1J5ET

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1j5eT00
4DV2T 4JI8T 4DR4T 4DV1T 4DR3T 5IWAT 4B3TT 2UUAT 4LF5T 4JYAT 4X62T 4DV4T 3T1HT 2VQET 1N36T 4B3MT 4LFBT 5LMUT 1IBMT 2UUBT 4DV0T 4DUYT 1IBKT 4JI3T 4GKJT 2E5LT 2UXBT 4JI5T 1XMQT 4YY3T 4LF6T 4LF8T 5LMNT 4JI7T 2F4VT 2UU9T 2HHHT 4NXMT 4DV6T 1N32T 1HNZT 1N34T 4DV5T 4YHHT 4JI6T 4AQYT 3OTOT 4JI2T 3T1YT 1HNXT 4JI1T 1J5ET 1XNQT 5BR8T 4LF4T 4LFCT 4B3RT 4DR2T 4B3ST 1XMOT 1XNRT 1N33T 4NXNT 4JI0T 1FJGT 1HR0T 4DR6T 4OX9T 2VQFT 1I94T 4LFAT 4DV7T 4DV3T 4LF9T 4GKKT 4DUZT 2UXCT 2UUCT 2UXDT 4KHPT 4X66T 4K0KT 4X65T 1HNWT 4X64T 4DR5T 2ZM6T 1IBLT 4JV5T 4LF7T 4DR7T 4JI4T 4DR1T
chains in the Genus database with same CATH superfamily
3JAFA 4H63H 2ZM8A 2VKJA 2C5KT 3L8RA 3OYZA 3UU4A 2UUAT 3CX8B 4QX7B 2WBLA 1HG2A 5FVKA 2UUBT 2IHR1 4U2ZA 5JR9A 1L0VA 4JI3T 2WP9A 3AE9A 4LF6T 3FZKB 1UURA 3V5UA 1ZHCA 4PK5A 1U4QA 4UVBB 4UF0B 4EGWA 4PJNA 1GQEA 2YK0A 2WDQA 4OK0A 2JIWA 1T7SA 3D0TA 2VKDA 3KBTA 3UFEA 2LRKA 5ABFB 4YSXA 5JDHA 3H37A 3PDYA 5L3GB 3FHNA 3UU5A 2XQ9A 4LMJA 4DBRA 4YLHA 2XQ4A 5KMGP 3RKOA 1YKEB 3L39A 3UU6A 3ONLC 4LMKA 2ACXA 2LKGA 2EHOD 2CXFA 4NUUA 2LJLA 4LF9T 2HPJA 4G63A 1UCUA 4AXPA 5LGUB 3P4WA 5LXTE 5HXRA 4JV5T 2E9XD 4O4JE 2JJ9A 4L9IA 5LNKA 4DVDA 4JI4T 3QB5A 4WW0A 5LBQB 4JI8T 5EZYE 5HEOA 1R8IA 5LBMA 4QX8B 3ZC0A 4QXBB 4IE7A 4DV1T 2CXDA 2UXNB 3IHRA 4AKRB 5DQVA 2RPAA 4X62T 1UK5A 3SOLA 4ZI3C 4Z90A 2UXBT 1HS7A 1KNZA 4ZS3A 1IAPA 1QLBA 3AEAA 4IE6A 3B13A 3RI5A 5C3JA 1KNRA 4BA9A 4O2BE 4ILUA 3UU3A 4U74A 3Q2MA 4CI3B 4U33A 3PURA 4JI2T 1UGOA 4YT0A 1WLXA 4XZCA 3AXJB 1OEDE 2W66A 4O8SA 5AQPB 2L9QA 4MHCA 1E2AA 5CFBA 2A72A 3ZT6A 4WNKA 3VKGA 4NXNT 4XBFB 2V5DA 4DR6T 4JUYA 3ZMSB 5AQRB 3ZCIA 1XWMA 2WY2A 1I94T 3MACA 3FZHB 2JQ9A 2XAGB 2V7JA 2CBJA 4PFPA 3TLVA 3KBUA 4PJMA 4KMCA 1YXRA 2DNXA 4EZ4A 4IHJE 5CB4E 4WBOA 5AQGB 1OEDA 2K9AA 2H7VC 2XQYA 2Q9QA 4YTNA 5HCMA 3HL6A 3KFWX 5CGMA 3FBZA 2LKHA 1N36T 2OA5A 3RH3A 1S94A 3LK42 2H89A 4DUYT 4UEMA 2FJAA 2MAWA 2I59A 2YOEA 4ZZCA 4YTPA 3O1IA 4ZS2A 2XAHB 3AVSA 4X1KE 4EV6A 1N32T 2AE9A 2EHOC 2BG9B 3AEBA 2CEAA 5GONE 3RX6A 4L5GA 2BVMA 3ZYMA 4LF4T 4JBWF 4ADZA 4LFCT 5F3JA 2ODVA 2E9XC 3AE1A 1XDOA 1LVKA 1IJ6A 2X9XA 1LVFA 2X51A 3NVOA 5HXCA 4OYKA 1Z8UA 3VKHA 2DWGA 2BS2A 4PK6A 1NEKA 3CK6A 3R6NA 3PUGA 4QH4A 2V6XA 4TX5A 3ZT5A 4UXNB 1SHZC 2XM2A 5LB7B 2X9HA 4HE8A 5AQMB 4HWCA 5LG4A 3SFDA 3B5MA 2XPKA 4NUVA 3MK7C 2JQKA 2JQQA 1YQ4A 4MALA 5CA0E 2H7OA 4DIDB 4H9QC 4LFBT 4GOUA 5LMUT 3N9NA 2XM1A 4U7YA 4YTMA 2PJQA 5LGTB 4ZHQE 4KBMB 4HFIA 2V7MA 4JI7T 1NAFA 3TKLB 1FMVA 3K1SA 3OJAA 2CXLA 4DO0A 2JMHA 3P4SA 4KUMB 4UF0A 4IL4A 1KK7A 5BR8T 1IJ5A 2JRKA 3EDVA 1MMGA 1MIVA 3LBXB 2KINB 2RP4A 3RC8A 3SWHA 1T72A 4IGUA 5JRCB 2OLTA 2N2NA 2H3RA 4CN1A 1ZP0A 2ZLYA 2XQ5A 3CQGB 4DV3T 4X1YE 2X0LB 5JDLA 4EXTA 5FXVA 4TNVA 1OWAA 4AKGA 3N9PA 2IDOB 5HXHA 2WU5A 3WAJA 2DWKA 5FMNA 4EYUA 1YKHB 3VRBA 3B57A 4KI0F 2HH7A 1HX8A 1HF8A 2W67A 1JNRA 3C50A 3VHLA 1KEYA 3FXEB 5FY1A 1W9RA 1IBMT 2NW9A 1OXZA 4EAHA 4H9PC 3UUXB 