1J5ET

Structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1j5eT00
4DR1T 4B3MT 4DV5T 4B3RT 4LFCT 4JI6T 2UXCT 4JI0T 4DR2T 4DV7T 4LF9T 4DV6T 1I94T 2HHHT 1HNZT 1IBLT 2UUCT 1XMOT 4B3TT 4LF6T 4B3ST 4JI7T 4GKKT 4DUZT 4DV4T 4AQYT 4NXNT 4DR5T 4JI4T 4DV1T 4DV2T 3T1HT 1IBMT 4YY3T 1HNWT 4GKJT 2UU9T 1N36T 4OX9T 4JV5T 4JI5T 4LF5T 4LF8T 4JI8T 1FJGT 5LMUT 1IBKT 1N34T 2ZM6T 4DR6T 2UUBT 1XNQT 5BR8T 4X65T 2UUAT 4LF4T 5LMNT 5IWAT 4X62T 1J5ET 1HR0T 4DR4T 1N32T 4NXMT 2VQFT 4JYAT 4KHPT 3T1YT 4X64T 4LF7T 2VQET 4JI2T 4LFBT 2E5LT 4DV3T 4K0KT 4JI3T 4DR3T 2UXDT 1N33T 2F4VT 4YHHT 4JI1T 2UXBT 3OTOT 1XMQT 4X66T 1XNRT 4LFAT 4DV0T 4DUYT 4DR7T 1HNXT
chains in the Genus database with same CATH superfamily
3AE2A 4EZ4A 3IEEA 2YK0A 4UV9B 3FZFB 4BA9A 1OWAA 3N5LA 3DJBA 3PUZF 1D0ZA 4PW8A 4J2CA 4AXPA 4PJLA 3IA3A 4JI0T 2WU5A 2V26A 2H7VC 4UVCB 2VURA 3RLFF 4CN6A 4DR2T 3QK6A 3LDQB 1I94T 1WFDA 2C0SA 4H9SE 2HHHT 4HE8A 2ACZA 4Q25A 5LG4A 5JDHA 3RIUA 3AE5A 1BR1A 4K0UA 5BMVE 3AA7B 4OYJA 4MALA 1WRDA 2WDVA 3HL6A 3VRAA 4ANJA 1MIWA 2CLYC 2XSBA 2KWIB 3ZLIA 2MYSA 3PURA 3LSVA 5FXVA 3RC3A 2JRKA 3C4ZA 2NW9A 4JI7T 3AE6A 1ZP0A 2LKGA 3Q5EA 4YSYA 4I0UA 1KFYA 1HS7A 3AVRA 3L09A 4E7SA 4P0AA 2BG9C 2W00A 1FMWA 1NEKA 2JMKA 3B5MA 3OBVE 2WWUA 4H9OC 1OEDC 5AQTB 3E08A 4IDQA 5L3BB 2K48A 2X0LB 3PV0F 2NR4A 4JEHB 3RKOA 1D1BA 1XDOA 4DR5T 4JI4T 3UUNA 4DV2T 2KZ7B 3NKZA 3NZPA 4PNIA 4U31A 2L3LA 1M7KA 2BS3A 2EHOB 3V5SA 3ETVA 1HNWT 2E5VA 2WY2A 5LOVE 3EABA 5JH7E 2CPTA 3FBLA 3NVOA 2W66A 3OJAA 5HXRA 2XM2A 1HG2A 3GMIA 3TKLB 2RA1A 4CN4A 4CXYA 2I6HA 3PUWF 4IL9A 2KINB 2YDSA 4IDPA 2MAWA 2P9BA 2WBLA 3LK3B 2L8KA 3ZMSB 4LF5T 2E9XA 3GN5A 4HFIA 3I1AA 3SFDA 1J1JA 3AXJA 4O8SA 4C90A 4EGWA 5L3DB 4TNWA 3KBTA 1YKEB 3PU3A 1IZNB 3ANWB 3ABVA 4HWIB 4TN7B 3F2EA 1GQEA 5HCJA 1EZ3A 4EB6E 3C64A 3K8PC 4JEUB 4YT0A 2G0UA 4GK5E 3ZYMA 1XNQT 2KXPB 2D9DA 5FKYA 4ZI2C 5FYMA 5LHIB 2QYWA 2CHOA 5AQVB 4IIJE 2LSGA 5JTGA 2Q9QD 2IW5B 4EOZB 3Q2MA 1FIOA 3ETUA 1J5ET 1FEWA 1HX8A 2V1DB 3UUBA 3SFEA 2JQHA 3MKDA 4DR4T 4H9NC 2XAQB 2YDQA 4P09A 2ZM0A 1KNRA 2V6YA 2MOZA 1BR4A 2QVAA 3F57A 3N9MA 3P4PA 3PUSA 1KEYA 2QA7A 4AQGA 4WBNE 2BZBA 4JYAT 3VRBA 5IUXA 2DHRA 2K5BB 4U3CA 3RYFE 5AQGB 2E8IA 1Z8UA 2VQET 2M6BA 3AE3A 3PE0A 1NAFA 3O4XE 4LF7T 3FZHB 3ZCJA 2JIWA 2LOPA 5EK2A 2Y6XA 2LKHA 3JCFA 2K24A 5C3JA 4CI1B 3MK7C 5ABFB 4UR9A 1UX4A 4QH4A 3ZYKA 5LYJE 2V5DA 2UXDT 3P4SA 2D2SA 1OEDA 2K9AA 4HN9A 3PJAA 4EXTA 5L3CB 3FZKB 4UELA 3RIFA 1SUMB 4CQIA 2WU2A 2UXBT 2W62A 1X9BA 4JBWF 3AECA 3N2GE 2X0HA 4X1YE 1XMQT 2SPCA 5KXJA 1XNRT 3OYXA 3NWIA 2JQ9A 4DV0T 4H63H 3S4UA 2Y8DA 4H9RC 2IUBA 5HEHA 4A97A 3LBXA 2HH7A 1D1AA 2VASA 4TX5A 5AQKB 3J9X1 3GWHA 5DQWA 1HNXT 2D0TA 5JDMA 4ZS2A 3B57A 3PU8A 2X66A 2QGSA 2W0GA 5LHGB 3RQWA 3TLWA 4F8HA 5CA1E 5LA6E 4JUYA 1LVKA 1W9RA 2X68A 4B3MT 2VL0A 3KBUA 4UXNB 2NW8A 4LFCT 2EHOC 4CI2B 2XAJB 2X9WA 3N9NA 3E22E 4FJOA 4ZXLA 2H7OA 2UXXB 2W63A 4AKRB 2X9YA 4GYSA 3PTRB 5LBQB 5L4EA 2DLRA 3RRCA 2CWOA 3FXEB 3GN5B 1SA0E 3RRWA 3H37A 2XQ3A 2WWVA 