B;  3RYC A;  4FLT A;  4H33 A;  2LW1 A;  1IBL O;  3SYA A;  1X59 A;  3P30 A;  4X64 O;  3ICX A;  2CH7 B;  2FTK A;  5KA5 A;  4U3J B;  1OCC B;  5JQG A;  5L3E A;  4FFK A;  5FL7 G;  2GHY A;  4O2A B;  2BTQ A;  5L3B A;  2R9R B;  4GKJ O;  3BFR A;  5KA6 A;  3OT7 A;  5KHG A;  1XNR B;  2HG5 C;  2Q4P A;  2EIK B;  1R6K A;  2IH3 C;  1BHB A;  5B66 Z;  3DSQ A;  4FM2 A;  1K3E A;  1S5L Z;  1WB8 A;  1M90 W;  3NXS A;  2LP7 A;  2EX3 A;  1K7D A;  2L6L A;  4UVC A;  5C93 A;  3L71 H;  3E35 A;  5KHH A;  1GH6 A;  4QJF B;  4X66 O;  2E5L B;  4F6E A;  4TV9 B;  3CJH A;  3U0Z A;  4X1Y B;  3F7Y C;  5CBF A;  2ARH A;  1JCH A;  5IJ9 A;  3P3N A;  4K0K O;  3B4S A;  1HR0 O;  4O4H B;  3OTF A;  4PDR A;  4IIJ A;  1KKD A;  3PJS K;  2UXB O;  3HKD B;  4N23 A;  4PHZ A;  3ZHS A;  1F4M A;  3SJQ C;  4GX2 A;  4JGS A;  3ZRW B;  4I0X B;  5GON B;  1I7F A;  5JH7 A;  2PY5 A;  3G67 A;  1SKV A;  2BSK B;  3T4Z A;  3K58 A;  5LOV A;  1IBM O;  1MOF A;  2CUG A;  4PDV A;  1JFF A;  5H9C A;  1M1K W;  2A7W A;  3MAQ A;  1FXK B;  2FKX A;  3C90 A;  4I55 B;  4DV4 O;  2D2C B;  2YEV B;  4DR3 B;  4I5S A;  1FJG O;  1Y67 A;  3WB0 A;  3BEH A;  3THO A;  4LP8 A;  3OFN G;  2EZO A;  2ZNJ A;  1AJN A;  1CEZ A;  5C8Y B;  3E22 B;  4DR5 O;  2QSA A;  2OWO A;  1ZWI C;  4UFZ A;  3VQV A;  1QBZ A;  2ILM A;  1EN4 A;  2X0L A;  5CMU A;  1N36 B;  4DXW A;  4AI8 A;  4JI4 B;  1L0N H;  1KUQ A;  3FB8 C;  3SPJ A;  2JGD B;  3CS5 A;  4I50 A;  2EIJ B;  2OTJ V;  4ZOL A;  1O9G A;  3ZMS A;  2ZM6 B;  2DYR B;  3WFV A;  1LR1 A;  3D3Q A;  2P4V A;  5LP6 C;  3B40 A;  3OAA G;  2H3O A;  5KMG A;  4MVQ A;  1NI8 A;  2W0F C;  4X62 O;  1BE3 H;  3KG2 A;  4X1K B;  1HDJ A;  3BA9 A;  4JAA A;  3CEI A;  4X8A A;  4FFB B;  3J80 N;  1W59 A;  4CS2 A;  1JVM A;  3U11 A;  2Q7H A;  1XMO O;  3CB2 A;  2B1I A;  5E79 Z;  1NU1 H;  3W7W A;  4J7K A;  2ODM A;  4K35 A;  3BCC H;  2ZIM A;  3ABU A;  4UXN A;  1OCZ B;  2R9A A;  4WBN A;  3OGI B;  3A8T A;  2OTL V;  3SYO A;  2WAM A;  3JAR A;  3T2M A;  4OPH A;  1BS3 A;  4JI6 B;  1XMQ B;  3JD4 A;  5AG2 A;  3M99 B;  1MSW D;  4FM0 A;  4TV8 A;  1E1R G;  3O65 A;  2D3O W;  3OUS A;  5IE9 A;  5BXZ A;  4F6R A;  1IUR A;  3JD1 A;  2JS3 A;  3ABL C;  1VQ8 V;  4K8Z A;  