1WCRA 1U5PA 3AE5A 4I4TE 3ZSTA 1EZ3A 3AE4A 1MMDA 2XASB 4DMVA 3AEEA 2X9WA 5HEJA 2V6YB 1D0ZA 3AE7A 1YD8G 2M6IA 1WYCA 2BBHA 4QXHB 3P7IA 3GN5A 5F5WA 4ZI2C 5ABGA 1J5ET 4JI1T 4B3RT 4X20E 2VK9A 4HGAA 1D1CA 2V7KA 3E08A 2UXXB 2K5BB 2A9UA 3W15B 2LEHA 1N33T 3HA4A 4DNDA 1Y64B 2ZM2A 3HKDE 4UVAB 2PFVA 1FEWA 3AEDA 3RYCE 5ADXL 4B6XA 2CE7A 5IYZE 2NR4A 1HNWT 1MNEA 3AAEB 2VL0A 3UQ4A 4P0BA 3JC6D 3UUMA 3O1HA 2LT3A 3Q5XA 2J47A 2LM2A 3RYFE 3K3QC 2DLRA 2XQ8A 2XUEA 2R6GF 3C98B 2NWBA 3A8YC 5FL0A 4ZEYA 4QHOA 4ILBA 2QGSA 2KWHA 1IBKT 1SE7A 2V1DB 4GK5E 3IA3A 3VR8A 4QH1A 3ZLIA 3F57A 2V26A 2WB5A 5LHIB 3DTOA 3Q5WA 5HXEA 1CHUA 2Y48B 5EK2A 2IW5B 3ZMZB 3AB3B 1Z0PA 2IAKA 2BG9C 5CA1E 3BK9A 1WFDA 4YHHT 3LK2B 3KV9A 4UV8B 3TLWA 4IDOA 2HN2A 5JQGE 5L3DB 5ETWA 3KINB 3QUJA 3PE0A 3P50A 4IT4A 2KMFA 4QH5A 4NIQA 4B3ST 1E1HB 4ILAA 5C2TA 4AISA 4O4HE 3C64A 5HEUA 3UTKA 1CUNA 4C91A 4OX9T 5EK4A 2N1GA 4KX6A 2PBIA 3HKCE 3F2EA 2XZEA 3AAAB 2UXCT 2XTLA 1SUMB 4KHZF 2WAUA 4A56A 2DL1A 3CQCB 1WRDA 4PAGA 3TLSA 3EUHA 4LF7T 3CMLA 3PUZF 2XQ7A 4EEBA 2YINA 4X1IE 3T8OA 3ZKRA 5IWAT 5AFUL 4LF5T 3PJAA 3T1HT 3RYIE 3IF8B 3OBVE 2P9BA 3RHWA 5L3FB 4JEUB 1WR0A 1XMQT 2WU2A 3PUQA 4O2AE 3ANWB 4YY3T 4LF8T 4EYYR 4JLEA 3AECA 5LMNT 4U72A 5AQTB 3ZYLA 3KV5A 4H9NC 3ZN1B 3LG7A 2KXPB 4K0UA 4JI6T 2YN6A 4N78D 3N9OA 3U78A 1VCSA 4PFOA 3C4WA 3I0OA 3EVYA 2CHOA 3KVBA 4DBQA 4A97A 5LHGB 3JC6C 5FXZA 5HEHA 1NWMX 5FY7A 1HR0T 5L3CB 3ABVA 3Q9DA 4KP3C 4O4IE 4C90A 2QA7A 3OVUA 1UX5A 1KNPA 4V1Av 4AKHA 1JNZA 2XQ3A 5M4YA 4K0KT 5FY0A 4TWDA 2W00A 5F8PA 2ZM0A 3M3ZB 3WAKA 4WYVA 5J2TE 4PNIA 2M67A 2NOXA 2PTFA 1YQ3A 3K3OA 2WWVA 2LSYA 2X66A 3M65A 3PV0F 4GYRA 4Z91A 4PJJA 3U3IA 3KV6A 3FXDB 2BBJA 2E5VA 4ILCA 4ERRA 3GA8A 2M6BA 4ZXLA 2W2UA 5H6QB 3ETUA 1BR4A 3UU8A 5FKYA 5AQKB 1VRBA 2HN1A 4HTEA 1X9BA 4ISTA 5DABA 3NRYA 3MA9A 1XNRT 3NZQA 1E7PA 4F6RC 3RIUC 1US7B 1FJGT 1KF6A 5AQNB 2PG8A 3P4PA 2IC9A 2YDQA 4ZOLE 2XJ7A 3MXZA 5JR9B 4YXDA 3J7Yq 1I6ZA 4X65T 2EHOA 5KX5E 1MIYA 2X68A 2XAJB 2ZMAA 3C51A 3ZSSA 2OV9A 4EOZB 3I9WA 3QNUA 5JH7E 4HEAA 3RIAA 4TUYE 2E9XA 4I55E 2LSJA 2J4GA 1UUSA 3LJCA 4I0UA 2VQET 4HFVA 5HCJA 4AKLA 3JADA 4CZZB 2D9DA 2LM9A 3LFMA 3RIFA 2IUBA 4F8HA 2VVNA 4YHJA 4YFSA 1BR2A 2WDRA 1XDPA 3AA0B 1HNZT 3RKGA 3LSVA 4IE0A 3BQKA 5J2UE 2WS3A 3NRXA 4TWHA 3T1YT 1HNXT 1XNQT 4HFBA 3ZMUB 5HXSA 4PJLA 2QRXA 3KDSE 3CWZB 1IZNB 2V7IA 2ACZA 5FXXA 1X79A 2RA1A 2AXDS 3K8PC 2KNDA 3X1DA 3EAMA 1V9DA 2UXDT 4MFRA 2JMKA 4UV9B 5AQQB 2WQYA 1IBLT 2BVLA 2FJEA 2XQ6A 5ABFA 2SPCA 3MJXA 3PUSA 3QB5K 4IDPA 5AQUB 1MIWA 3N9MA 4M1PA 3QK6A 3K3NA 5HYAA 5JVDE 4GK0E 4JYAT 4IDNA 3HI2A 1YW0A 4ZZBA 4P0AA 4AI6A 1D1BA 4Z8XA 2BKNA 2BS3A 3RPUA 2V8SV 2XSAA 3ETVA 4G2AA 1ZV4X 4AQFC 2CHNA 5TAOA 2CWOA 2MTQA 2HHHT 2Y6XA 3V5SA 2VKHA 5KXJA 5FXWA 3TLUA 5BMVE 3OTOT 3AA6B 2X0YA 5L2LA 2NW8A 1OEDB 3CX6B 3P4QA 2LSIA 5J0ZA 1O3XA 2Q9QB 5HAXA 2LHNA 3NKZA 1HG5A 4HWFA 1MNDA 3N5LA 4CXXA 1M7KA 3DP7A 5ABEA 4J2CA 4HWHA 3ZJ2A 1ZOYA 2ZM6T 3KVAA 2L3LA 3AXJA 2DHRA 5JREA 1FIOA 4HWIB 2V5CA 1HCIA 1ZEEA 