1J5IA

Solution structure of a novel chromoprotein derived from apo-neocarzinostatin and a synthetic chromophore
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
113
structure length
113
Chain Sequence
b'AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (Apo-Neocarzinostatin)
publication title Solution Structure of a Novel Chromoprotein Derived from Apo-Neocarzinostatin and a Synthetic Chromophore
pubmed doi rcsb
source organism Streptomyces carzinostaticus
molecule tags Antibiotic
total genus 10
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2002-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1j5iA00
1HZLA 2MCMA 2CBTA 1O5PA 2CBMA 1AKPA 1J48A 1ACXA 2G0LA 1NCOA 2CBOA 1J5HA 1NOAA 1J5IA 1HZKA 2CBQA 2G0KA 4JW3A
chains in the Genus database with same CATH superfamily
5HHOA 2UZYA 3P0YH 5TF1L 1A1NB 3IMTA 1UD3A 2F7OA 1LO2L 3SDAB 4P2OD 3GGWA 4EN3C 1OVZA 1ZLDA 4AKPA 3MNVB 5IJBC 3FS9A 3I50H 5IFJA 3WFEH 3E2HB 1BBDL 1XVSA 4YSDA 1SHMA 3ZE2F 1FYHB 1REIA 4LRIC 5C0DA 4KHTL 2BVYA 2QQKH 3OG6B 4IU2B 3SE8L 3QA3A 4X4XA 3IRPX 3FOMB 3LQAH 2J4WH 2FL5B 3CSYA 1DP0A 1IZJA 2HH0H 3AU1A 4ANVA 2EZ0D 4M9OA 2ZSWA 2ZKMX 4HG4K 3NABH 3F58L 1QP1A 4PRIA 5C0IB 3GTVA 2ZUTA 4D9LH 2R0WH 2XV2A 3EJYC 5D7JD 2W60B 3KPMA 3AM8A 1ZHBB 3CTTA 3IEAA 4XXCA 3ZDWA 4DOHE 1HHHA 3VD5A 3E9UA 5IV2B 5IK3A 3APDA 2NY0C 4H2AA 1WO2A 4PTUB 3RTQD 3D6GA 3DMMB 4WSJA 2FATH 3AMKA 3WY2A 3GINA 1NC4B 3HN8A 3WKML 4F37F 3HJ0A 4TUOB 2DKSA 4GP4B 2VSCA 5CKGA 2Z93A 4Y7MA 2R4SL 4U3SA 4I88A 3O9WC 3WL9A 1A21A 1QRND 2A6JA 4YHML 3PXHA 2K9FB 2YSTA 5IQ7L 4XB8A 1V55B 7FABH 4ABWA 1T4KB 4OCNC 4K5OA 5EU6A 3BPCB 3H9HB 1BVOA 3BGMA 4JY4B 2VMDA 4O9HH 5C70A 4IRSD 4AQ1A 1CXKA 3MBXL 2BFVH 1FL6A 3W57A 4MVBD 3DYPA 1QWHA 3ZHFA 5CSZA 3QH3A 1WDAA 2E27H 3HBGA 4XMZA 4WDIB 3PGFL 5SX4H 2IGLA 2G2PA 3HTLX 4AY0A 3Q9PA 1A4JA 3UJJH 1E67A 1A1MA 4MTMA 5GS3A 2RB8A 1F00I 3O8XD 4PREA 3VXUB 1RZ7L 3SGKA 5KS9E 2WYIA 2X1QA 5EEZA 3BLBA 1KCUL 4XNBA 4HU8A 3BX7C 3VCLA 3CFNA 1L9SA 3FQXA 4MS8D 3IDYC 3LS5H 3RGVD 1FZKB 2J25A 2UZIL 2V9QA 1CGSH 3CH1B 5GGRY 1EFXA 1AACA 3VD7A 1A7OL 1S9XA 5A7EA 3EO1A 4NIKB 4KX9A 5CJ8A 5CCHE 3RFZA 1R3JA 3D85B 3QEHA 2ZF9A 4X7EC 4DVBB 3NSFA 4JFZL 4PJ7B 2APSA 2AITA 3ZDZB 4UV7H 2OJ1A 4WHCA 1J9TA 4M6NL 3UC2A 3V9CA 1GGBH 4I0PA 1FL3B 4K2UL 3BH8B 4XOBA 5HJ3A 1HH9B 1FFQA 3MLWH 4PJ9A 3HRZA 3AW5A 3GTNA 1F58H 5GGSY 3RY6A 4NHCH 2IFFH 3G04B 3OBAA 4B9GA 4OH2A 1Y1DA 5FA3A 2RD0A 3VGAC 4HWNA 1THAA 1UOVA 4H8HA 2CK2A 2PXYA 5DJDA 4MXWH 3TBBA 4GUCA 2RQEA 1MHPH 1OD9A 3QQ9D 4XP1L 3PNRB 1WLHA 4OZHA 4LCYA 4QHUB 5I1DB 2O93L 1TVBB 4OFQA 1KXVC 1RZ8A 3X11B 2I60H 2IV9A 2XDHA 4HUXA 1FNLA 2V6HA 3W0WD 3VXTA 2AXGB 2OYKA 2MCPH 4WTWA 4FMFA 3GT6A 3HZVB 3NCFB 4KJPD 4Y5YB 2AEQL 1T0MB 2HT2C 4PN6A 1Q94B 3PCYA 1JWUB 5KVGH 2MJWA 2O6EA 4YPGA 2VR4A 4QHLA 3LHAA 5KZCB 5GSVB 3BQUB 1R3IL 4LLUB 4YHOL 1UB6A 1FNSL 2CGRH 5IOPA 1AQMA 5E2VH 3QWQB 1Y18A 1IFGA 4ZW8A 1GW6A 4WHYH 4EIZC 2X4NA 1G6RL 3QZWB 1TJGL 4KXBA 1V7ML 4P05A 2GK0B 1A6WH 4ZQKB 4I18C 1BVLA 4X6FB 5I8OL 2YC1A 5DF0A 2A77L 1F4XH 3QEGH 1KXHA 4Z7OB 4CNIB 1H3WM 1KCVH 2VWEC 4GAYA 2YUXA 3IS0X 4UZGA 5JPNC 2QGCA 3UJTH 5JORA 1J1PL 3MNWA 4AIZB 3L7FA 3EH3B 4U6VH 4E9TA 1WE5A 1MHEA 2Z8VC 4JG1L 5F9WB 5IHLB 4G7RB 2VXVL 2GUOA 2TRYA 4OCWH 4HXAL 1TKWB 4WU5B 4J5VA 5IB3B 12E8H 2V2XA 4JO2H 4IBQA 5F6HI 4XCFH 4NZDA 1N59A 3SJVA 4JK0D 4L1HA 4NQDD 4QY8A 4YIQB 4D9QD 3KVQA 4UTAH 4GG6F 1DANT 3C5ZD 4ONHB 2AQTA 1KYUA 2X3AA 3HFML 4JFFD 1OAUH 2W0KA 5BOZG 3DPBA 2QGEA 4J3OC 2OYMA 2G3XA 2CLRB 4NYLA 2QSCH 3AU0A 4DP6X 2WWOA 1X5AA 2IAMA 3C08H 3FB8B 1KDJA 2Z8SA 4ZPVB 4ZUTB 2UUDH 1U8PB 4RZCB 3WTXA 2WQUA 4NP4L 4KO7A 3RDTD 3FT4B 3GSQA 3T0EC 4U49A 5MP6L 3U83A 2E46A 1I4FB 2YO3A 3ML8A 3BIKB 4XZUA 4LGSB 4BSVA 3LV3B 1ZXQA 2DS4A 1NMCC 2FQEA 2YPLB 4Y19A 3S0PA 2HYMA 3NRQA 4ES9A 5GRUH 2J72A 2DQJH 4JDZA 4XVJH 4MRBA 4RISL 1WAAA 4QT5B 3V9FA 5KBDA 4HCGA 5MHSE 4H8WL 2G2RB 1CFQA 5DJ0A 4ZSOE 2G3NA 1ZRUA 4NNYA 5ENWB 1A6AB 4G1EA 4K15A 4ZAKB 1OP5K 3MROB 1F4WH 4UIKL 4RMBA 1O7DE 2H4EA 2WKGA 3BUBA 4F7KA 2ZXGA 4RAUB 2OK0H 1PLGL 2M8XA 4HMEA 2PCFB 5CJXA 1JSYA 3CZFB 3NJIA 5EEWA 2WTOA 5ANMB 5HSFA 2IH1A 1C08B 2ZP0T 1COBA 1T03L 4GB9A 1AO7B 4QKXB 1GW0A 1HSAB 4JO3L 5EU5A 4AMKH 2HFFA 4AG4L 5K9QG 3OTTA 3E3QC 4QHMB 2AERT 2R2CA 3MBEC 5DC2A 1J1OL 1FZOA 3W81A 3S48A 2XPGB 3ASWA 1KJ2H 3MJ8A 5BRZE 3R8QA 2CM6A 4M7KL 1LDPL 2WBJA 2XIIA 3WTYA 1Q9LA 5HXMA 3MV7B 2WXKA 4PUBH 3HB3B 5DJ2B 2XKNB 2VCOA 4GIPD 5E5MA 5I74C 5GGQH 4JHAH 3QI9A 1KJ3L 1ACZA 4M61A 3EYVB 4JE4B 4PD4J 1J05A 2C7UA 4B6ZA 2DEYX 3GMQA 3OKLB 2HSIA 1TZGL 1Q8MA 2BCMA 3GBMH 3MOAL 4YSPA 3JWDH 3OXRB 3EGXA 2YD8A 1ZIBA 3B5GA 2C9SA 1OY3B 1GC1H 4M1GH 1QUNA 4JFXB 5F1NA 1QFUL 5FKPA 2WLMA 3IMVA 3E0GA 5G2NA 2XWRA 3PABB 4FI6A 5IB5B 3IXAA 2E6JA 1Q72L 1QQDB 4PJXB 3GKWL 4KJWD 2KLTA 1Q38A 3H9SB 1KNOB 2X2UA 1RQ5A 1RULL 1FO0A 3V0DA 2ZOLA 3IFOB 3KLAA 5DJ6B 4BH7B 4TSAH 2VDML 3B34A 2RACA 3KXFE 3OKDA 3SBWC 1CT8A 4MLSA 1OTUC 3CHSA 5FECB 2WM0A 5HY9B 2CNZA 1R5VA 2HFGH 3OAUL 2VDQB 4FN0A 4KVNH 4X2UA 1ZWIB 3CLEH 2VZUA 4EUPA 3RWIA 4NN7B 2QEJA 2VQUA 3QIBD 5CKAA 4HPYL 4KKAC 