5DJQC 3VKGA 2FUPA 3ZN0B 4CN1A 2YU2A 4EV6A 4QXHB 3JC6C 4DBQA 4TV9E 4O2AE 3UU4A 5KX5E 2BS4A 3JAFA 4PK5A 2CM0A 5KDMC 4IE5A 4ADZA 3CX7B 5GONE 4KI0F 4B3ST 3UU5A 2V5CA 3RGLA 2A9UA 4PJMA 4U2ZA 1YXRA 4U2YA 4UVBB 2WP9A 2Q9QB 4UF0A 4DVDA 3ZMZB 3KV9A 4DUZT 4IL4A 3RIUC 1S94A 5J0ZA 3NBXX 1T8BA 1YQ4A 2A2FX 2BG9E 2V6YB 2V7MA 3E0ZA 1D1CA 5EK3A 4DV4T 2FJAA 2GK9A 2YKSA 4NXNT 2BVMA 2BKPA 1R8IA 4HWHA 5LGNB 2H89A 3TLSA 1W09A 2WDQA 4ZS3A 3TLVA 4ZEYA 2CWYA 4XAXB 2OV9A 3RIAA 1BR0A 2J47A 3CPZA 1YQ3A 3HKDE 3PUQA 1BR2A 1SE7A 2FJEA 1VCSA 2WZHA 1MMDA 1Y01A 2DCFA 2V7IA 3GA8A 3FBZA 3O1IA 1Y64B 4YFSA 1G73A 4GKJT 3ZT6A 4TZ4C 3VR8A 3OVUA 4QH1A 4TWFA 3IBPA 4AKLA 5L3GB 2H3RA 4NUVA 3KVAA 3HKBE 4MBQA 4X1KE 3PDYA 3NRYA 4CXXA 3KDSE 4L0RA 4YSXA 1VCTA 4LF8T 4AKHA 4JI8T 3N9QA 4IHJE 3AAEB 2RP4A 4B6XA 1UURA 4TNVA 3ZSTA 4O4IE 4ZZBA 2VVSA 3C50A 1YW0A 2M67A 5AQRB 4DR6T 2FBWA 2VKDA 4PFOA 5L3FB 1LKXA 3FHNA 2NWBA 5AQNB 2UUBT 1AJ3A 2LSIA 1ZHCA 1H7CA 2D0UA 2DI4A 4HTEA 4NPPA 5JR9B 2UUAT 2CA5A 4DMWA 5IHYA 2WM9A 5LMNT 5DABA 5AQMB 3UU3A 4CZZB 1W0BA 5JDGA 1N32T 4YTPA 4CI3B 3ZEFB 2IIUA 5AQFB 3AE7A 1XDPA 4DIDB 3T1YT 3ESLA 3RH3A 2XQ6A 3CMLA 3RX6A 4X64T 3O9XA 2BG9A 3MJXA 4HFEA 1HG5A 4GIWA 4XBFB 4HGAA 3ZN1B 3LG7A 4HWDA 2K3WA 3O1HA 4H9QC 4QH5A 4A56A 4LMJA 2VKOA 1VOMA 2XQ5A 3PUVF 2V6XA 4JI3T 4KBMB 2VWAA 2X67A 3WAKA 4EZHA 4IE0A 2VVNA 2B76A 5FY1A 1ZV4X 1XWMA 3AAIA 1DU2A 2ZM2A 1IJ5A 2Q9QA 3KVBA 4QKNA 3CQGB 2W4XA 1V9DA 2XAFB 3PUXF 2WCAA 2X51A 3NRXA 4XZCA 4C91A 5ABGA 4LFAT 2V7LA 1QSDA 2J1DG 2RPAA 4KHZF 4QX8B 5L4HA 5JQGE 5LXTE 4IDZA 4OHFA 2X0YA 1HTJF 2W61A 3VHLA 2OA5A 4QHOA 1QLBA 2C5KT 2FJBA 3CX8B 3I9WA 2MBGA 5HWYA 3I0QA 3UQ4A 3DP7A 3ONJA 3HR0A 4HFCA 3TLUA 2E9XB 4YHJA 1M62A 3CVRA 4IREA 3I9YA 5JDLA 1XMOT 4JI6T 5JDNA 2VKHA 1Z0PA 3JAEA 4YXDA 2Q9QC 3AE1A 2BVLA 1U4QA 2XZEA 3ANWA 3FXDB 3MXZA 3V5UA 4AQFA 5HXSA 3G06A 1W0AA 2DWGA 4L9IA 3T8OA 1T72A 1SHZC 2IC9A 3AEEA 4WYVA 2C5IT 4PFPA 5LBMA 3UUMA 3UU8A 4BAYB 5HYAA 2C5JA 4DV6T 5ABEA 4P1NA 4TWHA 1HX1B 4OYKA 1WLXA 2NP9A 3ZKRA 2VB6A 3ZYLA 2CMRA 3EDVA 4ILCA 2JQQA 3JADA 5LG3A 4WW0A 4TV8E 2IC6A 2CBIA 1IBLT 4EEBA 1WR0A 4IGUA 2UUCT 2LSKA 2CRBA 2IMLA 3BQIA 1LVFA 3LK42 5JR9A 2Y48B 2V7KA 1O3XA 1ZOYA 3HA4A 1E1HB 4O4HE 4LF6T 4CXWA 3FZLB 4KUMB 2LRLA 2MTQA 4TUYE 1ZEEA 5DQVA 4YJ3E 1X79A 2XQ9A 3HI2A 5JRCB 5CJ5A 5AQPB 2VKJA 1I6ZA 2YOEA 5IWAT 1T7SA 2L9QA 3W15B 4AQYT 3RYIE 3ZPOA 5C8YE 2BDEA 4ZI2D 2PTFA 2J4GA 3AE9A 4ILAA 4YTNA 5JR9C 1OEDB 3P4WA 3WI3A 4AKGA 4ISTA 5L2LA 1OXZA 3EUHA 5CB4E 1UK5A 3UT5E 5ABHA 5J2TE 3N2KE 2DL1A 5TAOA 1KK7A 2W2UA 2E9XD 5J1GA 2XASB 2B1EA 2X9HA 4P0BA 3T1HT 4YJ2E 1IBMT 3KV6A 2XPKA 4NIQA 5AQJB 5FXWA 3R84B 3ZJ2A 1LRZA 3U3IA 3D0TA 4G63A 5FY0A 3KV4A 3RQUA 2ZMAA 3C4WA 2BS2A 4HWCA 3CX6B 2UU9T 5AQLB 4OX9T 4JV5T 3H3MA 1HFAA 4X20E 1IAPA 2HN1A 4KMCA 4JI5T 4A98A 3QNUA 5J2UE 2WZIA 4ZI3D 2BKNA 4EYYR 1FJGT 4WZXA 3JC6D 4QX7B 1J5WA 3J7Yq 5LMUT 1WCRA 1IBKT 5F5WA 5H6RB 2AE9A 5IYZE 4Z90A 4U72A 3SS1A 3EHZA 3AE8A 4IE4A 4UV8B 3R6NA 5FL1A 2ZM6T 3K1SA 