1J5IA

Solution structure of a novel chromoprotein derived from apo-neocarzinostatin and a synthetic chromophore
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
113
structure length
113
Chain Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of a Novel Chromoprotein Derived from Apo-Neocarzinostatin and a Synthetic Chromophore
pubmed doi rcsb
source organism Streptomyces carzinostaticus
molecule tags Antibiotic
molecule keywords PROTEIN (Apo-Neocarzinostatin)
total genus 10
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2002-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 1j5iA00
1O5PA 1HZKA 2CBOA 1J5IA 2G0KA 1NCOA 2CBMA 2CBTA 2G0LA 2MCMA 1J5HA 2CBQA 4JW3A 1AKPA 1HZLA 1J48A 1NOAA 1ACXA
chains in the Genus database with same CATH superfamily
3WYRA 3MV9B 3VFUA 5E2VL 5I15H 1ZA3A 3I9GL 4Q0XL 2Q87A 3T2NL 5BRZE 1NWPA 3VXSD 3AWFA 1F0LA 4FLSA 3QPKA 2YGNA 5FCSH 4J3XA 2HN7A 2QKIC 1R3IL 4Y7OC 1CXKA 1UCBL 2CZNA 2X53A 2N7BA 3PQYE 1U8MB 1BJ1J 3WNNA 4YHIB 2ZOKA 4CC4A 3LV3B 4V2BA 3PV6B 3UTSD 4WO0A 1UQSB 1H0DA 4DK3A 1TQSA 1T1WA 4TUOB 2K6ZA 4PVMA 3CQQA 5D7JD 3QNYA 4GMTH 4MAYB 2K4AA 4F57H 1MW3A 3ZTJH 1PPIA 3MREA 3UFIA 5HYEA 4G6MH 2Y2TA 2IPUK 3SJVD 2IGTA 1KEGL 2FH8A 1E40A 3OJDB 5EU5A 2WTPA 3I6GB 1ZHBA 2Q8BH 1OAZH 2EDQA 3LN4B 2XKNA 1O9VA 1ZEAL 2Z0UA 3F6LA 3QUZD 4L05A 4NC1E 4O58L 5E1IA 2HRHA 1SF5A 2IXQA 3OKYA 4QAWA 5HDOA 4ABVA 1DVZA 4ETQB 4NPJA 1FP5A 2LABA 3DOSB 4J8QA 4N90D 4WNSA 1ONQA 1ACCA 2GABA 1XSIA 2JJVA 3BPOC 1SHXA 4FHBD 3U2SB 1I8IA 3TZVC 3UAJC 3CN3A 1SY6H 2LQRA 4AGLA 5T1MB 3ZY7A 4QYOB 3C09C 3NTCH 4L4TD 3SGDH 1BD2A 4P5TB 5INCA 4NSKB 1T03H 1H15B 5C0DB 1T6BX 1TJGL 2AQQA 4YGAB 4A7GF 4FXTA 3IF1B 3HJ0A 3VSUA 2XRAH 3QJSB 5JXAH 2DLTA 2WXJA 3LKPB 5CU5A 4B5ZA 4Q9RH 1U4EA 5J12B 4B9IA 3MJ7B 2XUWA 1S7TA 5KVGL 