3H3MA 4DV2T 2W62A 4UVCB 2YDRA 5LG3A 5AQFB 2E2AA 4EEDA 3PUAA 3P8CD 1T98A 3DJBA 5IHYA 3UQ7A 2VASA 1Y01A 5FVLA 1BR0A 2VURA 2MBGA 3PUXF 1G8XA 4BAYB 4EZHA 2XHEB 4QWNB 5L3BB 2G0UA 3GWHA 2LSGA 4CQIA 2BG9E 4HN9A 3ZN0B 3ESLA 2C0SA 5L3EB 3IEEA 3Q5DA 2D0UA 4AQYT 3Q5EA 2FBWA 3AVRA 4OYJA 4IIJE 2YEVC 3EABA 4IL9A 2CPTA 3ZC1A 4IE4A 1XMOT 2LOSA 4AQGA 3E0ZA 3O9XA 2YU2A 2BKPA 4HFHA 1MMNA 3RRCA 1S35A 5JR9C 3VRAA 2XAQB 4GKKT 3QOFA 2BG9A 2W63A 2HPLA 3RF1A 4CI2B 2Q9QD 4HFDA 3JAEA 3A5XA 4WZXA 3J9X1 3RLFF 3UULA 2CRBA 1WYBA 3G06A 4DR3T 2XQAA 4CI1B 2CLYB 2KZ7B 3HKBE 2FJBA 3AE6A 2E5LT 3UUNA 3JCFA 1D0YA 5H6RB 4PW8A 4COFA 4FI5A 3AE8A 4DV6T 3OKQA 2WMOA 3CVRA 2CCQA 4A5XA 2N9DA 3CIRA 2I6HA 1N34T 5LJMA 3L3PA 5L47A 1H7CA 4CXWA 2X9YA 3H3AA 3N9LA 1VCTA 2K24A 2C5IT 3QC9A 3O4XE 3UUBA 3I0QA 5FNVE 2VKOA 3GMIA 3PTRB 4GYSA 2H88A 5CJ5A 5AQHB 2QYWA 4I50E 2J1DG 3IBPA 2CMRA 1WR6A 4HFCA 2NTYA 5ABHA 4HWDA 1HX1B 5AQJB 4Q25A 3ZT7A 4KHPT 3SRZA 4ANJA 2LHRA 1D0XA 1ZKEA 5LJNA 4DR5T 2WMNA 3UT5E 5AQOB 4P1NA 2FUPA 2XY8B 4DR1T 2MYSA 3LBXA 4OFZA 2LLYA 4IDQA 2VWAA 3NWIA 3GN5B 3ZCJA 3PU3A 3SS1A 5JRCA 4BJMA 2W4XA 4E7SA 3N2OA 2L8KA 4EB6E 3OPCA 2ODUA 4DV0T 3FZFB 1J1JA 2KWIB 2DI4A 2B76A 1HFAA 4I43B 4WBNE 5KDMC 2F4VT 4GIWA 4NXMT 5L4EA 3RQUA 1HTJF 2K3WA 2V7LA 2VVSA 3FBLA 2NP9A 4U7IA 2WZIA 4TV9E 1W0AA 4MBQA 1OEDC 5HWYA 5IUXA 5FL1A 2IIUA 2Q9QC 3VU7H 3AEGA 5AQSB 3RQWA 2IC6A 2CWYA 5LGNB 3O1JA 4TN7B 4NPPA 3HR0A 2WWUA 2V6YA 4DV7T 1M62A 5LA6E 2D2SA 3VR9A 4HKAA 3AA1B 3E22E 4TWFA 3C4XA 2BS4A 3I9YA 5JDGA 4UELA 4TZ4C 4CN4A 2Z6EA 4DR4T 5LHHB 4EIWA 4HFEA 3RIUA 4L0RA 4H9SE 3ZPOA 5DQWA 4H9RC 2WZHA 2YU1A 3C4ZA 4XAXB 4YSYA 2DCFA 5LP6E 2MOZA 2A3DA 4P09A 3EHZA 3LK3B 3PUVF 1VOMA 3RGLA 4E7ZA 3FZLB 5LCYA 1QUUA 2A2FX 1XZYA 3PUWF 2IMLA 3MZKB 3FZMB 3KV4A 2C5JA 2LOPA 1T8BA 2LE8A 4ZI2D 4DR2T 5L4HA 3LDQB 3ZYKA 5HWXA 4JEHB 2CBIA 4ISSA 1DU2A 4JI0T 3MKDA 4O4LE 3HKEE 3OYXA 2WCAA 4LFAT 3ZJ1A 3TLTA 4PK4A 3S4UA 1B7TA 4LMLA 4QXCB 2UUCT 4CXYA 3PJAJ 5JTGA 4AKIA 3SFEA 2KLQA 3NZPA 4AIUA 4DR7T 2VB6A 2W0GA 5LOVE 2K48A 2MPKA 3F31A 4YJ2E 2CLYC 3RRWA 4B3TT 2QVAA 4BJNA 4TNWA 2XSBA 3NBXX 4DV4T 2KSRA 2D0TA 4IREA 4B3MT 5AQLB 4GKJT 5FYMA 4JI5T 1W0BA 4YJ3E 2KT9A 5J1GA 2UU9T 4U2YA 2WM9A 2BZBA 3CPZA 4H9OC 3CKDA 3R84B 2X0HA 2E8IA 1LKXA 4ASKA 5E0OA 3ZEFB 4UIGA 1NENA 2NW7A 2NTXA 4TV8E 1UX4A 3N9QA 1MMAA 4IE5A 2X67A 3ANWA 3ZMTB 5HEGA 4H63V 3RC3A 4OHFA 3CX7B 5A1LA 2LSKA 4AQFA 4CN6A 4UR9A 5AQIB 2B1EA 1LRZA 5EK3A 5FP3A 2I0MA 3UFGA 1AJ3A 2VL8A 3EDUA 4X64T 3ONXA 3RYHE 5JDFA 3N2KE 4QKNA 2GK9A 3AA7B 3EI0A 4X5TA 3I1AA 5DJQC 1QSDA 2W61A 2WDVA 4DMWA 2WSSV 3WI3A 3CQXC 1FMWA 3PUYF 5JDQA 4ZI7E 4IDZA 2YKSA 1J5WA 3BQIA 2Y8DA 5C8YE 3AEFA 2LRLA 2D5UA 2BKOA 1BR1A 1KFYA 1W09A 1G73A 2YDSA 3AE2A 3AAIA 3L09A 4DV5T 2CM0A 4MLKA 2EHOB 4ZI3D 3ZMVB 5LYJE 4YSZA 2CA5A 5JDMA 3FB2A 2JQHA 1D1AA 2BDEA 4FJOA 3AE3A 3ONJA 4U31A 3A7MA 2E9XB 2JPFA 3P4RA 1SA0E 2J62A 2VQFT 2ES0A 2FJDA 2XAFB 4DUZT 3N2GE 3PU8A 5AQVB 4X66T 3BQLA 4A98A 5JDNA 4U3CA
