1J5ET

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1j5eT00
4LF6T 3T1YT 2HHHT 4JI4T 1XMQT 4DV5T 4DR4T 1XNRT 4DR2T 4YY3T 1HNWT 4X65T 4X66T 4AQYT 4B3ST 4DV3T 4X64T 4DV1T 2UXCT 2UUBT 1N34T 4JI5T 1J5ET 4LF9T 4JI2T 4DR7T 4DR6T 4DUYT 4DR5T 4JYAT 1I94T 1FJGT 4B3TT 4YHHT 4DV4T 4JI8T 1XNQT 1IBKT 4LF7T 3T1HT 4NXMT 4GKKT 4LFBT 5LMNT 2UUCT 4JI3T 1HNXT 4JI1T 4JV5T 4LF4T 4DR1T 4NXNT 2UXBT 1IBMT 4B3MT 1HNZT 5LMUT 4DV7T 1HR0T 2UUAT 4DV6T 4KHPT 4OX9T 2UU9T 2VQET 4DV2T 4JI0T 4K0KT 5BR8T 4B3RT 1IBLT 1N36T 3OTOT 2ZM6T 4LFAT 4LF8T 4DUZT 2F4VT 4JI6T 2UXDT 1N32T 4X62T 4JI7T 4GKJT 1N33T 4DR3T 4LF5T 1XMOT 2VQFT 4DV0T 4LFCT 5IWAT 2E5LT
chains in the Genus database with same CATH superfamily
3PDYA 1IJ6A 4U7YA 2BS2A 2JMHA 5JDMA 2VK9A 4UVAB 4CI2B 4PW8A 4IDZA 3MK7C 3O9XA 3B13A 5AQHB 4JI2T 3AE5A 4FI5A 1U4QA 1UUSA 1T8BA 1FJGT 1ZEEA 2L8KA 3ZJ1A 3JAEA 5AQKB 4QHOA 3ZCIA 2X9YA 3FXEB 4BJMA 3KFWX 1YD8G 2WY2A 2BG9B 5JREA 1D1BA 3FZMB 2MTQA 4EV6A 1Z8UA 2Y48B 1T72A 3BK9A 3OVUA 3QNUA 1V9DA 4YT0A 4DV6T 5JDGA 2V26A 5JVDE 4YSYA 2Q9QC 1XWMA 4PAGA 2G0UA 4A97A 2HH7A 3L09A 4ANJA 2CXLA 3HA4A 2DNXA 2WU2A 4DUZT 4AI6A 4JI6T 3CPZA 2VURA 5FVKA 4EZ4A 2IC9A 3U3IA 2IW5B 4PJMA 2N1GA 1WLXA 4E7ZA 4UVBB 2MOZA 2VB6A 1MNEA 4YTMA 4QXCB 1WYCA 2KZ7B 3AEDA 1AJ3A 2MBGA 1N34T 2X9XA 2N9DA 5IUXA 3UQ7A 2EHOA 4N78D 2NOXA 3K1SA 3KBTA 3CX6B 4B3TT 2BBHA 3C4XA 5LXTE 4HEAA 3T1HT 4IDNA 5AQFB 2KLQA 2LSGA 2KSRA 2UUCT 5ABEA 5F3JA 4JBWF 3P4WA 5L3BB 3RYCE 4JV5T 3DTOA 3QC9A 5DABA 4IE7A 2H7OA 5JR9C 2K24A 3UULA 1JNZA 4HN9A 2YOEA 2FUPA 1S94A 2WU5A 2WQYA 1SE7A 3EUHA 3PV0F 1MMAA 2WWVA 3FBLA 4GKJT 2LLYA 2QRXA 1LVKA 2Z6EA 3ABVA 3NKZA 4UELA 3T1YT 4HFHA 2V5DA 2JQ9A 2K5BB 3FZHB 4HWCA 5JDHA 3L39A 4QH1A 4X1YE 4DV1T 5AQVB 3UFGA 3SS1A 4YXDA 5LGNB 2RA1A 3ESLA 1NWMX 3CK6A 2BKNA 3WAJA 1WCRA 1ZOYA 4GK5E 4AKGA 4COFA 3LK42 2NP9A 5HEUA 3QK6A 3D0TA 4JI3T 1HNXT 3AE1A 1YKEB 2W67A 4DR1T 1YQ4A 3VRBA 4OYJA 2ODUA 2W0GA 4F6RC 3AA1B 2W61A 4KMCA 4JI0T 2WP9A 4TV8E 3DJBA 2W4XA 3N5LA 4P09A 3AA7B 1HTJF 4U2YA 2E9XD 3PUWF 1DU2A 5AQJB 2E9XA 1HFAA 4EAHA 2UXDT 1NEKA 3AEEA 3HKDE 2CHOA 3EAMA 5LCYA 3UU3A 4LFCT 4H9NC 4DV5T 2L9QA 4CN6A 1HNWT 1UX4A 4Z91A 2XQ5A 3AE4A 4HWFA 2CMRA 3KV6A 3VRAA 4EIWA 2WS3A 4PK5A 5LP6E 1SA0E 2E8IA 3NRYA 4IE0A 3H3AA 2CHNA 1OEDE 1Y64B 4JI8T 3GWHA 3PURA 3MKDA 3A8YC 2WDQA 3Q5WA 4ZS3A 4LFBT 3EDUA 3EABA 4A98A 3P7IA 2VKOA 2WDVA 3S4UA 1YQ3A 2IUBA 1D1CA 4OYKA 1MNDA 1KNRA 2HN2A 2DWGA 1IBMT 2D0UA 5LMUT 2DHRA 3OYXA 2KT9A 2XAFB 4EOZB 3A5XA 3PU8A 2GK9A 4ASKA 4DVDA 3PUAA 1GQEA 3L3PA 3ZJ2A 3TLSA 2BDEA 3RF1A 3HI2A 1SUMB 2E5VA 1N32T 4IREA 1Y01A 2NW7A 2VQFT 5DQVA 2W2UA 1LVFA 3GN5B 3SOLA 3RQUA 1S35A 4YHJA 5AQTB 1KEYA 5LJMA 4I50E 3ZLIA 4J2CA 2ACXA 5HXCA 3I9WA 4XZCA 3UU6A 1HG2A 5ABFB 4QWNB 2CPTA 2YDRA 4IE6A 3NRXA 3P4QA 4KI0F 4NXMT 3LK2B 4B6XA 1HX1B 1YW0A 1J5WA 5F8PA 4PK4A 3IBPA 2WB5A 3EI0A 2CBIA 1MMNA 2LM9A 2X9HA 2BBJA 3V5SA 1G73A 3CX7B 2LOSA 1X79A 4P1NA 4U72A 2IMLA 5J0ZA 1HR0T 5CJ5A 4KHPT 3CX8B 1OXZA 2IAKA 3AEFA 