1J5IA

Solution structure of a novel chromoprotein derived from apo-neocarzinostatin and a synthetic chromophore
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (Apo-Neocarzinostatin)
publication title Solution Structure of a Novel Chromoprotein Derived from Apo-Neocarzinostatin and a Synthetic Chromophore
pubmed doi rcsb
source organism Streptomyces carzinostaticus
molecule tags Antibiotic
total genus 10
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2002-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1j5iA00
1O5PA 1J48A 2MCMA 1NCOA 2CBOA 2G0LA 1AKPA 1HZKA 1ACXA 1HZLA 1J5HA 2CBQA 1J5IA 2CBTA 2G0KA 4JW3A 1NOAA 2CBMA
chains in the Genus database with same CATH superfamily
5GS2D 4JY4A 2EKSB 2UYLB 4Y16A 1R4XA 5I5JA 1CTOA 1I9IL 4NFBA 1TVBA 3FCBA 3GPSA 4X5WB 1UFGA 1FLRL 1EGJA 4MAUH 3L3KB 4PJDB 2OW6A 1MJ7L 1S9KC 4C4KT 2DQUH 5I26A 3M46A 1WP6A 2QGDA 5GSVA 2C7UA 3BC9A 2X28A 4P9HL 1F3DJ 2NTFA 5B38A 1IVTA 5IEKB 1VIWA 1FCGA 2PTVA 3FU6A 1MXDA 1U3HA 3V10A 2IWGA 2YJQA 3BOVA 4M9OA 3NN8A 5I1GL 2XN9D 5DFVC 5J1AB 1OSEA 2LU7A 2VM4A 3KWVA 4L0PB 4O2CB 1M9WA 2EIZA 2F53A 4XCCL 3V5HB 2QSCH 3FTVA 1EH9A 1K8DA 3NJHA 3MJGX 4HIJA 5J0BA 2F1BA 1NMBH 1SFHA 1T0MB 4AOFA 2HVKB 5GS0L 3GIZL 4P23C 2ZXWB 5DA0B 3MFFB 3FT2A 5C0CB 5ESVA 5JTWA 5IBLC 4ANWA 3S48A 4ZSOA 1ACXA 1UM6L 2VQ1B 2YQ2A 5JIPA 2XA8H 3IDJA 3N85L 4I13B 4KRLB 4A2DA 4Q7DA 3VX0A 4FNSA 2L3BA 2YGOA 4CMHC 4NO0B 2TRHA 4FMVA 3DVNA 3OKDB 1I7RA 5DR5H 5BXFA 1KN2L 2Z3FA 4I9XA 3CHSA 4I0PC 3AVEA 2ZOLA 5T1JA 4U1JA 4LVHC 4UZUA 3IFLL 2D4DA 1R5IA 2QDVA 5J6GB 2QBWA 3CN2A 4R97C 1AE6H 4G6KL 2V3EA 4Z76A 1JNLL 3BW9A 4DPCX 3CPUA 3E8VA 1I75A 3D87B 4FMKA 4OCRH 5JPMB 4KRPD 3MBEC 1DZ0A 4GS7B 2AJVH 5DC9B 4R3SA 4BD4A 2FD6L 2VXUL 2YUWA 2AI0H 2DLFL 2VDOL 3IRCA 1MWAH 4J3WA 2HLEB 2CCLA 2DWDB 4X4XA 1Q4NX 5I8OL 5BJTB 2FYVA 3B37A 3NUKA 4QLWA 4IJTA 1OE3A 5BW7C 1PW3A 4YMPA 3ENEA 3VXMA 4Z18A 1IB5A 3LQZB 1S3KH 4HF5L 3IYLW 3MRDA 4WFEE 4RFOL 1F11B 2CA3A 2NSXA 1YMMD 3NJLA 4B9CA 3KL0A 1CICA 3FQTB 2GTWB 2BNUB 3I9GL 4R8WH 4YE0A 1RULH 5DLMH 3NTCH 5DEGA 5ID0B 2YGPA 1G7JA 1M56B 2FJFB 2UY6A 3MOBL 5D2LB 5HHMD 1U8CA 2WYIA 2TAAA 1J0JA 3IN2A 5DXWA 3TA3C 2XKSA 3MLXL 3OKLB 5C0DB 2K4WA 5IFHH 4G9FB 1HWGB 2R2CA 5HHXL 5E6RB 1DP0A 1AVAA 2XVKA 3LVTA 4H1LG 2EYRA 3WS6A 1X7SA 2FYYB 1MI5A 3V52H 2ZQKA 3E6HA 3H0TA 3QZWG 1AO7A 3DARA 4GLRI 1FVDB 4F3FA 2V2TB 4PR5B 1WUZA 3GMRB 4AZ8A 5DD0L 1S9VB 1GZQB 4P46B 2XT1B 4URKA 2A74B 5CEXB 4IIZA 1QBBA 4FLRA 5L88H 1KGWA 1CBVL 3SDCC 3SDXE 2VLJD 2IQ9H 1TLMA 2D0GA 1W0YT 5TK2A 3KYKL 5FCUL 1G7PB 4IGBD 3RTQB 3IM1A 3AB0C 1HOCA 2VSKB 2WBKA 3R7QA 5D5ME 4JZNB 5JQ6L 2VSCA 4XMLL 2MOQA 1D5ZB 4F7MB 5TJWK 5L2KE 1KV3A 3HHSA 5GGVH 1D9KA 4UILL 3N42B 5LCVH 3C60D 2FGWH 3ZDZB 2AEQL 1M6OB 2X2JA 4WCYH 4N8CL 2VITA 1KJVA 1AGBA 4OZFB 1PS3A 2OP4H 4AWJC 5CF3A 4X9BA 5SWZD 2ADIA 5HVWA 1XGQA 4RDBA 5IBUG 4F7TB 1RUML 4GSXA 3QG7L 5LN8A 4PD4K 1T1WA 3T0VA 1EXGA 1UOWA 1SHSA 4U6VL 4YSDA 1BFSA 2VGLM 5IW1B 1V7NH 4GW1B 2XWRA 1MCPH 3NRQA 2XKNB 5EPMA 2FO4A 1TQBB 1WCQA 3KLAA 2I25N 3AM8C 3NCEB 2QQNH 4WI2A 3OKYA 3UYRH 3VXSE 3E1F1 5J13B 4PG9B 4G5ZH 4DAGL 2WMPB 3U7YL 4KV5E 2L7UA 5FV1L 4PU2A 5F1IA 2A9AA 3F7LA 1B3IA 3QORA 5KN5A 1MRDH 5L8LB 4FJ6A 1ADWA 2D7OA 1P4IH 1U58A 5I75B 4EN3A 4GRLD 1JCKA 5DRZB 1KCKA 4K94L 2YAOA 5IIEA 5G5DB 3RGVC 1DLFL 4LLUB 4JFPB 4PGCB 4LPWA 1JPTH 2CUMA 1ZVSB 3KGTA 3MOAH 4NNPH 5DVKA 5IHUL 2NYKA 1FL5B 3CQFA 4G72B 4HZLB 5FGCE 4AJVA 1MZYA 3ZQWA 4MD5A 4PJ5E 4OF3A 4LDCA 2CRZA 4PRAB 3MLVL 2R29A 1FVEA 2QPDB 3G08A 3DUSA 2FIKB 1O9ZA 3L4YA 3QIWC 1EJFA 1EEYB 2DQIL 3UO1H 5KVFH 2ZIDA 3CSFA 4YFDB 5IWLA 2X9WA 1YJDL 2R0WH 4MX7B 3ABKB 3QS2A 3L5WA 3OKOA 4OD3L 4B9YA 5BVPL 4AYBA 4YFEA 32C2B 5JXED 1AXSB 1X5ZA 1XXDC 3C5ZB 4KZDH 2LQRA 1QSEB 1Z2KA 4FQJL 5D93B 1UXMA 3KWUA 4U49A 1MVUB 1DFBL 3X2QB 2CR0A 2KH2B 3TZVD 1B2YA 2CU9A 1D2PA 3KH3A 3H9SA 1WK0A 4CADA 1NSNH 3AREA 4OZHE 1WV7T 1KPUA 3MCKA 2BVYA 1LP9E 2YAMA 4ZOBA 4ZFGH 5E8PB 4H88H 5CSGA 4YXHH 1VPOH 3UTSB 1BG9A 1HAWA 4IEFB 1BBJB 2OR9H 1OSPL 3HR5B 4PJEB 2AQTA 4X4ZA 3OR6A 3QI9B 4WIQA 3W3BA 4C57C 4BH8A 4DVBA 2EDDA 3APNA 1URLA 4UQ2A 3U4BH 2XBZA 3JV4B 4OVVA 4X0KB 4ZX6A 5I1AB 4N0FA 3GI8L 2VDML 5EOTB 2D3LA 3EGDB 4OKVA 1D7BA 5HP5A 1CD0A 3E6FB 3LKQA 5F2FA 2YLHA 1A7PL 2B59A 3QG6B 3UAJD 3BGFC 4YEEA 5CGYD 1UD4A 4RBPK 4N68A 3NJXA 3NAAH 2C1OA 3HN8A 3S37H 2C9SA 1GKEA 5DTFA 4UI2A 2EH8L 1HXMA 1UVQA 5E1AB 5HI5D 3OMNB 2VM9A 4E2OA 5TH2B 5FC9A 4AKQA 4UT6L 4E5XG 4ETQA 3ARGB 2VDPB 3G5XB 3FTGB 3PDDA 2EACA 3WJLC 4P4RA 4RRPM 4YWGH 4ZT1A 1KYFA 3EJTA 1HCYA 1NKRA 5GZOA 3S35X 5HXMA 4B0MM 3ISWA 3BAEH 4NC2B 1KYDA 2NY3B 3DGGA 4UU9A 4ES9A 3MR9B 4K9JA 4A7GF 3NESA 1CDBA 2NX5D 1L9OA 4RA0C 5HVGB 1LO4H 1TTAA 3AACA 4P2OB 3TYGL 3GMLB 2K7PA 3I6GB 3EYFB 1I53A 4HK3J 4ZD3H 3HI1B 4MD4B 4DEUA 3NZHL 5DEJA 3T0XA 2VXQH 3QUXB 3OWEA 2CG9X 2J43A 4X83A 5TF0A 5E6ZA 5D70L 5AKRA 2ISDA 4MA7L 3M86A 3R19A 4PG2A 3DVGA 5E8DH 4M8QB 5EC2A 3S6CA 2J20A 4PJXA 1O9WA 4ZUUB 3UADA 4O9HL 4L4VE 2B0SH 1H8OA 3BQVA 5F70A 1NCWH 5DJYB 3TCLB 5C9JA 3KPQB 1MJJB 1EVTC 3PV6B 4DW2H 3MRLB 4DP0X 4MJJA 2OQJA 