3P4RA 4WBOA 3CQCB 2KWHA 1MMAA 2XTLA 2KSRA 1NWMX 2CXFA 4IE6A 3C4XA 3PUYF 3A7MA 2V7JA 3QC9A 2LOSA 4NUUA 5M4YA 5HEUA 4GOUA 2PBIA 5L3EB 2BBHA 4MHCA 4PJJA 4NXMT 4PAGA 5C2TA 4MLKA 2VQFT 2ES0A 4EEDA 3AEGA 4Z91A 1YKHB 4AKIA 5EK4A 4MFRA 2CXDA 2VK9A 3C98B 2WB5A 3B13A 3CKDA 5FNVE 3AE4A 4EAHA 2OLTA 5HEGA 5F3JA 2CLYB 2PJQA 3X1DA 2WSSV 2ODVA 2I0MA 2XAHB 3ZT7A 4COFA 3WAJA 3UULA 3FZMB 2JMHA 1MIVA 3UTKA 5HXHA 4DV3T 5FL0A 3UFGA 3M65A 2E9XC 1N33T 5LGTB 2WMOA 4YHHT 5FP3A 2ACXA 2XHEB 3RYHE 2NTXA 2R6GF 2LSJA 3N9LA 4OK0A 2LHRA 5FY7A 2XUEA 3A8YC 3A5XA 2HPLA 3ZSSA 2ZM8A 4EIWA 3I0OA 3KINB 1T98A 1E2AA 1JNZA 4F6RC 4U7IA 3ZMVB 4AISA 3ZC1A 3U78A 4HEAA 2WS3A 5AQSB 3AVSA 3OKQA 4HWFA 4DUYT 3ZC0A 4AI6A 1QUUA 3Q5DA 2E2AA 4KP3C 3QUJA 1UGOA 4HFVA 1KNZA 3BQKA 2CXLA 3Q9DA 4UEMA 5HEJA 1G8XA 4L5GA 2IAKA 3QB5K 4BJMA 4DBRA 1WYCA 2I59A 2QRXA 2CEAA 3TLTA 4DR1T 2NOXA 4A5XA 1MIYA 2H88A 4DV5T 3KFWX 3RPUA 3M3ZB 4B3RT 1NENA 1WYBA 3AAAB 4HFHA 2UXCT 2M6IA 4ZI7E 2LT3A 4QWNB 1KNPA 2DWKA 3L39A 1S35A 3F31A 3ZJ1A 5ADXL 2EHOD 3P4QA 5HWXA 3LFMA 2XAGB 5JDQA 5H6QB 2XY8B 2KT9A 1MNDA 1U5PA 3L8RA 4DV7T 5F8PA 4LF9T 1WR6A 5HXEA 2PFVA 4IDOA 4DNDA 5CFBA 3CQXC 4I4TE 2Z6EA 3NZQA 1CHUA 1B7TA 4UF0B 2XQ7A 2KNDA 5HXCA 5JVDE 1HNZT 4U33A 3Q5XA 5LJMA 1UUSA 4ISSA 1US7B 2BKOA 2DNXA 4M1PA 3UU6A 4E7ZA 4ZZCA 4I55E 4OFZA 4B3TT 4DO0A 2IDOB 5HEOA 3ZT5A 2A3DA 3N9OA 5KMGP 3ONXA 2LLYA 5LNKA 4G2AA 4O4JE 4ILBA 4DMVA 3H3AA 3AEBA 2D5UA 4YTMA 3P8CD 2YINA 4PK6A 4GKKT 4O2BE 5AQHB 2LRKA 5A1LA 2XSAA 3MACA 3SWHA 4ZHQE 2LSYA 2BBJA 5AQUB 3K3OA 3BQLA 5HAXA 3PJAJ 3CIRA 3RC8A 4N78D 2JQKA 4ILUA 5LCYA 5LJNA 4IT4A 4DV1T 2V8SV 3N2OA 2PG8A 4V1Av 2XJ7A 4X5TA 3VR9A 2WAUA 3BK9A 3MA9A 4O4LE 2HPJA 1KF6A 2YN6A 4LMLA 4QXCB 5JDFA 3UUXB 3UQ7A 3C51A 1E7PA 2CHNA 3LBXB 3RI5A 3ZCIA 4YY3T 3RKGA 2AXDS 3ONLC 1N36T 4YSZA 2ODUA 3N9PA 3ZMTB 2JJ9A 4HFBA 4AQFC 3OYZA 4WNKA 4EYUA 5AQIB 4PK4A 3EDUA 3K3NA 3CK6A 5FVLA 3PUAA 3Q5WA 5HCMA 4I50E 3P7IA 3RYCE 1IJ6A 3IHRA 2XQ4A 1VRBA 3AEAA 4FI5A 4ZOLE 2LE8A 4U7YA 2XQYA 5FMNA 4GK0E 4BJNA 1N34T 2YEVC 1HF8A 1ZKEA 3ZMUB 5BR8T 1D0YA 1UCUA 2LEHA 3QB5A 3VU7H 4X65T 4LF4T 3AB3B 3SOLA 4UVAB 1XZYA 2CE7A 2XM1A 2IHR1 3HKEE 3LJCA 3P50A 4HKAA 1D0XA 2W67A 3AA1B 3KV5A 3LK2B 4LMKA 3O1JA 4X62T 5AQQB 1HR0T 3EAMA 2WMNA 4ASKA 1JNRA 3SRZA 4KX6A 2KLQA 1MNEA 3OPCA 2CCQA 3PUGA 5AFUL 2XQ8A 3EI0A 2KMFA 5E0OA 5JREA 4HFDA 2A72A 2NTYA 2LM9A 4KHPT 2NW7A 3EVYA 1OEDE 5FVKA 5CGMA 2J62A 2LM2A 2N1GA 2VL8A 4ERRA 2LHNA 4H63V 4JLEA 5JRCA 4JI2T 4QXBB 4I43B 4Z8XA 3AEDA 3HKCE 3QOFA 2XQAA 2HN2A 2JPFA 2EHOA 5FXZA 2E5LT 5ABFA 1UX5A 4LFBT 1FMVA 3DTOA 4K0KT 4DR3T 2N2NA 2N9DA 5ETWA 4UIGA 4IDNA 4GYRA 5AQOB 1MMGA 2F4VT 3RF1A 2LJLA 3IF8B 4JI1T 3CWZB 2UXNB 3OTOT 1MMNA 3VKHA 2BG9B 5CA0E 3RHWA 1CUNA 4YLHA 1L0VA 4U74A 2FJDA 3AA0B 4X66T 1YD8G 5LGUB 3AXJB 2WQYA 2YDRA 5FXXA 3FB2A 4IE7A 4PJNA 1HCIA 4X1IE 4AIUA 2ZLYA 5EZYE 4ZI3C 3AA6B 5L47A 4H9PC 3K3QC 4DR7T 2X9XA 2YU1A 3L3PA 5LHHB 2CBJA 3MZKB 4TWDA 3AEFA 2MPKA 5LB7B 2WDRA 5LP6E 3UFEA