3RVY A;  4DUY B;  1GMG A;  1EM1 A;  5LA6 A;  4DV0 O;  3H9V A;  2F66 C;  4NKG B;  1Y66 A;  5LMN O;  1SF9 A;  4JI8 B;  2VWJ A;  2WLL B;  4FM1 A;  4AHC A;  1I94 B;  2OT5 A;  2OIE A;  3K5L A;  4LF9 O;  2LW7 A;  2EBO A;  4PDL A;  1KBH A;  3CCQ V;  4DV1 B;  4Z1M G;  4ZHQ B;  4FPP A;  5JWP A;  3W7S A;  3F5T A;  1XUQ A;  1BQ0 A;  2QKC A;  3A0H Z;  3AG4 C;  1KD1 W;  5H6Q A;  1T5E A;  1VMG A;  4MTO A;  5IYB O;  1SQB H;  4PA9 A;  4YY3 O;  4LF8 B;  4KHP O;  1OCO C;  5H2F Z;  4UCU A;  1QLE B;  2W6J G;  3E8F A;  1FFT B;  2EIM C;  2K9P A;  3G71 V;  1UJW B;  3OEH G;  2IW5 A;  4LCU C;  1SES A;  1DF4 A;  2RJZ A;  3QF7 A;  1BHA A;  2P67 A;  4EB6 B;  5CBG A;  2OCC C;  2QWN B;  2DWE C;  2BOC C;  3AG3 C;  3CCV V;  1R6T A;  3QG5 A;  3QNE A;  3TXQ A;  5EZY B;  2VWK A;  5FNV B;  2ZQM A;  4EFB A;  1F4N A;  1S3J A;  4LF5 B;  1SZT A;  2H8P C;  2QTO A;  2Q73 A;  1M57 B;  3CD6 V;  4GZR B;  3OE7 G;  3O9O A;  1ZL8 B;  1AI4 A;  4LFA B;  2JJ2 G;  3E86 A;  1PKX A;  4IHJ B;  3K57 A;  3N2G B;  3ZCC A;  1K4C C;  1J5E B;  3KCX A;  2LFS A;  4ZKI A;  1VQK V;  2W0X A;  1NR7 A;  4H0L B;  4HBN A;  3ZRX A;  4BIO A;  3OGC C;  1HW7 A;  3EXA A;  3SYQ A;  2ZXW C;  2AW9 A;  4ZI7 A;  2PYJ A;  1OCR C;  2R72 A;  2CTR A;  2UXX A;  1QCE A;  1XNQ B;  4RAI A;  4GKK O;  4DV5 B;  1B6Q A;  1MMM A;  1XQ8 A;  5BZB A;  1N32 B;  1DF5 A;  1SQP H;  5J2U A;  1KKC A;  4UCV A;  3OM3 B;  2Y0P A;  2YSU B;  3VBB A;  1ZAU A;  4B3T O;  4B3R O;  1OJH A;  3B09 A;  1HNZ O;  4RO2 A;  5IJ0 A;  2UXD B;  5CN0 A;  2Q0O C;  1BSM A;  4UVB A;  4YIP A;  1GTO A;  5JVD B;  1SS3 A;  3JCU Z;  1G4Y B;  1VEW A;  3MD0 A;  1GM7 A;  2CGN A;  4OPA A;  2P7T C;  4LFB O;  4IYI A;  2DMX A;  1WP8 A;  4DV6 O;  1S76 D;  1NVP D;  3QVN A;  5JJJ B;  5LXT A;  4YJ3 B;  3X2Q B;  3E83 A;  3T4D A;  1XBL A;  2GUZ B;  2HFE C;  4LF7 B;  3OR7 C;  3HB3 B;  5ITZ B;  2XHB A;  2XND G;  4N21 A;  2QGN A;  2XAF A;  2WLI A;  1Y76 A;  3BVO A;  2VQE O;  2M6Y A;  1RM1 C;  3K06 A;  4O4L B;  5B1B B;  3OTO O;  3AG2 C;  2UUB O;  4JI7 O;  3CRQ A;  1Q43 A;  4JV5 O;  3ASN B;  4XDL A;  1LUW A;  1IBK O;  3APQ A;  3ZMT A;  1OV9 A;  4RQE A;  4J10 A;  2R9I A;  2IJI A;  4DV2 O;  4UUJ C;  