2P8PB 3AU0A 1U2YA 2LABA 4U1MB 3EO1B 4OCYH 3BVXA 3UC0H 1WA2X 5GGTL 3ULVC 3RWCB 4XNQA 5CMAA 3QQ3B 1LO0H 2A6DA 1KV7A 3FN3A 4OQTL 1HKLL 2J21A 3D39E 3RUGA 4ODWB 1E7UA 4QTIH 1A9VA 2HRLA 3G6JA 3LVEA 3OGOE 4Y89A 1B0WA 1U92B 2IBZY 3NSJA 4CSPA 1YEFH 2DTSA 3MXWL 1PZ5A 4N0CD 3NCJL 4PGDA 3MRFB 4IU2A 4BUQA 1S7TB 3V5DA 2GEQA 4FYSA 1LJMA 2P8MA 1FHGA 1X4YA 5JW5A 3Q5YA 1MQ8A 4KUCF 4NENB 3VFTB 3WDHA 4KU1A 3UG4A 3L48A 3BYYA 2HH0H 2OBGA 3NIGB 3FFCA 4NP4L 2OMVB 3PQYE 1HC1A 1S8DA 1INQA 1XF5B 4DPAX 5C0CD 1KDIA 1FSKC 5IVXA 3W39A 3DBSA 1CYXA 3EFDH 2X44D 3WIFB 1FZOA 1QLRA 2YSSB 4A63A 2OZNA 3LRHA 3RL2A 4NO0D 4G2AA 5I0ZA 2YK1L 5KANG 3S36X 4KAQH 3WYRA 1YUKB 3QZOA 4HIIB 2VXTL 3K72A 2CIIB 4I0PB 1AXTH 5GRUH 5HHPA 1X7QB 3QCVH 2OCFD 1ZIBA 4U4IA 3W0WE 4LVHB 2FH8A 3ARVA 3JWOH 3RZCC 1IGTA 2W65B 4ZYKB 4R97B 1RPUA 3STZB 1I1AB 1UD5A 4FABL 1GTNA 2XN9A 4Z7QF 1QUNA 4MWFA 3UBXG 1T5XB 1I7TA 3HI5H 5D72H 3TNNB 3N0AA 3MBEB 2Y2TA 1C5CH 1KTJA 1ZHKA 2E7MA 2IBGA 3CMGA 5EZLA 1KWKA 1FDLH 1OF0A 2HWZH 2H5UA 1WLHA 3ECVA 2ZNXA 4KK9C 4BZ1L 5JZ7D 3UZQA 3DI2B 6CGTA 1SNRA 3WXWL 5IZ7A 2VO8A 4FNQA 1CB4A 2G9HB 2ICWI 1GH7A 2CMRL 2VZVA 3KL5A 3NQKA 4CKQA 1MCFA 1P53A 3QWOB 5HHOB 3IMBA 4PWIA 3ISRA 4B9KC 4Y2DD 1DBAL 2C1PB 3FRUB 3HHMA 4OSUL 1BDYA 1TQUA 2FH6A 4N9GB 5IMKA 3ABLB 3SDXF 1K4DA 2ICCA 2OZ4A 5T1KD 4JKPH 4QXUH 2AQQA 3PYCA 2JMRA 3L8QA 3Q6FB 5DJ2B 5D5MF 3AG1B 3ULUL 1SXNA 2XU9A 1Q9KA 4LKCB 1SBSH 3SGJC 2DTML 3DSFH 1W15A 4LSTH 5H94A 3CCHA 1PTZA 5H37G 4DUWA 4XNXH 1V7ML 2VWEC 3KR3H 5E03A 4ZI8A 3ZE2E 2X4TA 3TA3B 5IHBA 1TJXA 4PUBL 1EBAA 1KIQA 3LYRA 2R1XA 1G7LB 2HG0A 1E2VA 2F7IA 3B2VH 4B3EA 3P9LB 2FJUB 2P9RA 2EP6A 3FUEA 1VF5C 3MRNB 1YYLL 3MREB 3QNYB 3O6LL 1BF2A 2KZBA 1PG7X 4AYID 3LRSA 3WUZA 1P4UA 4BSWA 4DN3H 4XHQA 5KZCB 3N40F 1B4RA 4X4KA 5DMKA 1WYJA 3FTWA 4IBTA 4NWUL 3AT9A 2M8XA 4XCFH 1OOWA 3OAYK 4KV5F 4NIKB 3L4WA 3C8KA 1QZNA 3KEDA 1M53A 4U1IB 3FHEA 5F3FA 5D1QA 3S88H 4TVPL 5DQJB 1LEKB 4H25B 3AB0B 3IAQA 4W6YB 5AENA 1JJUA 3IBEA 1OTSC 1FHNA 2FHCA 4HAKA 2EDRA 4WNQB 4DKTA 4AH2A 5MEQB 1YMMA 4PJIA 3IDGA 2J3SA 2RR3A 3IJEA 1I8KA 1MIEH 2AK1H 3GSQA 1GGUA 3FT4A 4J8RB 5AW6B 1T21A 2HRPL 4M7JL 5E4IA 4QTHB 2Z31C 3MNMA 4C59B 2KMWA 4TSBH 2FWOB 2XZQH 2YPVA 3AGWA 3GYRA 3W5NA 2B7DT 4XNYH 3FPYA 4IMLB 1PJ9A 5DVMA 1ZRUA 5EZJB 5LBSH 4HFUL 1MNUH 5E2VL 1XHHA 1AR2A 4DUXA 3TGXA 1DBKL 2NNCA 4M7KL 3OX8A 4AT6B 3H54A 2EDBA 1D6EB 3TTYA 3OXSB 5IMMB 1OLLA 4LP8A 2F58L 5T33H 3VFPA 2OMXB 1UXSB 5BRZA 4NAMA 1SYVA 4PP1D 3L95B 3STBA 4I0KA 3R1GH 5A7BA 3F7QA 5F7EL 4YDIH 5EO1B 1CUOA 2G5UA 4FGMA 4QXTA 4BHUI 2VLJA 4HDIA 3ULSA 1NAMA 4NUQA 4HKXB 1RL1A 1M57B 3F58H 3AY4A 4HMCA 1S9WB 3VG0L 1K8IB 5C09B 4FCHA 3KPTA 4KKQA 4LBAA 3WFHB 1I1FA 4PPTA 1YEKH 3BEVB 3L2MA 2R0KH 4XNAA 1IGIL 4GT0A 5TPWH 5CZVL 3RGVB 4L3EA 1YNTF 3CZNA 4WFFE 1GXEA 2K70A 5I1KH 4H1LB 1R3KA 3D9AL 1IGMH 3GSRA 3B43A 4DGVL 2RJMA 3IVKA 1D6VL 2O6FA 2X6AA 1G4MA 3J7HA 4BFOA 4KGJA 4JO2L 4NO5A 5EN3A 5JW3H 4M93C 1HNYA 4HJJL 4Y0GA 3CSYB 2FX9L 2FZ3B 2ZF8A 1FC2D 5CEZE 3QIWB 1H0DA 3OC8A 3TWCL 3ZT5A 3FQ4A 5DK2A 3BE1H 4LCCC 4XCYB 4Y5YA 1JVKA 2BLFA 1K85A 2WLYA 1PAMA 2CBQA 5SWQA 3SO3C 1LDPH 4P3DB 4RGMC 4FHKA 4WEBL 4G7YL 5KOVC 3ATBA 4AVHA 3SQOL 1AI1H 1U8LB 2NYYD 1SM3H 4LPVA 1MHEB 4POUB 4XCNA 4KXDA 2AJSL 2GJ6B 3IE9A 4ZTPH 2Q8BL 1KEMH 3AT8A 2JI1A 2ATKB 4G42B 2GBUA 2NY1B 2WN3A 3BI9X 3KXFB 4JG1L 2VZ3A 5F97E 3K91A 2WN2A 4JZOB 2EDNA 2YPLD 3LZNA 3N5AA 3UDWA 4N2NA 3GSNL 3BX7C 3UTSD 3N41B 2JIXA 1JDCA 3WHXA 1FV1B 4KUZH 1NLDH 3D06A 3HMWL 2LW3A 3NH7L 2Q86B 3EYQC 3WFCH 2CKBL 1XCWA 3RJOA 1JYWA 3BVTA 1VFBB 3QXVA 2X4QB 3VFGH 2I26N 3U0TA 1AZUA 5CGTA 3VMPA 5IFAL 1IGCH 3F12A 1BEYL 4OFDA 4YK4C 1VESA 1AQDA 5D1ZC 5DS8B 3WKYA 1HU8A 1LO2H 1OZTG 3JBG7 4EI5C 4TNVK 1LEIA 4Q56A 3IPEA 3ZMNA 1JGLL 2EIBA 4AQEA 4XP4L 4Y8AA 1R5WA 4PJHE 2R0ZL 3BGFB 1WCBB 3QK0A 3MLZL 5I73C 4KQ4L 1OW0C 5CP3A 5JXEA 2OMWB 2XBTA 3ZDWA 3OGCA 5DO2D 2D7TH 2XBDA 5KS9B 4WEUD 4PMEA 2DD8H 3ARGD 5DJDA 4IRZL 3O4LE 5K9OB 1MY5A 3MDJA 4V1DA 3EYVA 4W81A 4BZ2L 5L8KB 1PY0A 2P5EB 3QNXA 1J88A 2F7RA 3RIAF 2XY1A 2WOYA 4QYAA 2W9DH 2NY3D 3UZEC 3DV6B 5F7WC 4ANXA 2FNBA 3FTYA 3QJRB 1XF4A 3QDMB 2ZWLT 4JJ5A 1KJMA 3GIVB 4OM1H 5JW4Q 5TFSL 1L0YA 2K4AA 3UO8B 2Y7LA 3WSQH 4S11A 4P2OD 2EDQA 2EICA 2DQMA 4X5XB 3WDIA 3L3OC 2H3NA 3GTTA 4GG8B 3QW9A 4KJQD 1IC7L 3BT2L 1A4JA 4DP2X 4NM4H 1EUUA 5IEHA 5TE6H 1IKNC 1JGDA 4C54A 3QUXD 1TJIL 5EU4B 5CEYA 1A2YB 1UZ6E 3MNZA 2HN7A 1R33A 2UZPA 4BH7A 4CGTA 5E24E 4UBDD 5TE7L 5I16B 2DMKA 2P49B 5KBLA 3KYNB 3QHZH 4F8QA 5ILTH 1X5IA 5AWNL 1KB5B 3IBOA 1SY6A 3ETBF 3GKWL 2C4FU 2DQFA 2JKTM 2N1KA 2D03H 2O5ZL 2NY4C 4JM2F 4OF8A 4PS3A 4XMPH 5F7BA 1HESA 1DCEA 2XTJE 4ICXA 1JTTA 2GT9B 4AEEA 4MAYD 4G1MB 2VC2B 5A3ID 1UQSA 2Q3XA 4BUGA 1WITA 2Z1KA 3VDCA 1CLYL 3ZE1B 4X9FA 4NOFA 5AVWB 2F7PA 1AKJD 3CFDA 2B39A 3GGWB 4NZ8A 4MJID 2JELL 2BERA 3B7SA 5C0RL 3K8MA 3ZIMA 8FABA 4Y4KA 1FZMB 3GD1C 4I3GA 4WU5A 4E41A 5E0FA 1HYRC 1WF5A 1RJYA 3SJVE 3VRJB 1UATA 4O2FB 2ZUQC 2Q6WB 3WFBL 1K6QL 2HXAA 5I6MA 1AY1L 2R0LL 1HE7A 3ABMB 5DVNA 1JPGA 2I9LB 2NR6A 3GBLA 4AYGA 3B3IA 1ZV9A 3C6LA 2BH0A 2PW2A 3ZRSA 1QMUA 5HDQL 