1N8OE 1MG2C 4ABQA 4I85A 3NJFA 4JFSA 2I69A 3Q6FB 1LL1A 1WBYB 5I2IA 3MGAA 1DJXA 3NIFE 1KGXA 1XB8A 4P4RA 1U2CA 1YEEH 3ZU8A 3LB6D 3S5ZA 3Q5OA 4X4ZA 5AL0A 5LGKA 1ZK5A 4NQDA 3V2AR 1TQVA 5KVEL 1KNOA 2V9RA 1E0OB 4GIOA 2BXZA 1ICTA 3D87B 2KZBA 4X8JB 3CFDA 5D96C 4DKFL 4PMFA 2DQTH 2WZ5A 5LGHH 4OLXH 3BKJH 3TYGH 2VZSA 1SXAA 2Z7YA 1UXWB 3DXAA 4XMVA 1LNUA 3QQ4A 1NLBL 5GGRA 4RDQF 4Z7VE 3J27A 3PS6A 2MQ3A 2FIRT 1E28A 3LS4H 2CKBB 4BEIA 3KGUA 4DP5X 4NQXA 4N6QA 1HQ4A 1ZXQA 1FGVL 2JCCB 4JZNB 4IGBC 5EOTA 3D4YA 4V1DB 5I8CB 1O75A 3HZKA 1UA7A 4YDVB 1A02N 3X3FH 2FX7L 1BZ7A 1A5FH 3JV4B 5KVGE 2BRQA 1ZT7A 5E03A 4UBDC 1CO1A 4F37K 3LMJL 1EEUA 4P9HC 4TNGA 3T3MF 1FL3A 2P8PA 1CJYA 3RVTD 2AJZB 3CFCL 3TEZA 1C9SA 3SGJA 9PCYA 1RJLB 2V4LA 4AVKA 3ARDC 4L48A 1OGTB 3ZMNA 4QJ3B 2C8NA 4N28A 5KVEE 2D9CA 5DD5H 3OJVC 2W9DH 1CMOA 2OZ4L 3FSAA 3HFMH 3IXTB 3FB6B 3GJFH 4YZFF 3U7YH 2BCKB 3QNXA 3WTUA 2FO1A 3DARA 5BV7C 5AWNL 3FJTA 1TQWA 2E7MA 3BN3B 3AROA 4FE9A 4U1SA 5KYWB 4WKXA 1NUGA 3RX8A 2FJHA 4FI8A 3L3JA 2WXIA 3EO9L 3BX7C 5GGQH 1SEQH 1F18A 2A9AA 2DOCA 2V9QA 1ZSDB 3Q5YA 2CO2A 2F53B 4HJUA 4Z9KB 4X9IA 3QULA 3L4XA 2NW3B 5DJ8B 4NUJA 1DN0A 1FYTE 3FFCA 5IQ9B 3UBHA 1A3LL 4FQIL 4WI4A 2RB8A 1FLRL 1CL7I 5D4IA 3RURA 4QHMA 3V95A 5C0CD 1EEZB 4Y4KA 1ADQA 2XFGB 3ARDB 2X9ZA 1EZVX 1HILA 1TJHH 2XN0A 3RX5A 4K3JH 2XZCL 5ICYA 4ACTA 1S9YB 4IBUA 2HFGL 4QXWA 5GHWL 2DQIL 3PP4L 2CIKA 4N20A 4P5TD 3MGTA 2O30A 2ESVB 2DDQL 1H3TA 4KAQL 4Q9BA 4WHTA 2MCAA 4YDJA 1QWHA 2ZPKH 2NOYA 4G8GA 4KJYB 3WXVL 1YMME 5I6KA 3I84A 1R3LB 2AEWA 1G0XA 1BVKA 3GSXB 5KSAC 4P2CG 4HAFA 2PCPB 3QFDB 5J13C 4OLUL 2H6PA 4WFGE 3KR3L 4U2YA 4FQ1H 5JIDA 3OLIA 3WY3A 4GG6B 1I1FB 4EI6A 2YPVH 2IWEA 2YEVB 5TPWL 4Z5RA 4N8CL 3UROR 2JJSA 5FO2A 5KS9A 1L0YA 1TZHA 5TDNB 3QISA 4X7TA 5JDJA 3QEQA 3V0IA 2FB4H 2VITA 3FF7A 4TXVB 4HD5A 