chains in the Genus database with same CATH topology
4DV2T 4JI8T 4DR4T 4DV1T 4DR3T 5IWAT 4B3TT 2UUAT 4LF5T 4JYAT 4X62T 4DV4T 3T1HT 2VQET 1N36T 4B3MT 4LFBT 5LMUT 1IBMT 2UUBT 4DV0T 4DUYT 1IBKT 4JI3T 4GKJT 2E5LT 2UXBT 4JI5T 1XMQT 4YY3T 4LF6T 4LF8T 5LMNT 4JI7T 2F4VT 2UU9T 2HHHT 4NXMT 4DV6T 1N32T 1HNZT 1N34T 4DV5T 4YHHT 4JI6T 4AQYT 3OTOT 4JI2T 3T1YT 1HNXT 4JI1T 1J5ET 1XNQT 5BR8T 4LF4T 4LFCT 4B3RT 4DR2T 4B3ST 1XMOT 1XNRT 1N33T 4NXNT 4JI0T 1FJGT 1HR0T 4DR6T 4OX9T 2VQFT 1I94T 4LFAT 4DV7T 4DV3T 4LF9T 4GKKT 4DUZT 2UXCT 2UUCT 2UXDT 4KHPT 4X66T 4K0KT 4X65T 1HNWT 4X64T 4DR5T 2ZM6T 1IBLT 4JV5T 4LF7T 4DR7T 4JI4T 4DR1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 T;  4JI8 T;  4DR4 T;  4DV1 T;  4DR3 T;  5IWA T;  4B3T T;  2UUA T;  4LF5 T;  4JYA T;  4X62 T;  4DV4 T;  3T1H T;  2VQE T;  1N36 T;  4B3M T;  4LFB T;  5LMU T;  1IBM T;  2UUB T;  4DV0 T;  4DUY T;  1IBK T;  4JI3 T;  4GKJ T;  2E5L T;  2UXB T;  4JI5 T;  1XMQ T;  4YY3 T;  4LF6 T;  4LF8 T;  5LMN T;  4JI7 T;  2F4V T;  2UU9 T;  2HHH T;  4NXM T;  4DV6 T;  1N32 T;  1HNZ T;  1N34 T;  4DV5 T;  4YHH T;  4JI6 T;  4AQY T;  3OTO T;  4JI2 T;  3T1Y T;  1HNX T;  4JI1 T;  1J5E T;  1XNQ T;  5BR8 T;  4LF4 T;  4LFC T;  4B3R T;  4DR2 T;  4B3S T;  1XMO T;  1XNR T;  1N33 T;  4NXN T;  4JI0 T;  1FJG T;  1HR0 T;  4DR6 T;  4OX9 T;  2VQF T;  1I94 T;  4LFA T;  4DV7 T;  4DV3 T;  4LF9 T;  4GKK T;  4DUZ T;  2UXC T;  2UUC T;  2UXD T;  4KHP T;  4X66 T;  4K0K T;  4X65 T;  1HNW T;  4X64 T;  4DR5 T;  2ZM6 T;  1IBL T;  4JV5 T;  4LF7 T;  4DR7 T;  4JI4 T;  4DR1 T; 
#chains in the Genus database with same CATH topology
 3JAF A;  4H63 H;  2ZM8 A;  2VKJ A;  2C5K T;  3L8R A;  3OYZ A;  3UU4 A;  2UUA T;  3CX8 B;  4QX7 B;  2WBL A;  1HG2 A;  5FVK A;  2UUB T;  2IHR 1;  4U2Z A;  5JR9 A;  1L0V A;  4JI3 T;  2WP9 A;  3AE9 A;  4LF6 T;  3FZK B;  1UUR A;  3V5U A;  1ZHC A;  4PK5 A;  1U4Q A;  4UVB B;  4UF0 B;  4EGW A;  4PJN A;  1GQE A;  2YK0 A;  2WDQ A;  4OK0 A;  2JIW A;  1T7S A;  3D0T A;  2VKD A;  3KBT A;  3UFE A;  2LRK A;  5ABF B;  4YSX A;  5JDH A;  3H37 A;  3PDY A;  5L3G B;  3FHN A;  3UU5 A;  2XQ9 A;  4LMJ A;  4DBR A;  4YLH A;  2XQ4 A;  5KMG P;  3RKO A;  1YKE B;  3L39 A;  3UU6 A;  3ONL C;  4LMK A;  2ACX A;  2LKG A;  2EHO D;  2CXF A;  4NUU A;  2LJL A;  4LF9 T;  2HPJ A;  4G63 A;  1UCU A;  4AXP A;  5LGU B;  3P4W A;  5LXT E;  5HXR A;  4JV5 T;  2E9X D;  4O4J E;  2JJ9 A;  4L9I A;  5LNK A;  4DVD A;  4JI4 T;  3QB5 A;  4WW0 A;  5LBQ B;  4JI8 T;  5EZY E;  5HEO A;  1R8I A;  5LBM A;  4QX8 B;  3ZC0 A;  4QXB B;  4IE7 A;  4DV1 T;  2CXD A;  2UXN B;  3IHR A;  4AKR B;  5DQV A;  2RPA A;  4X62 T;  1UK5 A;  3SOL A;  4ZI3 C;  4Z90 A;  2UXB T;  1HS7 A;  1KNZ A;  4ZS3 A;  1IAP A;  1QLB A;  3AEA A;  4IE6 A;  3B13 A;  3RI5 A;  5C3J A;  1KNR A;  4BA9 A;  4O2B E;  4ILU A;  3UU3 A;  4U74 A;  3Q2M A;  4CI3 B;  4U33 A;  3PUR A;  4JI2 T;  1UGO A;  4YT0 A;  1WLX A;  4XZC A;  3AXJ B;  1OED E;  2W66 A;  4O8S A;  5AQP B;  2L9Q A;  4MHC A;  1E2A A;  5CFB A;  2A72 