2XZAL 2ZSWB 3SCMD 3TLRA 1FSKB 2O6EA 4IRSD 2OSWA 1P5UA 2N01B 4ZUTA 2JV6A 3NMEA 2BNQA 1L5GB 1NOFA 2VXSL 3OJVC 1TCRB 1MN4A 2K45A 3OKMB 4IMKC 4JL1A 4KXCA 4Q9BA 3MYJB 4R5VA 2IPUK 3DLQR 2A4EA 3SY0A 1QSFE 4Z6AT 1KCUL 1N9PA 3ARWA 3VFRA 4Y5VA 3FUIA 4TM9A 4ALAL 1RHFA 3LS5L 1OAZL 4N2EA 1ZLSL 4R96A 2NLJB 3MJ9H 1MF2L 1C5BL 2BY3A 3NACH 1I9IH 3Q9PA 4PSRA 2HKFH 2VLRD 3CVCA 5GGUA 4PP2A 4KH9A 4XZUB 2XXGA 1XGZA 3RZCB 1JK8B 1G9NL 1MJ7H 4HS8H 4PJFA 3U30C 1I1AD 4GP4B 2R23B 2AQ3A 5HHQB 2E6PA 2R9HC 3BVNB 4P9HH 3M1OA 1FORL 4HLZG 1QBML 2WXLA 3ZE2F 4CVUA 1S6NA 3O2VH 1KBGL 3WFEL 3A67L 1SN5A 3QH3A 4HHAA 1MWAA 4PRIA 4X9IA 4XE5B 4BFIB 1HHGA 4PJCA 3D30A 1P69B 5AW7B 4KKLC 5CJBA 2NMSA 2ARWA 1MJUL 5ANMA 5TQ2L 1U42A 2GAZB 1ED3B 4JVPA 2IXQB 3APCA 1KLUA 3F5WA 5IF0B 3GIZH 4ZFOL 4PI2A 4QHNA 4JFSA 1ETA1 1TTUA 3G5WA 1RURL 3FSVA 2X7LB 2WCPA 4P9ML 1IAOB 3TT1L 2WGXA 4Z7QB 1BOYA 1JZDC 2FJGA 3ARDD 4BSVB 1IC0A 1ZTXH 5EB9A 2OMYA 1AZNA 1IIKA 2BSTA 4Y4HD 2CUAA 4KROD 1KN2H 3WLBB 4F8OA 1NGWA 3IXAB 2COQA 3TPUA 3HUJA 4RGNC 4X6CA 3TA3D 5I0DA 1N12A 3IFLH 2BNRA 1BVKB 1C1EL 4YDVA 1LE9B 1NM9A 4QHMB 2BFGA 3QCUL 4I1RA 1R9FA 4NUGL 2OCCB 4PVLA 2ITEA 1JNLH 2MIZA 1KOAA 1COBA 1G84A 2WQXA 2P45B 4GAAA 3V0IA 1WAEA 2IV9A 3WNPA 3HPLA 2FD6H 3C09B 3F8UB 3ARQA 2VDOH 3F62A 3NK4A 3JQOB 5D5MB 5BQ7A 4ZMLA 3TO4C 2PPEA 4LQFL 5L4MA 3F7YB 3CH1B 3HNVH 5I8OH 2CJUL 2NY5L 2VDRH 3GUFA 3NCYP 3SPVB 3QRBA 1U6AL 3EOBA 4UTAL 5KYXB 2BP8A 4HF5H 1KFGA 1NCHA 4X80L 2R2EA 4FHJA 1YO4A 4RFOH 1RERA 3FTZA 3OMZA 4G8EA 5LCVA 1EDQA 2DI9A 3V4UL 4ZFZA 2C3XA 1XZ0B 5FDYA 4J4PC 4GAGL 4GP5B 2ZWKA 4K8RL 5GHWL 1Y6NR 3V8CA 1MCBA 4URTB 4FADA 5EOCJ 2Z31B 1FYHB 1NGQH 2ZXBA 1QA9A 1YECL 3EDDA 4PCKA 1KELH 5G4NA 2X5PA 4PGEA 3MOBH 3B7UX 1PX8A 5H4YA 4L8CA 1EPFA 5CSZB 3HBZA 3GSOB 3TIDA 4AMXA 3G6DL 5LHDA 1P1ZA 4LL1A 2WCGA 1IO4C 5EU5A 1ZT7B 4XMWA 4KFMA 2X4OB 4LP5A 3BVWA 2VZOA 1INDL 1FNFA 4OGZA 2VN5A 4BCXA 4G83A 1GW0A 5E1IA 4GQPH 1HSBB 4JDEA 4M1GH 4FN0A 4Y19A 5ID1A 3KJ6L 2G2RB 5DD0H 4AL8C 2NW3B 1WIUA 4L4TE 5AZ2L 3S35L 5C09D 2W94A 1W91A 4S2SA 4L2LA 1F8TL 15C8L 1CBVH 5LXVA 1JL8A 1I3GL 2DB8A 4C4KO 3ILEA 1ITBB 1PY9A 3QIUB 4V11A 4AQ1C 4OGXH 5LXGH 1G7IA 3KYKH 2P7TA 3N91A 1DBJL 4ONGL 2VZSA 1YNLL 4WI7A 4PJ8A 2VISA 5D1XD 2MQCA 5JQ6H 5KSAA 1L3NA 4L37A 3N9GL 1E8WA 2Z4QB 2ZG2A 4UILH 3QEHB 1SRDA 1H3XA 5I30L 2AEQH 3K6DA 3KPOB 4EO5A 5C2BL 1Q9OA 5E6IA 5IB3A 3D18B 2EVJA 4M93B 4PRBA 1XH3A 3TO2A 4ODSH 5I6OA 1YC8A 4FQ1L 2RAMA 3ULAB 4E9TA 2WVVB 4P2AA 1XFPA 3FUNA 3RY6A 2O1AA 3DX8A 1C8QA 5C97A 4LCCB 2CO1A 2CDGB 3JYCA 3FB8A 4CBZA 4YR6B 5IMOB 3SO3B 4U6VH 4XVUD 5AKTA 4RGMB 5IHZA 2X6VA 4HHWA 1YNTB 3R06A 2GJ6D 3V2AR 4MXWL 4WW2F 4OGAC 1ZY9A 4PJHF 4XRCA 1WFIA 2NY1D 2PYED 4IOSD 3KXFD 4EUPG 2OK0H 2BHYA 4PRNA 1G94A 3O11A 4PIBA 1OV8A 5DRNB 1H15B 1IM3A 1UB5A 3QSKB 3IPFA 3U7YH 3L5XH 1OGTA 2C3WA 5CFAA 3PREA 1VGKA 2WAHA 5KSBA 3G6AA 1XMEB 2MTPA 4BJLA 4U1KB 2HPTA 3ARSA 4HOWA 4LAQL 4HCRL 3RPIA 1FCCA 4L8DB 3O2DH 2CJSA 1SXSA 1LYQA 5DDHB 3JZYA 3UP1A 1JBJA 1DLFH 4JFHD 5GS1B 1TTRA 3CHOA 5K93A 5IHUH 2MKWA 1M1XB 1S7UA 4FKHA 3II2A 3DO3A 5K9QG 1ZHNA 4YK4B 2WNKA 4QHUB 4JZJA 1U3NA 2APVA 4M61A 4M29A 1AGCB 4QLRA 4A2LA 3MLVH 4EI5B 3DUUB 2BIHA 3KGRA 1QRNE 1IT9L 3FN0L 3FQWA 3ZTJG 1A6ZA 1UZ6F 2VDMB 2M1KA 1IV8A 5IB2B 2C3HA 1HDMA 1KXHA 1RPQA 2VLMD 4WFHD 4JO1L 3LEXA 5I73B 4L3FA 2EZ0D 3DRQA 3JV0A 3U2IA 3IJHA 3NEEA 4OD3H 3WIIL 5BVPH 3S36L 4FQXC 3NIFE 2FO8A 2FLBT 4YPJA 1OF2B 2BIIA 2VOTA 2QFPA 4PCYA 5DUPH 4FQJH 1NC2A 1WICA 1DFBH 5ISZB 3IAPA 4AYFB 1TO4A 4P5TD 3FYEB 2GY7B 3RIFK 3WD5H 1DQLL 3QFJE 1AGFA 3VQLA 2P5WD 4R26L 5KVEE 2B4CL 3FCSB 1KJ2L 4M7ZB 1D5IL 1BWWA 3LRLA 4NRYA 3MRHA 3U25A 4Z5RA 2IGLA 4QPEA 2QR0A 1N10A 3D4ZA 4OJFL 4ZO6A 3PGCB 1MCCA 3SE4A 1S7RA 2BY2A 3SKJH 2MPAL 3C9NB 3O3EA 1N0LA 3DYMA 1JPFB 5CJXA 3L3OB 5FB8B 3U9UA 4HS6A 1HEZB 3MKGA 3QDGE 1BQHB 1WZMA 1K4CA 4NGHH 3BYTA 1MSPA 4WFGE 4WWNA 1F3JA 2V3DA 2VXQA 3TBBA 4HWBL 4NO2B 4QAMB 1JP5A 2G3XA 5F1OB 2OAAA 2AEIT 2X05A 2XTJC 2GBTA 3DO4A 1MAKA 5D9SA 1N7ML 4A6YH 4WI5A 1A7PH 5CJQL 3KCPB 1TQTA 2G9KA 2WB1A 3VQ2C 2NOYA 2WQWA 1LWRA 1NC4A 1FNGB 4AYMC 2QV4A 2EH8H 5FHBL 2H6OA 2JJWA 4LCYA 2J6EL 1VZHA 4UT6H 1W72L 2YOAA 3ZHDA 1KEGL 3AXIA 1IGYA 4WEMB 1Z3GL 3Q5TA 5AW0B 2KZ1B 3GXMA 5IB5A 1J8HE 3QWRA 5F6HJ 4AGPA 1INEL 1EAPA 4DNLA 5LDUA 3WUWB 3MV7A 5HYQA 1A3LL 4U31A 2W38A 1MCWM 1WH0A 1KENH 4NNYA 4QRFA 2EDEA 1DVTA 1TVHA 2FHBA 3M1CA 1PCSA 1ZLUK 1JWSB 4AJYV 3I6SA 4ZTEA 1RIUL 5JLZB 4HU2A 2WXNA 1QLFB 4XVJL 3S4SA 2XG4A 3MPCA 3A22A 3PDOA 1AJ7L 4NWTL 2B1HH 2ZUQB 1JS4A 4JCMA 1SJMA 1XGUB 5FA4A 4M6ML 4MCZA 4LLMB 2YOCA 3FU7B 1L9MA 1U8PB 3NZHH 2D2OA 3SKNB 4KITB 4YLCA 5T1MA 1B4JL 4MA7H 3FQNB 2VR5A 1F18A 5IJVB 3RE0A 3I9AA 5GS0D 4YDKH 2BVQB 4FNRA 4KXZH 2KLRA 3SGDI 2O26U 3CFKB 4G7RB 4XZ4A 1JWMA 4UQ9A 4OIAA 5FW7A 3MYZA 4I18A 3LKRB 1KPRA 2WLJA 1MFEL 2X88A 2XRAL 2Q76A 3DX7B 3LN5B 4AVKA 2VABA 4O2EA 1CFSA 4KUCD 5AZEH 3TPKA 5I71C 1JMXA 4EF3A 4XE0A 1DQVA 2BVEA 4BCYA 1GL4B 3I9IA 3QUKB 2NUPB 3TL5A 2YHGA 3K6OA 4AW4A 4N8VA 4NLHA 4TQEL 4WUKL 3U30B 3OG6B 2WSKA 2XVLA 3DROA 2AGJL 2V37A 3WKQA 4OQTH 1CFQA 2Z6FA 5EU6A 