5AQQB 4Z90A 1IBLT 2ZMAA 2CLYC 2ZM6T 2WMNA 3EVYA 5CFBA 3KV4A 2V7LA 5LJNA 5FY7A 3AAIA 2PG8A 2JPFA 1VCTA 4C91A 4TN7B 4OHFA 4L5GA 5TAOA 4O4IE 3RIUC 4JLEA 2SPCA 2LSYA 1YXRA 4B3ST 5CGMA 4DIDB 4JEUB 3P4PA 5EZYE 3PUSA 2CBJA 2XUEA 2R6GF 4O4JE 2ZM0A 4H9OC 3RIFA 4HWDA 4HGAA 3C98B 4OK0A 4LF7T 3P8CD 2X66A 1KK7A 4IIJE 5FY1A 3R6NA 1OEDC 3CQCB 5CB4E 2E9XC 4BJNA 3N9QA 5A1LA 2BZBA 4I0UA 3GN5A 2D0TA 2XTLA 3FZFB 2WZIA 2YU2A 2C5JA 1KNZA 2XQAA 5FNVE 3LJCA 3R84B 3NBXX 4EB6E 4HTEA 2BS4A 3C4ZA 5C8YE 3UUXB 1XDPA 2H88A 4U31A 2V8SV 5C2TA 3BQIA 5ABFA 4DV0T 1W0AA 3FBZA 5HXEA 4UF0B 4H63H 3RKOA 3AXJB 3SWHA 4CI3B 2LJLA 4WNKA 2QVAA 5HEJA 3UUMA 5LGTB 1J5ET 3KBUA 4LF9T 4UEMA 3RQWA 4O2BE 5J1GA 4ZI3D 2H89A 1T98A 4Q25A 5FKYA 4HWIB 3RYHE 1MIYA 4U7IA 3CIRA 3TLVA 1UK5A 3JADA 4ILAA 5F5WA 2EHOD 2UXXB 1LRZA 3OJAA 4AXPA 5L47A 2XASB 2KINB 3F31A 2J4GA 1H7CA 3ZSSA 2CA5A 4G63A 2CXDA 4I55E 5AQNB 2UUAT 1KNPA 3AE3A 4LMKA 4PFOA 1VCSA 5LGUB 4LMJA 2XQ4A 2M67A 3N2KE 2FJEA 3VKHA 3Q5DA 3KVBA 2F4VT 3GA8A 3TLUA 3J7Yq 2XSBA 3C64A 3RX6A 1FMWA 4AKLA 2X51A 1MIWA 1XZYA 4AQFA 4AKHA 4DR4T 5FYMA 4DR2T 4GOUA 4ZEYA 2YKSA 3RYFE 4AIUA 3NWIA 2BVMA 4CQIA 4WBNE 2Q9QB 2LHNA 2UUBT 3GMIA 2CM0A 4EZHA 1UX5A 3AE2A 3PUVF 3QB5K 3RLFF 4DNDA 4PK6A 2UXNB 2Y6XA 3L8RA 1WR0A 3ZT6A 1KF6A 2FJBA 2ACZA 2BG9A 5FXVA 4HFVA 3RIAA 3AEBA 4JI1T 4ZI2D 4QX8B 4CN1A 3F57A 1WYBA 4TUYE 1JNRA 5FMNA 4ILBA 1ZP0A 3BQLA 3TLWA 3ZKRA 3NZPA 1BR4A 1U5PA 2NWBA 2D9DA 4ZOLE 4OX9T 3IA3A 4UF0A 3AXJA 1UGOA 4WW0A 2VVSA 3ZSTA 4YLHA 3HKEE 2BG9E 2VKJA 4QKNA 3AE8A 4DR3T 1XMOT 5EK2A 4PJNA 1SHZC 2VL0A 4IDQA 3K3NA 3H37A 4MBQA 3PUXF 3P4SA 5KX5E 5LBQB 3N9NA 3U78A 2K3WA 1FIOA 2XAJB 5H6QB 5AFUL 2X67A 2LT3A 5JR9B 4NPPA 4FJOA 2XQ8A 3Q2MA 2AXDS 3CKDA 2MPKA 2C5KT 5E0OA 1J1JA 3ZN0B 4JYAT 5JQGE 4ZS2A 3AA6B 2QYWA 4KUMB 4DBQA 3ZYMA 1CUNA 4UR9A 4TNVA 1LKXA 3AE7A 2WSSV 3RPUA 2V7KA 5ABGA 3RRCA 2WZHA 3AE9A 4ADZA 2CE7A 2A9UA 5J2UE 4YTNA 4EYYR 4B3MT 5LB7B 2M6IA 4OFZA 3J9X1 1M62A 3RGLA 5C3JA 4QH4A 1HF8A 2PTFA 4ISTA 3V5UA 2CCQA 4LMLA 4IHJE 2K48A 3B57A 5JDFA 4IDOA 2I59A 2J62A 4LF8T 3AVRA 2LSJA 4EGWA 4ZXLA 3PUZF 4P0BA 4DBRA 4HKAA 3N2GE 1D0YA 4DMWA 3HR0A 4JEHB 3AVSA 3B5MA 3PE0A 3AAAB 4ZI3C 4KBMB 4NIQA 1XMQT 1WR6A 4O4HE 2ES0A 3E22E 2H7VC 4H63V 4IL9A 2CEAA 4KP3C 3ZPOA 5L2LA 4HFCA 5LNKA 1NAFA 3IEEA 4TX5A 5L3CB 3SRZA 3ZMTB 2EHOC 3ZMUB 3NZQA 5FXZA 3FZKB 2YK0A 3SFEA 2W66A 3A7MA 4EYUA 2J47A 2NTXA 4YHHT 4O4LE 2XZEA 1YKHB 2NR4A 3MJXA 3K8PC 4UV9B 2XY8B 1E7PA 2VVNA 3TLTA 3VR9A 4ZHQE 2N2NA 1MMDA 4X5TA 4IE4A 2K9AA 2NTYA 5L3FB 4NXNT 1BR2A 1BR1A 1W0BA 1FMVA 3MA9A 3G06A 4AQFC 4U3CA 2XQ7A 2UU9T 4QXBB 4HE8A 5EK4A 5ADXL 1N36T 5JR9A 4DO0A 2KWIB 3OYZA 3ZYKA 2XQ6A 3ONLC 3PTRB 4X62T 2DL1A 4Z8XA 3RH3A 4BA9A 3CVRA 4O8SA 1D0ZA 2V7JA 5L3EB 1UURA 5HXRA 4IL4A 3M3ZB 2I0MA 4X65T 2BG9C 2VASA 4ISSA 4L0RA 1NENA 2IC6A 4HFBA 5HAXA 2V6YB 2DI4A 5IHYA 3JC6D 4HFIA 3ANWB 1D0XA 4O2AE 4GK0E 4TNWA 2YDSA 1XNQT 2JIWA 4JUYA 2WCAA 5J2TE 3KV9A 2XQYA 2WDRA 4PNIA 3PUGA 1ZHCA 2V5CA 3I0QA 2LM2A 2M6BA 