3QNFA 4AQAB 5IESL 1BAWA 3KPSB 2DI7A 4O2EA 3CUPA 1N67A 1P1ZA 1MJJA 4ODTH 4Y16D 5AOJA 4PTUB 4G6FD 5GGRB 2YD6A 3GIZH 3KWWB 1N18A 1WBXA 4NI6A 1A1NA 4YFEA 4G80A 2SODB 3HNVH 2ZCKL 2K0RA 2ATKB 1W0WB 2VM9A 1RZPA 1QFPA 3MR9A 4F2EA 1XGYL 3DBSA 5HI3C 5JPMA 4KTEL 3OLEA 1JPEA 5FCUL 4E36A 1EFXB 3QB7C 1V5JA 1J12A 5D1XA 1MCCA 3S34H 1MPAH 4F33B 3QORC 4PJDB 3CSPA 4B9JA 4MJ6A 1WA2X 4MWFB 3IJYB 5AAMC 3PNRB 4DKEH 5DJ2B 1BF8A 3KDMA 3BH8A 4ENEC 4H25B 1NKGA 1VZHA 2BC4A 4OBSA 5C71A 2WCSA 3M45A 4M3HA 2F74A 1HINL 2FLMA 2HRLA 2QQKH 3OR6A 3O3EA 3Q8CA 4ZSOB 4U7SA 4AVJA 1KB5B 3SPVA 4BKTC 1IIKA 5F96L 1JMXA 2O4EA 1CI5A 4UDTB 2Z31C 5C9JA 4D8OA 2RA1A 2X10A 3HOGA 4HZ1A 5KW9L 2BIIA 3IEAA 4Y5VB 4QXTA 1T83C 2WBWB 1XF1A 5HJGA 1PNCA 3OHXC 2OTWA 4GS7C 4F58H 2VDLB 3HN8A 4RFOL 3K1KC 2N7SA 2P45B 3UTSA 2NX5A 2X4QA 4BK5C 4A7QA 3Q05A 2WLNA 1QQDB 2HFEA 3QJUB 3SGKC 1HHIB 4NO0D 3ZRCC 1LP9F 2JLLA 4GSQA 4WFFD 1AKJD 1SVCP 4PJEE 2COQA 1DQLL 3UO1L 5CR8A 1VZGA 4JFFA 4HGKC 4KUCD 2NSMA 2ATPB 1XGPA 2R56H 4KV5E 3UG5A 4KXAA 3AT9A 3QQDB 4HZLB 4I7ZC 4ZDHB 4X4ME 5AVRB 1FG2B 3PF2A 4OZGE 2IDSA 5ESVB 3FB5A 1TETH 3PE9A 5IQMA 4KMQA 3NFNB 3VWKB 3NIFB 3RWJA 1S5IH 3FQ4A 4IIQC 2IANE 4KRPD 1OTUD 1UJTA 5C09E 1OZTG 2Q6WB 2O72A 4QY8B 4IOFD 3KJ6L 5T5FL 3BD5A 2GTZB 2FEDC 5DHMC 3F04A 4YBQD 3C2AH 2D03H 2OBGA 3AG3B 1DBJH 3QG6A 4ES9A 2M1KA 3AY4C 1JXDA 1YUHA 1CBVH 1J5OL 1OO2A 4X0NA 5TQ2L 2J43A 5T8IA 2GK2A 3DHMA 5CEZH 4MFHA 3KPNA 1RCYA 3HZMA 2CHWA 1HC1A 3CZFB 1M6OA 2RACA 3N91A 5E23A 3CVHA 5TPWH 4FFYA 4BE6A 3O6LL 1DJWA 4HT1H 4YN3A 1BVOA 5F3HB 5BMFL 1DVFC 5DVMA 3KGTA 1XIWD 1DJIA 2VB5A 4A68A 4GNKB 5IG7B 1B2WH 3IWUA 4YHOH 2ITDB 3GNMH 4JW3A 3SZKC 4XMUA 1TKWB 4B3VA 3CU1A 3GXUB 4UQ2B 5AW3B 3S88L 4G6FB 5HDWA 3BP7A 2EE6A 4P2QB 4ONFL 2QFRA 1XXFC 2FWSA 5D2NC 5KBPA 5GZNA 3JTTB 3EDDA 3MJWA 3KGSA 1AY1L 