chains in the Genus database with same CATH topology
4DR1T 4B3MT 4DV5T 4B3RT 4LFCT 4JI6T 2UXCT 4JI0T 4DR2T 4DV7T 4LF9T 4DV6T 1I94T 2HHHT 1HNZT 1IBLT 2UUCT 1XMOT 4B3TT 4LF6T 4B3ST 4JI7T 4GKKT 4DUZT 4DV4T 4AQYT 4NXNT 4DR5T 4JI4T 4DV1T 4DV2T 3T1HT 1IBMT 4YY3T 1HNWT 4GKJT 2UU9T 1N36T 4OX9T 4JV5T 4JI5T 4LF5T 4LF8T 4JI8T 1FJGT 5LMUT 1IBKT 1N34T 2ZM6T 4DR6T 2UUBT 1XNQT 5BR8T 4X65T 2UUAT 4LF4T 5LMNT 5IWAT 4X62T 1J5ET 1HR0T 4DR4T 1N32T 4NXMT 2VQFT 4JYAT 4KHPT 3T1YT 4X64T 4LF7T 2VQET 4JI2T 4LFBT 2E5LT 4DV3T 4K0KT 4JI3T 4DR3T 2UXDT 1N33T 2F4VT 4YHHT 4JI1T 2UXBT 3OTOT 1XMQT 4X66T 1XNRT 4LFAT 4DV0T 4DUYT 4DR7T 1HNXT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 T;  4B3M T;  4DV5 T;  4B3R T;  4LFC T;  4JI6 T;  2UXC T;  4JI0 T;  4DR2 T;  4DV7 T;  4LF9 T;  4DV6 T;  1I94 T;  2HHH T;  1HNZ T;  1IBL T;  2UUC T;  1XMO T;  4B3T T;  4LF6 T;  4B3S T;  4JI7 T;  4GKK T;  4DUZ T;  4DV4 T;  4AQY T;  4NXN T;  4DR5 T;  4JI4 T;  4DV1 T;  4DV2 T;  3T1H T;  1IBM T;  4YY3 T;  1HNW T;  4GKJ T;  2UU9 T;  1N36 T;  4OX9 T;  4JV5 T;  4JI5 T;  4LF5 T;  4LF8 T;  4JI8 T;  1FJG T;  5LMU T;  1IBK T;  1N34 T;  2ZM6 T;  4DR6 T;  2UUB T;  1XNQ T;  5BR8 T;  4X65 T;  2UUA T;  4LF4 T;  5LMN T;  5IWA T;  4X62 T;  1J5E T;  1HR0 T;  4DR4 T;  1N32 T;  4NXM T;  2VQF T;  4JYA T;  4KHP T;  3T1Y T;  4X64 T;  4LF7 T;  2VQE T;  4JI2 T;  4LFB T;  2E5L T;  4DV3 T;  4K0K T;  4JI3 T;  4DR3 T;  2UXD T;  1N33 T;  2F4V T;  4YHH T;  4JI1 T;  2UXB T;  3OTO T;  1XMQ T;  4X66 T;  1XNR T;  4LFA T;  4DV0 T;  4DUY T;  4DR7 T;  1HNX T; 
#chains in the Genus database with same CATH topology
 3AE2 A;  4EZ4 A;  3IEE A;  2YK0 A;  4UV9 B;  3FZF B;  4BA9 A;  1OWA A;  3N5L A;  3DJB A;  3PUZ F;  1D0Z A;  4PW8 A;  4J2C A;  4AXP A;  4PJL A;  3IA3 A;  4JI0 T;  2WU5 A;  2V26 A;  2H7V C;  4UVC B;  2VUR A;  3RLF F;  4CN6 A;  4DR2 T;  3QK6 A;  3LDQ B;  1I94 T;  1WFD A;  2C0S A;  4H9S E;  2HHH T;  4HE8 A;  2ACZ A;  4Q25 A;  5LG4 A;  5JDH A;  3RIU A;  3AE5 A;  1BR1 A;  4K0U A;  5BMV E;  3AA7 B;  4OYJ A;  4MAL A;  1WRD A;  2WDV A;  3HL6 A;  3VRA A;  4ANJ A;  1MIW A;  2CLY C;  2XSB A;  2KWI B;  3ZLI A;  2MYS A;  3PUR A;  3LSV A;  5FXV A;  3RC3 A;  2JRK A;  3C4Z A;  2NW9 A;  4JI7 T;  3AE6 A;  1ZP0 A;  2LKG A;  3Q5E A;  4YSY A;  4I0U A;  1KFY A;  1HS7 A;  3AVR A;  3L09 A;  4E7S A;  4P0A A;  2BG9 C;  2W00 A;  1FMW A;  1NEK A;  2JMK A;  3B5M A;  3OBV E;  2WWU A;  4H9O C;  1OED C;  5AQT B;  3E08 A;  4IDQ A;  5L3B B;  2K48 A;  2X0L B;  3PV0 F;  2NR4 A;  4JEH B;  3RKO A;  1D1B A;  1XDO A;  4DR5 T;  4JI4 T;  3UUN A;  4DV2 T;  2KZ7 B;  3NKZ A;  3NZP A;  4PNI A;  4U31 A;  2L3L A;  1M7K A;  2BS3 A;  2EHO B;  3V5S A;  3ETV A;  1HNW T;  2E5V A;  2WY2 A;  5LOV E;  3EAB A;  5JH7 E;  2CPT A;  3FBL A;  3NVO A;  2W66 A;  3OJA A;  5HXR A;  2XM2 A;  1HG2 A;  3GMI A;  3TKL B;  2RA1 A;  4CN4 A;  4CXY A;  2I6H A;  3PUW F;  4IL9 A;  2KIN B;  2YDS A;  4IDP A;  2MAW A;  2P9B A;  2WBL A;  3LK3 B;  2L8K A;  3ZMS B;  4LF5 T;  