4ERRA 2B76A 2ZLYA 3JAFA 4G2AA 3ZEFB 4ZZBA 2UXBT 2DLRA 3CMLA 3N9MA 4X1IE 1E2AA 3LFMA 3UUBA 3LK3B 3UT5E 5AQSB 2XAGB 5FL1A 5FP3A 2WWUA 3UU4A 5HEHA 3LG7A 4LFAT 5JTGA 2L3LA 3WI3A 2YN6A 2OA5A 5LHGB 2ZM8A 1L0VA 5L3DB 2HPLA 4HWHA 4XAXB 3CQXC 4LF6T 4IDPA 2HHHT 4YFSA 5JDQA 4TWDA 2LRKA 5M4YA 4AQYT 3JCFA 2KXPB 2JRKA 4DV3T 4X64T 1MMGA 1QLBA 4X1KE 2LHRA 2XJ7A 4JI5T 4BAYB 2CLYB 5HCJA 4DR7T 1X9BA 5LHIB 3LBXB 2MAWA 4TZ4C 2AE9A 2MYSA 4DUYT 1FEWA 5AQUB 3I9YA 3CWZB 1I94T 2JQKA 3Q5EA 3UU8A 5HWYA 2JQHA 3IHRA 3PUYF 4IT4A 4ZZCA 4U2ZA 4IE5A 4F8HA 4UXNB 2JJ9A 4A5XA 5L4HA 4IGUA 1ZV4X 2HN1A 3RC8A 3KV5A 4YSXA 5KMGP 5LYJE 2VWAA 2IIUA 4QX7B 4PJLA 1T7SA 5GONE 1QUUA 5LHHB 2A72A 3I1AA 4CN4A 3P50A 3AEAA 5AQGB 5AQOB 1VRBA 5FXWA 3P4RA 4CXYA 3ZC0A 3FZLB 4MALA 5BMVE 2RPAA 2V1DB 3AECA 1B7TA 5HXHA 4GYRA 2W00A 2V6YA 2V7IA 1OEDB 2LEHA 1BR0A 3ANWA 4NUVA 4LF5T 2E9XB 3O4XE 3N2OA 3ZN1B 2DWKA 2ZM2A 3MXZA 3KVAA 4CZZB 1XNRT 3ZCJA 3OKQA 2X0HA 4X66T 4QXHB 3HL6A 4WBOA 1VOMA 4ILUA 2OV9A 2PBIA 3PU3A 3ZT5A 2XQ3A 2OLTA 2BKOA 4A56A 3DP7A 4DV4T 5KXJA 3RRWA 3W15B 5LMNT 2CXFA 2PJQA 1QSDA 5KDMC 5LOVE 3VR8A 2CWYA 2XAQB 2BKPA 4YJ2E 1ZKEA 2ODVA 5H6RB 3BQKA 2NW9A 2LKHA 2XM2A 4ILCA 2LE8A 3RC3A 3UU5A 4C90A 3MACA 2C0SA 2KWHA 4EXTA 1CHUA 4K0KT 5BR8T 4MLKA 5FY0A 1I6ZA 2WBLA 3Q5XA 3ONJA 4I43B 3C51A 4TV9E 4L9IA 3QOFA 1W9RA 3EDVA 2X68A 2XHEB 3OPCA 4V1Av 5AQMB 1IZNB 2E2AA 3LBXA 2YINA 3JC6C 1N33T 2BS3A 3E08A 4XBFB 3AEGA 3C50A 4UIGA 3VKGA 1HCIA 5AQRB 4YY3T 3K3OA 2NW8A 2LRLA 2HPJA 3RIUA 2XSAA 4U74A 5HEOA 2WM9A 1EZ3A 2XM1A 3O1JA 5FXXA 2H3RA 3PUQA 2YDQA 4DR6T 3EHZA 4HFEA 3F2EA 2W62A 5CA1E 1G8XA 2Y8DA 5EK3A 3LDQB 3N9PA 2YU1A 1Z0PA 2LSKA 2X0LB 3AA0B 4KX6A 4PFPA 3KDSE 5HCMA 5IYZE 1OEDA 2A3DA 3OBVE 1HG5A 2XQ9A 5FL0A 2B1EA 2J1DG 1HS7A 3FHNA 4NUUA 4DV7T 2JMKA 4AKIA 3RI5A 2LOPA 4HFDA 3RYIE 1XDOA 1R8IA 2YEVC 3AAEB 3QUJA 4DV2T 1UCUA 2KMFA 3VHLA 3X1DA 3O1HA 2V7MA 3ZMZB 2VL8A 5JH7E 1E1HB 4GYSA 5LA6E 4MHCA 4P0AA 2XAHB 4U33A 4JI7T 5ABHA 2PFVA 1WRDA 2WAUA 2E5LT 1IAPA 2XPKA 4KHZF 2Q9QD 3CQGB 4UVCB 4CI1B 2Q9QA 4AKRB 4ZI7E 5AQLB 4H9SE 3UUNA 3O1IA 3ETUA 5JDLA 5JRCB 4EEDA 4K0UA 2X0YA 3WAKA 2JQQA 1M7KA 3H3MA 1IJ5A 4AISA 3UFEA 2IHR1 3NVOA 2I6HA 3RHWA 3T8OA 3VU7H 3N9LA 1IBKT 4CXWA 5HWXA 5AQPB 4WZXA 5JDNA 2D5UA 4H9QC 3ZMVB 4AQGA 4E7SA 4H9RC 1HX8A 4GIWA 3ONXA 4X20E 4PJJA 3UQ4A 4YJ3E 3RKGA 5HXSA 2VKDA 4YSZA 3MZKB 3PJAJ 3ZT7A 2VQET 3UTKA 4TWFA 3SFDA 5ETWA 2FBWA 3AB3B 2KNDA 4DMVA 3E0ZA 2X9WA 3K3QC 2FJDA 3TKLB 3LSVA 1D1AA 2BVLA 3M65A 1O3XA 5HYAA 5L3GB 4JI4T 2LKGA 2LSIA 2VKHA 4UV8B 5CA0E 4I4TE 3ETVA 3Q9DA 4YTPA 5LG3A 1MIVA 3FXDB 5LBMA 2UXCT 3HKCE 1KFYA 1OWAA 2QGSA 3AE6A 3C4WA 4DR5T 5DJQC 1US7B 2V6XA 3IF8B 2CRBA 3ZC1A 2C5IT 4QH5A 5AQIB 4GKKT 5DQWA 4WYVA 4CXXA 2W63A 2CWOA 4M1PA 2A2FX 2DCFA 4H9PC 4ZI2C 3I0OA 3PJAA 3HKBE 4TWHA 2P9BA 3QB5A 4LF4T 2EHOB 5L4EA 4MFRA 2IDOB 3N9OA 1W09A 2RP4A 1HNZT 3FB2A 3KINB 2D2SA 2FJAA 4B3RT 3ZMSB 2WMOA 3OTOT 4EEBA 5JRCA 2QA7A 5HEGA 3ZYLA 5FVLA 5LG4A 1WFDA 5IWAT