A;  3ZT6 A;  4WNK A;  3VKG A;  4NXN T;  4XBF B;  2V5D A;  4DR6 T;  4JUY A;  3ZMS B;  5AQR B;  3ZCI A;  1XWM A;  2WY2 A;  1I94 T;  3MAC A;  3FZH B;  2JQ9 A;  2XAG B;  2V7J A;  2CBJ A;  4PFP A;  3TLV A;  3KBU A;  4PJM A;  4KMC A;  1YXR A;  2DNX A;  4EZ4 A;  4IHJ E;  5CB4 E;  4WBO A;  5AQG B;  1OED A;  2K9A A;  2H7V C;  2XQY A;  2Q9Q A;  4YTN A;  5HCM A;  3HL6 A;  3KFW X;  5CGM A;  3FBZ A;  2LKH A;  1N36 T;  2OA5 A;  3RH3 A;  1S94 A;  3LK4 2;  2H89 A;  4DUY T;  4UEM A;  2FJA A;  2MAW A;  2I59 A;  2YOE A;  4ZZC A;  4YTP A;  3O1I A;  4ZS2 A;  2XAH B;  3AVS A;  4X1K E;  4EV6 A;  1N32 T;  2AE9 A;  2EHO C;  2BG9 B;  3AEB A;  2CEA A;  5GON E;  3RX6 A;  4L5G A;  2BVM A;  3ZYM A;  4LF4 T;  4JBW F;  4ADZ A;  4LFC T;  5F3J A;  2ODV A;  2E9X C;  3AE1 A;  1XDO A;  1LVK A;  1IJ6 A;  2X9X A;  1LVF A;  2X51 A;  3NVO A;  5HXC A;  4OYK A;  1Z8U A;  3VKH A;  2DWG A;  2BS2 A;  4PK6 A;  1NEK A;  3CK6 A;  3R6N A;  3PUG A;  4QH4 A;  2V6X A;  4TX5 A;  3ZT5 A;  4UXN B;  1SHZ C;  2XM2 A;  5LB7 B;  2X9H A;  4HE8 A;  5AQM B;  4HWC A;  5LG4 A;  3SFD A;  3B5M A;  2XPK A;  4NUV A;  3MK7 C;  2JQK A;  2JQQ A;  1YQ4 A;  4MAL A;  5CA0 E;  2H7O A;  4DID B;  4H9Q C;  4LFB T;  4GOU A;  5LMU T;  3N9N A;  2XM1 A;  4U7Y A;  4YTM A;  2PJQ A;  5LGT B;  4ZHQ E;  4KBM B;  4HFI A;  2V7M A;  4JI7 T;  1NAF A;  3TKL B;  1FMV A;  3K1S A;  3OJA A;  2CXL A;  4DO0 A;  2JMH A;  3P4S A;  4KUM B;  4UF0 A;  4IL4 A;  1KK7 A;  5BR8 T;  1IJ5 A;  2JRK A;  3EDV A;  1MMG A;  1MIV A;  3LBX B;  2KIN B;  2RP4 A;  3RC8 A;  3SWH A;  1T72 A;  4IGU A;  5JRC B;  2OLT A;  2N2N A;  2H3R A;  4CN1 A;  1ZP0 A;  2ZLY A;  2XQ5 A;  3CQG B;  4DV3 T;  4X1Y E;  2X0L B;  5JDL A;  4EXT A;  5FXV A;  4TNV A;  1OWA A;  4AKG A;  3N9P A;  2IDO B;  5HXH A;  2WU5 A;  3WAJ A;  2DWK A;  5FMN A;  4EYU A;  1YKH B;  3VRB A;  3B57 A;  4KI0 F;  2HH7 A;  1HX8 A;  1HF8 A;  2W67 A;  1JNR A;  3C50 A;  3VHL A;  1KEY A;  3FXE B;  5FY1 A;  1W9R A;  1IBM T;  2NW9 A;  1OXZ A;  4EAH A;  4H9P C;  3UUX B;  1WCR A;  1U5P A;  3AE5 A;  4I4T E;  3ZST A;  1EZ3 A;  3AE4 A;  1MMD A;  2XAS B;  4DMV A;  3AEE A;  2X9W A;  5HEJ A;  2V6Y B;  1D0Z A;  3AE7 A;  1YD8 G;  2M6I A;  1WYC A;  2BBH A;  4QXH B;  3P7I A;  3GN5 A;  5F5W A;  4ZI2 C;  5ABG A;  1J5E T;  4JI1 T;  4B3R T;  4X20 E;  2VK9 A;  4HGA A;  1D1C A;  2V7K A;  3E08 A;  2UXX B;  2K5B B;  2A9U A;  3W15 B;  2LEH A;  1N33 T;  3HA4 A;  4DND A;  1Y64 B;  2ZM2 A;  3HKD E;  4UVA B;  2PFV A;  1FEW A;  3AED A;  3RYC E;  5ADX L;  4B6X A;  2CE7 A;  5IYZ E;  2NR4 A;  1HNW T;  1MNE A;  3AAE B;  2VL0 A;  3UQ4 A;  4P0B A;  3JC6 D;  3UUM A;  3O1H A;  2LT3 A;  3Q5X A;  2J47 A;  2LM2 A;  3RYF E;  3K3Q C;  2DLR A;  2XQ8 A;  2XUE A;  2R6G F;  3C98 B;  2NWB A;  3A8Y C;  5FL0 A;  4ZEY A;  4QHO A;  4ILB A;  2QGS A;  2KWH A;  1IBK T;  1SE7 A;  2V1D B;  4GK5 E;  3IA3 A;  3VR8 A;  4QH1 A;  3ZLI A;  3F57 A;  2V26 A;  2WB5 A;  5LHI B;  3DTO A;  3Q5W A;  5HXE A;  1CHU A;  2Y48 B;  5EK2 A;  