1EZVY 3MJ8A 3QIWD 4HC1L 5ICXA 5I24A 1YLBB 5I1GH 3EJZD 3WEAA 2NUPA 2XN1A 3B56A 4JRXB 1RZKC 4U1IA 3BUDA 3C5ZB 4HJIA 3A67L 1FNGA 3H7BA 1D9KA 2A83B 3B2UC 3IDMA 4GXFA 3W2DH 2DM2A 4PJDA 2OTUA 1MFNA 5KBNC 3P4NB 4Y9BA 3FCBA 4CVXA 3IJSB 5AFAA 4PJCA 4AQZA 3PQYB 2X6CA 4RFOH 2DWEB 1GYAA 2DLGA 4JX0A 2F74B 3MRBB 1CTNA 3CX2A 3OR6B 4ZSOA 5K1JA 5C0FB 4M02A 3EH5B 1TYJA 5IFAH 1PFCA 1I7RB 3KYAA 3QQNA 4YR6A 3TBBA 5HI5D 5KVDL 4N0CC 1XVSA 2C9RA 1FRGL 1RD6A 2DI9A 5IQ7L 2AXFA 3TJPA 4C56B 2DTSA 5GS0C 1E5AA 2A6IB 1IAKA 5GGVH 5EN3A 3O4LD 3L2MA 4LQFL 4PR5B 1DQDH 4Z7OB 1E5BA 2VUKA 3DTXB 5F70A 3OG4B 3P9WB 3SQBA 3MA9L 3TBTB 5B1AB 4DGVL 4E5XG 2BVOB 2ICEA 3CSGA 2MOGA 2XWEA 3R0NA 5C2UB 1I1FA 4EI6B 1SHSA 2H7WA 3EADA 4WFED 2V5RA 5J6HA 5BCAA 1WDAA 3M1CA 3DDFA 1DL7H 2BFVL 3AM8C 1R75A 4RRPA 4E41E 4Q89A 4KUZH 4LU5L 1UCBH 4U1LB 4XN1A 5ANMA 1QUPA 4RA0C 1QBML 2EABA 2RAMA 1TKWA 2ICCA 4O5LL 2J1XA 4TTDC 3UX9B 4H0LC 3UC0H 3SDAC 3V0EA 4OGAD 5ESVA 3ZQWA 4X6DB 1E42A 3OMAB 5IHUL 2XG4B 4XB7A 4XTRC 2IQ9H 5HVHB 3EHBC 1J86A 4L3EE 4HIQA 4NZRH 4AMKH 3Q06A 4D0CA 1RMFL 4RNRA 3UMTA 2AVFA 4QHNA 1NINA 2XWJB 2HTKD 3MOBL 3RTQD 4LLVB 2GAZA 1FFOA 2IOMA 3MLTB 2NUTA 2K70A 3CX5J 3R06B 3F84A 3RWCA 4OCYL 4G7VL 3VD5A 4I88A 4ZPTA 2NZIA 1N19A 2WZAA 5C0ND 3NPSC 3D50A 4TQEH 4OLXL 5LB1A 3JWOC 3DX6A 5F0MB 4EQ2A 3AU0A 4IMKC 2IG2L 4GXVL 1CFTA 4L9DA 2D3VA 3PHOA 2WSPA 4J2XA 3M7OA 4BM7A 1G7IA 5IVNA 5D96B 1CDGA 5I75C 3JSSA 4ZUUB 5E5RB 5KVFL 1JDCA 4HUXB 2B16A 4OSUL 5ISZD 5E1HB 1BA9A 5DHVB 3KPNB 3FU3A 5B1JA 2BIPA 4JKMA 3T9WA 3HG2A 3VFGL 3WFEL 2X38A 2HLEB 3B7SA 4PVLA 2XV6B 2EEAA 1S7TB 2FQGA 3QUML 2IEPA 2GT9A 3BH4A 3KPRA 4YNYB 4DGUA 1DBML 1OP9A 1T5XB 2EE0A 5KOMC 4MZIA 4KY1H 5J12C 1R33A 5DRXB 1NSNL 3ZKSD 5GRWA 1SOXA 5GJTL 3QJOA 4DGYL 3LKQA 1JVKA 1BP3B 1EAPA 1AHWB 1TPXC 4M8QB 2BRRL 3BSZH 