2OJEA 1CDYA 3KJ4C 4ZDHA 1BXXA 1XZWA 3VFTA 3NAAH 4DO5A 3VI4F 3L2MA 5E8EB 1U21A 2Z64C 1NCDH 2C4FT 4ZUUA 3EHBD 2CCVA 2HTKC 3VFNB 5C0BD 4L5FL 3FZUD 2LABA 1LNUB 1BYNA 1J8SA 3SPGA 1OT4A 1I1CA 3UBXB 3WFHB 2BVUA 1KG0B 2F1AA 2IFGA 4DUWA 4WZ9A 1JNLH 1A7RL 1UZGA 3EGDB 3SGDH 1A6UL 4LVNB 3X17A 3D18A 4OV5A 3MZTA 1U58B 1ZVSB 4P2AA 1T04A 5DT1L 1CCZA 2BXYA 2OCJA 4J6RL 4ZUVB 2J6EL 1QTSA 4XPAH 4RSVA 5GQBA 5L4MA 2XY2A 4JAMA 1UFUA 5CU5A 2BHUA 3NQIA 5HP5A 3QXTA 4L1SA 1DLHB 1YECH 3ROLA 1HHGA 3CDCA 5KSUA 4IK7A 4N86A 1LO4H 2Y1AA 3BH4A 2W9DL 1TQBC 3QIWC 3ZZSA 1MVFA 4XB3A 5LBVA 1KV3A 2V17L 3QFDA 4KROC 1N4XL 4IMLB 4O4YH 5L88L 1RAMA 2AJXH 5DK2B 4L3CB 2JNZA 4QRSA 5D70L 5H4ZA 5CF3A 4AXWB 1GC1C 4YSEA 4PJ8C 2NY2D 4WW2B 4D0DA 5LQBL 1S8DA 1ZV5A 3UG3A 5E08H 4DK3A 4HIEB 2ZWLT 1FO0L 1N5AA 1TNMA 1VACA 4R97C 2ITDB 3G5YA 4KH2A 3C60C 3OAYH 1UWGL 5EC2A 5FUZL 5FYKL 2VZOA 2J1WA 1D6EB 4DEPC 5B4MC 1EJ6A 2Q8AH 1J87A 4HMCA 4PJCE 2OXGA 4I48B 5GGRB 3ZQWA 2PKDA 1MDAA 1UH3A 5CJOL 2WZAA 5JXAH 4N4YB 1A7QL 5FYJL 2YSSB 2DMHA 3GIZL 1RJYB 4OD2B 2XI9A 5J6GB 4WJG3 3WFDH 2A83B 3DC0A 4R7LA 4RFEA 4K8RL 3HE7A 5EUOA 4L29B 2Y69B 3OKOB 2A3TA 4YE4H 3SQOL 3QUZA 1MCWW 3HVDA 2CHNA 2R56H 1RK0A 3FO9A 3BPOB 3V95A 1CVRA 4M43L 5ESVA 3PYCA 2DQCL 5GGSB 3GNMH 4MJHA 5C0CD 1A7PL 1VLXA 2C9UA 1DBJL 3FFCA 1U93A 2Q6WA 2QVKA 3NIGF 4PRBB 4AEIH 5AVSB 1EO8H 3D0LB 4J3BA 4P9HC 1MH5A 1J0ZA 3OLIA 5EOCJ 3DV4A 1AXSB 2WB1A 3BFQG 2IPTL 2CJUH 4M8QA 4HIIB 1NCJA 5AUMA 4NRYA 3ESOA 2AQPA 3HE6B 3HI5L 3TEZA 2F53E 1S7XA 3L1GA 4P4KA 3WV0A 2CLZA 4JJ5A 3VQ2C 3OJDA 1NCTA 3VRIA 3MUGB 1P2CA 4OT1L 2A74C 1EQWA 3MMEB 1XGTB 4JQIA 4XO8A 3T8XB 3WIIL 3MDJA 4M62L 4ZJ9A 3BH9A 1XGQA 2V9TA 2ID5A 4K5NA 4ZXBD 3D30A 3LSOA 3A6CL 5FUOH 5A3IC 1D7DA 3ZY7A 4XNZC 1B0IA 3QPKA 3MFGB 2ZQKA 1AGDA 2JK5A 4N85A 1K5NB 4GMSL 2BS8A 1UCBH 2EDYA 5T1DL 2VLME 3SY6A 3UPRA 2H6OA 2BNRA 1J9QA 4IJ3B 4BXVA 2EDEA 4KKPA 2EADA 2JQAA 4W9DC 5J12C 4RVBA 2WBKA 4WY7L 1IBDA 3G3LA 4APQD 3IJEA 5J57B 1FNEA 3S7GA 3RHWF 1CR9H 3K0YA 3S3BB 1ZANL 3ZBMA 4ODWA 3BRGC 4ZPTA 3QJVB 1NCGA 4NIYE 1M7XA 4KQ4L 1FN4B 1FBIL 3HZYA 2GBTA 3KDMB 3OR7B 4M7JL 3ZJAA 1SY6A 5KEZA 3BKMH 3ENEA 4OZGA 5DMJB 4F9PA 1SJVA 5D7LA 1LD9B 3SDCA 5FWRA 2V2TB 5BOJA 4WU7A 4UNTA 4HOXA 3FT3A 4OJAA 2Y4SA 1X7QB 4MXQD 4GFTB 4OLEA 5LBGA 3NZ8A 4NQEA 1MNUH 1S7UA 3TV3L 2O5ZH 5H35A 5DD6B 1CFNA 2BXZA 2LOEA 4R4FH 3K6OA 1I8AA 3HS0A 1G4MA 4NQSB 4F93B 2QMKA 4LEBA 5B3NA 2FVNA 3N2JA 3LMJL 1J0IA 3VI3F 3AT0A 4LF3A 2HG5B 3BKJH 3O45A 1ED3A 4YN3A 4FQPA 3AAZB 25C8L 3CPUA 3HC4H 5C3LD 2DWYA 1V8HA 2B59A 4OCRL 3CSTA 2A38A 4N2OA 3MV8E 3S5LA 3AXLA 4KY1H 4BZ2A 4A37A 5AAWA 3PP4L 1IVLA 1A6ZA 2PWHA 1YY9D 3LNDA 2GBUA 2D3LA 3B9EA 4L4TB 4W6XB 4EVNA 2OMWB 4AKQA 1VZIA 1FORH 3PWPA 2X6MA 4QXUL 1MWAB 2X4RB 4HPOL 4QXTB 5DZVA 3K6SA 1NBYB 3CFCL 4NNPH 5AYUL 4A1RA 3TJHD 3DSNA 5FGRA 3WTWA 5E6SB 4LVOC 1ZA3A 3MREB 2FYVA 4L0YA 4P2RA 4QRUA 4WNJA 4X9FA 1MLBA 4ONFH 3KHQA 3IMUA 3N1MC 1UACH 3S3PA 1CQYA 2DLTA 5TPWH 2KQMA 2DBLL 5GGTH 3ZQXA 3IYLW 2OBGA 2GTZB 2H0JA 2RFXA 2CAKA 1OM3H 2NCEA 4JLRA 4TNVF 1BZ9A 1QASA 1NWPA 1G7PB 4FG6C 3TEYA 2FWSA 1FIEA 1SOSA 2GPZA 3VXRE 1NINA 1JV2B 3FRPG 4JR9L 4F7TA 2WWNA 1J5CA 1SF3A 2YOAA 1CICC 2CJTA 5BUPA 1IC5L 4ZMXA 1DUYA 2DDQH 3RVUD 3KWWB 2VLJD 3V5DA 3L1OL 4PJ6A 4R4NC 4Z3IA 4KO9A 2P5WB 3P11L 4PJDE 3T0AA 1BOYA 4XAWH 2ZCHH 5I2IA 3HC0A 1ILUA 3LN5A 4HFUL 3UEQA 5D2NB 1SGKA 2AVFA 2IQAA 1IAOA 1PKQE 2ADFL 5GZND 4GW4A 2MFNA 3RUGB 4IIQA 3D0VB 4NJ9L 3TO4A 2JKNA 2R2EB 3NACL 1TPXC 5AENA 4O2EA 1U6AH 1VFBB 1J8HB 2YARA 4PJFA 3FTVA 4F8PA 1HEJC 2WWKO 1E6OL 1BVKA 3QG7H 3TURA 3JV4B 1PYWA 1LE9B 3KGSA 1JWMB 3CPLA 1BBJB 1CLOH 3IFNL 1L0XA 1UOWA 4GIOA 2NW3A 4CMMA 2J8UB 3M1BA 3VFPB 1MW1A 4U4IA 4PH8A 4OZIB 2UV3A 3FFDA 5CCKL 1B0RA 3KD4A 3LKQB 1O75A 1YEEL 3NJVA 4IBWA 4M7LT 2P43B 4Y16B 1YYLL 3CSBA 2I7SA 1RSFA 2O6PA 4X99B 2ORBL 3EYFB 5AZEL 3WNOA 1N7MH 4LNRA 5C0GA 1WGOA 1QR4A 4GSQA 5E0QA 3VD0A 4U1SB 4ZO7A 4UF7C 1U8CB 2Y5TB 3VYOA 3QISA 1GZQB 1QA9A 3TBWB 4CVUA 4D0BA 1ZSHA 4FQJH 4KK8C 1UM5H 2F8OA 3CXFA 5E4EB 5T3XD 5FIEA 5I17A 3OJMB 3SCMB 3S34H 1SN0A 2WTRA 3N55A 4TQ8A 1JTOA 4OM1H 3KVDD 2VXUL 4NT6B 4CMHB 3D51A 1XZ0A 1TO4A 1OF2A 4H5SA 4OD1H 2D31A 1HL4A 4TKWA 4FQCH 4W6WB 5J0BA 4EI5C 4K7FA 3QO1B 1RPKA 3N40F 1CU4L 5D1QB 4ELKB 2F08A 4LSSL 2CMRL 4PVLA 2O6FA 5I1AA 2Z31B 3S4SB 3RI5K 4MMZC 2VRQA 4Z3EA 2BCKA 5IEKA 2VM9A 2G5BB 2H2SC 2TSAA 4NI6A 3DVNB 4WEBH 3RAJH 1YEDA 4XWOC 2FB4L 2OI9C 1UQSA 4YXHL 3CMOH 4G8FB 3H85A 3CCHA 2WUCH 5MEPA 3I6GB 4NEHB 5E8PB 5L4JA 4HISA 4UT7H 4N3TA 3GMPA 4N8CL 2G4EA 3IMBA 1FH5L 1OGAE 5ES4B 1OTSD 3KYOA 4BFNA 2FJHA 3LN9A 4JKMA 4S1QH 4YOKA 2FJFA 3EJCA 2YD2A 5DYOB 1FAIH 5E9NA 5ADPL 5D2LA 2XZZA 4Q6IA 4B5ZA 4BFEA 5IBLC 4CW1B 4YSQA 5IFJB 2XWJB 4XN9A 3DXAA 3VA2C 3K8KA 4N0UA 5L9DH 4X83A 1TQTA 5B8CC 1V54B 4I3SH 4J28A 2E4FA 3OHXB 4PJIE 3D5OF 4GRWB 2AS5M 2D9CA 3TYFA 3CSYB 1BDYA 1M4KA 4DERA 2XETA 5F6IC 1F45A 2NXZC 1BQHG 4Y4FA 2ZSWB 5IF0A 5KYWA 4JREC 4PRIB 4E5XA 4MMYA 1JGVL 5E4AA 3EUDA 1AKPA 1KIUB 1OTTC 1A1OB 2HT3C 5JIHA 2EUVA 3C8KA 5D4IA 4LOEA 2Y07H 5D6DA 4EKJA 2ED8A 1ZVYA 3QORC 3UZVA 3N0AA 5TE7L 1N6VA 