chains in the Genus database with same CATH topology
4LF6T 3T1YT 2HHHT 4JI4T 1XMQT 4DV5T 4DR4T 1XNRT 4DR2T 4YY3T 1HNWT 4X65T 4X66T 4AQYT 4B3ST 4DV3T 4X64T 4DV1T 2UXCT 2UUBT 1N34T 4JI5T 1J5ET 4LF9T 4JI2T 4DR7T 4DR6T 4DUYT 4DR5T 4JYAT 1I94T 1FJGT 4B3TT 4YHHT 4DV4T 4JI8T 1XNQT 1IBKT 4LF7T 3T1HT 4NXMT 4GKKT 4LFBT 5LMNT 2UUCT 4JI3T 1HNXT 4JI1T 4JV5T 4LF4T 4DR1T 4NXNT 2UXBT 1IBMT 4B3MT 1HNZT 5LMUT 4DV7T 1HR0T 2UUAT 4DV6T 4KHPT 4OX9T 2UU9T 2VQET 4DV2T 4JI0T 4K0KT 5BR8T 4B3RT 1IBLT 1N36T 3OTOT 2ZM6T 4LFAT 4LF8T 4DUZT 2F4VT 4JI6T 2UXDT 1N32T 4X62T 4JI7T 4GKJT 1N33T 4DR3T 4LF5T 1XMOT 2VQFT 4DV0T 4LFCT 5IWAT 2E5LT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 T;  3T1Y T;  2HHH T;  4JI4 T;  1XMQ T;  4DV5 T;  4DR4 T;  1XNR T;  4DR2 T;  4YY3 T;  1HNW T;  4X65 T;  4X66 T;  4AQY T;  4B3S T;  4DV3 T;  4X64 T;  4DV1 T;  2UXC T;  2UUB T;  1N34 T;  4JI5 T;  1J5E T;  4LF9 T;  4JI2 T;  4DR7 T;  4DR6 T;  4DUY T;  4DR5 T;  4JYA T;  1I94 T;  1FJG T;  4B3T T;  4YHH T;  4DV4 T;  4JI8 T;  1XNQ T;  1IBK T;  4LF7 T;  3T1H T;  4NXM T;  4GKK T;  4LFB T;  5LMN T;  2UUC T;  4JI3 T;  1HNX T;  4JI1 T;  4JV5 T;  4LF4 T;  4DR1 T;  4NXN T;  2UXB T;  1IBM T;  4B3M T;  1HNZ T;  5LMU T;  4DV7 T;  1HR0 T;  2UUA T;  4DV6 T;  4KHP T;  4OX9 T;  2UU9 T;  2VQE T;  4DV2 T;  4JI0 T;  4K0K T;  5BR8 T;  4B3R T;  1IBL T;  1N36 T;  3OTO T;  2ZM6 T;  4LFA T;  4LF8 T;  4DUZ T;  2F4V T;  4JI6 T;  2UXD T;  1N32 T;  4X62 T;  4JI7 T;  4GKJ T;  1N33 T;  4DR3 T;  4LF5 T;  1XMO T;  2VQF T;  4DV0 T;  4LFC T;  5IWA T;  2E5L T; 
#chains in the Genus database with same CATH topology
 3PDY A;  1IJ6 A;  4U7Y A;  2BS2 A;  2JMH A;  5JDM A;  2VK9 A;  4UVA B;  4CI2 B;  4PW8 A;  4IDZ A;  3MK7 C;  3O9X A;  3B13 A;  5AQH B;  4JI2 T;  3AE5 A;  4FI5 A;  1U4Q A;  1UUS A;  1T8B A;  1FJG T;  1ZEE A;  2L8K A;  3ZJ1 A;  3JAE A;  5AQK B;  4QHO A;  3ZCI A;  2X9Y A;  3FXE B;  4BJM A;  3KFW X;  1YD8 G;  2WY2 A;  2BG9 B;  5JRE A;  1D1B A;  3FZM B;  2MTQ A;  4EV6 A;  1Z8U A;  2Y48 B;  1T72 A;  3BK9 A;  3OVU A;  3QNU A;  1V9D A;  4YT0 A;  4DV6 T;  5JDG A;  2V26 A;  5JVD E;  4YSY A;  2Q9Q C;  1XWM A;  4PAG A;  2G0U A;  4A97 A;  2HH7 A;  3L09 A;  4ANJ A;  2CXL A;  3HA4 A;  2DNX A;  2WU2 A;  4DUZ T;  4AI6 A;  4JI6 T;  3CPZ A;  2VUR A;  5FVK A;  4EZ4 A;  2IC9 A;  3U3I A;  2IW5 B;  4PJM A;  2N1G A;  1WLX A;  4E7Z A;  4UVB B;  2MOZ A;  2VB6 A;  1MNE A;  4YTM A;  4QXC B;  1WYC A;  2KZ7 B;  3AED A;  1AJ3 A;  2MBG A;  1N34 T;  2X9X A;  2N9D A;  5IUX A;  3UQ7 A;  2EHO A;  4N78 D;  2NOX A;  3K1S A;  3KBT A;  3CX6 B;  4B3T T;  2BBH A;  3C4X A;  5LXT E;  4HEA A;  3T1H T;  4IDN A;  5AQF B;  2KLQ A;  2LSG A;  2KSR A;  2UUC T;  5ABE A;  5F3J A;  4JBW F;  3P4W A;  5L3B B;  3RYC E;  4JV5 T;  3DTO A;  3QC9 A;  5DAB A;  4IE7 A;  2H7O A;  5JR9 C;  2K24 A;  3UUL A;  1JNZ A;  4HN9 A;  2YOE A;  2FUP A;  1S94 A;  2WU5 A;  2WQY A;  1SE7 A;  3EUH A;  3PV0 F;  1MMA A;  2WWV A;  3FBL A;  4GKJ T;  2LLY A;  2QRX A;  1LVK A;  2Z6E