4UMGA 3VXME 4XOCA 3GXMA 3DO4A 3LX9A 3RE0A 1GYVA 2ZYRA 3S35H 2WAHA 2AQSA 3BO8A 1JWSB 2QDWA 3CDGB 3BKYL 3TEXA 3FTWA 2AJVH 3TO4C 3T0BA 4MHHI 1SXSA 4AH2B 5MEQB 1NKRA 3WO4C 1P6FA 4IBWA 6FABL 1XCTA 1XCWA 2AAAA 3BWAB 3TFBA 3SY0A 5FR3A 5DR5H 3F65A 1CT8B 1K4DB 2R2HB 2A4CA 2GJ6D 5IBTL 4DVRH 1HIML 5E8EB 4GKZA 4AENB 3QCTL 5EPMA 1I3VA 3ZDYE 3ZQXA 4G1MA 2ILLA 5KAQG 1G7MA 4LEOB 4MXWH 4QYOA 4P2OB 4XB3A 2IWGA 1VAHA 4K3EH 5DD0L 1M53A 2MWCA 5JYMA 1KSRA 4QOKA 1YNTB 4E41D 1OAUL 1R5WA 3K5SA 4MAUH 4DJMA 5GGSY 1TQCC 3O6FC 2B4CH 1JXKA 1ZIAA 3L3OA 4HFWA 4QHMB 5E4EB 4L8DB 5I1LB 1CFQA 1ZLUH 2CGRH 5K9OA 2EIZB 4GAFB 4MS6A 3RBSA 3EYUL 2YPLB 5HI4C 3EOAA 4PJXE 1BBDH 1MWAA 4ZFOB 4KKBD 5MENB 4IKJA 1W72A 5H2BB 5BS0E 1F1GA 5IVXF 5B7FA 5DRZA 4ZS6D 3FN0H 2CAKA 2VC2H 3DSNB 1AQDB 4KKQA 5IJKA 4G6JL 2DF3A 3BXNA 4J4PA 1KTDB 1KG0B 1ERNA 3GBNL 4WI0B 4ZRGA 4BKSC 1BAGA 4G83A 4DIXA 2WP3O 2X89A 3D25B 4X99B 1FSKC 3L5HA 4A6YH 4R96B 3IJ7A 1ZLSL 1N6QL 3IE9A 4RAHA 3T77B 2HMIC 1U2HA 4DW2H 1UGKA 5DQDL 5C0CA 5SWZD 3T0EE 1D5MA 3VSTA 3T0EA 3IDGA 1MFCH 5E2JA 1ADWA 4R84A 4H88L 3BUTA 4LVOC 4P0DA 5DJDA 4F91B 1A66A 2YK1H 3QXUA 1J87A 3BZ4B 4P3DB 5EU6E 5I9QB 1FFTB 5FOBA 4NCC1 1SFHA 2IOIA 2OSXA 5A1AA 1HOCB 1JZHA 4APQC 2QQQA 1FNAA 2B1AH 3CCHA 2O61A 2R9HD 3W57A 1HE7A 1U0QA 4DTGL 5DHYB 3NOIA 4LEOA 1XX9C 3FT2A 5CKAA 1IEBA 2W9EL 3FTSA 1IILE 3KCWA 3J7HA 2WO4A 2A6JB 5D72L 3VRLF 2QVIA 2XQYA 5DMIL 4KI5F 4DNLA 3HG1B 3GMNA 4OIBA 2CNZA 2ZKHH 2J25A 2GC7C 3ZTNH 1R9FA 3D8MA 3GJFB 1W6WA 3NEOA 3L1OH 4G8GE 5TGBB 1VFUA 4GSDH 1WCBA 1I7UA 5I71B 5KG9A 2WQUA 3ZR6A 3V5DB 1I3GH 4DGVH 4XO4A 2WO2B 3QJRB 4P5MB 3FCSA 2D3NA 1DFBL 1FIGH 1SJEB 1U3HA 1P4UA 2XY1A 1OTTD 4WLCA 1JZIA 1IQWH 1M71A 4I18A 4LIQL 3VXPA 5ETUB 2BSEA 1UT1A 2AJVL 3L9RB 3N1FC 2JXMA 4JE4B 2CDFB 1YN6B 2OR7A 1INQA 4HJGA 4LCYA 5CEYA 1HZKA 