1NBCA 5BO0D 1LNUA 3ABZA 4YBHA 2CJTA 2IF7A 3D4YA 1CTMA 4HYTB 2B15A 3ECBA 2EO1A 5CJOL 3NCJH 2JKRM 3CDCA 2FNWA 4YQXL 4CKVX 5EEUA 4WFED 1G6RL 3DMMB 1H8LA 2O61B 4JM0A 1ZVNA 3MRPB 4MBOA 4P3CL 4HIPA 4UM8B 4HZ1A 4X7TB 1IJ9A 2F9BT 2HFEA 2NNAB 2MWCA 4Y1AA 5JHMA 4OLWH 2ZOOA 1G0DA 1NEPA 1TSHA 4TVUA 4NZJA 4TL4A 4KY1L 3SCMA 3FUKA 4XVTL 4J7RA 2ZG3A 4IRSA 4LLYB 1X5HA 2DYPD 4W1TA 3FB7A 2DWXA 1F56A 4YHZH 1YDPB 2OYMA 3P73A 2X4PB 1ID2A 3PAYA 3BEWB 3H7LA 5DMGD 4FTVA 2DQJH 2OSLB 3CBJB 4JRYE 4AUYA 5C2UB 3U4AA 4M7LL 1KLGB 4LRNL 2G5BB 5DU7A 1MFDL 3SGEH 1XGPB 3K0YA 4BWTA 1SJVA 1KB9J 1ZVYA 2GUOB 2IH3B 2AJ3B 3QZMA 5ERWB 5DRXA 1U41A 2CK2A 4RGNB 3PUUA 5E7BA 3U6XA 4LSSL 4K3JL 4KX8A 4U6HA 2YFOA 3H2WA 1ONQB 4E9QA 4W4NA 4IRJC 2WIMA 1N70A 1A1MB 4FABH 4JFEA 4KK6D 4Z3EA 3KAAA 2MQGA 3QXDA 4TTDD 2C3VA 2WO3B 1CDUA 1BZOA 3LQAL 4OZIE 3S5LB 5AOZA 2O5XL 1OHZA 4BZ1H 1TZHA 4R5XA 4N22A 4NZUL 5L2KD 4NQXB 1H6TA 2H6UA 3FUMA 4JQXC 4TQ8A 3WXWH 3EO9L 4FG6C 4N2IA 1GW6A 4I3RL 1A6VH 1OCRB 1ZLVK 4CL7A 5IEHB 4HIXL 1CLZL 1BVOA 3P54A 2E3VA 3LXCA 1DBAH 4TLKA 4PS4L 3HG1B 4QF1A 4UDUA 3WTXA 3ZRFC 1CTNA 3VFWA 1A65A 5D7KE 1GS6X 4QXWA 4G11A 3ARDA 1A4CA 1LDSA 4NJAH 3Q48A 2BSDA 4S1QH 4NLAA 1VRSA 2Z31D 1DTUA 1GGCL 3HZYB 1X6NA 4GRMB 4I4WB 3II1A 2VAJA 4X9GA 3ULUH 4WDIB 4XCEA 4XN7A 1R3HB 2DTMH 5LBSA 3VXSD 3DYOA 4ZPTA 2OXGB 1W0WB 2CCVA 1I3RB 1N19A 3KVPA 3MNWB 4J1UA 4DP6X 1KYOJ 4QRQA 2ITFA 2DQGL 4UNVA 1QW9A 3I75A 1D5MB 3KMDA 4MKTA 4JNXA 1FYTE 4PUBH 3VWKD 3GMQA 1ORQA 3QA3B 4IHOA 1JN6A 1EANA 4EDWL 4HWEL 3UG3A 3LZFH 1ZA3A 4KZEL 3RKDC 2VB5A 1QACA 4MDJA 3VD1A 1HHHA 3OJDA 5FM8A 5T8IA 4R7DB 3A4AA 4A2EA 3QHTC 4QUOA 2GYSA 1HXKA 4GSQA 4LCWA 4APQC 2ZX5A 3D0LA 4AMKH 5LKNA 3IS0X 4F7EB 5D4IA 3JSSA 4G6FB 4DCQA 3PWVB 4N1HB 4WWKA 5DURD 3VI3A 1E9QB 4PJ5D 3CZGA 4Y5XA 3QIUD 3V6OA 4D9QE 1GPOH 3OKKA 3ZO0A 4PFEA 5JMOC 1E4WL 1SDDA 2H32B 2R7EB 5IMLA 1GS7A 1KXTA 3O41B 3FSZA 1EZSA 5FK9A 5DS1A 5HGAB 1T04B 4AQ1B 2J73A 4TVPH 1ORSB 3EZ8A 5MEPB 1UTDA 2PMZA 2LU5A 4RAHA 1UD2A 3IKKA 1JFQL 2FBRA 4QD2E 2EYSB 3VSUA 1DANT 3QO0B 2HRPH 3EG9A 4M7JH 2GJJA 5AVRB 5F88A 4YIQB 3DO7B 1EZVY 5JIHA 3GMMA 3GLZA 2IGFL 5AKSA 2E4TA 4H5SB 5GGVY 5C1MB 1FGNL 3PPEA 3TC9A 3ALWA 4FYRA 5BV7C 5AL0A 2FCBA 1T2QH 5SWSE 2P24B 3EJJX 5BS0B 4RRPA 3GSUB 1NL0H 5CNHA 2PABA 3TURA 1DBKH 1EO5A 3IJ8A 1HOEA 1LE5B 1ZT1B 2GPZA 3ZGHA 1RIVH 4NQSB 1UOKA 3FO0L 5AVVB 3H3PL 1JDDA 2CO6A 3L08A 3CVHB 2R1YA 4DFHA 4GG6E 2H2PC 3NFSL 3O0RL 4N0UE 3KPNB 3MO1A 3NIFF 1BZ9A 2A4ZA 2F0CA 4J23A 1T66C 3NT0A 1AMXA 4F5CE 3VG0H 5E9DB 4GRWE 4B95C 3EYQD 5IGXL 5D4QA 5D7LE 1JZ2A 5B1AB 4BGDA 4F7PB 1WBYB 1TYJA 3DTDA 4FQCL 1RZFL 1IGIH 1ASOA 3E0GA 5CZVH 3FH8A 3QZWA 1FFNB 1QNZH 2EUVA 3KNBA 1CT8A 1EMTH 4RA3A 3R18A 2GK2A 4YGAB 2FL5A 4OZFH 1L4IA 2GTZB 2UZYA 2G60H 4PJHB 3V6FA 4DGVH 5CN2A 3HZ3A 3VFNA 4DEPC 4EI5D 4JO2H 1OTTC 4YXKL 3FO2B 2EXYC 2FWUA 1P4LA 1OARL 5F3HB 2A7BA 4JBSA 3FAWA 4PB0H 3Q6GH 1T83C 4ODBD 4EI6A 1XEDA 2KS0A 3DWTA 4JHUA 1ET7A 4DP1X 1M7UA 1M7IB 3U36B 4FQXB 3BZ4A 4G7YH 4PJAB 1T80A 4AJWA 3QYMA 2FECL 3SQOH 4M5ZL 2XPGA 4FLHA 4HKZB 1PF3A 1KCVL 2Z35B 5IQMA 2CDFB 1YPZE 2G0LA 3KDMB 2Q8BH 1U8KA 4O02B 1IBGH 3QJFB 1PX4A 2EILB 4JG1H 3RGBA 2N7AA 5D96C 2P1YA 4HH9A 2GIXA 4YAQA 3L7FA 3GSNH 5DUML 3HCVA 5TE4H 1JAEA 3HMWH 1HQ4B 3Q8AA 4MRCA 2CKBH 2JQMA 1M2VB 1FC1A 3L6FB 4F58L 5D4HA 3LS4H 1S46A 1QTYT 1UUNA 5IFAH 2VIRB 5CU5A 3OBAA 4L4VD 4UIMA 1MCIA 1XCQA 3TYFA 4XPGL 3C2SA 1NGYA 3WS3A 5CBEA 3X11A 4G6AC 1BVNP 3AITA 1PD0A 1EHKB 2XTJB 2CSPA 4YSUA 1BD2A 1JGLH 4J2XA 3SE9L 3TH3T 1W2KT 1I1YA 3EJYC 3I6KB 3OMIB 4O4YH 1PIGA 4L5FH 2QMKA 2VDNL 3HKFA 3SHSA 1PEWA 1ET5A 5DMYA 2R0ZH 2UZXB 2EEFA 3BD4A 2E8YA 1EAQA 2ZAIA 1JFHA 3PGDB 1JZIA 2Y6SD 5LGJB 3CUPA 3SPHA 3B2DC 2GITB 2F53E 2BZ7A 3D39D 3JT2A 3T0DA 3LN4A 4P5TA 2NY6D 3MBWB 4NT6A 4P07A 1IEBB 3L17A 1UOVA 1SF5A 4F33B 2ZUUA 4NZFA 1DN0B 3QUMB 4IRZH 2WLNA 2PLTA 2Y07L 3BPCB 3AS1A 2E7BA 4BZ2H 1KN4L 3SJVB 3WEAA 3SDAC 3OKNA 3DURB 3EO0A 1T20B 4ZSOE 3V4VL 3HS0A 4GAYA 4HOZA 1B0RA 2Y7SA 3OR7B 4IM8A 3OSKA 4JM2D 1RIHL 2KT6A 4YLBA 5EN2A 3PQYD 2X70B 4R4BB 3TJEL 4RMSA 5DFTA 4JJOA 5FOJA 4ABQA 5JIKA 3P4LA 3W5MA 1DJZA 3OF6A 1MVFA 4PWFA 5KG9A 2VN3A 1TJIH 4WWPA 2J4WH 4U6XB 3QCTH 2WXGA 2PXYC 4UZGA 2CD0A 1HZHL 3ESNA 3SPIA 5TE7H 2YC1B 3P77A 4ACPA 4TF4A 3NIDE 4JDZB 1E4KC 4HPOL 3WTVA 4AGNA 1U91A 3MAWA 5AWNH 3BHBA 5IY5B 4KXBA 1BLNA 1PDKB 5M94B 3VQMA 3ESVF 4ZAKC 3W0WD 2ROYA 1UH2A 3FK3A 1SMDA 4R9HA 5FM4A 3ZKMC 5A40E 1J5HA 3HE7D 2WWNA 5CD3A 35C8L 1FO0B 1NCJA 1FVCA 2KQNA 2VDPH 2A9NL 2MEJB 2JTDA 3ZE0E 4TXVB 1KPVB 3MJ9A 3ATEA 1UZ8B 5I71B 3VXME 3ZTJH 1UACH 4ONFL 1LD9B 1XX9C 5ITBL 1SJEB 5L0QC 1JHLH 3MRQB 1BVLB 1Q94A 3WG7B 3UGXA 5C0RH 4ODXB 3MNVB 2HJLA 2YMOA 3O8XA 4WW1B 5E8OA 5FYKE 1O7VA 3BQUC 3OLGA 4J12A 1OXYA 1TR7A 4E5XA 1KIPB 1S5HA 5I74B 3DMMD 3GFUA 3WFBH 2EYTA 2CO7B 5ABAA 1M7DA 1K6QH 4RISL 1RP9A 2IPTL 4FNLL 4X98B 2R0LH 2H26A 1Z7JA 4XPAL 5H2BA 4JVWA 2FX8L 4U3SB 1SBBA 4AGLA 3EJSA 4CN1A 1JHTB 5C0EB 4OZIF 2Y7NA 5IESL 2H1PL 3H2QA 1QFHA 5HDQH 1HH6A 2DBLL 1NPUA 2ARJB 5KYNA 1FFOB 1DEEB 1AO7E 3L3DB 3UAEA 4FZEL 5I0YA 2QQQA 1KTDB 3OZ9L 