1OAKH 3T4YB 3GMOB 1PG7W 3EO0A 4PJ5E 1HN1A 1DDHB 1KBVA 3MV9A 4WUUE 4WEUD 1P7QB 3DJ9A 1KB5H 4QHKI 2WQVA 1RP9A 2FHFA 2JKWA 3BGMB 3QNFA 3QEUA 3OB8A 3UGEA 1U4FA 3IDUA 3PDOA 4MZ3A 4PBDA 3G6JE 4AQ1B 5J11C 5T1JA 4DH2A 2KC0A 5CR1A 2DIBA 5F96H 4U3CA 4DWHA 3GSOB 1NFDA 2AK4D 4NDMB 4Z3FA 3B8YA 4Y2LA 4JKNA 5GS0H 5E1GA 5F7EH 1JGIA 3MI6A 1SXNA 2FGWH 3HW7A 2WHVA 4LLAA 3PGDA 1Z5HA 1P7KB 3RWCB 3U7YL 4D9RD 4X8GA 3VVWA 1E43A 3GDBA 3FQXB 3FQUA 1NCWL 4GRLC 4JFDD 1YUHA 3NBNA 3BP4A 3EFOA 1QYGL 1K6QL 1MWOA 1QSFD 1PSKL 2AXFB 3CN1A 3AMLA 5CS7A 4HH9B 4EPSA 1BZ8A 1HDMB 3ILEA 2XYBA 3CU1A 2KS0A 3S35H 1PNCA 4AEFA 1X6LA 2VZ3A 3IM1A 5AKTA 3RVXC 2PPFA 3KM1A 4WK2B 3HNTL 3ZR5A 2X4UA 4XOEA 2X0WA 4GKNB 3QJOA 4JCMA 3VYNA 4YPJA 3K71B 3UDWC 4YHPB 3GK8H 4DP0X 4M7LH 2BHZA 1CE1L 4OF5A 2NDFA 4FHKA 4LP5A 1N3NA 4GI6A 1TMCB 2QFPA 2YA2A 3Q8EA 5HHQA 3M8OL 1DVZA 2K4AA 4YFLF 4LPUA 5IHZA 3FN0H 3ZO9A 1E30A 3ARDC 4X7DC 2X87A 1NDGA 2FWOA 4WFHD 1KV7A 3H2PA 5D6CA 3FMGH 4NO3B 3UIZA 2EIJB 4LGPB 5F1IB 1AP2A 4CKVX 4LCIL 5EDSA 1WHOA 1XGUB 3OMAB 2K3TA 4M93B 5J8OA 5I9QB 5KVEE 4OIAA 4G82A 5DA0B 3T65A 5I75B 2EUXA 5JPMB 3ZE0B 5I30L 5EEXA 2XN9D 2F7QA 4BQ6A 4FYTA 1EHAA 1IU1A 3DSFL 5HYSB 2W0FB 3J07A 1E3XA 1U8HA 3O3AA 5ALBL 2QQLH 1DJXA 5C9JB 1ZT1A 2X38A 3FSZA 1JE6A 1KGUA 2VW6A 4HUUA 4QXGL 1PAMA 4EJ1C 4QHLB 4KNUA 1JI1A 3SE4C 2JIXB 3MRBB 2R29A 4RFNC 2KMWA 5CEXB 5DK3A 3KGTA 5IW1A 5AG9A 4AK1A 2ZWYA 2ADYA 3TA3B 1BECA 5C0JB 2VH5L 3GSUB 2HX8A 2KH2B 1E4XH 5IMLA 2X4NB 5FK9A 2ISDA 2X1PA 2AXWA 3LNFA 2PCXA 4PB0L 1XL4A 2IGFL 4G7VH 4DKFL 3QZWG 4RMQA 1VJSA 4ZG1A 3NDZE 4GAYB 5IY5B 4N90D 5CBAB 1QZ1A 4GXVL 4J8RA 5D1ZD 3MCKA 3T4AA 3MRJB 1HCVA 5T3ZL 3TCTA 5HYQB 1F41A 3AREA 3O3BA 3OQRA 1B0GB 5TFSH 4A2MA 4OQ1A 5G4OA 2OP4H 2R1WB 3O0LA 4PJAF 3FSWA 1C7TA 5HI4D 2ATPB 1PDKA 3A22A 5IFHH 4DZBB 1WIUA 4OZFA 4ZK8A 4HX1A 1BPVA 4HC1A 2BMKA 1BSIA 1N59B 3SOBL 4C83B 1BF8A 4ZO9A 3DX7A 4G5AA 1XO8A 1T21B 2EXTA 32C2A 4Y9EA 2IADA 5GS1B 1DCLA 1DSYA 1XR9A 2GCYA 3DPBB 4ZMAT 1AHMA 3JV6A 1EZVY 4Z23A 4BZYA 1OL0A 5CU9A 4RCAA 1MEXH 3TN0C 1LP9B 3RWDB 4YDLB 2IAMB 1WEJH 2GJRA 3ZE1F 4JFPB 3QS3A 4L3FA 5ICXA 3L9YA 4WHTB 4XMTA 2ZXQA 3D8MA 1XGPB 2KZWA 5TGBA 5JTWA 2C3HA 1E2VA 3BGFB 5I8CA 4JFSA 1RURH 3EG9A 3MOBH 3R06B 4GMTL 4ZX3A 4JRWA 4XNYL 1KBWA 4Y19B 2KPWA 4MCNA 1TQSA 4LPTA 1PY9A 5F0JB 3S88L 1CIUA 1OZTG 4KK5C 4FJYA 1P4BH 1AMYA 3ILPA 5L7XL 1FFRA 2PNDA 1TYEB 2QV2A 3TCXA 1GKOA 5FAAA 2HPTA 5C07B 4HGKC 4MA3B 4XPFL 5F7KC 1FC1A 3TVMA 5L2KB 3A6OA 5LBSH 1PX8A 2JCCB 5DUBA 4DFIA 3QFGA 5EPMA 3RVVC 4C56E 2P4AB 4XP4L 4IHOB 1DVUA 1DQLH 1DZ0A 4LMQI 1MUJB 3BN3B 2RALA 4M3JA 3P0VH 2AGJL 4U1LB 1EBPA 1LWRA 4YHIB 1SOKA 1CZ8L 4NENB 3X3GL 1MVUA 4BQ8A 4TQEL 4G6KH 3WAKA 5E6ID 3MC0A 3GI9L 1I7RA 3NFNA 2HFFB 3GIVA 6FABL 1L9NA 4AOFA 3ULAB 5A2AA 4AYFB 3SPVA 2MCMA 2LLGA 4JRYA 4K9EL 5J1AA 1CC3A 3CHXA 5FUCC 4Z0XB 2RIKA 3ECUA 2Z9TA 2P8LB 4NFBA 3IFPA 4ELMA 1HHIA 3OWRA 4J2QA 4MNGA 2GW5A 1F3JB 3MNMA 5E5MB 3JV0A 4P99A 2Z91B 4I2XE 4JKWA 3X13B 5IHWA 5HDBF 4BZ1A 4UILH 1C16A 3WGVB 4DN3H 3TTSA 4PG9A 2XIBA 3RNKB 1ETJA 5I16A 4LSVL 4YDIL 3GLEA 1D7FA 3V6FA 2R0KL 1CBVL 2MPAH 4GFXA 1JPTL 1QUNB 4I3GA 5FS5A 1ZJBA 4KVCH 5F1NB 5D4QA 3KPSD 3TFBA 4DN4H 3N41F 4Q52A 4F9LC 1N0LB 1P9MC 2B7DT 4JFED 2E75C 4C4UA 5F3BA 1IEAA 4J1UA 2Z35B 2Y24A 3KBFA 4N6RA 2QELA 5DUML 3GZQA 3UERA 1ZJAA 2J71A 2FNBA 2OXHA 2B1OA 3FU7B 4L8BB 1ZTMA 5FYLL 1YNTF 2C1OB 4R0LC 4X42A 4DP5X 3HI1A 1QI4A 3OSKA 3BESR 3WJJA 2JJSA 3OKDB 4ZD3L 3G6DL 4ZW6A 3OMNB 4DVRL 1KT2A 1U91B 4KUZL 5ITFA 4OCSL 3VX1A 4KC3B 4BQBA 3HNVL 4G9FD 1QLEH 3RWIB 2EYRB 2WIMA 4JO1H 5GRJH 4XPGL 5K39A 5E9DA 3LH2H 2Z7UA 3VW3L 1MRDH 2NTFB 5FLUA 5DWUL 3UTSD 5J4MA 2J1YA 4UDUA 5JW5A 4HJEA 1DVFC 3L4XA 5D7SH 5KVEH 1UM6H 3OAWA 1UUNA 3GBNL 2WXIA 4K3DL 2J1ZA 1AHKA 1AGCA 2BZDA 3LHPL 5FPIA 3HI6H 4HJ0D 4HK0A 4LXFA 1IIKA 2JXMB 1DBKL 3VACA 3QP3A 5CSBA 4H88L 4A04A 5JHDE 3SYQA 3MBEA 4HEPG 3HKZA 5DD3L 2X6CA 1PY0A 5C08E 3SBQA 4E9QA 3D18B 1RK1B 1F4HA 5INCB 3BSZA 1T04B 1BFTA 4BZ1L 5IT2L 3HBZA 4NPYA 3VGEA 3ZQ9A 4I1RA 3NN8A 2A73A 1QUPA 4S1SL 1MFUA 5FGCB 3QPXH 4IRJD 2K4WA 3B9KB 3IDXH 3LEVH 2DICA 4HK3J 3VSUA 1AIZA 3I2CL 1E3FA 3BVDB 3ARQA 4AQOA 1FAKT 1OF0A 1QBMH 4CN1A 5GS2H 4Z7AA 4Q9QH 1U2YA 4YBQC 4YDZA 2IPUG 3TPUB 3WLWC 1OPGH 4Q4IA 3QQ3B 4XHQA 3F84A 4XPTH 1D9KC 3L4VA 1UB5A 1XHHA 2Z7WA 4GEIA 2JB6A 1IC1A 1IGCL 3CXDL 3HG1E 4D0DB 4DK5A 1S8DB 3LYRA 5K59F 4JN1L 1YNLL 3ZN6A 4B9PA 4QRPE 4FQ2L 4BSJA 2WXOA 1TU2B 2Z92B 4ZMNA 3GD1C 3U6XS 5IVXB 4PJHE 1W8EA 1YRKA 3ULUE 2CR6A 5AOJA 3K1DA 5JQ6L 3D52A 1MJUH 1KELL 3V0WH 2Q87A 3U0PA 2Y6SC 3C8DA 5DQJB 2A6DA 3UTTE 1RJLB 1BJMA 5CUSL 3ARXA 5IB1B 4RFEB 5DR5L 2VKXA 2LAGB 4D8PA 4OI8A 2ZNXA 1KC5L 1CDJA 3AG3B 3ARVA 4LAJH 3QUZB 3IJ9A 1II4E 2WCPA 4ERSH 2LU7A 1RK0B 4YDKL 3VG9B 5DRWA 1EDQA 2MH4A 3QUYC 2DLFL 3T71A 2C8NA 2FE0A 1EAPA 1AS7A 1KYOK 1ONQB 3D9AH 3NA9H 4GAGH 3GRWH 3H42L 1F1GA 1UM4L 2Q6WB 3VRJB 1RZKH 3AG2B 2VLKE 1BFVL 4LHUD 1UGNA 2N4IA 1MH5B 3BIAX 4HOMA 3G6AB 2IOIA 1NCAH 2Q86A 4X6CF 3DI2B 4M56A 3S2AA 3GHBL 2YAPA 2BNQA 3U48A 2NX5A 4NRYB 3UZQA 4JY6A 1RUAL 2CLZB 2XG5A 1FLRH 2B39A 1W72L 4CRPA 4KITB 