2K78A 3FC8A 4KAQH 2VRKA 1TTCA 4ZNCD 1I9JL 4PW3A 3WFCL 2AJ3A 2XA3A 3C8KA 1AVAA 1AC6A 3OMNB 4DZBA 4QKTA 4XT1C 1OCOB 1UT2A 3SDCC 2IV8A 2X2HA 4EJ1C 4Y9GA 5AZEH 4DK6A 2IALB 3O3BB 5CEXB 2BVQB 3QEGL 1R3KA 1W2KT 5INDA 4AEHH 5IB2A 3QEHA 1FQ9C 5I1KL 1L3NA 2DYPA 1BZ9B 3F7KA 3K2UL 4BFJA 4JRYE 4AL8L 3BGMA 2FB4L 1HSBB 3QIWC 2R69H 4EEEA 2FEEI 1C7SA 3SDXA 4PSRA 2UVFA 4ZO9A 4UI2A 4PJFE 2UYLA 5GISL 5C7XL 5CP7A 1BM3H 5I8CA 1I7TB 1JK8A 2DQFB 4JDZA 3QPXL 2FT6A 3BAEL 3FQXB 4PS8A 1GSKA 2ZYSA 3IDJB 4JFYA 3GGWA 5EO0A 3I9IA 3TCLA 3W56A 4D9RE 3JBG7 3PDGA 5IJKC 1ODUA 3PLYA 1UZ8B 3JTSB 4JHVA 4MMYB 2CBTA 5AW7B 2YFNA 1AZUA 3FN9A 4CADB 3MV7B 1BAFH 8CGTA 5H4YA 1DBJL 3J2PA 4DP7X 2DQEL 4BFOA 5HHOB 1ROCA 3EYOB 3JWDC 4K23H 4F8NA 3ARGB 4WFHE 3QORB 3P3RA 5ENWA 3SDDD 2Z8RA 1TG8A 2P52A 3V0VB 1LEGB 3L54A 3G6DL 3TA3C 4OLVH 1BG9A 3DKHA 4YLCA 4I77H 4OV6F 2EIKB 5CZXD 3QI9A 2YGQA 2JI1A 5DLML 2WQSA 1DBKL 2WCPA 3WAKA 2ZOLA 1PNDA 2TRHA 4XMXA 3T6XA 4PJFF 1BXUA 3QUMA 2VXVL 4M56A 4YQXH 3SDAB 1U8QA 2XC8A 4JQVC 2BVEA 5EC2B 1U8MA 1SJMA 2VYRE 5BO1H 4Q2ZB 1CF1A 4U7KA 3ZKQD 3TYFA 3CH1B 5F71A 1QEXA 4IRJA 4AYID 3ULVL 5D1QD 4LSRH 4DETA 1JTOA 1XF4B 3JTBA 4HJTA 4G1EA 4WFGD 4Z7WB 4N6RB 5C0RL 2XFXB 5D2NA 3N1PC 2ZPKL 1EHKB 4QJ5B 4JFFB 3QJFA 4CC1A 3RY5A 3EYFA 3ML9A 1NBVL 1WZ1H 1NIEA 2HVKB 1G5AA 4M1DL 4MGXA 2Z7UA 4P4KD 4QY8A 5B8CC 1OM3H 3C12A 1BPLB 1U8OB 4MMZB 5D7SH 3VI4A 4AYDC 1OEZW 1Z9LA 5EEWA 4WHCA 3ARED 4PBWD 4XC3L 3FQYA 1TETL 4JO1H 4A7VA 3WL9A 1VACB 2AHIA 4BWUA 3VTTA 4EDXB 4F80A 3EH4B 3AB0B 1IARB 4P59H 3KCPA 5JPMC 5KSAB 2ROYA 1MCLA 3ATAA 1LO5A 1UD3A 2V0AA 5DVNA 3MHZA 4LCIH 1H8OA 3AB0C 3HHSA 3D85A 1A7PH 1HEZB 3L13A 3O3AB 5D7EA 3ZRSA 5LVEA 5IQLA 2ZCHH 3P30L 1I1YB 1F86A 4FOMA 1AP2A 2FX9L 3QUMH 4F27A 2E9WA 1G43A 1NICA 1U41A 3SE4A 2YGPA 4ZXBB 2C5DC 1MJ7L 1GJWA 2JKNA 