3D3VA 2NQDA 4PJGA 3IGAB 3O6FD 4BINA 1ZS2A 2XQYG 2FB4L 3BWUF 4ODHL 1D5XA 1EEZA 4ALAH 4JAMB 3ULUD 4XP6L 3ABGA 1OAZH 2B1AL 2XTSA 3EAKA 2DZEA 1MF2H 1C5BH 1P2CA 4IKKA 5E1QA 2V2XB 2X41A 1I8MB 2HX7A 5C0ND 1VEOA 4GW4A 1G9NH 4ZX3A 4ZUSB 1VEMA 2DM3A 1QATA 4FXGC 5E6YA 1C16A 3TOPA 5GGQH 4WI3A 4YHLL 4IRJB 1WFNA 2UUDH 3WNNA 1QBMH 3IN0A 5LG6A 3L1OL 2I69A 2OJEB 4K07A 1KBGH 3A67H 3BP4A 3T65A 3PS6A 5JOEA 3SDDC 5FV2A 1HL8A 4P05A 1WS8A 4DP4X 3WN5B 2DY2A 3BAIA 3NDZE 4KMQA 2ZP0T 5FOBB 3DKHA 1VCBC 1SHMA 2B1OA 1MCQA 2D9QB 5TQ2H 3U9WA 2DYPA 1AAJA 3GC3A 4F9PC 3WLWC 3SE3C 3IPBA 3QUZC 5LJYH 1Z9SA 2N0KA 2O93L 3MRRB 2X6BA 3B8SA 3B34A 2DEYX 4L8SA 3OHXC 4Y4FC 4X42A 1RURH 3OB0H 5L7XL 4Q2ZA 4P9MH 5AVSB 5AVUB 3ILPA 5CN1A 1DR9A 4XH2A 1HN1A 2R29L 3G5VA 5ENWA 5EIIG 3RVWC 1L3WA 3OAWA 1CG9B 2X2UA 1AZBA 1NFDB 4LVEA 4LGSB 4FF9A 3MX0B 1U4EA 4UANA 3WY1A 4TUOB 3WFDH 3LCYA 3SDXA 3DPBA 5DHXB 1C1EH 5IJKC 3BKCH 4L4TB 3ARBD 2R2BA 5ADPH 4IBVA 1BCIA 4NUGH 3HG0A 4HOMA 3MUGB 3D25A 1NJ9A 3B7RL 4WENB 1QFUL 3AROA 3PJSB 4WFFD 1NEZB 1BP3B 1FN4A 1KG0A 1K5NB 5DJXA 3TJHD 3IJYA 4APQB 1KGCD 2V7NA 3D85A 1BJ1H 3IDIB 4HX1A 4LQFH 1WFJA 3RYMA 3DTUB 3CIAA 2NY5H 3PWPB 2ITDA 3O45A 1WE5A 2OX5B 3QO1A 4C55A 4S1RL 5CEZD 1QFOA 4UTAH 3CFBB 5AD0A 5LBGA 2NYZA 2PYFA 3P4MA 4KHXL 5KANI 1NICA 1I7UA 3H9SE 2KDYA 4EIGB 5FYJH 4X2UA 2LOEA 3F01A 3S8FB 3KHQA 1A3RH 4OFKA 1CMOA 2J8OA 5L8JB 4MRBA 2VR7A 1FFPB 3LKOB 2MQ0A 1Z9PA 5DHEA 5I6XC 4UQEA 2VW7A 3Q2CA 2BVPB 3PWNA 1JZ5A 1KCSL 4CBPA 3B1UA 5BV7B 4IJ3C 2QVIA 1A6AB 3VWKA 3B5TA 4NN5B 4W9ZA 2AXJA 4DSYA 1HHIB 1U8MA 3SYQA 3G6DH 5C0AA 3UBXI 4Z7VA 1PAZA 5B38G 2VUKA 3OLIA 2W9LA 4KZ0A 5TTRA 2HKHH 3L9RA 2WC7A 1FL6B 4RCAA 3DRTA 4PWEA 5I8CA 3FQ2A 1GJUA 1ND0A 3UX9B 4B27A 3VQ1C 1MCOL 3C5JA 4JO3H 4NN6B 4Y9GA 1ECYA 4W9KC 4UOQA 1J05B 1VERA 3MLRL 3EXJA 1S7SB 3S35H 1SEBB 3QC6X 1F8TH 1YPZF 15C8H 2YQ3A 4QXGH 1IX2A 4M5TA 3EYUL 4LEEA 1I3GH 3QXAB 1J0KA 1VFUA 1CXKA 2DEXX 4UM9D 1Z5LB 1YNKL 3K2KA 1NFIB 1NUNB 4WWOA 1DBJH 1Y18B 5F7YC 1ZCRA 2J55A 3MRBB 3HMXL 4Z0XB 1WBXA 3NP4A 3BH8A 2E7LA 1ZSHA 2DYSB 3WKPA 5DZLA 1RZ8A 5HSFA 4XNUL 3HRZA 3MV9E 5C0IA 2YMTA 5EUKA 2X09A 4DEPB 1TO5A 2R8SL 2VLKA 3DIFB 4A2GA 3EGXA 4KTEL 3LSOA 3O4LD 4WV1C 3WXVH 2J8UB 2L7JA 4OZHA 2ZX6A 3UYPB 1LP9A 4RH4A 1TNNA 1V05A 4KJWC 2DRUA 3QFJB 1HIML 2D3VA 4I5BA 4JFOA 1DDTA 1I3UA 1WA0X 4NDMA 2R83A 5AAWC 5CAYB 1JYXA 4IDJH 3TV3L 2WWOA 4DP5X 3GNMH 4MXWH 4XP9H 5HYFA 1Q8MA 1GZHC 3HB3D 3ZJAA 2DQHL 2OTUB 1TJHL 5LNGA 4MS6A 4NQQA 2H6PB 2X1OA 4NKOA 4PJXE 2EAEA 3LDBC 5D96B 4JGNA 3QQ9D 3M8OL 3BKYL 1RKRA 3ZGIA 1KJ2B 2VMEA 3F7VA 4LXFA 1F1DA 2DL2A 1SMAA 3BSHA 4LEBA 4RNRB 3MU3A 4XT1C 3VTMA 4DK5A 4ENEC 5AYUH 2Q5BA 3VFVA 3RVUD 1A4KA 4ZZFA 5A2KH 5HYJE 4JCLA 1IC4L 1T89C 2YEZA 2WLKA 5C6TL 3M45A 4MMZA 4WTQA 4J6RL 4PLOB 2PP9A 5ETUB 4QDGA 2O6CA 4X6BB 1YEHH 3UCRA 3RUGE 4DO6A 5DQ9A 3WJJA 4A6YA 5JA8B 3GBMH 4KHTL 3REWA 4YX2L 4G8GB 4GUPA 2P8LB 3QXUA 2WO4A 3ZY7A 1WQVT 2WXMA 1OAUL 1WGVA 3K6FA 4M3KB 3SSGA 5EC1A 4YO0A 1ACYL 5DFAA 2H0FA 3AY2A 3NIDF 1GY2A 3D2UA 3O3AB 1V54B 3S36H 3I50L 2DM4A 4DQOL 1RVFL 1MLBA 1RUQL 4UT6A 1H5BC 5J4MA 5EMYA 4G8IA 2VN6A 1ZKAA 4JN2B 3WO4C 3S8GB 3SJVD 5B3NA 5IB1A 3IMVA 4O5LL 5IFJB 4ZBJA 4R26H 5IVXE 4ZMWA 5A16A 3SDAB 1D5IH 5FO9B 2IANA 1X5KA 4X4MA 3KLHC 3IE4A 1IFRA 3P4OB 1LILA 1G87A 1KCRL 1G9MC 1AD9A 4OJFH 3VXTA 5KJ4A 2FBJH 2OL3L 5JXAL 5ADOH 4LSUL 2MPAH 3W81A 4JREC 2PW1B 1VSCA 3C8DA 2ED9A 4FD0A 4KPHL 4I85A 5C6PB 2DJSA 2CALA 5SX5H 1FJ1B 2Y69B 3OB8A 5D6DA 4HWBH 4LU5L 2PXYB 1HEJC 5EA0L 1QSFD 1JV5A 4HUXB 2DLTA 2DQEH 3MODL 1U95B 5L2JB 4FP8L 4AQ8A 1KACB 1DJSA 4U1SA 4GO8A 4W9HC 1HINL 4WEEA 4ZAKB 1U33A 2YMXH 1ZEAH 3EOAA 4NPJA 4J3OG 3V79C 4NHUB 3Q0HA 1Q90A 4KJYB 5BZWB 3HN3A 1PSKH 3HS9A 3E3QE 1UH4A 4CMMA 2N0MA 2V5TA 3VGHA 4R4NC 4XBGB 2J6EH 4UQ3A 3QNFA 2VDKL 1W72H 4R7NB 4X99B 5E4EC 3VFOB 1Z3GH 4L2YA 3KLQA 4MB5A 1JNNH 3QHFL 4K3EL 2J5WA 1INEH 2B5IC 4MMXC 4YGVA 5L0QB 4IBYA 5B4MD 4OQTA 5ACZB 3VYNA 1JZ7A 3SGKA 3PQYA 3RILA 5ANHA 3F6JA 4KXZI 1IAKA 1S7VA 2ZCKL 1CL7L 3K1KC 4ZS7L 2ZWNA 4FQIL 1DE4B 3BQUB 5J3HD 3UJTH 1PG7H 2IAMA 3WS6C 4NWTH 1AJ7H 5JDJA 1XB3A 3EFFB 3BGMB 3DX6A 4HK0A 1BZ7B 1SLUA 3QPXL 1QRKA 3GMOA 3GRWH 5C07B 5DZNA 1KB5H 4HZAA 4OF5A 3FCTA 3V0FA 4Z23A 3IXTB 2WXKA 4JY6A 1YG9A 3U48A 2EXSA 4WGWB 5IKCB 4YPGB 3DX1A 1NIBA 4L48A 5E00A 2HLAB 2FQEA 2JKNA 1I4FA 2AJZB 2ZXDA 3W0WA 3AU1A 5I9QC 2VC2H 2EKSA 2UYLA 1TG8A 2YZ8A 1E9PA 1PY4A 4JN1L 4L29B 2BOCB 5DHYB 4ANVA 2JJTA 4JFYB 3A6BH 3FU9A 4WKZB 3EH5B 5FO8B 4GKZB 2QPFA 3QZPA 3HFML 3ULVH 3LKSB 4DO4A 4WO0A 1D9KC 1MFEH 2XRAH 4PJDA 2YPVL 3MN8A 4QJ4B 2BMKA 3L4TA 5D1QE 1W8OA 2CBTA 4NIYE 4I77L 5BOJA 2BY1A 2IH1B 4OZIB 4PJIE 4TQEH 4IRJD 1VJSA 2AGJH 3TNMB 4FXGB 3RU8H 2AABL 1CZ8H 1U4FA 1XIWD 3EJPA 1AR1C 2AV7B 2FEJA 4GSDH 3V5HA 4AV5A 5CHNA 5HVHC 4BZ1A 1RMFL 2XWJA 1SF3A 1EQWA 3BFWA 3VRLE 1T0MA 4U4BA 3IMWA 2Z0UA 1F13A 1G6RH 3SDDB 1JV2A 1XB8A 1NAML 2HCZX 4ODUB 3MFFA 5KEZA 1DBML 4JKWA 2X4NB 5CIPH 5M95B 1MFVA 1OE2A 2VQ1A 3QORC 2XXCB 1NCDL 5DHVB 1OAJA 1MCJA 4IOFC 1HL4A 4KY1H 3RURA 3V4PB 3VXRD 1G1CA 1NANI 1PL3A 3QUZB 1UA6L 1NCIA 4M1CC 4XVTH 