2E9X A;  3GN5 A;  4HFI A;  3I1A A;  3SFD A;  1J1J A;  3AXJ A;  4O8S A;  4C90 A;  4EGW A;  5L3D B;  4TNW A;  3KBT A;  1YKE B;  3PU3 A;  1IZN B;  3ANW B;  3ABV A;  4HWI B;  4TN7 B;  3F2E A;  1GQE A;  5HCJ A;  1EZ3 A;  4EB6 E;  3C64 A;  3K8P C;  4JEU B;  4YT0 A;  2G0U A;  4GK5 E;  3ZYM A;  1XNQ T;  2KXP B;  2D9D A;  5FKY A;  4ZI2 C;  5FYM A;  5LHI B;  2QYW A;  2CHO A;  5AQV B;  4IIJ E;  2LSG A;  5JTG A;  2Q9Q D;  2IW5 B;  4EOZ B;  3Q2M A;  1FIO A;  3ETU A;  1J5E T;  1FEW A;  1HX8 A;  2V1D B;  3UUB A;  3SFE A;  2JQH A;  3MKD A;  4DR4 T;  4H9N C;  2XAQ B;  2YDQ A;  4P09 A;  2ZM0 A;  1KNR A;  2V6Y A;  2MOZ A;  1BR4 A;  2QVA A;  3F57 A;  3N9M A;  3P4P A;  3PUS A;  1KEY A;  2QA7 A;  4AQG A;  4WBN E;  2BZB A;  4JYA T;  3VRB A;  5IUX A;  2DHR A;  2K5B B;  4U3C A;  3RYF E;  5AQG B;  2E8I A;  1Z8U A;  2VQE T;  2M6B A;  3AE3 A;  3PE0 A;  1NAF A;  3O4X E;  4LF7 T;  3FZH B;  3ZCJ A;  2JIW A;  2LOP A;  5EK2 A;  2Y6X A;  2LKH A;  3JCF A;  2K24 A;  5C3J A;  4CI1 B;  3MK7 C;  5ABF B;  4UR9 A;  1UX4 A;  4QH4 A;  3ZYK A;  5LYJ E;  2V5D A;  2UXD T;  3P4S A;  2D2S A;  1OED A;  2K9A A;  4HN9 A;  3PJA A;  4EXT A;  5L3C B;  3FZK B;  4UEL A;  3RIF A;  1SUM B;  4CQI A;  2WU2 A;  2UXB T;  2W62 A;  1X9B A;  4JBW F;  3AEC A;  3N2G E;  2X0H A;  4X1Y E;  1XMQ T;  2SPC A;  5KXJ A;  1XNR T;  3OYX A;  3NWI A;  2JQ9 A;  4DV0 T;  4H63 H;  3S4U A;  2Y8D A;  4H9R C;  2IUB A;  5HEH A;  4A97 A;  3LBX A;  2HH7 A;  1D1A A;  2VAS A;  4TX5 A;  5AQK B;  3J9X 1;  3GWH A;  5DQW A;  1HNX T;  2D0T A;  5JDM A;  4ZS2 A;  3B57 A;  3PU8 A;  2X66 A;  2QGS A;  2W0G A;  5LHG B;  3RQW A;  3TLW A;  4F8H A;  5CA1 E;  5LA6 E;  4JUY A;  1LVK A;  1W9R A;  2X68 A;  4B3M T;  2VL0 A;  3KBU A;  4UXN B;  2NW8 A;  4LFC T;  2EHO C;  4CI2 B;  2XAJ B;  2X9W A;  3N9N A;  3E22 E;  4FJO A;  4ZXL A;  2H7O A;  2UXX B;  2W63 A;  4AKR B;  2X9Y A;  4GYS A;  3PTR B;  5LBQ B;  5L4E A;  2DLR A;  3RRC A;  2CWO A;  3FXE B;  3GN5 B;  1SA0 E;  3RRW A;  3H37 A;  2XQ3 A;  2WWV A;  5DJQ C;  3VKG A;  2FUP A;  3ZN0 B;  4CN1 A;  2YU2 A;  4EV6 A;  4QXH B;  3JC6 C;  4DBQ A;  4TV9 E;  4O2A E;  3UU4 A;  5KX5 E;  2BS4 A;  3JAF A;  4PK5 A;  2CM0 A;  5KDM C;  4IE5 A;  4ADZ A;  3CX7 B;  5GON E;  4KI0 F;  4B3S T;  3UU5 A;  2V5C A;  3RGL A;  2A9U A;  4PJM A;  4U2Z A;  1YXR A;  4U2Y A;  4UVB B;  2WP9 A;  2Q9Q B;  4UF0 A;  4DVD A;  3ZMZ B;  3KV9 A;  4DUZ T;  4IL4 A;  3RIU C;  1S94 A;  5J0Z A;  3NBX X;  1T8B A;  1YQ4 A;  2A2F X;  2BG9 E;  2V6Y B;  2V7M A;  3E0Z A;  1D1C A;  5EK3 A;  4DV4 T;  2FJA A;  2GK9 A;  2YKS A;  4NXN T;  2BVM A;  2BKP A;  1R8I A;  4HWH A;  5LGN B;  2H89 A;  3TLS A;  1W09 A;  2WDQ A;  4ZS3 A;  3TLV A;  4ZEY A;  2CWY A;  4XAX B;  2OV9 A;  3RIA A;  1BR0 A;  2J47 A;  3CPZ A;  1YQ3 A;  3HKD E;  3PUQ A;  1BR2 A;  1SE7 A;  2FJE A;  1VCS A;  2WZH A;  1MMD A;  1Y01 A;  2DCF A;  2V7I A;  3GA8 A;  3FBZ A;  3O1I A;  1Y64 B;  4YFS A;  1G73 A;  4GKJ T;  3ZT6 A;  4TZ4 C;  3VR8 A;  3OVU A;  4QH1 A;  