2IW5 B;  3ZMZ B;  3AB3 B;  1Z0P A;  2IAK A;  2BG9 C;  5CA1 E;  3BK9 A;  1WFD A;  4YHH T;  3LK2 B;  3KV9 A;  4UV8 B;  3TLW A;  4IDO A;  2HN2 A;  5JQG E;  5L3D B;  5ETW A;  3KIN B;  3QUJ A;  3PE0 A;  3P50 A;  4IT4 A;  2KMF A;  4QH5 A;  4NIQ A;  4B3S T;  1E1H B;  4ILA A;  5C2T A;  4AIS A;  4O4H E;  3C64 A;  5HEU A;  3UTK A;  1CUN A;  4C91 A;  4OX9 T;  5EK4 A;  2N1G A;  4KX6 A;  2PBI A;  3HKC E;  3F2E A;  2XZE A;  3AAA B;  2UXC T;  2XTL A;  1SUM B;  4KHZ F;  2WAU A;  4A56 A;  2DL1 A;  3CQC B;  1WRD A;  4PAG A;  3TLS A;  3EUH A;  4LF7 T;  3CML A;  3PUZ F;  2XQ7 A;  4EEB A;  2YIN A;  4X1I E;  3T8O A;  3ZKR A;  5IWA T;  5AFU L;  4LF5 T;  3PJA A;  3T1H T;  3RYI E;  3IF8 B;  3OBV E;  2P9B A;  3RHW A;  5L3F B;  4JEU B;  1WR0 A;  1XMQ T;  2WU2 A;  3PUQ A;  4O2A E;  3ANW B;  4YY3 T;  4LF8 T;  4EYY R;  4JLE A;  3AEC A;  5LMN T;  4U72 A;  5AQT B;  3ZYL A;  3KV5 A;  4H9N C;  3ZN1 B;  3LG7 A;  2KXP B;  4K0U A;  4JI6 T;  2YN6 A;  4N78 D;  3N9O A;  3U78 A;  1VCS A;  4PFO A;  3C4W A;  3I0O A;  3EVY A;  2CHO A;  3KVB A;  4DBQ A;  4A97 A;  5LHG B;  3JC6 C;  5FXZ A;  5HEH A;  1NWM X;  5FY7 A;  1HR0 T;  5L3C B;  3ABV A;  3Q9D A;  4KP3 C;  4O4I E;  4C90 A;  2QA7 A;  3OVU A;  1UX5 A;  1KNP A;  4V1A v;  4AKH A;  1JNZ A;  2XQ3 A;  5M4Y A;  4K0K T;  5FY0 A;  4TWD A;  2W00 A;  5F8P A;  2ZM0 A;  3M3Z B;  3WAK A;  4WYV A;  5J2T E;  4PNI A;  2M67 A;  2NOX A;  2PTF A;  1YQ3 A;  3K3O A;  2WWV A;  2LSY A;  2X66 A;  3M65 A;  3PV0 F;  4GYR A;  4Z91 A;  4PJJ A;  3U3I A;  3KV6 A;  3FXD B;  2BBJ A;  2E5V A;  4ILC A;  4ERR A;  3GA8 A;  2M6B A;  4ZXL A;  2W2U A;  5H6Q B;  3ETU A;  1BR4 A;  3UU8 A;  5FKY A;  5AQK B;  1VRB A;  2HN1 A;  4HTE A;  1X9B A;  4IST A;  5DAB A;  3NRY A;  3MA9 A;  1XNR T;  3NZQ A;  1E7P A;  4F6R C;  3RIU C;  1US7 B;  1FJG T;  1KF6 A;  5AQN B;  2PG8 A;  3P4P A;  2IC9 A;  2YDQ A;  4ZOL E;  2XJ7 A;  3MXZ A;  5JR9 B;  4YXD A;  3J7Y q;  1I6Z A;  4X65 T;  2EHO A;  5KX5 E;  1MIY A;  2X68 A;  2XAJ B;  2ZMA A;  3C51 A;  3ZSS A;  2OV9 A;  4EOZ B;  3I9W A;  3QNU A;  5JH7 E;  4HEA A;  3RIA A;  4TUY E;  2E9X A;  4I55 E;  2LSJ A;  2J4G A;  1UUS A;  3LJC A;  4I0U A;  2VQE T;  4HFV A;  5HCJ A;  4AKL A;  3JAD A;  4CZZ B;  2D9D A;  2LM9 A;  3LFM A;  3RIF A;  2IUB A;  4F8H A;  2VVN A;  4YHJ A;  4YFS A;  1BR2 A;  2WDR A;  1XDP A;  3AA0 B;  1HNZ T;  3RKG A;  3LSV A;  4IE0 A;  3BQK A;  5J2U E;  2WS3 A;  3NRX A;  4TWH A;  3T1Y T;  1HNX T;  1XNQ T;  4HFB A;  3ZMU B;  5HXS A;  4PJL A;  2QRX A;  3KDS E;  3CWZ B;  1IZN B;  2V7I A;  2ACZ A;  5FXX A;  1X79 A;  2RA1 A;  2AXD S;  3K8P C;  2KND A;  3X1D A;  3EAM A;  1V9D A;  2UXD T;  4MFR A;  2JMK A;  4UV9 B;  5AQQ B;  2WQY A;  1IBL T;  2BVL A;  2FJE A;  2XQ6 A;  5ABF A;  2SPC A;  3MJX A;  3PUS A;  3QB5 K;  4IDP A;  5AQU B;  1MIW A;  3N9M A;  4M1P A;  3QK6 A;  3K3N A;  5HYA A;  5JVD E;  4GK0 E;  4JYA T;  4IDN A;  3HI2 A;  1YW0 A;  4ZZB A;  4P0A A;  4AI6 A;  1D1B A;  4Z8X A;  2BKN A;  2BS3 A;  3RPU