5ISZE 4EEEA 2VDKB 1MRFL 2Y06H 5I0DA 1OT1A 2E0PA 4MD0B 4D7PA 3Q05A 3LH9A 5F7DA 2F19H 4LAQL 4NBXB 4QRTB 2WZPD 1HZLA 4RQQA 2I25N 3QIWA 5FEBA 5LGHL 3OG4B 5KJ4A 3TJEH 5HDLA 3FF8A 5IG7B 4D3CH 4MXVE 2XA3A 4OFPA 2X2YA 4BV1A 2K7QA 4PJ8A 4MB1A 4IRZH 3WIHL 1IGML 5KSBA 1AC6A 4X6DA 1A7NL 2Q2LA 2FO4A 3CLFL 5IHUL 1HAWA 3EBIA 3P2BA 4X6BA 2XZQH 3TL5A 2D3VA 4WO4C 3L48A 1PX3A 1Q90A 3JVGC 4AENB 2BSSB 3M17A 4ZPTB 4MBRA 4Z7QE 1INEH 1HWGB 5FFLA 2LHAA 3F2LA 2BP0A 3E1ZA 4PGBB 4OZGB 3BAEH 5GZOD 1CYXA 4MDIA 3BEWB 3PQYB 4WU7B 2B4CH 4QXVA 5D7JA 2VXSH 2NQDA 3VXUE 4P9MH 3NZ8B 3Q6FA 4N0YH 4YC2B 2VN6A 5KAQG 4DTGL 3RTQA 3BZEB 3B43A 2ZP9A 3QJSB 1OARL 4P4RB 3DIDA 4WFGE 5EUKA 5I15H 3RGHA 3CAFA 2VE6A 3F05A 3FCSA 1GOGA 1MLCB 4APQB 4ODSL 4FQLH 1ADWA 4ODTH 2CDEA 3L54A 1D5RA 1HXMA 1QRNA 3S5LB 5BS0A 5KVDL 1A6ZB 4ZTEA 4MJIB 3SOTA 4PJ7E 2WAQA 5F21B 3ZDZE 2H3XC 3L81A 5AKSA 4LLVA 1TJMA 3N9GH 2F5BH 3Q2NA 2AJSH 3L3OA 1OANA 3CX5K 3KAAA 2LLLA 2IWGA 3CIQA 1MFCH 3P30H 3WSQH 4ZX6A 5I24A 3LKSA 2COVD 1FL5B 2WQ8A 2A74A 3KCPB 2WP3T 4JQVC 4UM8A 3ESMA 3W2DH 5TK2A 2J2ZA 3HHMA 4Y4KC 5DSCA 2E8YA 2PYFA 2CUIA 4P2RB 3S37L 3L5WA 5DQDH 2DQIL 4JFWA 4N0FB 2V7NB 4KTEL 4L8DB 2P80D 2OMNA 4MJ5B 3ECWA 3BE1L 2F74A 3U1QA 1YQVL 4EZLA 3CJJA 3F00A 4X80L 4ETYA 3EW3B 1QBLL 4H1LB 4XMPL 1KWGA 4HOWA 1FSKB 4FQIH 2Z4QA 2AI0L 3BHBB 1KTKE 2UWEA 3RGVA 1R6VA 1XTMA 1U92B 2YRPA 3F12A 5I28A 4JX0A 3UTPE 3R19A 5I76B 2XVBA 3C6LB 1S7SB 4LT7A 4EXKA 4XP6L 4ALAL 2NR6C 5JXEC 1HL9A 4MAYC 2AJYH 3CDZA 3GDCA 3V0HA 5IVNA 1GA2A 3D39D 3L3DB 1X5YA 3AT9A 5MHSD 3MRPB 2XA8H 4QNPE 1JBJA 1OW0C 2X1OA 4HS6B 2Y2TA 3CBRA 5F3HA 3H7BB 5C97A 1ERNA 2IQAB 1CGTA 3DJTA 1IUZA 4WEMB 2W8CA 1XBDA 4GW4B 5C7XH 1HXYA 3F5WB 1C12A 3BZ4B 1YY8A 3WE1A 1C5CL 3VJ6A 4I77L 3EFFA 4P5TC 3E80A 4QF1A 1FNGB 3GSXA 4I4WA 1ND0B 4PJFB 3P9MB 4OF0A 4O51A 1IT9L 2AJVL 3OGCB 3VFVB 1I53A 5ADOL 4LOFA 1JXKA 3WKPA 4U0RC 1MNNA 1OAYH 3Q2CA 2IDQA 3IWVA 3TJPA 3ULUH 4E9LA 4B0MB 3NEXA 5KOMC 3W0WA 1QLRB 3OR6A 3DETD 1LILA 1AGFB 3NSXA 3FFDB 3HMXH 4FERA 1A3ZA 4S2SB 4G8EB 1MXGA 4GT0A 4ZMYA 4LNRB 5C0GB 5BRZD 2Z1PA 4FG0A 3QQDA 2C4FU 3U30C 4S1RH 4UAHA 3N1FC 5F93C 4FCAA 5EBMA 3U1PA 2NZ1A 3D08A 1KIRA 4M8UA 3CDGB 1KN2L 1L5GA 2AJUH 5I17B 5EN2A 2BSTB 3GSNB 5C0AE 4ISVA 1H6UA 3SO3C 1V3LA 4WUKH 3NIDB 1AI1L 4KI5E 1VGKA 2IG2L 2FT8A 3D4ZA 5D7IF 3DVIA 4LBAA 2HCZX 8FABA 4PCYA 3O2VL 4YMPA 2EUWA 3W3BA 5I1AB 1VKXB 4PIBA 1A5FL 1DJGA 2YPLE 1ETA1 3QPQD 4JFTA 4XNQB 1E2ZA 1MCNA 4DGIL 1QFWH 4WI8A 1UQSB 1LDSA 3IXTA 4AQAB 4CU6A 4PP1C 1BD2A 1JPSH 3LXBA 4RWYH 3GMPB 2HMID 4YL4A 1O7VA 1UATA 2ENJA 1IFHH 3RX7A 3UAJD 2DQHH 1JG9A 2IANB 4NRZB 3P73A 4NQDA 2BHFA 3I75B 5T1KA 4B9IA 2LT9A 3RWJB 4BFOA 3C5ZA 4BKSC 4JFFA 3QDAA 1QNZH 1CVSC 1WCBB 3V7MA 1ZTXL 5I0XA 1GYWA 3DV6A 2FWUA 2GJZB 3RZCD 1BZDA 5KAQF 4L3EE 1A4BA 3H1ZA 1TJIH 3KL0A 1YSOA 5ANME 4ZUSB 3RX5A 2O5NA 5KBMA 3S96A 3UO8B 5M94B 5JDSA 4BWUA 1T83C 5IW6A 2GSIB 3J7HA 1NUDA 3R4RA 3RDTA 4DAGL 2VW7A 4HF5L 2A6KB 1G7QB 4J3SA 5IF0B 3IDGA 4F8TA 5KYWB 2Y3AA 5HDQH 3VWKD 2H9GA 1ORSB 2C5DC 2QVIA 4IGBB 5IFAH 2CK0H 3ECQA 4HIHB 4JS7A 1WC7B 1XWVA 2N0KA 5MEOB 3TS8A 1MQKH 2HVBA 2XBDA 1GYVA 3DTDA 1F5WA 2EDLA 5TJWK 4GUQA 4TLSA 1YZZA 2AKRA 4PP2B 4PV8A 3H3BC 4HXBL 3KPPB 4NN5C 4P5MB 3TYGH 1CL7H 1P5VB 2AZAA 2HLFC 3FTUA 4PJBF 5AW9B 5C2UB 2EH8H 1GAFL 4HIXL 4HWBA 1DBAL 1U3ZA 1FCGA 4MBOA 5C3TA 2EDTA 3IJHA 1HILA 4A7GF 1KBPA 1NSNL 1ACYL 2LVEA 5JW4R 1H6FA 5ID1A 4WTZA 1NL0H 2OMUA 4TSCH 3IDMA 4ORGA 3QEUB 5AB9A 3K72A 4JZNB 1YN6A 1SXAA 1CLZL 1IJ9A 1QHQA 2ATKA 3L3JA 4XNXL 5JZ7D 2DB8A 1OCWL 2XRAH 5JO5B 1UOLA 3QEQB 3REVB 1AGEB 3KZ8A 1IGFH 3ETTA 4UNUA 1I1AD 4XPHL 1JF5A 1NCIA 2IQ9H 2LE9A 4UZUA 4DGYL 3H9SE 2OMVB 2XX1A 1RZFH 5F3FA 4YXLL 1H5BA 3SYCA 3CFJA 5IIEA 4MMZA 3EGSA 1AQDA 2UXGA 3RVWD 1KBGL 3HAEB 2BWIA 2Q0ZX 4MJJA 15C8H 4ZFGH 1YMMD 3PGDB 2MMXA 1JZ8A 1NEZB 3AY4A 5E5LA 5TQ0H 1JWSB 5I6XB 2F54A 5HYJE 1TTUA 3TT1H 3V4PB 1JV5A 1KY7A 4WQOA 2MCAA 4XC3L 1BQSA 1G7IA 2D3NA 4J27A 4ZODA 4XXDB 3AGVA 3I84A 4HS8H 3Q2LA 4EN3B 4Z7NB 3MLXH 4AW4A 4JO4H 1HYRC 3GBDA 2G3ZA 4JE0A 2K3HA 4G42A 4DW2H 3ZKSD 1TCRA 4XBGA 2EINB 4Y1SA 5DVLA 4Z7WB 1NBCA 2NY5C 1I1YA 5B8CA 3DX6B 1QABA 4ATWA 3B83A 2EDOA 4OM0H 4H25A 2N0MA 4MNQE 4JMNA 4RGOH 2UXFA 4ZQTA 3PL6D 3RRQA 4NAQA 4TF4A 2OMTA 4GKSB 5T5NF 3ZKMD 2XWTB 5ETUA 2P8MA 3QRGH 3QRBA 5DLLA 2EDFA 2CUMA 3T04D 3NFSL 3NPSC 5DK0A 3DOSA 1NDGB 1TZHB 2X4QA 1U8OA 5E51A 4HWBL 4X5RA 1YEFH 3B7UX 2NY0B 3EIFA 1WZMA 3EAKA 4XRCB 1W2KT 5IJDC 1DJHA 2XPZA 4QD2E 5HGBB 3VFMB 5KOVC 4Y9FA 3G9VA 3E38A 5GISL 3T65B 5KJ7E 3DDGA 5L2JA 1UADC 2D0HA 1U0QA 2R69H 1B4JH 2DMKA 3O9WB 3QIBA 2H3NA 3FSVA 1ZOXA 5TDPA 3VFSB 2E7LC 4KJQD 3X1NA 1BVNP 3HLKA 3QXWA 1Z7JA 3OX8A 2VSDA 3QR2A 35C8L 1M71B 2W88A 3QZPA 2XPYA 4U1GC 1IC0A 4E9WA 6PCYA 3F7QA 3LX9A 2YXMA 4JG0L 3VWJB 2HTLC 4MJ4A 3BUYA 2VLRE 1OV8A 5CZVH 2ZJSL 4J4PD 5FKAB 1AD9B 1YUKB 5C0BA 5A2LH 4L8CB 2WLIA 4HULB 1HKLH 4R5XA 3VFRB 1KCLA 4HIQA 4CC0A 4AL8L 2YA1A 1OM9A 4TLUA 4KQ0A 3QYCA 3DOHA 3CFKB 4PLKD 3GXMA 4FQ1L 4APXA 4FABH 1P53A 3Q1SL 1FFNA 4JFHE 1JXDA 2H1LM 1IAMA 1YPZB 3IFLL 5FK9B 3EYSH 3IWUA 2AJ3A 2MHAA 3M7FB 3MLVH 