4TWF A;  3IBP A;  4AKL A;  5L3G B;  2H3R A;  4NUV A;  3KVA A;  3HKB E;  4MBQ A;  4X1K E;  3PDY A;  3NRY A;  4CXX A;  3KDS E;  4L0R A;  4YSX A;  1VCT A;  4LF8 T;  4AKH A;  4JI8 T;  3N9Q A;  4IHJ E;  3AAE B;  2RP4 A;  4B6X A;  1UUR A;  4TNV A;  3ZST A;  4O4I E;  4ZZB A;  2VVS A;  3C50 A;  1YW0 A;  2M67 A;  5AQR B;  4DR6 T;  2FBW A;  2VKD A;  4PFO A;  5L3F B;  1LKX A;  3FHN A;  2NWB A;  5AQN B;  2UUB T;  1AJ3 A;  2LSI A;  1ZHC A;  1H7C A;  2D0U A;  2DI4 A;  4HTE A;  4NPP A;  5JR9 B;  2UUA T;  2CA5 A;  4DMW A;  5IHY A;  2WM9 A;  5LMN T;  5DAB A;  5AQM B;  3UU3 A;  4CZZ B;  1W0B A;  5JDG A;  1N32 T;  4YTP A;  4CI3 B;  3ZEF B;  2IIU A;  5AQF B;  3AE7 A;  1XDP A;  4DID B;  3T1Y T;  3ESL A;  3RH3 A;  2XQ6 A;  3CML A;  3RX6 A;  4X64 T;  3O9X A;  2BG9 A;  3MJX A;  4HFE A;  1HG5 A;  4GIW A;  4XBF B;  4HGA A;  3ZN1 B;  3LG7 A;  4HWD A;  2K3W A;  3O1H A;  4H9Q C;  4QH5 A;  4A56 A;  4LMJ A;  2VKO A;  1VOM A;  2XQ5 A;  3PUV F;  2V6X A;  4JI3 T;  4KBM B;  2VWA A;  2X67 A;  3WAK A;  4EZH A;  4IE0 A;  2VVN A;  2B76 A;  5FY1 A;  1ZV4 X;  1XWM A;  3AAI A;  1DU2 A;  2ZM2 A;  1IJ5 A;  2Q9Q A;  3KVB A;  4QKN A;  3CQG B;  2W4X A;  1V9D A;  2XAF B;  3PUX F;  2WCA A;  2X51 A;  3NRX A;  4XZC A;  4C91 A;  5ABG A;  4LFA T;  2V7L A;  1QSD A;  2J1D G;  2RPA A;  4KHZ F;  4QX8 B;  5L4H A;  5JQG E;  5LXT E;  4IDZ A;  4OHF A;  2X0Y A;  1HTJ F;  2W61 A;  3VHL A;  2OA5 A;  4QHO A;  1QLB A;  2C5K T;  2FJB A;  3CX8 B;  3I9W A;  2MBG A;  5HWY A;  3I0Q A;  3UQ4 A;  3DP7 A;  3ONJ A;  3HR0 A;  4HFC A;  3TLU A;  2E9X B;  4YHJ A;  1M62 A;  3CVR A;  4IRE A;  3I9Y A;  5JDL A;  1XMO T;  4JI6 T;  5JDN A;  2VKH A;  1Z0P A;  3JAE A;  4YXD A;  2Q9Q C;  3AE1 A;  2BVL A;  1U4Q A;  2XZE A;  3ANW A;  3FXD B;  3MXZ A;  3V5U A;  4AQF A;  5HXS A;  3G06 A;  1W0A A;  2DWG A;  4L9I A;  3T8O A;  1T72 A;  1SHZ C;  2IC9 A;  3AEE A;  4WYV A;  2C5I T;  4PFP A;  5LBM A;  3UUM A;  3UU8 A;  4BAY B;  5HYA A;  2C5J A;  4DV6 T;  5ABE A;  4P1N A;  4TWH A;  1HX1 B;  4OYK A;  1WLX A;  2NP9 A;  3ZKR A;  2VB6 A;  3ZYL A;  2CMR A;  3EDV A;  4ILC A;  2JQQ A;  3JAD A;  5LG3 A;  4WW0 A;  4TV8 E;  2IC6 A;  2CBI A;  1IBL T;  4EEB A;  1WR0 A;  4IGU A;  2UUC T;  2LSK A;  2CRB A;  2IML A;  3BQI A;  1LVF A;  3LK4 2;  5JR9 A;  2Y48 B;  2V7K A;  1O3X A;  1ZOY A;  3HA4 A;  1E1H B;  4O4H E;  4LF6 T;  4CXW A;  3FZL B;  4KUM B;  2LRL A;  2MTQ A;  4TUY E;  1ZEE A;  5DQV A;  4YJ3 E;  1X79 A;  2XQ9 A;  3HI2 A;  5JRC B;  5CJ5 A;  5AQP B;  2VKJ A;  1I6Z A;  2YOE A;  5IWA T;  1T7S A;  2L9Q A;  3W15 B;  4AQY T;  3RYI E;  3ZPO A;  5C8Y E;  2BDE A;  4ZI2 D;  2PTF A;  2J4G A;  3AE9 A;  4ILA A;  4YTN A;  5JR9 C;  1OED B;  3P4W A;  3WI3 A;  4AKG A;  4IST A;  5L2L A;  1OXZ A;  3EUH A;  5CB4 E;  1UK5 A;  3UT5 E;  5ABH A;  5J2T E;  3N2K E;  2DL1 A;  5TAO A;  1KK7 A;  2W2U A;  2E9X D;  5J1G A;  2XAS B;  2B1E A;  2X9H A;  4P0B A;  3T1H T;  4YJ2 E;  1IBM T;  3KV6 A;  2XPK A;  4NIQ A;  5AQJ B;  5FXW A;  3R84 