4EN3C 2EVHA 1RSYA 5EU7E 4Y4FB 3OHXB 5BRZE 3G9AB 3ZKND 3CTTA 1MCDA 4FFZL 5TGBB 4NUPA 3CVDA 2A6KA 2PNDA 4DGIH 1EJ8A 1SUHA 4TLSA 1BOGB 4BQ9A 1GAFL 5FGBC 5LLIC 1EAJA 4LRNH 4K8RD 2VJ0A 3KPMA 2DEWX 2QVMA 4F2MB 1N3NB 3B2UC 4Z78B 4PJ7A 2SEBB 3P0VL 4YL4A 4L3EE 3U0PB 4B9ZA 4GUOA 3SBWC 4FXLA 2GC4C 3BZFB 5JPMA 1JYVA 4L4TD 2OJ1A 4LSSH 4K3JH 4PLKC 2WB7A 4X7SH 3T8XB 5SV3A 3G5YA 2UXVA 7PCYA 5DI8A 3AADB 4ZX4A 1RK1B 2E5EA 2OXHB 3UJJH 4XBMA 3M6DA 4DK6A 1DBBL 4PLJC 4K5OA 3LQAH 1E27A 2NW2B 4EPSA 2VH5L 2O5XH 3FL7A 4OD1L 5F1NB 3G04A 1L0XA 2XG5B 2BOBB 3AREC 1Q9WB 2GSGB 3G3LA 43C9B 5I6NA 3CDZB 4XXCA 4LASH 4XTRD 3T3MF 1LO5B 5DJ6B 1IGFH 5D7EA 2QELA 4HIXH 5HYSG 4WU7A 2YD5A 1CE6B 3CK0L 3FQRB 5CJ8A 3CN1A 3FQTA 2BNUA 4PS4H 4Z7UB 1P7QA 1QYGL 2ED8A 3CQPA 1BGXL 1BW8A 3B7YA 4ZQKB 1U21A 1VENA 4QRSB 3MXVL 2FJFA 5D2LA 4MNQE 4P2CG 1GGCH 2OFQA 3NJKA 5K9KA 1E28B 5C0DA 3PHOB 3RDTA 4EVNB 3LH8A 5I6XB 1IEHA 5T3ZL 3K2MC 4XO5A 3K4AA 5HHNA 2BRQA 5FO2A 4FQHB 1MCSA 3S2AA 4XNBA 5GZND 3TCXA 1A1NA 2FYYA 2DQGH 2NZ1A 2VDLB 1MJ8L 4N0UB 2X10A 5F89B 1TSRA 1N6QL 1DVFA 3F65A 4PR5A 3CDGB 4H2AA 2DIAA 4EDWH 1GZQA 4YSAA 3TFKC 2OKMA 1AFVL 1UWFA 4HWEH 3DC0A 5CEXA 4LBEB 2BRRL 4KZEH 1FIGL 2I5YH 2QEJA 5D7LB 1FH5L 3MLWL 2BS71 5T3ZE 3LNEA 3GSVB 3RHWK 4NRZB 1GC1C 3S5ZA 1S9XB 2AS5M 2VN4A 3NGBC 5EIIB 3RTQA 4Q9CA 2UX6A 3ZW3A 2OR8A 2WXJA 4PTUA 1E4WH 5GZOC 2GCYB 4PJXF 4OKDA 4WHYH 4ZFFB 1QRND 2QPSA 2KLSA 3B3BA 3NFNB 4P57B 4GI9A 3RQ3A 1C12B 5AKVA 1TIUA 4GMTH 1DN2A 3VXUB 4V1DE 2OTWA 4IS6A 1BZDA 3HG3A 1CGSH 2QSTA 3P2BA 1T7XA 1F1AA 5J9PA 5HPMA 5IOKA 4I8DA 1QFWM 5GSRB 1QKZL 3LD8B 1XR8A 2WD0A 2EXYD 1EV2E 3OLEA 5IV2B 4K3DL 5IW1A 2WYZA 1OCOB 3JWNC 5FUZL 3EBHA 5E5MA 2BK8A 2W60B 3QFJD 1SY6L 4XAKE 1YPZB 5B3SB 3RUGF 4HJ0D 3Q8EA 4FFYH 4GRWH 2J1WA 3G6JF 4QWWC 4HUUA 4FTDA 2WMPA 3ZQXA 4FFWD 1YMHA 3RRQA 3H3PH 2XJKA 3VRIB 4P4KA 1I8LC 9CGTA 5JR1H 2PPDA 3NFSH 3QDGD 5DRZA 4MS8C 5G5DA 2DQUL 2EXWD 3GSNA 3LDBB 2EVGA 3IGFA 4PGCA 4WFGD 5BOPA 1TVBB 4N90E 4EBQL 4HSAC 3LTVA 4QR7A 4UM9A 1FL5A 2FEDD 5IGXH 2CKBA 5IR1B 3D0VB 5F96H 4DKFH 4HISA 4C56E 1NEUA 5IVXF 5GSVB 7PAZA 3CZSA 4PRAA 5EEYA 2NTFB 5C8JB 2UY7A 3FU8A 3P3TA 2EC8A 4QOKB 4ESKA 3NN8B 4I48A 2HTKD 2QSCL 2H3KA 4P5MA 1IFHH 3MACL 2AKRA 4Q89A 3L5IA 1NMBL 4HJEA 3A21A 3EJYD 4N6RA 2EIZB 3T08A 1YYCA 4E41E 1AXSA 3PV7A 5C0GA 1WTGT 1K8DB 2VKXA 2ZKYA 4KK5D 3MRGA 4M5YH 1MVUA 2YD8A 5IQLA 1J8HD 3ZN6A 1M71A 2XA8L 3US0A 3T77A 1NWPA 5CSBA 4EZMA 3RNKA 3FT2B 5ESVB 4DGYL 3O6ML 1YYMH 3S3SA 4ZSOB 3DJTA 3FMGL 4N8UA 3RG1C 4CNIB 5DR5L 2F8XC 1NBQA 3IDJB 4M5ZH 1H5BB 4IRZA 1WC7A 1MW2A 1KCVH 4BZ2A 5E8PA 3DX2A 5BZDB 4RBPH 1ASPA 2KBGA 2PCPA 4XMZA 1NBVL 1P6WA 1PLBA 3HR5A 5DD3L 3WE6A 1AE6L 3QI9A 2ZOLB 2DM2A 2BNQE 2APXA 4D94A 1M42A 4PGJA 2QZ5A 2YGQA 1CXFA 1DSFH 1R5IB 2DMGA 3LOWA 1JGUH 3CMOL 4F58H 4X0KA 3BW9B 4MD0B 5I1AA 3NIDB 4JFFB 4B9FA 2AI0L 2DMCA 3EGDA 3D08A 1E9OB 2NZ9D 3PXLA 1CIDA 1T1ZA 3QFDA 2PXYD 3QG6A 3BRGC 5EZOL 2NPLX 3N44F 3BLPX 4PJFE 4PI0A 1EXUB 2C9PA 1IM9B 3S5YA 1JGVL 2WQRA 2IBBA 2W80C 1JRHI 3CZKA 1I1CA 1THAA 1KF9B 3WIHL 1NH6A 2CM6A 2WZAA 3E3QC 4X4XB 3SE9H 1G9EA 1S3KL 4D9LH 1OLZA 4BK5A 2VDNH 4H0LC 3APDA 3LKPB 4UINH 4ZS6D 2BWIA 4FFVD 4PRIE 2DH2A 4LIQH 5FFOA 3VCLB 4PGBA 4R8WL 3IU4L 3MRDB 4NO3B 2NDFA 4AK1A 2M2DA 2YD1A 1MNNA 2QHLA 4KMTH 3O3UN 4G3YH 4XN9A 2IFFH 2NXYB 2OMNA 3K6IA 4YEFA 3VD0A 1VACB 3CLWA 2XVGA 1KN4H 4GKNA 5KW9H 5DEGB 2B5IB 4MMXB 4BWUA 2CH8A 2O5YL 2UY6B 3V4VH 4AJ0A 1IAIM 2QGEA 3GMLA 3I6GA 3EYFA 2Y36H 4FULA 4YH6A 1BXVA 3PWJB 1QTSA 1MRCH 5KBPA 3UBGA 3V52L 4MD4A 1RIHH 4QGTA 1MKFA 4PJIF 5K9QI 3VM7A 3TJEH 4PB9L 7CGTA 4QIRA 1MI5B 3HUJE 4X6CE 4P2YA 2AERT 1AO7B 4F3FB 2J5LC 3UH8A 5L88L 1E90A 1QSFA 1O6SA 4ZUUA 2BNRE 3JV5A 4JRYD 1KYAA 2IQ9L 4AZ8B 3GKZA 2XV0A 4AMWA 2XV2A 4GFXA 3ZKSD 5DJYA 3TU6A 4LKXA 1BQSA 2ZOUA 4ICWA 3VRLF 5I1HH 1UJ3C 4H8HA 5I9QB 4ABUA 4U1MA 5GGVL 5BVJA 1HOCB 3QJTB 2X12A 4DETA 2FGWL 4Z7NF 3EDEA 2CLZB 35C8H 4OF6A 1D9KB 2X6UA 2Y9RT 1MW3A 2JKSA 4NZTL 1A7QL 5DC4B 1QO3B 5E5RB 5KJ7E 3ZPDA 2XWBB 3PUCA 4JHAH 5I8EB 1QFPA 1KJVB 1AGBB 4N5UA 1I7ZA 2WUCH 4H8UA 2WNXA 2ADIB 3LRKA 1XGQB 2ILLA 3OPZL 4HQQH 1V7NL 3AW5A 1SLVA 3UXFA 3MRFA 2DAVA 3P4NA 1MCPL 4WI4A 3V4LA 1T1WB 2YA0A 2A5UA 3CIQA 1I9RH 1NCGA 3P2TA 5LBVA 3QEQB 3IAGC 1CGTA 4OR1A 3COOA 3VTTA 3VFTA 5LWYH 1MFMA 3GHBH 4E9LA 5HVHB 4TPRH 4OV5B 2FO4B 2VCOA 3KLAB 3MJ7B 5F1KC 3MRMA 2L0DA 1ZAGA 3DIDA 4DF9A 3K6NA 3HZMA 5D7KD 4RISH 2IPTH 4MHHG 1MRDL 4OI9A 4XPAH 2G5RA 1A64A 2FX8H 1YSOA 2JCWA 4P23A 1BF8A 1A21A 3HPJB 3WIFA 43CAB 3QORB 2XWEA 4FRWA 5F8RC 5IESH 1JPTL 1A7RH 4Y4FD 1U58B 3MOAL 4NNPL 4ZFOA 4OLUL 1QD0A 4EN3B 5EOCL 3M07A 2CGZA 4Y19E 1JYNA 2N56A 3LPOA 5IIEB 3M88A 2CIIA 1J9QA 4MA3A 1FYTD 3OZ9H 1V3MA 2IWKA 3SEPA 2WK2A 4PCSA 4NNXB 1U8IA 3C60C 2ORBL 1PEZA 3MFGB 3RVWD 4IKIA 4MD5B 2W65A 2FB4H 4ODHH 3N40P 5KVFL 1XH0A 4XP6H 3CVBA 4MA1C 1FVEB 4OAWA 5D55A 1X4ZA 2R0WL 2WO2B 2X89D 3POHA 5ALBH 3WEXB 1UASA 3OQRA 4F8NA 4NPYB 3VG9C 4LPUA 1E4HA 4D0DB 2QSQA 4G6JL 4YHLH 4J3OH 4D9QD 4KZDL 5HJDA 4Y5YC 5KYYA 3CX5K 4CDHA 3RHWF 3L5WB 5I1JL 4MJHA 2P80A 1XXFC 1DLHA 2G9HA 1RK0B 2Y72A 5E0QA 