A;  2V8S V;  2XSA A;  3ETV A;  4G2A A;  1ZV4 X;  4AQF C;  2CHN A;  5TAO A;  2CWO A;  2MTQ A;  2HHH T;  2Y6X A;  3V5S A;  2VKH A;  5KXJ A;  5FXW A;  3TLU A;  5BMV E;  3OTO T;  3AA6 B;  2X0Y A;  5L2L A;  2NW8 A;  1OED B;  3CX6 B;  3P4Q A;  2LSI A;  5J0Z A;  1O3X A;  2Q9Q B;  5HAX A;  2LHN A;  3NKZ A;  1HG5 A;  4HWF A;  1MND A;  3N5L A;  4CXX A;  1M7K A;  3DP7 A;  5ABE A;  4J2C A;  4HWH A;  3ZJ2 A;  1ZOY A;  2ZM6 T;  3KVA A;  2L3L A;  3AXJ A;  2DHR A;  5JRE A;  1FIO A;  4HWI B;  2V5C A;  1HCI A;  1ZEE A;  3H3M A;  4DV2 T;  2W62 A;  4UVC B;  2YDR A;  5LG3 A;  5AQF B;  2E2A A;  4EED A;  3PUA A;  3P8C D;  1T98 A;  3DJB A;  5IHY A;  3UQ7 A;  2VAS A;  1Y01 A;  5FVL A;  1BR0 A;  2VUR A;  2MBG A;  3PUX F;  1G8X A;  4BAY B;  4EZH A;  2XHE B;  4QWN B;  5L3B B;  2G0U A;  3GWH A;  2LSG A;  4CQI A;  2BG9 E;  4HN9 A;  3ZN0 B;  3ESL A;  2C0S A;  5L3E B;  3IEE A;  3Q5D A;  2D0U A;  4AQY T;  3Q5E A;  2FBW A;  3AVR A;  4OYJ A;  4IIJ E;  2YEV C;  3EAB A;  4IL9 A;  2CPT A;  3ZC1 A;  4IE4 A;  1XMO T;  2LOS A;  4AQG A;  3E0Z A;  3O9X A;  2YU2 A;  2BKP A;  4HFH A;  1MMN A;  3RRC A;  1S35 A;  5JR9 C;  3VRA A;  2XAQ B;  4GKK T;  3QOF A;  2BG9 A;  2W63 A;  2HPL A;  3RF1 A;  4CI2 B;  2Q9Q D;  4HFD A;  3JAE A;  3A5X A;  4WZX A;  3J9X 1;  3RLF F;  3UUL A;  2CRB A;  1WYB A;  3G06 A;  4DR3 T;  2XQA A;  4CI1 B;  2CLY B;  2KZ7 B;  3HKB E;  2FJB A;  3AE6 A;  2E5L T;  3UUN A;  3JCF A;  1D0Y A;  5H6R B;  4PW8 A;  4COF A;  4FI5 A;  3AE8 A;  4DV6 T;  3OKQ A;  2WMO A;  3CVR A;  2CCQ A;  4A5X A;  2N9D A;  3CIR A;  2I6H A;  1N34 T;  5LJM A;  3L3P A;  5L47 A;  1H7C A;  4CXW A;  2X9Y A;  3H3A A;  3N9L A;  1VCT A;  2K24 A;  2C5I T;  3QC9 A;  3O4X E;  3UUB A;  3I0Q A;  5FNV E;  2VKO A;  3GMI A;  3PTR B;  4GYS A;  2H88 A;  5CJ5 A;  5AQH B;  2QYW A;  4I50 E;  2J1D G;  3IBP A;  2CMR A;  1WR6 A;  4HFC A;  2NTY A;  5ABH A;  4HWD A;  1HX1 B;  5AQJ B;  4Q25 A;  3ZT7 A;  4KHP T;  3SRZ A;  4ANJ A;  2LHR A;  1D0X A;  1ZKE A;  5LJN A;  4DR5 T;  2WMN A;  3UT5 E;  5AQO B;  4P1N A;  2FUP A;  2XY8 B;  4DR1 T;  2MYS A;  3LBX A;  4OFZ A;  2LLY A;  4IDQ A;  2VWA A;  3NWI A;  3GN5 B;  3ZCJ A;  3PU3 A;  3SS1 A;  5JRC A;  4BJM A;  2W4X A;  4E7S A;  3N2O A;  2L8K A;  4EB6 E;  3OPC A;  2ODU A;  4DV0 T;  3FZF B;  1J1J A;  2KWI B;  2DI4 A;  2B76 A;  1HFA A;  4I43 B;  4WBN E;  5KDM C;  2F4V T;  4GIW A;  4NXM T;  5L4E A;  3RQU A;  1HTJ F;  2K3W A;  2V7L A;  2VVS A;  3FBL A;  2NP9 A;  4U7I A;  2WZI A;  4TV9 E;  1W0A A;  4MBQ A;  1OED C;  5HWY A;  5IUX A;  5FL1 A;  2IIU A;  2Q9Q C;  3VU7 H;  3AEG A;  5AQS B;  3RQW A;  2IC6 A;  2CWY A;  5LGN B;  3O1J A;  4TN7 B;  4NPP A;  3HR0 A;  2WWU A;  2V6Y A;  4DV7 T;  1M62 A;  5LA6 E;  2D2S A;  3VR9 A;  4HKA A;  3AA1 B;  3E22 E;  4TWF A;  3C4X A;  2BS4 A;  3I9Y A;  5JDG A;  4UEL A;  4TZ4 C;  4CN4 A;  2Z6E A;  4DR4 T;  5LHH B;  4EIW A;  4HFE A;  3RIU A;  4L0R A;  4H9S E;  3ZPO A;  5DQW A;  4H9R C;  2WZH A;  2YU1 A;  3C4Z A;  4XAX B;  