B;  3ZJ2 A;  1LRZ A;  3U3I A;  3D0T A;  4G63 A;  5FY0 A;  3KV4 A;  3RQU A;  2ZMA A;  3C4W A;  2BS2 A;  4HWC A;  3CX6 B;  2UU9 T;  5AQL B;  4OX9 T;  4JV5 T;  3H3M A;  1HFA A;  4X20 E;  1IAP A;  2HN1 A;  4KMC A;  4JI5 T;  4A98 A;  3QNU A;  5J2U E;  2WZI A;  4ZI3 D;  2BKN A;  4EYY R;  1FJG T;  4WZX A;  3JC6 D;  4QX7 B;  1J5W A;  3J7Y q;  5LMU T;  1WCR A;  1IBK T;  5F5W A;  5H6R B;  2AE9 A;  5IYZ E;  4Z90 A;  4U72 A;  3SS1 A;  3EHZ A;  3AE8 A;  4IE4 A;  4UV8 B;  3R6N A;  5FL1 A;  2ZM6 T;  3K1S A;  3P4R A;  4WBO A;  3CQC B;  2KWH A;  1MMA A;  2XTL A;  2KSR A;  1NWM X;  2CXF A;  4IE6 A;  3C4X A;  3PUY F;  3A7M A;  2V7J A;  3QC9 A;  2LOS A;  4NUU A;  5M4Y A;  5HEU A;  4GOU A;  2PBI A;  5L3E B;  2BBH A;  4MHC A;  4PJJ A;  4NXM T;  4PAG A;  5C2T A;  4MLK A;  2VQF T;  2ES0 A;  4EED A;  3AEG A;  4Z91 A;  1YKH B;  4AKI A;  5EK4 A;  4MFR A;  2CXD A;  2VK9 A;  3C98 B;  2WB5 A;  3B13 A;  3CKD A;  5FNV E;  3AE4 A;  4EAH A;  2OLT A;  5HEG A;  5F3J A;  2CLY B;  2PJQ A;  3X1D A;  2WSS V;  2ODV A;  2I0M A;  2XAH B;  3ZT7 A;  4COF A;  3WAJ A;  3UUL A;  3FZM B;  2JMH A;  1MIV A;  3UTK A;  5HXH A;  4DV3 T;  5FL0 A;  3UFG A;  3M65 A;  2E9X C;  1N33 T;  5LGT B;  2WMO A;  4YHH T;  5FP3 A;  2ACX A;  2XHE B;  3RYH E;  2NTX A;  2R6G F;  2LSJ A;  3N9L A;  4OK0 A;  2LHR A;  5FY7 A;  2XUE A;  3A8Y C;  3A5X A;  2HPL A;  3ZSS A;  2ZM8 A;  4EIW A;  3I0O A;  3KIN B;  1T98 A;  1E2A A;  1JNZ A;  4F6R C;  4U7I A;  3ZMV B;  4AIS A;  3ZC1 A;  3U78 A;  4HEA A;  2WS3 A;  5AQS B;  3AVS A;  3OKQ A;  4HWF A;  4DUY T;  3ZC0 A;  4AI6 A;  1QUU A;  3Q5D A;  2E2A A;  4KP3 C;  3QUJ A;  1UGO A;  4HFV A;  1KNZ A;  3BQK A;  2CXL A;  3Q9D A;  4UEM A;  5HEJ A;  1G8X A;  4L5G A;  2IAK A;  3QB5 K;  4BJM A;  4DBR A;  1WYC A;  2I59 A;  2QRX A;  2CEA A;  3TLT A;  4DR1 T;  2NOX A;  4A5X A;  1MIY A;  2H88 A;  4DV5 T;  3KFW X;  3RPU A;  3M3Z B;  4B3R T;  1NEN A;  1WYB A;  3AAA B;  4HFH A;  2UXC T;  2M6I A;  4ZI7 E;  2LT3 A;  4QWN B;  1KNP A;  2DWK A;  3L39 A;  1S35 A;  3F31 A;  3ZJ1 A;  5ADX L;  2EHO D;  3P4Q A;  5HWX A;  3LFM A;  2XAG B;  5JDQ A;  5H6Q B;  2XY8 B;  2KT9 A;  1MND A;  1U5P A;  3L8R A;  4DV7 T;  5F8P A;  4LF9 T;  1WR6 A;  5HXE A;  2PFV A;  4IDO A;  4DND A;  5CFB A;  3CQX C;  4I4T E;  2Z6E A;  3NZQ A;  1CHU A;  1B7T A;  4UF0 B;  2XQ7 A;  2KND A;  5HXC A;  5JVD E;  1HNZ T;  4U33 A;  3Q5X A;  5LJM A;  1UUS A;  4ISS A;  1US7 B;  2BKO A;  2DNX A;  4M1P A;  3UU6 A;  4E7Z A;  4ZZC A;  4I55 E;  4OFZ A;  4B3T T;  4DO0 A;  2IDO B;  5HEO A;  3ZT5 A;  2A3D A;  3N9O A;  5KMG P;  3ONX A;  2LLY A;  5LNK A;  4G2A A;  4O4J E;  4ILB A;  4DMV A;  3H3A A;  3AEB A;  2D5U A;  4YTM A;  3P8C D;  2YIN A;  4PK6 A;  4GKK T;  4O2B E;  5AQH B;  2LRK A;  5A1L A;  2XSA A;  3MAC A;  3SWH A;  4ZHQ E;  2LSY A;  2BBJ A;  5AQU B;  3K3O A;  3BQL A;  5HAX A;  3PJA J;  3CIR A;  3RC8 A;  4N78 D;  2JQK A;  4ILU A;  5LCY A;  5LJN A;  4IT4 A;  4DV1 T;  2V8S V;  3N2O A;  2PG8 A;  4V1A v;  