A;  3ABV A;  3NKZ A;  4UEL A;  3T1Y T;  4HFH A;  2V5D A;  2JQ9 A;  2K5B B;  3FZH B;  4HWC A;  5JDH A;  3L39 A;  4QH1 A;  4X1Y E;  4DV1 T;  5AQV B;  3UFG A;  3SS1 A;  4YXD A;  5LGN B;  2RA1 A;  3ESL A;  1NWM X;  3CK6 A;  2BKN A;  3WAJ A;  1WCR A;  1ZOY A;  4GK5 E;  4AKG A;  4COF A;  3LK4 2;  2NP9 A;  5HEU A;  3QK6 A;  3D0T A;  4JI3 T;  1HNX T;  3AE1 A;  1YKE B;  2W67 A;  4DR1 T;  1YQ4 A;  3VRB A;  4OYJ A;  2ODU A;  2W0G A;  4F6R C;  3AA1 B;  2W61 A;  4KMC A;  4JI0 T;  2WP9 A;  4TV8 E;  3DJB A;  2W4X A;  3N5L A;  4P09 A;  3AA7 B;  1HTJ F;  4U2Y A;  2E9X D;  3PUW F;  1DU2 A;  5AQJ B;  2E9X A;  1HFA A;  4EAH A;  2UXD T;  1NEK A;  3AEE A;  3HKD E;  2CHO A;  3EAM A;  5LCY A;  3UU3 A;  4LFC T;  4H9N C;  4DV5 T;  2L9Q A;  4CN6 A;  1HNW T;  1UX4 A;  4Z91 A;  2XQ5 A;  3AE4 A;  4HWF A;  2CMR A;  3KV6 A;  3VRA A;  4EIW A;  2WS3 A;  4PK5 A;  5LP6 E;  1SA0 E;  2E8I A;  3NRY A;  4IE0 A;  3H3A A;  2CHN A;  1OED E;  1Y64 B;  4JI8 T;  3GWH A;  3PUR A;  3MKD A;  3A8Y C;  2WDQ A;  3Q5W A;  4ZS3 A;  4LFB T;  3EDU A;  3EAB A;  4A98 A;  3P7I A;  2VKO A;  2WDV A;  3S4U A;  1YQ3 A;  2IUB A;  1D1C A;  4OYK A;  1MND A;  1KNR A;  2HN2 A;  2DWG A;  1IBM T;  2D0U A;  5LMU T;  2DHR A;  3OYX A;  2KT9 A;  2XAF B;  4EOZ B;  3A5X A;  3PU8 A;  2GK9 A;  4ASK A;  4DVD A;  3PUA A;  1GQE A;  3L3P A;  3ZJ2 A;  3TLS A;  2BDE A;  3RF1 A;  3HI2 A;  1SUM B;  2E5V A;  1N32 T;  4IRE A;  1Y01 A;  2NW7 A;  2VQF T;  5DQV A;  2W2U A;  1LVF A;  3GN5 B;  3SOL A;  3RQU A;  1S35 A;  4YHJ A;  5AQT B;  1KEY A;  5LJM A;  4I50 E;  3ZLI A;  4J2C A;  2ACX A;  5HXC A;  3I9W A;  4XZC A;  3UU6 A;  1HG2 A;  5ABF B;  4QWN B;  2CPT A;  2YDR A;  4IE6 A;  3NRX A;  3P4Q A;  4KI0 F;  4NXM T;  3LK2 B;  4B6X A;  1HX1 B;  1YW0 A;  1J5W A;  5F8P A;  4PK4 A;  3IBP A;  2WB5 A;  3EI0 A;  2CBI A;  1MMN A;  2LM9 A;  2X9H A;  2BBJ A;  3V5S A;  1G73 A;  3CX7 B;  2LOS A;  1X79 A;  4P1N A;  4U72 A;  2IML A;  5J0Z A;  1HR0 T;  5CJ5 A;  4KHP T;  3CX8 B;  1OXZ A;  2IAK A;  3AEF A;  5AQQ B;  4Z90 A;  1IBL T;  2ZMA A;  2CLY C;  2ZM6 T;  2WMN A;  3EVY A;  5CFB A;  3KV4 A;  2V7L A;  5LJN A;  5FY7 A;  3AAI A;  2PG8 A;  2JPF A;  1VCT A;  4C91 A;  4TN7 B;  4OHF A;  4L5G A;  5TAO A;  4O4I E;  3RIU C;  4JLE A;  2SPC A;  2LSY A;  1YXR A;  4B3S T;  5CGM A;  4DID B;  4JEU B;  3P4P A;  5EZY E;  3PUS A;  2CBJ A;  2XUE A;  2R6G F;  4O4J E;  2ZM0 A;  4H9O C;  3RIF A;  4HWD A;  4HGA A;  3C98 B;  4OK0 A;  4LF7 T;  3P8C D;  2X66 A;  1KK7 A;  4IIJ E;  5FY1 A;  3R6N A;  1OED C;  3CQC B;  5CB4 E;  2E9X C;  4BJN A;  3N9Q A;  5A1L A;  2BZB A;  4I0U A;  3GN5 A;  2D0T A;  2XTL A;  3FZF B;  2WZI A;  2YU2 A;  2C5J A;  1KNZ A;  2XQA A;  5FNV E;  3LJC A;  3R84 B;  3NBX X;  4EB6 E;  4HTE A;  2BS4 A;  3C4Z A;  5C8Y E;  3UUX B;  1XDP A;  2H88 A;  4U31 A;  2V8S V;  5C2T A;  3BQI A;  5ABF A;  4DV0 T;  1W0A A;  3FBZ A;  5HXE A;  4UF0 B;  4H63 H;  3RKO A;  3AXJ B;  3SWH A;  4CI3 B;  2LJL A;  4WNK A;  2QVA A;  5HEJ A;  