4YSY A;  2DCF A;  5LP6 E;  2MOZ A;  2A3D A;  4P09 A;  3EHZ A;  3LK3 B;  3PUV F;  1VOM A;  3RGL A;  4E7Z A;  3FZL B;  5LCY A;  1QUU A;  2A2F X;  1XZY A;  3PUW F;  2IML A;  3MZK B;  3FZM B;  3KV4 A;  2C5J A;  2LOP A;  1T8B A;  2LE8 A;  4ZI2 D;  4DR2 T;  5L4H A;  3LDQ B;  3ZYK A;  5HWX A;  4JEH B;  2CBI A;  4ISS A;  1DU2 A;  4JI0 T;  3MKD A;  4O4L E;  3HKE E;  3OYX A;  2WCA A;  4LFA T;  3ZJ1 A;  3TLT A;  4PK4 A;  3S4U A;  1B7T A;  4LML A;  4QXC B;  2UUC T;  4CXY A;  3PJA J;  5JTG A;  4AKI A;  3SFE A;  2KLQ A;  3NZP A;  4AIU A;  4DR7 T;  2VB6 A;  2W0G A;  5LOV E;  2K48 A;  2MPK A;  3F31 A;  4YJ2 E;  2CLY C;  3RRW A;  4B3T T;  2QVA A;  4BJN A;  4TNW A;  2XSB A;  3NBX X;  4DV4 T;  2KSR A;  2D0T A;  4IRE A;  4B3M T;  5AQL B;  4GKJ T;  5FYM A;  4JI5 T;  1W0B A;  4YJ3 E;  2KT9 A;  5J1G A;  2UU9 T;  4U2Y A;  2WM9 A;  2BZB A;  3CPZ A;  4H9O C;  3CKD A;  3R84 B;  2X0H A;  2E8I A;  1LKX A;  4ASK A;  5E0O A;  3ZEF B;  4UIG A;  1NEN A;  2NW7 A;  2NTX A;  4TV8 E;  1UX4 A;  3N9Q A;  1MMA A;  4IE5 A;  2X67 A;  3ANW A;  3ZMT B;  5HEG A;  4H63 V;  3RC3 A;  4OHF A;  3CX7 B;  5A1L A;  2LSK A;  4AQF A;  4CN6 A;  4UR9 A;  5AQI B;  2B1E A;  1LRZ A;  5EK3 A;  5FP3 A;  2I0M A;  3UFG A;  1AJ3 A;  2VL8 A;  3EDU A;  4X64 T;  3ONX A;  3RYH E;  5JDF A;  3N2K E;  4QKN A;  2GK9 A;  3AA7 B;  3EI0 A;  4X5T A;  3I1A A;  5DJQ C;  1QSD A;  2W61 A;  2WDV A;  4DMW A;  2WSS V;  3WI3 A;  3CQX C;  1FMW A;  3PUY F;  5JDQ A;  4ZI7 E;  4IDZ A;  2YKS A;  1J5W A;  3BQI A;  2Y8D A;  5C8Y E;  3AEF A;  2LRL A;  2D5U A;  2BKO A;  1BR1 A;  1KFY A;  1W09 A;  1G73 A;  2YDS A;  3AE2 A;  3AAI A;  3L09 A;  4DV5 T;  2CM0 A;  4MLK A;  2EHO B;  4ZI3 D;  3ZMV B;  5LYJ E;  4YSZ A;  2CA5 A;  5JDM A;  3FB2 A;  2JQH A;  1D1A A;  2BDE A;  4FJO A;  3AE3 A;  3ONJ A;  4U31 A;  3A7M A;  2E9X B;  2JPF A;  3P4R A;  1SA0 E;  2J62 A;  2VQF T;  2ES0 A;  2FJD A;  2XAF B;  4DUZ T;  3N2G E;  3PU8 A;  5AQV B;  4X66 T;  3BQL A;  4A98 A;  5JDN A;  4U3C A; 
#chains in the Genus database with same CATH homology
 4DV2 T;  4JI8 T;  4DR4 T;  4DV1 T;  4DR3 T;  5IWA T;  4B3T T;  2UUA T;  4LF5 T;  4JYA T;  4X62 T;  4DV4 T;  3T1H T;  2VQE T;  1N36 T;  4B3M T;  4LFB T;  5LMU T;  1IBM T;  2UUB T;  4DV0 T;  4DUY T;  1IBK T;  4JI3 T;  4GKJ T;  2E5L T;  2UXB T;  4JI5 T;  1XMQ T;  4YY3 T;  4LF6 T;  4LF8 T;  5LMN T;  4JI7 T;  2F4V T;  2UU9 T;  2HHH T;  4NXM T;  4DV6 T;  1N32 T;  1HNZ T;  1N34 T;  4DV5 T;  4YHH T;  4JI6 T;  4AQY T;  3OTO T;  4JI2 T;  3T1Y T;  1HNX T;  4JI1 T;  1J5E T;  1XNQ T;  5BR8 T;  4LF4 T;  4LFC T;  4B3R T;  4DR2 T;  4B3S T;  1XMO T;  1XNR T;  1N33 T;  4NXN T;  4JI0 T;  1FJG T;  1HR0 T;  4DR6 T;  4OX9 T;  2VQF T;  1I94 T;  4LFA T;  4DV7 T;  4DV3 T;  4LF9 T;  4GKK T;  4DUZ T;  2UXC T;  2UUC T;  2UXD T;  4KHP T;  4X66 T;  4K0K T;  4X65 T;  1HNW T;  4X64 T;  4DR5 T;  2ZM6 T;  1IBL T;  4JV5 T;  4LF7 T;  4DR7 T;  4JI4 T;  4DR1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...