1T3FB 4YHNB 2ZXEB 4JRXB 5SWSD 3WNJA 3IS1X 5EBWA 5DHVA 3IDYB 3SDYH 3LDBC 1L0YA 1D5BA 5EO9B 4YFEA 5JA9A 1D2OA 2JCWA 3LPFA 3FO2B 1MAML 4BK5C 4PJEB 1WTGT 3I02B 4YSTA 3IDNA 4URKA 3ZO0A 3BAKA 4L0ZA 4YWGL 5I18L 4HUKB 2WLJA 1MW0A 4ENEC 3CHQA 1P5UB 4KK6C 5EZOH 3VU2A 1XB6A 3IKKA 2EE9A 5J9PB 1AZUA 4GO8A 5L8KB 3MXWH 1RHHA 2MWCA 1BLNB 32C2B 3IKCB 5CLTA 3SDXF 4KNQA 3QUMA 3CVIL 1DLFH 3QXAA 4QPEA 3ARDA 3NCWA 3VGAB 5D93C 2OAAA 3CK0H 4Q2ZB 4IOFC 2A9AA 3GXTA 4RDQG 4C47A 3WMPA 4XMLH 4IEFB 3WJMA 4JRLA 4ODVL 2NNAB 1LTXA 3AY2A 1DBBL 2AQ1A 5D1ZB 5ICXB 5GS0D 4NRXA 4YHZH 3MNDA 3P4LA 4MA8H 4U1NA 4V1DB 4ADIA 4IKNA 5EA0H 5JLZA 1F8TL 1OLZA 3QJRB 1BYOA 1WA1X 4E42B 4G6ML 1YEHL 4DQOL 1ZVHA 3APFA 3FCBA 2VDPL 3G08A 1GGCH 3P9LA 1GMEA 4WI6A 2ZX5A 2XQYA 5FM8A 1OB0A 4KRPC 1RZJH 4XOCA 1K8DB 5C0CA 2WZ5A 2NY6C 1N19A 1TTBA 5BCAA 4PGEA 3SE4A 3VH8A 1IM9B 4BFIB 3BZ5A 2XWXA 4E41B 5DUBB 1OAXL 3ZW3A 4GRMA 4QYOB 2HKFH 4JBSA 2YR3A 3FQWB 4XNAA 3DROB 1CK0L 1ZEAL 2B0SL 1SJHB 3AXIA 2IOMA 1UZ6E 4YDJB 5TD4A 4I18B 3LRGA 4TNEA 4M8RA 1O6TA 2YMXH 3FDWA 5CR8A 4JFVA 5AAMA 5HHPA 5AWNH 3TFKD 3QE5A 2J5WA 3DIFA 2CNYA 4Q89A 2CHXA 3IGUA 3RDJA 5JPNB 4FHJA 1HHKA 3K6DA 3E8UL 3D87B 2R1YB 5DZNA 1HEZB 3QXVA 3SPVB 5ICYA 2GITB 2WIIB 4KI5C 1P84J 1HZHL 1H3XA 3JTSA 2I5YL 5E94B 2DQUL 4X7CC 4F2FA 4P46D 4KNTA 3UTZB 3GB7A 4Y5VC 2OQJA 2IXQB 2XQYK 2YD6A 1EXUA 2QHRL 4JPIA 3ZPDA 3TC9A 5DEFA 4PCKA 2R0LL 3SE3A 3B6SB 3VGDA 4L4TE 5B3JF 5GJTH 3FB5B 3VSTA 2VDQH 1KJMA 4P0DA 4FYSA 4Z7VB 5TQ2H 5ESAB 4PRAB 1U3NA 1UC6A 2ZXAA 2OMZB 1AFVH 3BCFA 4XBPB 2VDKL 3T0EB 5F3BB 2ZOOA 4AQZA 4FG4A 3QUXD 2Y36H 5IP4A 5SWQB 1BF5A 4LKCA 3TV8A 4N6RB 2D0FA 4OJEH 3ZDYE 3OVUB 5A6LA 1WTLA 1NMCB 2VIRA 4WV1C 3QWOB 4PJGF 3NZHL 3H8NA 1MW2A 3QXDB 3FXIC 3ZRCC 1U8NA 1NGWA 1JDDA 1ZAGA 5C09D 5SX5H 3TONA 4AT6B 3U0WH 4A6YH 3G5VB 1RJZA 3FH7A 5KJRL 1RZJC 4S0SD 3ZZQA 4RBPK 4LCWE 1UTDA 1G7MA 5L8JB 3R1GL 1XR8B 1DQKA 1T1ZB 3I9PA 5F44A 3QUHA 2QKIC 4LCCC 5K39B 3R4DA 3VDAA 3RURA 2PF6A 3L17A 3UBFA 3CN0A 3L3GB 3JWOH 4MJ6A 2H32A 4EUPG 3HZKB 3KPRD 2ZNWA 3QJHB 4K71C 4GKZB 3PJSB 2A9NL 3UG5A 4XO9A 4WO0A 2X4SB 1RFDL 1UWXH 2XG4B 3MRDA 1BXUA 5I1GL 3QIUD 4OCXL 4R7NA 4L18A 4W81A 4NQCB 1ML0A 2GUYA 3EJPA 4R5TA 5I0WA 4KKBD 3EYQD 5MERA 3LKNA 3RUGE 2YEZB 3M46A 1DR9A 2G60L 3MBEB 4OFKA 5E99L 2EVFA 3TCLA 1MFAH 4MKTA 3MA7A 2UY6A 3RBSA 1NLDL 2EDWA 4OJFL 1NGZA 1IM3B 1J8HE 4Q9CA 2DQ6A 3TWCH 4WFFD 3STLB 2DQGH 4UAOB 5ACLA 1S6NA 3EFDL 4HKBA 3ZTCC 4FNLL 3UC0L 1IGIL 2QPFA 3D2UB 3FAXA 4LKXA 3U6RA 4ETQB 3HN3A 3S3JA 4ZTPL 5I74B 4H26B 5IESL 4UANA 3ALXA 2ICEA 2GHZA 2BJMH 1KGIA 3I3DA 2YD7A 3LD8B 4KZ0A 4L23A 3U79A 1CLVA 5E8NB 4OZIE 3V5HA 1T0PB 4DP8X 1A0QH 2IDTA 4GW1A 4UM9B 2YK1L 1IEBA 3CBKB 1PLCA 3MTRA 3NJJA 5HYIA 2CGYA 2VZSA 2F8VA 4RDQF 4X4YA 2FX9H 2YQ2A 3BKCH 4KFZC 2NXYD 4PVMA 1KGYE 4MX7B 2VLJA 2E7CA 3QCTH 4GO6B 4MQ7B 3UAJC 3QC6X 1JIBA 4F9LA 4Z77A 2X9ZA 3CFIC 4MRCA 1OAQH 2FX8L 4OGYH 1E9QB 2XKSA 3UP6A 2VW4A 3V6OC 2NUPB 1JMZA 5B1BB 2I9LA 4PJ5D 4LSQL 4GQPH 5GZNA 1FIGH 2KYIA 3K4AA 4Y2OA 4WUUD 1NOLA 5PAZA 1K4DB 4R0LA 2IDFA 4IRJB 5I5JA 3MR9A 3PP3K 3HCVB 1TO5A 4R90H 2XWDA 2EEFA 4UIMA 5IJKC 2FYYA 3MYJA 4FADA 2AV7A 3MJ9H 1XCTA 2CKBH 3LKPA 3Q2WA 2PWFA 1MCJA 5D1QE 3QDGE 5IVZA 2KZBA 1PCSA 4Q4EA 3FB7A 3N3EA 4DOHB 2VL5A 1JYXA 3PHOB 2CBOA 4MCMA 4KV5E 3WO4C 1SXCA 5GPRA 3KJ4B 3KNBB 3JWOC 3C09C 1ITCA 4QWWC 3EH2A 4LARL 2OJZL 2ZYSA 4FTVD 2W9EL 1NDMA 3QDMB 5HHOE 1MJ8H 4GSXA 4GLRI 5B1KA 3K91A 2X41A 3MXVH 3WLBA 4ANWA 1ZIAA 2JH2A 4N8VB 5HI3C 1GY1A 5CGMA 2CCWA 3VQ1C 4J3VA 5HHXH 1N6QL 3ARPA 3GS0A 3IMWA 2Q86B 1N26A 2Z0UA 1A6PA 2K6ZA 4R7DA 4W9IC 1FPTL 2EVIA 5LB1A 3UZQB 4Z7UF 4JY6B 1DEEB 1KJ2B 4G11A 4TL5A 1DSFL 4CN4A 3OC8A 2GY7B 2FT6A 1YC7A 2RCSH 1JZFA 2YAQA 4NM8L 4PRIE 4DCQA 4X4ZA 1A02N 2DQDH 5F7DB 3P3RA 5L6YL 1QPPA 4M48H 4CSPA 1G9NH 1MCPH 1T2QH 4FZ8H 5KS9B 4NO2B 3B2MA 1JXGA 5KSAD 3SDDC 3PHQA 4QRRD 1TQBB 4KPHL 3QIWB 3RA7H 1F4AA 3QDJA 4KROB 1I9EA 2XYCA 3OM3B 4NO0D 4OQTL 3CUPA 4CC4A 4PRHD 5G5DA 1D9KA 2VC2B 4OZ4A 5CD5D 5HGAA 3GO1L 4PJ8B 4TNGA 5DO2D 3IU3A 4GUPB 1SBBA 5CSGA 1XF2B 3OJ2C 4FFVD 5DS2A 4OFYD 5KSBB 1KEGH 4R97B 3NJXA 4IU3B 5ACZA 2FO4B 4FS0A 3H3PH 5E2WL 3VI3A 2NQ3A 2X42A 3C60B 3JYCA 1MFDL 5EU6E 1QRKA 5F7NC 2ADGA 1G0XA 2GFBA 3OZKA 4DEPB 1CD0A 1A6TA 1I8LC 1OAZH 4FLQA 1GPOL 3DHMA 4B5EA 1NBQA 4RNRB 4TYUA 1HH6A 1I7UA 4U6TA 3T2NL 2QDWA 5B38A 5I1LB 1OQOA 1P7HL 2GI0A 3CZUB 4DO4A 2BVQB 2BY0A 3MRMB 3TNNA 3UJIH 2BDNH 1MWAH 2XFXA 4LCVA 1DUZA 2CZNA 3THML 3AABA 2EDNA 3CFUA 3FQRA 1FFTB 1ETZB 1VRSA 5F1OB 4XC1H 4NNXB 4BKLB 5EC1A 1F6AA 3CVHA 3QUYA 5T3XL 1Z9SA 5CINH 1SQMA 1MJ7L 3US9A 1V27A 2ZUXA 2CO6A 2FJSA 3ESNA 3BKYL 4G7YL 4MZIA 4O00A 3IBEA 4G8GA 5EOCL 4BUGA 5BS0B 4FQHB 3MRQB 1A3LL 1NAKL 5T5FA 1R5IA 9PCYA 3NH7H 4R4BA 5ID0A 1J5HA 1I1RA 2V5MA 2ZX7A 1JUFA 4LLVB 3S5LG 4PLJD 4XNUH 3UZEA 3T1WA 5A6MA 1R0AL 4LOUD 3LRSB 1PCXA 4GP5B 3WXWL 5DMKB 1G7LB 3FTZA 2AK4A 3I6KA 4TOYH 5DSCB 1OB1B 2PYFB 3F7RA 4FZEH 3L5WB 3KPOB 4NJAL 3MRRA 4GJTB 1G9NC 4NZUL 4WWKC 1E4KC 1AQHA 3DDFA 2LTQC 4RGNC 2X89D 1DZBA 2YKKA 3ARFB 1LO3H 1MFEH 4XNZB 1ASOA 4DP2X 4OZHE 3EYUL 4FFYA 4LLYA 4B41A 