3UUM A;  5LGT B;  1J5E T;  3KBU A;  4LF9 T;  4UEM A;  3RQW A;  4O2B E;  5J1G A;  4ZI3 D;  2H89 A;  1T98 A;  4Q25 A;  5FKY A;  4HWI B;  3RYH E;  1MIY A;  4U7I A;  3CIR A;  3TLV A;  1UK5 A;  3JAD A;  4ILA A;  5F5W A;  2EHO D;  2UXX B;  1LRZ A;  3OJA A;  4AXP A;  5L47 A;  2XAS B;  2KIN B;  3F31 A;  2J4G A;  1H7C A;  3ZSS A;  2CA5 A;  4G63 A;  2CXD A;  4I55 E;  5AQN B;  2UUA T;  1KNP A;  3AE3 A;  4LMK A;  4PFO A;  1VCS A;  5LGU B;  4LMJ A;  2XQ4 A;  2M67 A;  3N2K E;  2FJE A;  3VKH A;  3Q5D A;  3KVB A;  2F4V T;  3GA8 A;  3TLU A;  3J7Y q;  2XSB A;  3C64 A;  3RX6 A;  1FMW A;  4AKL A;  2X51 A;  1MIW A;  1XZY A;  4AQF A;  4AKH A;  4DR4 T;  5FYM A;  4DR2 T;  4GOU A;  4ZEY A;  2YKS A;  3RYF E;  4AIU A;  3NWI A;  2BVM A;  4CQI A;  4WBN E;  2Q9Q B;  2LHN A;  2UUB T;  3GMI A;  2CM0 A;  4EZH A;  1UX5 A;  3AE2 A;  3PUV F;  3QB5 K;  3RLF F;  4DND A;  4PK6 A;  2UXN B;  2Y6X A;  3L8R A;  1WR0 A;  3ZT6 A;  1KF6 A;  2FJB A;  2ACZ A;  2BG9 A;  5FXV A;  4HFV A;  3RIA A;  3AEB A;  4JI1 T;  4ZI2 D;  4QX8 B;  4CN1 A;  3F57 A;  1WYB A;  4TUY E;  1JNR A;  5FMN A;  4ILB A;  1ZP0 A;  3BQL A;  3TLW A;  3ZKR A;  3NZP A;  1BR4 A;  1U5P A;  2NWB A;  2D9D A;  4ZOL E;  4OX9 T;  3IA3 A;  4UF0 A;  3AXJ A;  1UGO A;  4WW0 A;  2VVS A;  3ZST A;  4YLH A;  3HKE E;  2BG9 E;  2VKJ A;  4QKN A;  3AE8 A;  4DR3 T;  1XMO T;  5EK2 A;  4PJN A;  1SHZ C;  2VL0 A;  4IDQ A;  3K3N A;  3H37 A;  4MBQ A;  3PUX F;  3P4S A;  5KX5 E;  5LBQ B;  3N9N A;  3U78 A;  2K3W A;  1FIO A;  2XAJ B;  5H6Q B;  5AFU L;  2X67 A;  2LT3 A;  5JR9 B;  4NPP A;  4FJO A;  2XQ8 A;  3Q2M A;  2AXD S;  3CKD A;  2MPK A;  2C5K T;  5E0O A;  1J1J A;  3ZN0 B;  4JYA T;  5JQG E;  4ZS2 A;  3AA6 B;  2QYW A;  4KUM B;  4DBQ A;  3ZYM A;  1CUN A;  4UR9 A;  4TNV A;  1LKX A;  3AE7 A;  2WSS V;  3RPU A;  2V7K A;  5ABG A;  3RRC A;  2WZH A;  3AE9 A;  4ADZ A;  2CE7 A;  2A9U A;  5J2U E;  4YTN A;  4EYY R;  4B3M T;  5LB7 B;  2M6I A;  4OFZ A;  3J9X 1;  1M62 A;  3RGL A;  5C3J A;  4QH4 A;  1HF8 A;  2PTF A;  4IST A;  3V5U A;  2CCQ A;  4LML A;  4IHJ E;  2K48 A;  3B57 A;  5JDF A;  4IDO A;  2I59 A;  2J62 A;  4LF8 T;  3AVR A;  2LSJ A;  4EGW A;  4ZXL A;  3PUZ F;  4P0B A;  4DBR A;  4HKA A;  3N2G E;  1D0Y A;  4DMW A;  3HR0 A;  4JEH B;  3AVS A;  3B5M A;  3PE0 A;  3AAA B;  4ZI3 C;  4KBM B;  4NIQ A;  1XMQ T;  1WR6 A;  4O4H E;  2ES0 A;  3E22 E;  2H7V C;  4H63 V;  4IL9 A;  2CEA A;  4KP3 C;  3ZPO A;  5L2L A;  4HFC A;  5LNK A;  1NAF A;  3IEE A;  4TX5 A;  5L3C B;  3SRZ A;  3ZMT B;  2EHO C;  3ZMU B;  3NZQ A;  5FXZ A;  3FZK B;  2YK0 A;  3SFE A;  2W66 A;  3A7M A;  4EYU A;  2J47 A;  2NTX A;  4YHH T;  4O4L E;  2XZE A;  1YKH B;  2NR4 A;  3MJX A;  3K8P C;  4UV9 B;  2XY8 B;  1E7P A;  2VVN A;  3TLT A;  3VR9 A;  4ZHQ E;  2N2N A;  1MMD A;  4X5T A;  4IE4 A;  2K9A A;  2NTY A;  5L3F B;  4NXN T;  1BR2 A;  1BR1 A;  1W0B A;  1FMV A;  3MA9 A;  3G06 A;  4AQF C;  4U3C A;  2XQ7 A;  2UU9 T;  4QXB B;  4HE8 A;  5EK4 A;  5ADX L;  1N36 T;  5JR9 A;  4DO0 