2UUA O;  4NXN O;  5IWA B;  2ZDI C;  3S3X A;  3ZX6 A;  5L3F A;  5LL6 Y;  5J2T B;  4UB8 Z;  5LMU B;  3CRA A;  3JYC A;  4X9Q A;  4JI5 B;  3MDS A;  3JAW B;  3HKB B;  4DV7 B;  4J9Y B;  1Y4M A;  2HJD A;  1HNX B;  1IZ3 A;  3ABM B;  4G28 B;  4UV9 A;  5KX5 B;  4DYL A;  2ADQ B;  4CH4 A;  1OCC C;  4JI3 O;  4BAY A;  3TGU H;  4CBC A;  2ZCE A;  3OMA B;  1NKD A;  1TUB A;  4TOI A;  4YJ2 A;  1AP6 A;  5EYP A;  2YI8 A;  3ABK C;  2EIK C;  2ZE5 A;  3CC7 V;  1NTK H;  4LF6 O;  4DUZ O;  4GT1 A;  4JPR A;  2H94 A;  3AK3 A;  1X4T A;  5DED A;  1VIB A;  3MHH C;  4FZ0 A;  2ZDI A;  1E1Q G;  4PD4 F;  1BMF G;  3N2K A;  4X65 B;  2HHH O;  4O2B B;  4X88 A;  2RN9 A;  3R66 A;  3I55 V;  2EIN B;  4GCZ A;  1S72 V;  5GW7 A;  1N8R W;  3CE2 A;  3D36 C;  1VQ5 V;  1WAZ A;  4NXM B;  1N33 B;  3RGB A;  3ABT A;  3JAK B;  2EIL B;  3HKE B;  2F4V O;  3ZHR A;  4LH7 A;  2A3Q A;  1M9N A;  3CHX A;  2X6C A;  3EHB B;  4DR7 O;  4B3M O;  4U3J A;  1R6N A;  2QWO B;  3RFR A;  3FYE B;  5HFM A;  4O2A A;  3ZN1 A;  3OMI B;  4ASU G;  2PYL A;  3CCR V;  3ZHU A;  4JI1 O;  1TGO A;  4E2L A;  2AHY A;  5IYZ B;  4BW5 A;  3B8M A;  2UU9 O;  3T1H O;  1U97 A;  4I7Z B;  5LYJ B;  3DTU B;  1RSO B;  5KHI A;  2NR5 A;  1JQ0 A;  3FB7 C;  2DW4 A;  4BWA A;  3CC2 V;  4J11 A;  1H2S B;  2UUC O;  4YHH O;  5DM6 V;  3SPG A;  5JCO A;  1U96 A;  4TUY B;  3FFQ A;  4EKW A;  3WB2 A;  1RP3 B;  3TK1 A;  3W7U A;  3D36 A;  3AG1 B;  1JJ2 U;  3HR0 A;  5CA1 A;  4I9Q A;  1YZB A;  4PA6 A;  1L0L H;  1VQ4 V;  1FKA O;  3M7M X;  1M5I A;  2CGO A;  4O4H A;  1YDX A;  2EUL A;  3TXS A;  3ASO B;  3A2F A;  1V55 B;  3HKD A;  3OEE G;  2ZKO A;  5IY5 B;  2ZE6 A;  3SPH A;  2CE4 A;  4G2K A;  5GON A;  4TT3 G;  3CRM A;  5BMV B;  1BCC H;  5KHJ A;  1Q90 D;  2Y69 B;  2BSK A;  4C7U A;  2RCV A;  2E5L O;  1WNS A;  3JAL B;  4HYO A;  1TVK B;  2NNU A;  4B3S B;  1AJQ A;  4O4I B;  4TQF A;  3ZMU A;  1EZJ A;  1AIL A;  3APO A;  3CCU V;  1FXK A;  2RMK B;  2Y48 A;  1URF A;  3G4S V;  4I55 A;  2HLD G;  5CA0 B;  2YEV A;  3HKC B;  1Z5V A;  3AK1 A;  3Q4H B;  5H6R A;  4FMT A;  3ZHV A;  1IVS A;  4K8X A;  3SDL A;  3G6E V;  5C8Y A;  3E22 A;  4X66 B;  5H5N A;  1GN2 A;  1W0K G;  1H2G A;  1OCZ C;  1AI5 A;  4IT5 