1OK0A 4LIQL 4JFDA 2ZOKA 2BOCB 3PWJA 4AJVA 3NUKA 3ZE0E 4F3FB 2X7LB 1LO2H 3F12B 1T1XA 3QZBA 4PQXA 2JKXA 2ENQA 5J12B 2A1WL 4Q8BA 1RXLA 2K1MA 1GOFA 1BBDH 5C8JA 2DW5A 4QRQA 5KTEL 4KHTH 1TVDA 3JVGA 1HQ4A 1SJEA 4TULH 3SE8H 3ABKB 3ARSA 4TLKA 4N8UA 4TNVK 1BG9A 4M6OL 4U6HB 2C9VA 4LPXA 1IC4H 5AOZA 5J6SA 2J88H 4H7VA 3QFJD 2V5YA 4GIAA 5D7EA 3PAVA 3F58H 5DUJA 5HPMA 3RJQB 2GT9A 2W81C 2JKSA 5EWIH 3S36L 1WITA 1SDAB 3CVHL 3PWVB 1HXYB 4B96A 1C12B 4L8SA 4D7BA 1DJIA 3V0FA 1FGNH 2VR6A 1PZBA 3WKMH 1NGPL 4L4VB 4XN2A 2WZ0A 5IHHA 2DAVA 4HSCX 4PWGA 4JFQB 4K7PX 4M4RB 5T5FL 4YSRA 2R4SH 3RJDA 2XN9A 3U1SH 5AZ2L 5GGUB 1JD9A 4YHMH 4Y2DC 4AK2A 4E9VA 4F15C 4FQQA 2NY4D 1ZVNA 1H8NA 4HS3B 2V37A 1JOIA 2QQNL 2VJ0A 3DURB 4IS6A 3MBXH 3L3HB 1JZ7A 1CDHA 1JHKH 2PW2B 5J6HB 4U33A 4R2GC 3A0OA 3PGFH 3TT3H 1T20A 3CG8A 2VR9A 1WFNA 4RA0C 3C9NB 3CZNA 1DCEA 4LVOB 4ZS6D 4B9FA 4GAAA 5EBLB 4XBMA 5B3SB 4LDCA 2R2HA 4FFYL 1JK8B 2AXJA 2C3GA 3JWNC 2ATAA 4LFHG 4NUJB 4NQXB 1LP9E 2YGVA 1KCUH 3MCLL 3ZE2B 1HKFA 1QG3A 1SM3H 3EADA 5JOFB 2DIJA 1VGKB 3DUSB 1SFDA 5HHVH 1NC2B 3TFKC 3LZLA 1KLGB 1M1XB 1JK9B 1QHPA 1QLFB 1MFNA 1AIFB 1S78C 2BSRB 4BQCA 2ZKXA 3BSHA 3EOBA 1G7JB 4TSBL 1FG9C 4Y19E 5AKVA 1TCMA 1XGRB 1PLAA 1Z3RA 5F2FA 5DHDA 5JR1H 2EP6A 5LDSA 4PVNA 2QADC 2V9UA 1WAAE 2NR6A 4MAYA 1BD2B 1INQB 1CICB 2HUEA 4MMXB 1K2DA 4M6NH 4NPJA 1G9MH 3ET9F 3HR6A 3ZSTA 5ALCL 2NSQA 1AOZA 4HAGA 5L2KE 2OL3A 5CJQL 4OB5L 1HYSD 2DV6A 2OLDA 5E6UB 5T1KB 4W6YB 1OW0A 1W8OA 3FT2A 4I3RL 4AE0A 4IBYA 3BDYL 4BFJA 5KYXB 3K3QA 5DD5L 4LSDA 2WLKA 1YEKL 2ITEA 1UWEL 2ZCLL 2FD6H 4IBUA 1TPXB 2PPDA 3S96B 2NPLX 4JUTA 4LO9A 3SYPA 4OFVA 2R23A 3GJFA 1CB4A 1IAKA 1S46A 5FGBA 3RWGA 4B3VA 3BC9A 3P0YL 1TEGA 2MKLC 3MLTA 1U42A 4XE5B 2H9GB 5MEQB 1ZE3H 4R3SA 1KCKA 2FT7A 1IGYA 2YOCA 3FU6A 2AF2A 3PIQA 4G6JL 4ZTOH 1JZEA 2YGPA 2AEQH 2VM4A 3KXFB 5T8IA 1S5IH 3WFEL 4BDVB 4E5XG 1UD5A 5JHDD 2YGNA 3FQTA 4BE5A 3SPJA 3N5AA 1MCHA 4YQXL 4EIBA 3WGUB 4H2CA 1Q0YL 3GXNA 4WI9A 4UB0L 3ZRFC 4QJ4B 1XIWC 1R3IH 3LQAL 4YHOH 1L7IH 5CILL 5FO8B 5HYEA 4PB9H 4BA8A 4FXKA 3ARGD 2XQBL 5BZDA 1ZA6B 1HILB 3FQ2A 1DJWA 1B2YA 1L6XA 2F1EA 2R0WL 1TQCC 3QUKA 3WIFB 2DOCA 4JM2F 4X5WA 3AWFA 3V10A 2YXFA 1BAWA 1TJGH 1A22B 1J1XL 5ID1B 5AZUA 1NPNA 2OMUB 3O41B 4OCMC 5I8OH 3VWKB 1T22B 4XODA 2A77H 5GJSH 1PY4A 3GEFA 4XMKH 1AYRA 5BQ7B 2QPUA 3M88A 3MRFA 4LCUA 4EI5B 4KXAA 4X98A 2YRBA 3BZFB 3SN6N 3Q5TA 5E6IA 4F7CA 4XNMA 1EFQA 4MMZB 2DQFB 1J1PH 4X4MA 4QRPD 3BCDA 3VG0L 3VXMD 3A67L 3GJFK 3W9DA 1TUPA 2OI9B 4PV1C 2AQ2A 2OL3L 3GJEA 4OBRA 7FABL 4KZDH 3ULUD 1IVTA 2O5YL 5FYKE 4HXAH 3IDJA 5HVHC 3O3UN 4P59L 3OHMB 43CAB 2BFVL 4HJUA 3AM8C 4XXCC 3QYNA 4MQXC 3ZT5A 5DD1L 2E27L 1I8UA 2H8PA 4OLUL 1RIUL 2D7TL 3KE0A 3HFMH 4N0CD 4XBGB 4MAUH 3I6LD 3QR1A 3I9IA 4AC2A 4BELD 2QLVB 1OSYA 2R51A 3L8QA 3CVCA 4X5XA 1GJUA 5H37G 3D07A 5B8CB 3A23A 1KZQA 5I6LA 1Y0LA 1NANI 2YAHA 2ZOWA 2VJ8A 1K3IA 1D3CA 3AXHA 5K9JL 1DQTA 2YD1A 4NP4H 1ORQA 4URTB 3LEXB 5MP6H 2IWKA 1P7BA 5F6IB 2NXZB 1AD0B 3KPLA 3NJMA 2VGLM 4JREB 1N18A 2N3JA 3K74B 3SDAD 3GBEA 2P42B 3LQZA 5TE4H 4AM0Q 1ZE3C 3AQYA 4WTQA 5DK0B 5DWPA 2OTWA 1VEMA 2Y9RT 4I13B 1XSOA 3T1FA 5DXWA 4PJCB 4H8WH 3QORB 4Z7OF 2GJ6B 1Z32X 4PW9A 2ARJA 4BH8A 4FMVA 5FGCE 2I9TA 1GGBL 3SD2A 3CDFA 2YPKA 4X8JB 1JHTB 1VEOA 2CLVA 3SGKC 4UIKH 1MCOL 1SEBA 4O02A 1DQML 5TDPB 1WA2X 1F58L 2Z7YA 5F9JB 3UTSA 4NHCL 1C5DA 1IBHA 1QVOB 4Q14A 3S8GB 3RKDD 2AC0A 1PLGH 2ADIA 1XEUA 4HKJA 4K7PH 4DNLA 1I7ZB 2R9HC 3JZ7A 4MXWL 3KW8A 1MHPL 3W39A 4LMQE 1I8IA 3DMMD 1T03H 3EH4B 5J11B 4O2CA 2EC9U 4PJAA 1NC4D 2PCPB 3RFZC 5DS1A 1USQA 3SKMB 1RSYA 1XCWA 3PDGA 3IF1B 4B50A 1OP5H 2JLPA 1EEUA 3JTTB 2EXSA 3PWNA 4HV8A 4JO3H 5AD0A 5IVXE 3GMMA 4AZ8A 3QSKB 2XTJE 3T6ZA 4N8PA 1PVHA 5LGJB 1J1OH 4ZYKA 2YRZA 2F53B 3MKKA 4HZ1A 4I0PC 4O5LL 4AITA 2OCFD 2P5PA 3QG6A 1WAPA 3O6MH 4MD5A 4NZTH 4HJGA 1LDPH 4PJ9C 1IFRA 3HRZC 4NKOB 4X8CA 3T3MF 1UXWA 1BQ5A 2PTTA 3JUZA 3TO2A 2R2BA 4FI8A 5DHXB 3BWUF 3ZYJA 4GRLB 3MRHB 3UAEA 5EEYA 2V4LA 4MA1B 4X0NA 5DJXB 1TQUA 1KJ3H 4YBHA 4OSUL 5E7BA 3N91A 4N3UA 3QAQA 4IYKA 5EUOE 4HIPA 3U2IA 2CGRL 3IDNB 4HJSA 2SEBA 5E2VL 1TZGH 3MOAH 3OLGA 3FAWA 1FG2A 2GSMB 2HA1A 3VXUD 2CDFA 2CA3A 1SVCP 2ZWKA 4GSUA 3L4CA 3L5XL 5C6TH 5CJBA 1QFUH 4BWTA 4AYBA 4LU5H 1A6WL 1G9EA 1HHJB 3WY1A 3GLAA 2YXVA 4HSQA 4KTDH 1Q72H 3C5SA 1X9LA 1RHHB 3GKWH 3F7KA 1E4XI 4OZFG 3FU8A 3L5JA 3QUMB 1Z9MA 1IGTA 5IQ9A 3UJTL 3ARDB 2FBOJ 1BLIA 2FBRA 1RULH 5CLZA 3SQBA 3D85D 2C1PA 1DHKA 4RAHA 1XH3A 2VDMH 4TQHA 3Q9QA 3BIBX 3OAUH 2JB5H 3ATAA 3BMVA 4Z1PA 3OKNB 3K80A 12E8L 4NWUH 4JO2L 5JIPA 1GHFL 1MZZA 4XT1C 1IQWL 1FVCB 1TFPA 4YZFF 3B37A 2Z65C 2E7LA 1ZV2A 1KB5B 4H0HB 4KK9C 4AVKA 5CGTA 1OAUL 3DO7A 4JW3A 5K69A 4HZAA 2NDGA 4O58H 2QSCL 1OXYA 4JHVA 2BNRE 3MLZL 3C08L 3LAFA 3MV8B 5F6HJ 4RFNB 1NIDA 1WS7A 2Q3AA 4ECNA 3ULVE 4F20A 3R0NA 5D7HA 1S3KL 4S11A 3WMSA 1G84A 1LEKA 3ARBB 2WVVA 1NFDF 1A7RH 1MCLA 4CVXB 5A40E 1A6UH 3L7EA 4NOBA 1I3RB 4X9IA 1OGTB 2DQJL 4MQTB 5DFWH 2VQ1B 3VE0A 3OKYA 4FJ6A 2AXHA 4OZGE 5T1MB 1FVEB 2Y0SA 3AC0A 2OX5A 4PJXF 5KZCD 3DIFB 2H2PC 4F5CE 3CFDA 3BQUD 3K5RA 3UYPA 1KTLA 1N68A 1KPVB 4KAQL 4IBZA 5E0FA 4XHJC 2WZPA 