2XJ7 A;  4X5T A;  3VR9 A;  2WAU A;  3BK9 A;  3MA9 A;  4O4L E;  2HPJ A;  1KF6 A;  2YN6 A;  4LML A;  4QXC B;  5JDF A;  3UUX B;  3UQ7 A;  3C51 A;  1E7P A;  2CHN A;  3LBX B;  3RI5 A;  3ZCI A;  4YY3 T;  3RKG A;  2AXD S;  3ONL C;  1N36 T;  4YSZ A;  2ODU A;  3N9P A;  3ZMT B;  2JJ9 A;  4HFB A;  4AQF C;  3OYZ A;  4WNK A;  4EYU A;  5AQI B;  4PK4 A;  3EDU A;  3K3N A;  3CK6 A;  5FVL A;  3PUA A;  3Q5W A;  5HCM A;  4I50 E;  3P7I A;  3RYC E;  1IJ6 A;  3IHR A;  2XQ4 A;  1VRB A;  3AEA A;  4FI5 A;  4ZOL E;  2LE8 A;  4U7Y A;  2XQY A;  5FMN A;  4GK0 E;  4BJN A;  1N34 T;  2YEV C;  1HF8 A;  1ZKE A;  3ZMU B;  5BR8 T;  1D0Y A;  1UCU A;  2LEH A;  3QB5 A;  3VU7 H;  4X65 T;  4LF4 T;  3AB3 B;  3SOL A;  4UVA B;  1XZY A;  2CE7 A;  2XM1 A;  2IHR 1;  3HKE E;  3LJC A;  3P50 A;  4HKA A;  1D0X A;  2W67 A;  3AA1 B;  3KV5 A;  3LK2 B;  4LMK A;  3O1J A;  4X62 T;  5AQQ B;  1HR0 T;  3EAM A;  2WMN A;  4ASK A;  1JNR A;  3SRZ A;  4KX6 A;  2KLQ A;  1MNE A;  3OPC A;  2CCQ A;  3PUG A;  5AFU L;  2XQ8 A;  3EI0 A;  2KMF A;  5E0O A;  5JRE A;  4HFD A;  2A72 A;  2NTY A;  2LM9 A;  4KHP T;  2NW7 A;  3EVY A;  1OED E;  5FVK A;  5CGM A;  2J62 A;  2LM2 A;  2N1G A;  2VL8 A;  4ERR A;  2LHN A;  4H63 V;  4JLE A;  5JRC A;  4JI2 T;  4QXB B;  4I43 B;  4Z8X A;  3AED A;  3HKC E;  3QOF A;  2XQA A;  2HN2 A;  2JPF A;  2EHO A;  5FXZ A;  2E5L T;  5ABF A;  1UX5 A;  4LFB T;  1FMV A;  3DTO A;  4K0K T;  4DR3 T;  2N2N A;  2N9D A;  5ETW A;  4UIG A;  4IDN A;  4GYR A;  5AQO B;  1MMG A;  2F4V T;  3RF1 A;  2LJL A;  3IF8 B;  4JI1 T;  3CWZ B;  2UXN B;  3OTO T;  1MMN A;  3VKH A;  2BG9 B;  5CA0 E;  3RHW A;  1CUN A;  4YLH A;  1L0V A;  4U74 A;  2FJD A;  3AA0 B;  4X66 T;  1YD8 G;  5LGU B;  3AXJ B;  2WQY A;  2YDR A;  5FXX A;  3FB2 A;  4IE7 A;  4PJN A;  1HCI A;  4X1I E;  4AIU A;  2ZLY A;  5EZY E;  4ZI3 C;  3AA6 B;  5L47 A;  4H9P C;  3K3Q C;  4DR7 T;  2X9X A;  2YU1 A;  3L3P A;  5LHH B;  2CBJ A;  3MZK B;  4TWD A;  3AEF A;  2MPK A;  5LB7 B;  2WDR A;  5LP6 E;  3UFE A; 
#chains in the Genus database with same CATH homology
 4DR1 T;  4B3M T;  4DV5 T;  4B3R T;  4LFC T;  4JI6 T;  2UXC T;  4JI0 T;  4DR2 T;  4DV7 T;  4LF9 T;  4DV6 T;  1I94 T;  2HHH T;  1HNZ T;  1IBL T;  2UUC T;  1XMO T;  4B3T T;  4LF6 T;  4B3S T;  4JI7 T;  4GKK T;  4DUZ T;  4DV4 T;  4AQY T;  4NXN T;  4DR5 T;  4JI4 T;  4DV1 T;  4DV2 T;  3T1H T;  1IBM T;  4YY3 T;  1HNW T;  4GKJ T;  2UU9 T;  1N36 T;  4OX9 T;  4JV5 T;  4JI5 T;  4LF5 T;  4LF8 T;  4JI8 T;  1FJG T;  5LMU T;  1IBK T;  1N34 T;  2ZM6 T;  4DR6 T;  2UUB T;  1XNQ T;  5BR8 T;  4X65 T;  2UUA T;  4LF4 T;  5LMN T;  5IWA T;  4X62 T;  1J5E T;  1HR0 T;  4DR4 T;  1N32 T;  4NXM T;  2VQF T;  4JYA T;  4KHP T;  3T1Y T;  4X64 T;  4LF7 T;  2VQE T;  4JI2 T;  4LFB T;  2E5L T;  4DV3 T;  4K0K T;  4JI3 T;  4DR3 T;  2UXD T;  1N33 T;  2F4V T;  4YHH T;  4JI1 T;  2UXB T;  3OTO T;  1XMQ T;  4X66 T;  1XNR T;  4LFA T;  4DV0 T;  4DUY T;  4DR7 T;  1HNX T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...