1FRGH 5K39A 3L1OH 5KVFE 5IK3A 3B9DA 4GQRA 3BKMH 2Q2EB 5BW7A 4C83B 2Z8VC 1B0IA 2C1PA 2CKNA 3FRUA 4N85A 5EO9B 3RP1A 4XODA 4ZFGL 3H9SB 4H88L 3L9YA 4YSOA 4CADB 4XB3A 1VPOL 1QSVA 3AREB 4NKQB 3VXRA 1KPUB 2MPVA 1LLAA 4GRLC 4FKKA 4UTAA 5IW6A 1QFWH 2ZJSH 1E5ZA 4LVOC 3VACA 3RJQB 4FKEA 3AT0A 1XT5A 3U4BL 4K5MA 4P2QE 4JFDE 5SWSD 3WTYA 5E08L 5KSBE 2AJUH 2JNZA 4DVBB 2YAHA 4OFYA 4JKNA 5FDWA 2BW5A 5HDBE 3UGUA 1E5BA 5DA4A 1ACZA 1G5GA 1URZA 5JORA 4B53A 2JKIS 2EE6A 6FABL 1TFHA 3US9A 2X0VA 3HTLX 3LKNB 3T3MB 2HT2D 3MREA 2B59B 3NAAL 2OPCA 3VNZA 4BK4A 1HX0A 4YNYA 3ZUNC 5JXEC 1NWOA 4N1CA 3J07A 4NM8L 2DWEA 5D7LD 2C1OB 5DTFB 4ZW3A 5K1VA 3SDCA 1HXMB 4H4NA 1UVQB 2WANA 1F2QA 4WJ5A 4ZMTA 3Q05A 4U1IA 4ETQB 2WINA 2MSPA 4PJBB 3NGBB 3X1BA 4H25A 4WNQA 1TJGL 4P4RB 2YIHA 4ELDA 1OAXH 5MENA 4G8AC 1MUJA 3U9PH 5I76B 1K3ZA 1F41A 2A83A 2PO6A 4Q58C 3DXAB 3S0PA 3SQBA 1LO4L 4BQ6A 4S1RH 4QTHA 2RFXA 4BKLA 4Z7OE 1WAAA 2FWOA 1Q9LA 4C4BA 4KHXH 2VW6A 1E3XA 1BXUA 3GRGA 3PU7A 5T3XH 1R46A 3ESUF 4IMLA 1QG3A 2OLDA 2VXQL 4PCTA 1E5CA 3QDJA 2WVSA 3D69A 3I02B 4ZMXA 4Q9RH 3OV6A 5JHDA 4FI8A 2BXYA 5GZNA 5D7SL 3GWJA 1GA2A 4BFGA 3MROA 2P28B 3QUYA 5I82A 3RWDA 4OI7A 3UAJC 4NQDA 3AM8A 3U46B 5CGYC 3ASOB 1M2OA 1KGIA 4N86A 4PJXB 4DW2L 3X13A 1NDGA 3EYSH 2CRYA 2VQ4A 2H2SD 2FJHA 4FDWA 5C9JB 1IQDA 4AL8H 3AG4B 1FG2A 4MCYA 2EEDA 3BVDB 5FYLH 4Y16D 1QLEB 2OQJB 2YXMA 3LEVL 4QRUB 4AIOA 4JRXE 1MCOH 4RX4A 4YHIA 3ARTA 1NCAL 4LLQA 1LO0L 1R1CA 2KPWA 3KPRE 2ZKXA 3KYMB 4HIEA 4RZCA 1C7SA 5CMAB 1W9XA 2NTSP 3TXAA 1QRNA 3K81A 3STLA 5ICXB 2ZOWA 1WHOA 2A6DB 3RX5A 5HD8D 2OV0A 4HS3B 1U3HD 3HMXH 3G6JB 3RWGA 1F4WL 1KGXA 1HEHC 4V33A 1E4JA 3CSYA 2FZ3A 1C08B 1TYEB 2X53A 5LQBL 3QIWA 3W2DL 5M7QA 1BFTA 4XNUH 3SN6N 3V0GA 3MV7E 4PGDB 3VGAC 4IU2B 1JUFA 2V8MA 1NUGA 2F53D 2W92A 2P8MB 2ENJA 1UYWH 5DO8A 5FYJU 4OY9A 3V7AE 3WHE0 2I07B 4KTEH 1SQ2N 2O5NA 3C6LC 2LLLA 2FATH 4PJFF 3FFCB 4B50A 3ZR6A 3ELAT 1VFMA 1S8DB 1INQB 3F64A 1HIMH 3U6XS 2ATKA 4G42A 4POZD 4KAQL 3WV0A 4FG4A 2OMTB 2XX1A 4YBQD 5EF3A 1FZOB 1QLRB 1F5WA 4JZOA 2DDQH 3RL2B 5IBTL 2PTUA 4KO6A 3C08L 1AXTL 5FUCC 3QCVL 1HT6A 1F00I 1OGAA 4PJCF 3SD5A 4Y5VC 1TJHH 1MDTA 3IKCB 2IDSA 3JWOL 1QX1A 2ICWB 3WELA 1VFBA 3KLHD 1WBZA 2MHAB 2G4GA 3M8OH 3BKYH 3B6SB 1WEJL 4LF3A 2FLMA 3IJ9A 4QYOA 5F21B 1QEWA 3HI5L 5DS8A 5FCSH 3VSVA 1OQXA 4GMSL 5KWYC 1C5CL 3CFUA 3KH4A 4XP5H 3PDGA 2DICA 4IQHA 1FDLL 3ZIYA 4WI0A 2XN9B 1M05B 1MOEA 4N0CC 5C6TH 5E99H 2XC8A 4YVUA 4LOFA 4HWBA 1ZHKB 4PM1A 4PLNC 4CSSA 1R17A 3QYNA 2AQ1A 4B9JA 1WCBA 4GW5A 4CW1A 1WO2A 3UZQB 5BQDA 3ARFD 5GPRA 5EU6E 5AOKA 1KULA 3HUJF 1CFTB 1F02I 4X6CF 1AHMA 4YX2H 5JW4M 3Q1EA 5KS9A 3VXMD 1ILSA 1ZHLA 3K4DA 3EXLA 2DKMA 1OAUH 3DSNA 2CPUA 1TQVA 1ACYH 5BUGA 1HQRB 2UXTA 1XD1A 2P5EA 2YBRA 3H9YA 4O02H 5IMKB 3ROOA 4DQAA 4DQOH 1RUQH 2E8ZA 3FSAA 1CICD 1SBSL 3L3JA 4LSTL 4Y1AE 2J6EA 2NXYD 2WZPA 5IQ9B 5FYKD 1W72A 1CFNB 3P3RA 1HL5A 3KR3L 3ILDA 3QDMA 3N44B 4AQOA 3GIVA 4EMZA 1IKFH 2WQ8A 1CFBA 2DQDL 3V0DA 3VFUA 4YHKL 5H94B 2VDKB 3CCHB 1CD9B 1IC5H 1T6BX 3JV6B 3B2VL 4WF7A 4FTVE 3GZKA 5KSUA 5CCKH 5IHHA 2X4TB 1KCRH 1ZMYA 5E4AA 5AZUA 1KIQB 2R1XB 2OL3H 1GOFA 2E6JA 2JJVA 5JXAH 1PZDA 1FLTX 1TTCA 2GY5A 2VDQL 5CCHE 1AO7D 4KQ3H 3ASNB 4DN3L 5JZ7C 4W93A 5B39B 4KPHH 3GRWA 5HGDA 1EJOH 3ZYJA 2J5LB 1FL3A 1KIUA 1T5WB 1YEGL 4QO1A 4XCFL 4BSWB 4XMTA 1K3IA 1QSZA 2E59A 2Y23A 2KKQA 1PZUB 5DMKB 2B3IA 1WAPA 4R90H 1RU9L 4YSEA 4JFEE 4LNVA 1UJ3B 4FP8H 4I2XB 4NQTA 4Y2DC 1MCKA 2C5DC 1BPLB 3C8KB 2QMJA 1HINH 5D1QB 1H3GA 2QTVA 25C8L 4JRLA 1KBVA 1U0QA 3CC5B 1D9KD 1YMMB 2FSEA 4PJIB 1OSYA 4TSBL 4DHLA 3RY5A 4WWID 3IJEB 1I8KB 2XZQL 3GJFK 2KHAA 2WTRA 3FT4B 4XNYL 1T21B 5E2TL 2BVOB 1YC7A 3TBWB 5LBSL 3IWUA 4X7DC 1FZMA 5FKPA 1MNUL 1FNEA 4OCWH 2YJLA 4YXLH 1ML0A 3KPSE 3NVQA 3WI9A 2ADYA 2OW7A 5J6SA 5MI0C 3VRJA 5JNYA 2Q6WA 2WSDA 2QDWA 3TN0D 2QTEA 4PYHA 3VWJA 4GUCA 4YHNA 3MZGB 5T33L 1TQSA 3L3HA 3OX8B 2A99A 2MCAA 5FX3A 4P5SA 3RNQB 4Z7NB 3WGVB 3QR2A 1UADC 4YDIL 1G6RA 1BJ8A 2AMGA 2H3XC 3F58L 3VFPB 3QPXH 1P7KA 5CIPA 5E9NA 2K3TA 3CC1A 2L8AA 4QRAA 1G1YA 3SYAA 1XF2A 1YEKL 1L5GA 2R0KL 2VLJB 4M1CD 5BRPA 1OD9A 5MEOB 1TCRA 1ZIAA 3OKMA 5GGRB 2VTFA 2W9EH 1FO0H 2HFFB 2HJKA 4FERA 5GRVL 1CLOH 3FRPG 5BMFH 4YDLC 1MQKL 3H53A 4LCWE 5A6IA 2AZAA 4XNZC 2Z7YA 3OJ2C 5FEBA 3VI3E 3C60B 3HFMH 5EV7A 1S5IH 2OI9C 3V6OE 4LT7A 3IVKB 1JK8A 5INDA 1XBRA 3HHRB 5HHQA 4FEMA 4MA1B 2E74C 4BWWA 2XXFA 1Z1WA 2JE8A 4NO5B 5KSBF 3BE1L 5SWZB 1YA5A 1WDAA 4XGZA 5KOMC 4AG4L 2XXMB 4NKMA 1H0DB 4NPKA 1O75A 3VG9B 4FJZA 1LDPL 4WVRA 5DK2B 3F05A 3KE0A 3T5WA 3VO0A 5FXCH 3FONB 1JZJA 2X4UA 4Y5YB 4N2FA 1XSKA 4CGUB 1KEML 2OSXA 5E56A 4WO4A 4JG5A 1MH5B 4TNFA 5GGSA 1ED3A 4YFLF 2IXQA 3PCYA 4PP1C 1OM3H 1EFQA 3H9SD 3LNHA 5T5FH 5IF0A 4NHCH 3NA4A 5FW8A 4ACTA 1NLDL 4PD4J 4CN4A 3MQIA 3UOAB 5CLWA 2C9UA 4FNPA 1UM4L 1NCDH 4GRLB 3VFGL 1P7BA 5I6LA 3WHXB 3FH5A 1IGCL 1UA6H 1OT4A 4LVOB 1RLWA 1ULVA 4L9LA 4MMYB 1FYTA 2WVTA 2ZCZA 3SGJA 2F6AA 3D6GA 3W9DA 3FFOA 3WLBA 4ZMAT 3U0TB 2V9RA 2CR3A 1LO2L 1DUZB 4FFZH 3KEHA 3F12B 5E6UB 4OLVH 1AQDB 4C8XA 3T6QC 4LDEB 1BVKA 1LE9A 5IQOA 2NNFA 4QHMA 1X5GA 4BFBD 3WNJA 5F7FA 