3KS0H 4FQXC 4QUOA 3WD5H 2V8LA 4NQEE 1L3NA 2BWDA 2I32A 1JFQL 2V17H 2NY3C 1JJUA 1N4XH 3FTYA 1EH9A 5ICYB 5L88H 2R27A 1R3HB 1ZSDB 1MW3A 3MBWA 2NYZA 4L05A 2M2DA 1YNTA 3JTSB 1M9WA 3I9AA 3VFUA 3ZHLA 5LQBH 4POZC 3TF7C 2V3EA 1X9QA 4FXGA 1FO0H 3VXRB 1KTBA 4UQ3B 2WYHA 5G4MA 1XMWA 4JPIB 2KUTA 1UWGH 5FUZH 5FYKH 1Q9KA 1NEPA 1D5ZA 2X9WA 3NZUA 3BPLC 3PWPE 5HVFB 4EUPH 2HJFB 3DHUA 3FTXA 3TBSA 1NLBH 4IDLA 3DUUB 1R3KA 3TN0B 3VI4B 1M05A 1RLWA 4PI2A 5ILTL 5GZOA 2GB2A 4J3OG 4G8AC 4JZJC 4D0CB 1QD0A 2XWCA 1T5XA 3GIZH 4PUBL 4P2RE 1PZCA 1PKQB 5GGQL 2DLHA 4K8RH 2EH7L 1TYRA 4NCC2 5M7QA 5EIIA 1KULA 1RH8A 1QSEB 4AUYA 2DBJA 4UYQA 3HG4A 4BQ9A 1XF4A 3JWDL 4EZKA 1AKJB 2IC2A 4M43H 1ZT4B 3P69A 4UV4L 5DFTA 2HP4A 3NCEB 4LP4A 5IB4A 1JDCA 2OMYB 3FJTA 1BIIB 5DEGB 5KG9B 5CHNB 5GSRB 3P0GB 2NY4C 3P40A 1U8IB 2WBJC 2IPTH 3U4BL 1RHFA 3V6ZA 1JYVA 1ZLEA 3EYOA 1S9YB 4B9YA 5FHBL 4MWFB 2YPLD 2CIIA 1IO4C 3HI5H 3ILQC 4X6EB 5DMIL 4LPYA 1G7HA 3QI9C 4WW2F 1AXTL 2XXMB 2Z6FA 3H4HA 2R7EB 3VGFA 1H6TA 4OT1H 5FFOA 4CL7A 4JFYB 1X5JA 2BP8B 1X6NA 1ZPLA 4WKXA 4XO3A 2HFGL 4G7SB 4M62H 3CLEL 2DH2A 3HC2A 4ZAKD 3GSRA 5MERB 1RUML 1SYSA 5DJAA 3V0EA 2P80A 3KGUA 1K85A 1NIFA 1PG7X 3UCRA 3FCTA 1ZT7A 4Y5XB 3DRQB 1JVLA 1VFAB 4PJFE 3C6SA 4LASL 2WNXA 1MAJA 5T1DH 2HJKB 2NSMA 1JGLL 3MFFA 2CBMA 4NKDB 4FJZA 1NCNA 5E1HB 1O9ZA 2BS9A 3A4EA 1QR1B 3FUDA 3QZOA 1AO7D 3SKUD 2WKLA 1T5WB 4HWZB 1RZGB 4A39A 3V5HB 5J3HC 1NUNB 2NNXA 1IEBB 3WS3A 4UINH 3VMOA 4OLZL 2J20A 4JPWH 4FNSA 4WNSA 1S7VB 1I7TB 1OGAB 3RIAK 3D39A 4JUSA 1WUNT 4KQ4H 4BFKA 1FBIH 1R75A 1NIAA 4AGLA 1Q9WB 2GAZA 3MV7D 1W8NA 4XCCL 4Z77B 3HB3D 3AG1B 4XCEB 5DJCB 4HLEA 4F7EA 4G6FB 4RIRB 4BK4A 1YECL 2YGOA 4K8RC 1LO4L 5AAPA 2AZUA 1NKRA 4X6CA 3NIDE 4EIGB 4PV9B 4B97A 1G5AA 4O4YL 4L37A 2O4EA 5I1KH 2AV7B 4C8XA 4Q58C 2FR4B 3LMJH 4JO5A 1BOGA 1X5KA 2Y3NA 4EI0A 5E08L 1HOCB 4OCRH 3QULB 2QKIA 5L4IA 1KXQA 2E9JA 4U2YA 3D09A 3G5ZA 3PP4H 4NQVB 1LO5A 3H9SD 1YHPA 1TTFA 1WUZA 5K1JA 1DVFB 1HCZA 1MHHA 2ZKHH 4JQIH 5HD8D 4QXUH 3GRBA 2G0LA 3ZU8A 2VSMB 1BJ1H 5BRZA 1XF5B 4BRJA 4OUUA 1WCQA 3LB6D 5AYUH 1NAMA 2LV4A 3TBYA 1PZAA 5HYJD 5L0QC 2DM7A 1KENL 2OSLA 3MUHL 5D2LE 3ARGC 3MRKA 4ZOAA 4N0UE 4WRLA 3VNYA 3WFDL 2PW1A 2OW7A 5F7MC 4TLTA 4XCNA 4R7DB 2C3XA 5GRYA 3E7JA 5LXVA 2DBLH 1IRAY 5FGSA 4OLYL 4C59B 2KT6A 3ESVF 5CP7B 3VXNA 3K1KC 1W0VB 5FA4A 3EUUA 4AVIA 2NZ9C 3I9GL 4DCQB 2XTJC 3GNML 2XT1B 5B39A 5AW8B 1NICA 3HLAA 4AEIL 3LZOA 1SY6H 4ZT1A 4JR9H 2H6UA 1CGVA 2FECL 3QDJB 3SKOA 2CJUL 1IKFL 3CUPB 1CG9A 2HKHH 1D9KB 1C8QA 3HMWH 1JDAA 3BP5A 2DTSA 2GJPA 5LAXA 2WGNB 3UAJA 2EE3A 2P46B 5D4JA 3P11H 3Q2VA 4AJYV 3IU3B 5LN8A 2HJLB 1KCSH 4G43B 2ICWA 5T33H 5BMFL 1AZBA 4IOSD 4HFUH 3U25A 1RVFH 3V6OA 2VNCA 2BVOB 3N04A 4FL4C 3CVBA 2WP3O 3RZCA 2YPVA 5ACMA 5FUOL 3D0AA 2FEDD 3OSVA 2GFBB 2GTWA 2OMXA 1GGIH 2ZAIA 5EO0B 4N2HA 1E40A 4LLMA 5CZKA 5AOLA 4BZ2H 4HLZG 4W70A 1E6OH 2HX7A 2N59A 4FX5A 3WJLA 2O61A 5B38B 3GSVA 4NZRL 4FDWA 4RMSA 1PW3A 1UURA 5DI8A 1B3JA 1QLEB 4N2LA 1LQBC 1NGXB 2P1YA 2Y6TE 5CCKH 4P4KC 5D96B 3O3EA 3MRCA 1YEEH 4CU8A 3B8SA 2Q7YA 3E2HC 1YYLH 4FYQA 4YNYB 5LUMA 3KBHE 1NAML 2ORBH 1NBZB 3O4LA 3U9UA 2ESVB 3F04A 3V6BR 2MOGA 3WN6A 3QUYB 3EBAA 4XBEL 5FV2A 3L5HA 2I85A 2JKRM 1FF5A 2DLGA 2CO6B 2WV3A 5FCSH 4D8OA 1UYWH 3ARWA 2WWMC 4Z7WE 1L9QA 2X1XR 3X14A 4B95C 4G8GB 1T2JA 1EEZB 2E6QA 1PF3A 4MCYB 5SWZB 3EBGA 4GQRA 4X0KA 3N1QC 3WYRA 4ACPA 2VXUH 4BA0A 3US1A 4LLQA 2Q76B 4WNQB 1Z9NA 5T3ZE 4UUJA 4YE0A 5DUPH 3ETBJ 2VLLB 5I8EA 4R4FL 1I1AA 1ZD6A 2K6YA 5AW5B 4LSSH 2CMRH 3Q43A 3WEXA 3O4OC 5E5UB 3V0IA 4HG4J 4Q9RL 1TT6A 2FB4H 4YXHH 4KY1L 1YMMA 5HDOA 4TUKL 4C54A 5CLWA 5DVPA 5T1LB 3S3SA 4F9PC 3ZYZA 2G75A 2EE2A 4FLHA 3SDCC 3HE6D 1FH5H 1FORL 3AS3A 4F33A 2XX0A 2FSEB 2R83A 2E5EA 2WQSA 2ZOKB 4M6MH 5D1XC 5I66B 4DEUA 4PBWD 1H8SA 1PG7H 2YPVL 4FLOA 4R96B 2J8UF 2W9LA 4YHLL 1U8QB 5K9OB 2FJGB 2Z8WC 2L4OA 3DTXA 3HS0C 5AYTA 2WMPB 4WO4B 1HINL 2CBQA 4ONFL 2R4RL 4H0LC 5IQMA 4HWEH 4H0IA 5EF1A 2QDVA 5TPWL 4RGMB 4QXWA 4PHZA 2G2NA 5DJYA 2BRRL 2YLKA 1HTYA 1U2HA 3Q3GA 5AAWC 1BG1A 1QNIA 1OM3L 1EAJA 1PMYA 3COOA 1JGVH 2GSGA 2P5EA 2PETA 2WD0A 3LNEA 4XX1G 5AW4B 3O2DA 2ZUVA 1YPZE 4R5VA 1BCIA 2AEPL 2DQEL 3K2UL 4JM2C 3CN2A 3NIFE 3RWHB 4JRXE 5TE7H 4BEIA 3UPCA 2A0LD 1GSKA 2VN3A 2VITB 4YFLI 3C6EA 2CR0A 1XF3B 1MHCB 1TYJA 1U2CA 2BIMA 4AGQA 2VJXA 4FQQB 4JKKA 3VA6A 1BV8A 2X09A 3SE6A 2VQ4A 2VISB 3CFQA 1U33A 1IBZA 2ZAGA 2P28B 5BW7C 1BP3B 4W68A 5KVFE 2BC4A 3ZKND 1ANUA 4YSSA 3DBXA 2CRZA 5BZZA 3TIDA 3FTSA 2X12A 2DM3A 3PY9A 3V5KB 4J4PA 4HIJA 4PRDA 3VMPA 4C56B 1Z6JT 3QG7L 5IM7A 5IREA 4Y4KB 4B9KC 4BFRA 1F86A 2OV0A 5HTSA 1WG3A 2ENSA 2R2HB 4Q56A 5DRZB 5A16B 4WWKA 1QBBA 5J06A 4IOIA 3PPSA 3WY4A 3FU3A 2AP2A 1BA9A 3PV6A 4GRWF 4I1NB 1F56A 4HFWA 2IV8A 4L4TD 3OXSA 4R7XA 5AVVB 5DJZB 5I1EL 5IVOA 4RETB 5SWSA 4DGUA 1N7ML 1NCWH 3MRGA 2YZ1A 1QYGH 4IIQC 3TO4C 5F7FA 3RPIA 1EHNA 3V4UH 4HCRA 2BO0A 3BAJA 2YGQA 2YN5A 1H15B 1IBFA 1UM5L 3DHPA 4NP9A 4MAYB 5FDWB 1ECZA 1VERA 2NY1B 2Q8BL 3HNTH 4QTIH 2X05A 4S1DD 4OGAC 4XNDA 3V0VB 5FYLE 4OM1L 4I2XB 2WAHA 3MTXA 1CE1H 4OD1L 3O2DL 3IRZA 4FQCL 3QJXA 2PO6B 5J1TC 3M8OH 3P2TA 4PJBA 4GG6A 