A;  2KWI B;  3OYZ A;  3ZYK A;  2XQ6 A;  3ONL C;  3PTR B;  4X62 T;  2DL1 A;  4Z8X A;  3RH3 A;  4BA9 A;  3CVR A;  4O8S A;  1D0Z A;  2V7J A;  5L3E B;  1UUR A;  5HXR A;  4IL4 A;  3M3Z B;  2I0M A;  4X65 T;  2BG9 C;  2VAS A;  4ISS A;  4L0R A;  1NEN A;  2IC6 A;  4HFB A;  5HAX A;  2V6Y B;  2DI4 A;  5IHY A;  3JC6 D;  4HFI A;  3ANW B;  1D0X A;  4O2A E;  4GK0 E;  4TNW A;  2YDS A;  1XNQ T;  2JIW A;  4JUY A;  2WCA A;  5J2T E;  3KV9 A;  2XQY A;  2WDR A;  4PNI A;  3PUG A;  1ZHC A;  2V5C A;  3I0Q A;  2LM2 A;  2M6B A;  4ERR A;  2B76 A;  2ZLY A;  3JAF A;  4G2A A;  3ZEF B;  4ZZB A;  2UXB T;  2DLR A;  3CML A;  3N9M A;  4X1I E;  1E2A A;  3LFM A;  3UUB A;  3LK3 B;  3UT5 E;  5AQS B;  2XAG B;  5FL1 A;  5FP3 A;  2WWU A;  3UU4 A;  5HEH A;  3LG7 A;  4LFA T;  5JTG A;  2L3L A;  3WI3 A;  2YN6 A;  2OA5 A;  5LHG B;  2ZM8 A;  1L0V A;  5L3D B;  2HPL A;  4HWH A;  4XAX B;  3CQX C;  4LF6 T;  4IDP A;  2HHH T;  4YFS A;  5JDQ A;  4TWD A;  2LRK A;  5M4Y A;  4AQY T;  3JCF A;  2KXP B;  2JRK A;  4DV3 T;  4X64 T;  1MMG A;  1QLB A;  4X1K E;  2LHR A;  2XJ7 A;  4JI5 T;  4BAY B;  2CLY B;  5HCJ A;  4DR7 T;  1X9B A;  5LHI B;  3LBX B;  2MAW A;  4TZ4 C;  2AE9 A;  2MYS A;  4DUY T;  1FEW A;  5AQU B;  3I9Y A;  3CWZ B;  1I94 T;  2JQK A;  3Q5E A;  3UU8 A;  5HWY A;  2JQH A;  3IHR A;  3PUY F;  4IT4 A;  4ZZC A;  4U2Z A;  4IE5 A;  4F8H A;  4UXN B;  2JJ9 A;  4A5X A;  5L4H A;  4IGU A;  1ZV4 X;  2HN1 A;  3RC8 A;  3KV5 A;  4YSX A;  5KMG P;  5LYJ E;  2VWA A;  2IIU A;  4QX7 B;  4PJL A;  1T7S A;  5GON E;  1QUU A;  5LHH B;  2A72 A;  3I1A A;  4CN4 A;  3P50 A;  3AEA A;  5AQG B;  5AQO B;  1VRB A;  5FXW A;  3P4R A;  4CXY A;  3ZC0 A;  3FZL B;  4MAL A;  5BMV E;  2RPA A;  2V1D B;  3AEC A;  1B7T A;  5HXH A;  4GYR A;  2W00 A;  2V6Y A;  2V7I A;  1OED B;  2LEH A;  1BR0 A;  3ANW A;  4NUV A;  4LF5 T;  2E9X B;  3O4X E;  3N2O A;  3ZN1 B;  2DWK A;  2ZM2 A;  3MXZ A;  3KVA A;  4CZZ B;  1XNR T;  3ZCJ A;  3OKQ A;  2X0H A;  4X66 T;  4QXH B;  3HL6 A;  4WBO A;  1VOM A;  4ILU A;  2OV9 A;  2PBI A;  3PU3 A;  3ZT5 A;  2XQ3 A;  2OLT A;  2BKO A;  4A56 A;  3DP7 A;  4DV4 T;  5KXJ A;  3RRW A;  3W15 B;  5LMN T;  2CXF A;  2PJQ A;  1QSD A;  5KDM C;  5LOV E;  3VR8 A;  2CWY A;  2XAQ B;  2BKP A;  4YJ2 E;  1ZKE A;  2ODV A;  5H6R B;  3BQK A;  2NW9 A;  2LKH A;  2XM2 A;  4ILC A;  2LE8 A;  3RC3 A;  3UU5 A;  4C90 A;  3MAC A;  2C0S A;  2KWH A;  4EXT A;  1CHU A;  4K0K T;  5BR8 T;  4MLK A;  5FY0 A;  1I6Z A;  2WBL A;  3Q5X A;  3ONJ A;  4I43 B;  3C51 A;  4TV9 E;  4L9I A;  3QOF A;  1W9R A;  3EDV A;  2X68 A;  2XHE B;  3OPC A;  4V1A v;  5AQM B;  1IZN B;  2E2A A;  3LBX A;  2YIN A;  3JC6 C;  1N33 T;  2BS3 A;  3E08 A;  4XBF B;  3AEG A;  3C50 A;  4UIG A;  3VKG A;  1HCI A;  5AQR B;  4YY3 T;  3K3O A;  2NW8 A;  2LRL A;  2HPJ A;  3RIU A;  2XSA A;  4U74 A;  5HEO A;  2WM9 A;  1EZ3 A;  2XM1 A;  3O1J A;  5FXX A;  2H3R A;  3PUQ A;  2YDQ A;  4DR6 T;  3EHZ A;  4HFE A;  3F2E A;  2W62 A;  5CA1 E;  1G8X A;  2Y8D A;  5EK3 A;  3LDQ B;  3N9P