4BZ2H 3DROB 2WLZA 1TJIL 4PGZA 4N4YB 4WSGA 2H6UA 3RUGB 1E7UA 1KYDA 4RMUA 1T1YB 3BUBA 2H3KA 3FOLA 4XPBH 1CK0L 4NDMB 5GZND 4YHLH 1AFVL 5C9JB 2WXLA 2Z93A 4LPCA 3PWJA 2YKLH 3QUMB 4A6YL 1OM3L 2XWTB 3UYPB 3AU1B 2AXWA 5MP6L 3D12B 5JW5A 3OQRA 1B4TA 5TE7L 2GFBB 3CDZA 1R4XA 4YHKL 4KK9D 4NWUH 5IEHA 1EHXA 3UAEA 4HUMB 4G1EB 1VADA 4Z7WE 4HK3J 2VDKB 4NQSB 1UOKA 1Z7JA 4MB3A 4U6XA 4ZMLA 4JY6B 2D31A 3GWJA 3BQUD 1N3NB 4U49A 5J11B 2O5ZH 2MTAA 3DYPA 3QUZA 4FXGA 4KHTL 4Y4HB 3SKNA 2NY1D 2Z91A 4UUJA 4U6YB 4ETYA 4M8VA 1DN2A 3N44F 4JM2F 5JLZB 1U42A 2ODIA 3BKCH 4R97C 1SXNA 2V5SA 4HBCL 2QVTA 5ICZB 3RIKA 3K71B 4BD4A 1ZV5A 3X13B 1NMCC 3T2OA 2TSBA 5L4FA 2RGSA 5EU4B 5JIKA 3IJSA 1JGEB 3WY4A 4F7KA 5L2KE 2FSEA 1BOYA 3HG1A 3ETSA 4GAYA 1Z9SB 2DQUH 3QUYC 4HXAH 1X7SA 2OJZH 5GGVY 1D5XB 4UV4L 3DX4A 2VLKA 25C8H 2Q7YB 3EKCA 3ARGD 1QFWI 4OIIL 4EN3A 2R29H 2WLJA 3NJNA 2NNAA 2Y1AA 3MV01 3BVNA 1G5GA 5DFAA 4DKAA 4GW5A 2XVLA 1NGXA 3HZVB 2BNQD 4AW4A 2PUQT 3B9EA 4LB8A 4NUGL 3M1BA 1EIBA 3O4OB 1PY4A 2F54A 2Z64C 5FW6A 4XMKH 4AZUA 1KIQA 4GP5B 1X5AA 4PS7A 4RBPK 3HI6L 1JPFB 3SPGA 1N9PA 3ARXA 3KYNB 1EJ6A 3MACL 5HVGB 1O9ZA 4U1LA 2RIKA 3LQZB 5EC1A 3UJJL 4YMPA 1A6UH 3CC1A 4UT9H 1FL6B 5T3XE 4QRSB 4X7SL 4LT7A 4PAZA 4OVUA 4F8OA 1EHNA 5H35B 4NXKA 4GKNA 1GTFA 4DO6A 1B0GA 4MSWA 1S9KC 2Y6SD 2YPKA 3QC6X 4Y4HA 2VRQA 3MBXL 2EDFA 1RJYB 4UIMA 3V4VA 3FB5B 2X09A 3A6CH 1P4BH 3OXSA 4X80L 3FFCB 1X4YA 2VXSH 1L9RA 3FUJA 4FLOA 3QS3A 1XGRB 5D70H 4EF3A 4TNEA 5IM7A 1SN2A 1YEGL 4U1KB 3EGXA 5D7JA 1G0DA 1YN7B 1EBAA 2C26A 4M43L 5C0BB 3FKUS 4AENA 1BBJB 1KB3A 3KLLA 3CK0H 3N40P 5DJ6A 5K1NA 3IDIB 3KPRD 4YEEA 1S9VB 3QDME 4AYGA 3ULUF 4NUGH 1FVCA 4NAJA 3LY6A 3UH8A 5TGBA 3RFZC 4TVUA 5HYJE 1XV8A 2OMYA 1MLCB 5B7EA 1IGYA 2XWZA 2B59B 4Y2LA 2WNGA 2R1YB 4DEWA 1CE6A 3R4RA 3HCVB 2H1PL 4DGIH 5AVYB 4HK0A 5DD5L 