3SB3A 3FT2B 1SPDA 5BZXA 3N44B 4K55A 4KO5A 5TK4A 4ZNCD 2QSVA 4XVTL 4C58B 2QJDA 5FO7A 1MCEA 4YVNA 2X2HA 3RAJL 4XVUD 1E8XA 1CFTA 3CFEA 4P5TB 1CXLA 1FZJB 3PXJA 1A65A 1UXLA 1MREH 1XGYL 4P5KB 5ERWB 4ZUWB 2P9RA 5CP3A 2BNUB 3H9ZA 2DWSA 2VWEE 3R0MA 3E8VA 3KBPA 4U0RB 2R1XA 5BVJB 4S1QL 5D55A 1QFWI 2P5WD 3WO3B 5C0ND 4EMZA 1H0DA 4CVZA 1FAIL 3HIZA 4XGZA 5LGYA 2WVSA 4Y2DA 1AE6L 3HNSH 2V8MA 3PIQB 3VM7A 3U4EA 1AR1C 5IB2B 1MPAL 1EMTH 4HCFA 1E28B 4JQXA 4XP5H 1IV8A 4ZO6A 5DD0L 3EH5B 4QXGH 4ELME 1RLBA 4I3SL 4YH6A 4MCZB 2UYLA 2YRLA 3IJSB 1J8HD 1S7TA 2V33A 3U30B 1XT5A 1T66D 2VABA 4NI3A 5DTFA 4L9LA 5BV7H 3MLYH 2VH5H 4HSAC 4LQFL 4LSRL 2VXTL 3FUNA 4NO5A 4X5WB 3WCYA 4JO8A 4KKLD 1WD9A 4HA1A 5E70A 4BHUA 4ZFOA 2EYSA 2VN4A 2Y07L 4Y16D 1CMOA 3SO3B 5H37H 3T8MA 2EKSA 2H41A 1CFSA 2IGFH 4U1HB 2OZ4A 1HQRB 2EDKA 5H2BA 1K3ZA 1U3HC 1ODUA 4Q6IC 2YAOA 4HCRL 4WTZG 3FPXA 2P24B 2NZIA 3BVNB 4GXVH 3ZKQD 5BNXD 4NCDA 4PJDA 5C08B 5T3ZH 3A3YB 3GUTB 1AS8A 3W9DB 5G55A 1IZKA 3SY0B 4GW5B 1FZMA 3ETSA 5F8RC 5KVGE 1X5HA 2Z8RA 3SCMD 4HU2A 4R26H 4DP1X 1CBJA 2OZNA 3WG7B 4LSTL 3LNIA 4KXCA 1RZIB 1GS7A 3SOBH 4P46A 3KL5A 4LDEB 4YZWA 5ICZA 1OSPL 5F96L 5E9DE 5D7KE 5D6DC 5D1QD 1J12A 2IH9A 4Z76A 5EZJA 2Z31D 3VD4A 4QTHA 1I85A 3DX9B 5K5YA 1KUMA 1MF2L 4X5XB 5GS0L 4QHKJ 3TXAA 5KN5B 1Y0LB 3HG1B 5BZWA 1CGWA 4NZ8A 5FB8A 1EAQA 1EWHA 2DIAA 3TNMA 4AM0B 5KANG 1PU0A 4CA4A 1KGWA 4HETA 1F6FB 3L9RB 2ADJA 3EXLA 1THCA 1UVQA 4M7ZC 1GMIA 4N2NA 2DMGA 4XNYH 1EA9C 1NFIA 4JGNA 4YBLC 1TMQA 2ILLA 3OPZH 1OLLA 3RPKA 3V0GA 2VDLB 2D2OA 4AGMA 3S88H 5C0FA 5KW9L 2R29H 3SPIA 3UEZA 3S35L 4LDLB 5C09A 5L7XH 3UTTB 1HI6A 2I24N 3KYNA 5CWSA 3ZMEA 1KCRH 2EXYC 5JA8B 4NN5B 3B7YA 3U9PH 3WBDA 2QR0A 4XPFH 1KXTB 4GKLA 1FJ1A 1UXSA 1TXKA 2YEVB 4ZFOL 3RNQA 5EO1A 4PRID 1F6LL 2OZ4L 4TN9A 3PV7A 1LK2A 4N5ED 3FN0L 3A6BL 3KPRA 3OKKA 2QTVA 3BZDA 3F7LA 4QAMB 2DWEA 3M6DA 1U3YA 4HJJL 3LXUX 3QIUA 4F7MB 3UGUA 4O2CB 1PPIA 5BJTB 5DFVD 2VLKB 1JF1A 3MRLA 1E8ZA 4NWTL 3ARRA 2GK2A 1S7WA 5CEYB 3GI9H 4AZ8B 3BWAB 2BRQA 1AR2A 5KVFH 1BQHB 3H2WA 4OZFH 4BSWB 4ANKA 4ZYKB 1HWHB 1P7QD 4HC1H 3SDXA 2XV0A 1YN7A 4K9EH 3T6QC 3HPLB 5ISZB 2QQLL 1YDPA 2JLLA 3GQFA 3KL3A 4MDJA 5E7FA 3NP3A 4ZFZA 1JFHA 5DRXB 4PJIA 5BRQA 3MLRH 1NMBL 2DIEA 3ECBA 1XFPA 3QVAA 1KTCA 4I5BA 4MD4B 1ZDQA 3ZE1B 1ET5A 1R5WA 1X5IA 5C9KA 3POHA 2CO2A 2BM3A 3QNYB 5HHMB 3GXFA 4LSVH 1J9CT 2SEBB 1DJSA 1N8ZA 1A4KB 3E6HA 1S7RB 1VPOH 2R0KH 4HQQH 1E27A 3Q13A 4UT9A 3QDME 4YO0B 1JPTH 4BGLA 1BX2A 3FHAA 2JTYA 2NMSA 5CFAA 1D5IH 3ULSA 1CDGA 3K5SA 3BP7A 4M5YH 2JCCF 2WY3B 3WE6A 1M7IA 3C5SB 3PXLA 4EZMA 4QHNA 5A43C 2X4OB 4PWHA 3ZL4L 1XXDC 1JS4A 4G6AD 3IJYA 2BNQE 4PJ5A 5BO0D 2NX5E 4PMFA 4XN8A 5FYLH 2P52A 3NPSB 3KS0J 4Z7QB 3M86A 1FYTA 1XH3B 5BOPA 4QCIB 1QW8A 3IETB 4ZD3H 1KPRA 1RUPL 4HUNB 2VDOL 3G6DH 3NP4A 5KVDE 2OP4L 4HHAB 1SBSL 4NCC1 2XZCL 3EJZD 2Q7AA 4IKJA 5IFHL 4OCSH 3RBGA 3TBVB 3G6JA 3HNVH 4KKCD 1CTOA 3VW3H 2CBTA 3TLRA 4FNPA 5DWUH 3REWB 2YAFA 4FA8A 3T3PF 2J44A 4DGWC 5GIRA 3DO7B 1G6RA 1BVZA 4U1GB 4FTVA 4K3DH 4P3CH 5CIPA 3L3KB 1BIHA 4K3EH 3LHPH 1A64A 1TSRA 4MQSB 2EIEA 4A7SA 1IKNA 4IBVA 3T4AC 1VIWA 4XN4A 1ZLVH 5KSBE 4X6DE 2XQYG 1T7YA 2IO5A 4I89A 1E9OB 3AREC 4H88H 2WINB 2WLLA 3MX0A 1IIIA 3KHOA 1CE6A 2CHZA 2XN0A 3B2UD 4QO1B 2WVTA 3DARA 3MOBL 2VR8A 1GTFA 1Z1WA 2F7PA 3VH8G 2GEEA 5HDBB 1J0YA 2WXNA 1TJHH 1HNFA 4WFED 1F90H 2FECI 4N5UA 1XSIA 2KLSA 5CZXD 4QLWA 4U05A 4PY7A 5IJVB 4K9EC 4BZ1H 5IT2H 2XOTA 3MACL 1P4BL 2ROXA 3VE0B 4OF6A 2Y1YA 1I9JL 2D03L 3BUIA 4S1SH 3RU8L 2QPEB 2X4TB 3LNHA 3FOLB 3LDBB 3WFBH 4X9HA 4J3OH 5I1HL 3UYPB 3I2CH 2JIXD 3KYKH 4WSKA 3RKPA 4UT9L 3LKRA 5KSAA 5JMOC 4QRRA 3E6FA 4I85A 1UEMA 4O2FA 3BXNA 3O6FC 3TA3D 5EF0A 4H44C 2Y7QA 3FTWA 4GI9A 5CXPA 2M83A 3QRLA 4HKZA 1SHWA 4NO0A 4G1MB 4KMTL 4E9XA 4PRHA 3L1FA 3Q8FA 5CD3A 4PJGA 1YNKL 1YNTB 1IGCH 1NZRA 1U95B 1J0KA 1URLA 2FZ3A 3R7QA 1D5MA 1NKOA 5CGYC 4LLWB 5JUEL 4OFYA 1L9TA 1QRNE 1FVDB 1YLBB 2B15A 4FQ2H 3ZHNA 3VVVA 3KLHC 5BS0E 1P0SE 5IROD 4G6KL 4MSWA 1MJJA 1WT5A 4FNQA 4K07A 5D93B 5E6RB 2FIKA 1SHSA 2P3YA 4QGYA 5I1IL 2FX7L 1KELH 4YGVB 1EDYA 2H5UA 2YBGA 3CHPA 1JGEB 1E9PB 3TVMC 1AHWB 3KPNB 5SV4A 1M05B 4WEEA 1CIDA 2UY7B 1K8IA 4HCIA 3BO8A 5CUSH 2WC7A 1OHZA 3PAUA 4IJ3C 4TTDD 4W9KC 1EJFA 1MCDA 2OMBA 4KDWA 1E6JL 5DR5H 2J5LC 5A2JH 1BFOA 1J0JA 4FE9A 4W9ZA 1BGXL 3MRNA 2D0GA 2W65A 4P2QA 4JJHA 4KQ3L 5AW6B 3N0PB 2DLFH 4G8IA 2UWEE 4KRPB 3ZDXE 4TRPL 4KZEH 2IAMD 4HDIA 3JBG7 2NY6B 4KVCL 3H42H 1UM4H 5B7MA 5A2IH 4XWGH 1BFVH 3BSZH 4YHYC 3GMRA 4WI0B 3WXVH 3PWLA 3GHBH 3BISA 4P23B 3ROOA 4X7TB 1P84K 3PHSA 3Q7JA 4PYGA 3HHSB 4Y19D 1RUAH 1U30A 2ICWI 3IGAB 3TH3T 1NGYB 1DQQB 5E2TL 2V5TA 1EJOL 1W15A 5IEHB 1GJIA 2P8PA 3SIKA 4OGXH 3VRLE 1MRFH 5E00A 2F68X 5C07D 3CQFA 3GHEH 4AH2B 4CADA 4UU9A 2CWRA 4XN5A 4LAQH 1E65A 2RQ8A 5DHYA 5L2KD 4L0PB 4FQXA 3EH1A 5C0AB 1I1FB 4M6AA 5LGHH 3LH2L 1MRDL 2WO3B 4U1MA 3FCTB 2TRHA 1GS8A 2DL2A 4Z0BL 1KZYA 4FLRA 4L4VE 2V0AA 4YL9A 5KVEL 1S3RA 3GZOA 4YAQB 1F42A 1BJ1J 4JDEB 4WCYH 4AJWA 2BERA 1UOKA 4JM4H 1DBML 5IHUH 2L7JA 3SEPA 4Y5VB 5H94A 2AHIA 1D5XA 1S9WB 1VZHA 3WJJC 2JJSC 4HZLA 4XI5D 3I85A 1DN0A 3KYMA 3WS3B