A;  3G80 A;  3B8N A;  4JAU A;  1PL0 A;  4YIO A;  4F4L A;  4JTA B;  4CS4 A;  2DYS B;  2Q9L A;  2JEX A;  2KG7 B;  4OXS A;  5B1A B;  3WG7 B;  2YUA A;  3ZMZ A;  3JAT B;  4UCS A;  4JYY A;  4FZ1 A;  1F7Y A;  3P3P A;  2JGD A;  2A9H A;  3CRR A;  2AZ0 A;  4PJ0 Z;  1AR1 B;  4X20 B;  2WLK A;  1M4U A;  5EC2 C;  4HNA A;  4UCR A;  5EIB D;  4ABM A;  1Q5O A;  2C2A A;  3E89 A;  4XDK A;  2QWQ B;  4AQY B;  3LNN A;  2P90 A;  1W0J G;  3LUT B;  4X1K A;  1Y74 B;  2PI4 A;  1IBM B;  2ITC C;  1P7G A;  2DOS A;  4FFB A;  4UCT A;  1N36 O;  4DRX B;  1H2K A;  5IJ9 B;  2JRI A;  3RBZ A;  2Q7E A;  1VQ9 V;  3ETG A;  3UT5 B;  1FD9 A;  1KEC A;  3ZJZ A;  1PP9 H;  1QLN A;  3H1I H;  2W6I G;  2ZM6 O;  4Q6G A;  2LQT A;  3K3W A;  4JAS A;  5JH7 B;  4DR5 B;  2YIB D;  3ETE A;  1QLE C;  1W2B U;  4FLY A;  2QM8 A;  2RNB A;  4FLU A;  1K92 A;  4LBE C;  1P49 A;  2M7W A;  4OX9 B;  3BHP A;  3ZBH A;  2ZR3 A;  1JFF B;  3H1H H;  3H1K H;  3OR6 C;  1DLB A;  3E8H A;  5EK0 A;  4DR2 B;  4A5U B;  1B04 A;  5GTI Z;  4JYA B;  1KP3 A;  2WLJ A;  4QPK A;  3ZRV A;  3A0R A;  3TET A;  2WLL A;  3FX7 A;  1VF7 A;  2Y0I A;  4QNH B;  4U7O A;  1WPX A;  4JI6 O;  4NTW A;  4ZHQ A;  3ETD A;  2P06 A;  4MVZ A;  1H8E G;  1CP9 A;  3RN4 A;  2N05 A;  3EVK A;  5B3S B;  5EBW C;  2GBO A;  1LUV A;  3F5W C;  2VRZ A;  1GM8 A;  2IU3 A;  3ZIA G;  1JR9 A;  4RQF A;  1WA8 B;  2YIA A;  1XMO B;  5KAF Z;  4DUY O;  5DN6 G;  1TUE B;  4I50 B;  4XDJ A;  1Q7Y W;  4R7C A;  1YTF D;  3DGE A;  4JI8 O;  1SET A;  2HKO A;  1JJO A;  1MSD A;  3C3T A;  1N4C A;  5D5P A;  3L70 H;  4TSF G;  3SPI A;  3CRC A;  2XT9 A;  3WU2 Z;  1K5S A;  4DK0 A;  5KMG B;  4WCE V;  5HFL A;  4RUE A;  4DV1 O;  2DQ3 A;  3RYI B;  1FAF A;  4FLV A;  1ZSP A;  5KHK A;  4JZG A;  2YIB A;  2CTQ A;  4LNU B;  5EZY A;  3TCU A;  4Z2W A;  5FNV A;  2XOK G;  1MZE A;  1IXB A;  1VQ6 V;  1NJI W;  4LF8 O;  3ZS8 C;  2VQF B;  4ICG A;  1ZL8 A;  4GYC B;  1I0H A;  1RFY A;  2V7Q G;  4IHJ A;  4J80 A;  3X2Q C;  3N2G A;  3ZHQ A;  1S77 D;  2IM9 A;  4Q20 A;  3LDE A;  3JD2 A;  4PV1 B;  4DR6 O;  1YEW A;  3ML0 A;  3D3I A;  2B9Z A;  4LF9 B;  1XI1 A;  4IGG A;  1SC5 B;  4U7N A;  2PF4 E;  1R3I C;  4BR6 A;  1WPB A;  2XAH A;  4LWS