A;  2YU1 A;  1Z0P A;  2LSK A;  2X0L B;  3AA0 B;  4KX6 A;  4PFP A;  3KDS E;  5HCM A;  5IYZ E;  1OED A;  2A3D A;  3OBV E;  1HG5 A;  2XQ9 A;  5FL0 A;  2B1E A;  2J1D G;  1HS7 A;  3FHN A;  4NUU A;  4DV7 T;  2JMK A;  4AKI A;  3RI5 A;  2LOP A;  4HFD A;  3RYI E;  1XDO A;  1R8I A;  2YEV C;  3AAE B;  3QUJ A;  4DV2 T;  1UCU A;  2KMF A;  3VHL A;  3X1D A;  3O1H A;  2V7M A;  3ZMZ B;  2VL8 A;  5JH7 E;  1E1H B;  4GYS A;  5LA6 E;  4MHC A;  4P0A A;  2XAH B;  4U33 A;  4JI7 T;  5ABH A;  2PFV A;  1WRD A;  2WAU A;  2E5L T;  1IAP A;  2XPK A;  4KHZ F;  2Q9Q D;  3CQG B;  4UVC B;  4CI1 B;  2Q9Q A;  4AKR B;  4ZI7 E;  5AQL B;  4H9S E;  3UUN A;  3O1I A;  3ETU A;  5JDL A;  5JRC B;  4EED A;  4K0U A;  2X0Y A;  3WAK A;  2JQQ A;  1M7K A;  3H3M A;  1IJ5 A;  4AIS A;  3UFE A;  2IHR 1;  3NVO A;  2I6H A;  3RHW A;  3T8O A;  3VU7 H;  3N9L A;  1IBK T;  4CXW A;  5HWX A;  5AQP B;  4WZX A;  5JDN A;  2D5U A;  4H9Q C;  3ZMV B;  4AQG A;  4E7S A;  4H9R C;  1HX8 A;  4GIW A;  3ONX A;  4X20 E;  4PJJ A;  3UQ4 A;  4YJ3 E;  3RKG A;  5HXS A;  2VKD A;  4YSZ A;  3MZK B;  3PJA J;  3ZT7 A;  2VQE T;  3UTK A;  4TWF A;  3SFD A;  5ETW A;  2FBW A;  3AB3 B;  2KND A;  4DMV A;  3E0Z A;  2X9W A;  3K3Q C;  2FJD A;  3TKL B;  3LSV A;  1D1A A;  2BVL A;  3M65 A;  1O3X A;  5HYA A;  5L3G B;  4JI4 T;  2LKG A;  2LSI A;  2VKH A;  4UV8 B;  5CA0 E;  4I4T E;  3ETV A;  3Q9D A;  4YTP A;  5LG3 A;  1MIV A;  3FXD B;  5LBM A;  2UXC T;  3HKC E;  1KFY A;  1OWA A;  2QGS A;  3AE6 A;  3C4W A;  4DR5 T;  5DJQ C;  1US7 B;  2V6X A;  3IF8 B;  2CRB A;  3ZC1 A;  2C5I T;  4QH5 A;  5AQI B;  4GKK T;  5DQW A;  4WYV A;  4CXX A;  2W63 A;  2CWO A;  4M1P A;  2A2F X;  2DCF A;  4H9P C;  4ZI2 C;  3I0O A;  3PJA A;  3HKB E;  4TWH A;  2P9B A;  3QB5 A;  4LF4 T;  2EHO B;  5L4E A;  4MFR A;  2IDO B;  3N9O A;  1W09 A;  2RP4 A;  1HNZ T;  3FB2 A;  3KIN B;  2D2S A;  2FJA A;  4B3R T;  3ZMS B;  2WMO A;  3OTO T;  4EEB A;  5JRC A;  2QA7 A;  5HEG A;  3ZYL A;  5FVL A;  5LG4 A;  1WFD A;  5IWA T; 
#chains in the Genus database with same CATH homology
 4LF6 T;  3T1Y T;  2HHH T;  4JI4 T;  1XMQ T;  4DV5 T;  4DR4 T;  1XNR T;  4DR2 T;  4YY3 T;  1HNW T;  4X65 T;  4X66 T;  4AQY T;  4B3S T;  4DV3 T;  4X64 T;  4DV1 T;  2UXC T;  2UUB T;  1N34 T;  4JI5 T;  1J5E T;  4LF9 T;  4JI2 T;  4DR7 T;  4DR6 T;  4DUY T;  4DR5 T;  4JYA T;  1I94 T;  1FJG T;  4B3T T;  4YHH T;  4DV4 T;  4JI8 T;  1XNQ T;  1IBK T;  4LF7 T;  3T1H T;  4NXM T;  4GKK T;  4LFB T;  5LMN T;  2UUC T;  4JI3 T;  1HNX T;  4JI1 T;  4JV5 T;  4LF4 T;  4DR1 T;  4NXN T;  2UXB T;  1IBM T;  4B3M T;  1HNZ T;  5LMU T;  4DV7 T;  1HR0 T;  2UUA T;  4DV6 T;  4KHP T;  4OX9 T;  2UU9 T;  2VQE T;  4DV2 T;  4JI0 T;  4K0K T;  5BR8 T;  4B3R T;  1IBL T;  1N36 T;  3OTO T;  2ZM6 T;  4LFA T;  4LF8 T;  4DUZ T;  2F4V T;  4JI6 T;  2UXD T;  1N32 T;  4X62 T;  4JI7 T;  4GKJ T;  1N33 T;  4DR3 T;  4LF5 T;  1XMO T;  2VQF T;  4DV0 T;  4LFC T;  5IWA T;  2E5L T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...