2ID5A 4JFQA 2OR7A 4Y9BA 1LEIB 3QISA 4JKKA 1S7QA 2ZZUT 3HFFA 2YWZA 5D7HA 1KMGA 2X9ZA 2D7TL 3CLFH 3ESOA 4KKAD 5EHFA 1R5WB 3DX9A 2BM3A 4HJUA 5D7IB 2DD8L 1I8UA 3J2PA 4KK8D 4S10A 4DEWA 1BZQK 2PWGA 2CBOA 4WI9A 2XQYA 3OGCB 2NYYC 2HUEA 2GK0A 3F7YA 1XWVA 3BUQA 3FKUS 3HG5A 3LHAA 5DJDB 3SPVA 2VH5H 2ED7A 2XDHA 2A9DA 2W9DL 3NSFA 1ETZA 3OMAB 1T7ZA 3EYVB 3I3DA 3MV9D 4AI7A 4Z77B 4LHJB 4P5RA 5EFIA 5I2IB 1XR9A 3WSQL 4GKSB 1BIIA 5LG1A 3ZL2A 1XF4B 3PY9A 4FI6A 4C47A 1KJMB 4NM4L 3BDXA 1BGXH 5TE6L 5F0PB 3TVMA 4DP7X 1HKFA 5CJXC 2H3NB 3MXVH 1A4JB 1FAIH 2K8QA 1H3UA 3GSOA 3QHZL 2IALB 5CEYB 1PZAA 3MNZB 5DK3A 2HN7B 4GG6A 4BH7B 3VFMA 3V9CA 3HRPA 2L7EA 1JPSL 2X2HA 3MV01 5DYFA 2LE9A 4QTFA 2X4OA 2IO5A 4FFYA 1WZKA 1DJGA 3QAZC 1MJ8H 1RZJL 1OANA 1N6QH 3X1GA 5DO2C 2DQFB 4HWZA 4JLRA 1S7WA 4XPBL 2NW3A 1I9JL 1AFVH 2I7SA 2N7BA 3ARYA 1CGVA 3NJFA 1N59B 1HSAA 3ARGC 5HJGA 3ARUA 3D51A 1BD2E 3MLWH 1UQSB 4FL4C 1CDGA 3VNYA 5HYJD 3DVFA 2W88A 2BZDA 2NY7H 3BO8A 5IOPA 1NBYA 3AG3B 1UG9A 3KVQA 1LK2A 2BP3A 4IBLT 3TV8A 3MLYL 2NY3C 1OOAA 3D1MC 3S96A 1UXWB 1WWBX 2CBPA 3AUVA 6TAAA 1JZHA 2X1PA 4N2BA 4ONOA 3MRKA 1OSZA 2NX5B 4RWHA 4P2OC 2A38A 3HC3L 3IDYC 4E41B 4RSVA 3SBQA 4KJQC 2ZG1A 5I1EL 1RJYB 4N3TA 3ML9A 4AEHL 3QUXC 3VGAB 3GBDA 2IDUA 5FR3A 2Q7NA 4LCCA 2VL4A 3GDCA 4UBDC 4YDJB 1DQDL 1JPGB 2AXFA 3BRFA 4CUCA 3QJVB 4YR6A 3B3IB 5LGHL 5A43C 2V9UA 1R3LB 4NFCA 4PY7B 3P0GB 3C6LB 4G9DB 3QVAA 3T3PB 1L0QA 1R3IL 5I1DA 4D8PB 1OKEA 1Y1DA 2V4LA 3WNLA 2QL1A 2Z92A 1X5AA 1H15A 1MRFL 1WFOA 2JKWA 4ELMA 2EO9A 5BO1H 4ZUTB 4MAYC 2BNQB 5A3IC 4P8QA 3NZSA 1DANU 3WCYA 3MJ9L 5TD4A 4I18C 3NACL 3KLDA 2HKFL 4QAWA 3VFRB 9PCYA 4Y5VB 4TLTA 4ZW5A 4L8DA 2ZX7A 2YD9A 4HS8L 4HSQA 4R96B 5DDHA 5IT2H 2A6JB 4J8QA 1KUMA 1DYZA 3T1FB 4EBQH 1AZCA 1CFMA 3ZYZA 1OL0A 3ESMA 5JHAA 1LEGA 2VMJA 3EOTL 1U9KA 3CN4A 5AUMA 5D1ZA 4QHUA 4XP1H 1IBHA 4HT1H 2EC9T 3O2VL 3D52A 1GGBH 1EEQA 1Z5YD 3Q43A 2D9CA 4XN4A 1A6UH 5B7EA 4IYKA 3CLEH 3Q8CA 5DSCA 2FECI 4HUVB 2HMID 3HOGA 3L3GB 3ZLQC 1WRFA 5TDPB 4UDTA 1BQRA 4XVOA 1HXYA 4HHAB 3MACH 1MWAB 3VSQA 3MLUH 1HHGB 4PJCB 4XO9A 2ZXEB 3QRLA 3KS0H 4N87A 5CFHA 4GJTB 2CAKA 4LHQB 1Z5HA 4BSJA 2ESVE 1OF2A 5ANMB 2FTAA 1BWMA 3RB5A 3SCMC 1KLUB 3F5WB 4IRSC 2ZWYA 3LQMA 1J9CT 2QQKL 3QUHA 4QHNB 1X5YA 1ZTXL 4DGYH 3O6MH 1OCCB 3FMGH 3L4VA 4Q6IA 4GINA 1TZ8A 3FHAA 4AIZB 1CIUA 3UZEA 1JXGA 2AVFA 2EDWA 2V3FA 4HKJA 1CPUA 4AENA 5F3BA 4XHJD 1A8JH 2OMYB 2BSTB 5SX4H 5CLXA 1XF3A 3IMRA 1CD8A 4JG9A 2IJ0C 1NGWB 1NBVH 5DD3H 1G5AA 4PY8I 3V4VA 4DP9X 1JPFA 3TPUB 3HUJB 1I1AC 1BQHA 1ZJAA 3D3VE 1JWUA 2KYIA 1ZTXE 5KYUB 1XQ4A 4PJGE 1K9TA 2BNRB 2Z34A 1IKNA 3FULA 2N1TE 1MHCA 1UA3A 3EHBB 3ETBJ 4NO2A 1T4KA 4M48H 1MXGA 2ZOKA 3CMOH 3H9HA 1OAKL 3JTBA 1VADA 3PP4H 4U3CA 2ZYRA 1PD6A 4F2EA 2F54A 3KCPA 3NPZB 5EZOH 5GJSL 3HNVL 2NY2D 3ARFA 3HPLB 1ZLUH 3RWHA 3QUGA 2VDRL 4AM0B 2FR4A 1JGVH 1U8OA 5BQ7B 1NTDA 3HI6L 1FNGA 1NMCC 4LLDB 3WIHH 2D31A 1GYCA 1QNIA 4Y2DB 5D1QD 1V3LA 1JD9A 4M8UA 1MG3C 1BYNA 4QKXB 4RRPG 3EOBB 5HI4D 4HV8A 5HHVL 3D4GA 4UNIA 2BP8B 2APFA 3RWJB 2I60H 5T1KB 4P2RE 3IU4H 3WTSA 1NGQL 3ARDC 3NA9L 3WUWA 4KFZC 4GIAA 4Y4HC 4ZFZB 4Y2LA 1LHZA 4F37F 1KELL 1KCBA 4KROC 2F1AA 4YHPA 5DJZB 3ETSA 1LGVA 1GTFA 1JWSA 5F9JA 4TUUA 1QA9B 3VI3F 3AWGA 4AKOA 5JLZA 3LPFA 2HYMA 5B8CC 4FXTA 4PGEB 2O5YH 5MI0B 3BMWA 4KOBA 3B2MA 3VI4E 4L8CB 5DCCA 2J8HA 3TIDB 2WWMD 4OW6A 4JUSA 4Z3FA 3V0AC 4M1GL 3A6CH 1W6LA 3FU7A 3SKNA 5DRWB 5AAMC 3CFEB 5IM7A 4PB9H 3B4NA 3EDFA 4YHML 5BRZD 4JO8A 4KKCD 5IJVA 2D8KA 4JDEB 4LP4A 4Y19B 2DQCH 1CXEA 5ID1B 2B3RA 3HE6A 3RJDA 3ZYOA 1G7MB 5LXGL 4OGXL 3CFKA 5CM1A 4S2SB 4WWKC 4UV7L 3GT6A 1H3WM 3MCLL 2ZKMX 1CQKA 3B8YA 1NFAA 2BSBA 2XTLA 2OYPA 4L3ED 3DX7A 2EDYA 2P7TB 4YDLB 3PXHA 2VISB 4PJ8B 4XNZB 2XY2A 2QVFB 1RUAL 4KO9A 4XB7A 2VM3A 2HZHA 2NUPA 3QUKA 5KSAB 4L37B 2F7OA 2OI9B 4TULH 4NZTH 3TEWA 4WNJA 3RL1A 1A7QH 4ODSL 3PPSA 4AIEA 5CP7B 1Q9OB 5IB3B 4H26B 2CJ3A 1XH3B 2AAVA 2JQAA 4HXAH 2VMCA 4KTGA 2BPBA 3OPZH 5BUPA 2QLYA 3FAXA 1X9QA 5CO1A 3TN0A 3DX8B 4NKDA 3K74B 1ZGLM 1BLIA 4LHUG 4TNEA 3FB8B 3CU1A 2OK0L 1NBZA 4UM8A 1RZKL 4X7TA 4L9DA 2NNAA 3R06B 1YEEH 1OIOA 3L5XL 4XRCB 1T0PB 4MQTB 1QR1A 1WT5C 2PCYA 4LLYA 4PRNB 3GINA 1LVEA 3FUHA 2EIJB 2LLNA 2DV6A 2AAAA 1OGTB 2X4PA 4MNQD 5C0AE 4JRWA 4Z7VE 3B5GA 2IIJA 2JIXD 3G6AB 1E30A 3O2DL 5KSBB 2CA4A 4AIXA 3BDYL 4OZGB 3S3BB 4OLUH 5EOCH 2G5BA 1GRWA 1SUJA 1XGPA 2E56A 4GKLA 5D1XC 3RPIB 2QT6A 4APXA 3NSXA 2AJ3A 3S3JA 3H7BB 4LLVA 3H6JA 1W0VA 3FCUB 3MRIB 4J27A 2PR4L 1ZLVH 3RWFB 3UZVA 2COVD 4PMFA 4AE1A 1GIGL 2ORBH 4NCDA 1U36A 1Y07A 2WYHA 4JZJB 1VA9A 3C6SA 5JHLL 4JHBA 5T3ZD 4X5LA 2ADGB 1T03L 3FQWB 3BAXA 2XFGB 4TVSa 4K7PX 1SOQA 1TYRA 2MCMA 1HDMB 2NSMA 2XZCH 3VVVA 4G6JH 2IVFC 4LK4A 3LEXB 4X8JA 5DUPL 4XVUC 5ESAB 3GB7B 2HVJB 3MUJA 5JUEH 3IJHB 5BOZG 5ABDE 3AQDA 2BS8A 3TO4A 1OCWH 5I1JH 2VLKE 2NY1C 3GBEA 3WD5L 5KUKA 3VFSA 1IVLA 2F8OA 3E7JA 1JGIA 2A9MH 2P47B 3N43B 3QP3A 1NC2B 1Y7VA 4CRPA 1EHLH 4V1DD 5DHVH 3FB6A 3HG1A 4X8XA 2YPLB 1AGFB 4NQCE 1EHXA 2J6WA 4YUEL 1IEAA 5JOFA 1YVLA 3SKJL 1DQTA 1FG9C 1AC6A 4ORGA 5GGSY 4Z5RB 5C9KA 1MCHA 2QR0B 4J4PA 3BRDA 3HZYA 1Y6MR 1KT2A