B;  4LF5 O;  3H01 A;  5B1B C;  1XL6 A;  2JIZ G;  5LP6 B;  3CCS V;  4FIP C;  1ROP A;  4LFA O;  1YVW A;  4LFC B;  1K97 A;  1K5Q A;  1MAB G;  3IAY A;  1R3J C;  2HR3 A;  3UO2 A;  1J5E O;  2G38 A;  1I5X A;  1XHZ A;  5JVD A;  1AI6 A;  4CC6 A;  2ZE8 A;  1S0V A;  4J42 A;  3LDC A;  4L8J A;  3D8C A;  1AP5 A;  1THZ A;  2YXL A;  2WPD G;  3BA8 A;  1D5N A;  1MG1 A;  4DR4 O;  3LSQ A;  2QM7 A;  1K33 A;  1Q6U A;  1Y6X A;  1AR5 A;  1SQV H;  4YJ3 A;  1VQP V;  3P32 A;  1QNM A;  4ZIB A;  1BZK A;  1XNQ O;  3ABM C;  4DV5 O;  2QE7 G;  2Y4U A;  4EEQ A;  3JAS A;  1AR4 A;  1N32 O;  4FLW A;  4GUN A;  3K5N A;  3LNM B;  3SPC A;  3RVZ A;  5BR8 O;  2P5O A;  3RYH B;  1GN6 A;  1FFX B;  2UXD O;  5JJN B;  1M56 C;  4MVM A;  3AEI A;  1R3K C;  2CAZ C;  3VQX A;  4O4L A; 
#chains in the Genus database with same CATH homology
 2Z0A A;  4K0K O;  1HR0 O;  1XNR O;  4LF8 O;  3RT3 C;  3J80 N;  2HHH O;  2ZM6 O;  2E5L O;  5FLX N;  3J81 N;  3R66 A;  4DV3 O;  2UXB O;  2UXC O;  5IT9 N;  1I94 O;  1DK1 A;  2F4V O;  1R6T A;  4DR1 O;  1AIL A;  2VQE O;  1XEQ A;  1D2D A;  1XMO O;  4LF7 O;  1AB3 A;  3OTO O;  4JI4 O;  4B3M O;  4DR7 O;  1NS1 A;  4X65 O;  2UUB O;  4DR6 O;  1HNW O;  4JI7 O;  2VQF O;  4JI0 O;  1IBM O;  1FYJ A;  2DJV A;  1N33 O;  4JV5 O;  4A5U B;  4B3S O;  3J7A U;  4JI1 O;  1IBK O;  1IBL O;  3SDL A;  4OPH A;  1X59 A;  4X64 O;  2UU9 O;  4DV2 O;  3T1H O;  1N34 O;  2UUA O;  4NXN O;  2FKX A;  4LF5 O;  4OX9 O;  4DV4 O;  5H5N A;  5LL6 Y;  3O65 A;  1FJG O;  4LFA O;  4DR2 O;  2N74 A;  5BXZ A;  2UUC O;  4YHH O;  1R1B A;  4GKJ O;  4JYA O;  4JI6 O;  4NXM O;  1J5E O;  5IWA O;  4DR5 O;  4DV0 O;  4GKK O;  5LMN O;  4JI3 O;  1F7Y A;  4LF4 O;  5LMU O;  5BY1 A;  3T1Y O;  3JAM N;  4LFC O;  4JI2 O;  4B3T O;  4DV7 O;  4DR4 O;  4LF9 O;  4B3R O;  2LW7 A;  1HNZ O;  1HNX O;  4DUY O;  1YZB A;  3F5T A;  1KUQ A;  1XNQ O;  4DV5 O;  3M8A A;  5A2Q N;  4JI8 O;  1FKA O;  1N32 O;  2AGA A;  1XMQ O;  4OPA A;  4X66 O;  4LF6 O;  4DUZ O;  2DOS A;  4LFB O;  4YY3 O;  4KHP O;  4DV6 O;  1N36 O;  5BR8 O;  4DR3 O;  1A32 A;  2ZKO A;  4DV1 O;  2UXD O;  2JRI A;  4JI5 O;  4AQY O;  1G1X B;  4X62 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...