4FFZA 5LAXB 1JRHH 5D1XE 3TPUB 1IGTA 4RZCB 3KYOB 1DJYA 1J5DA 5FUZL 3VE0A 3MLSL 3V6OE 2HXAA 2AEOA 4OKVA 4KH9A 5AENA 3WN6A 4OT1L 2CDEB 2BY2A 2PMZA 4AH2A 5MEQA 2D2CC 2X4PB 2FHCA 5BS0D 5KUMA 1GS7A 2V7HB 3GSQB 5CM1A 5GXBB 3QNYB 4MAYA 2ITDA 1CDBA 5IIEA 1KC5L 2J88H 3BO8B 4NFCA 1FL6A 4WJG3 2I9TA 5G55A 2UY6B 2VR8A 3CMOH 5DZVA 3VW3H 2P7TB 4FNTA 2HT3C 1OW0C 2XNAB 4GQPH 5E95B 1T3FB 4AYMC 3OMIB 2EZ0D 5JO5B 3UBXB 3KG5A 3V0HA 3ULVF 1FCGA 4NAMA 4IJTA 3NSYA 2AEPL 2R4SH 4OTXH 5EO1A 1PW3A 2WK2A 1BVLA 1T89A 5HHMB 1G0YR 1P4IH 5CJOL 3BZFB 3IYLW 3O11B 4MZRA 2AC0A 5K9JH 1GC1H 4AM0B 3IS1X 3NCJH 3MCG1 1A14L 1LLAA 3OKLB 4GUOA 1W8OA 1XZWA 4LSPH 1NM4A 5GIRB 2XTLA 1W15A 2QGBA 2JJWA 3PWNB 3ISWA 1RZQA 1QFUL 1AGCA 4KVNL 4BYHA 5EZLB 3RPIB 5LNEA 2CR6A 3TBSA 5KJ4A 4L8DA 3UJJH 3ZE1E 5B1BB 1OWRM 2Y7MA 4E9YA 4UWQB 4J3OG 4QR7A 1FL3B 2P8PB 1NCGA 4JO4H 4XP6H 4PJ9B 2E27H 2EDOA 3O6FD 3FO9A 3VXMD 3LKPA 3AUVA 1H6EA 5EUOA 4K3EL 1AS8A 2EXSA 3MRIB 4KBPA 4XVJH 2YUZA 1SYVA 2P80D 2WNWA 4YHLL 4HV8B 3SSGA 1GSMA 4JZOB 3RKPA 3ZE0F 5FEBA 3DO3A 4WZ9A 3NZUA 1TZHB 5E2WL 4HC1H 1BVNP 2PETA 4A2DA 3VYNA 3H4HA 4Z7VF 3KNBA 2LGNA 2AI0H 3DGGB 5F7UA 2V2TA 5F0PB 2FYVA 3IDNB 3LH9A 2A73B 2LHAA 5EBMA 3LIUA 1JUFA 4RGOH 4BQ9A 4RISL 2Z9TA 1HEJC 3HS0B 3KYMA 3EOYG 4OUOA 3VXOA 3Q5TA 4QWWD 1NFIA 4LSSL 3GHEL 2B2XH 4QHKI 2DWEA 4Z7UF 4K8RD 4ONHA 3DV4A 3KBHE 1N59A 4W4OA 5BOZG 2OJ1A 3QZWA 5IV2B 2XKNB 1GZQB 4JQXC 3OPUA 4UT6H 5ALCH 3MGOB 4BK8A 2ZXBA 3L3KA 4UV7L 4BWWA 4C4KO 3IMBA 3BZFA 4IBYA 5DCCA 4C56A 1Q9WB 1FYHB 1HI6A 2PW1A 2BMKB 4BSWB 3CJJA 3ZSSA 3LOWA 1OVZA 3BH8B 2EE3A 5HGBB 2CM5A 5MEOA 3EAKA 4YZFE 2EIMB 5LO7A 3BPCA 2H2PC 5I1KH 5F1NA 1Q1PA 2R7EA 4JKPL 5FA4A 5JIPA 2IADA 5BJTA 2ALAA 2P5PA 3APCA 4P5MA 1UKTA 2CDGA 2Y24A 4FI6A 4J3OF 2F5BH 3U9PL 2K8MA 5IF0B 2C4FT 5BV7B 1C5BH 3HLKA 2CWRA 3V7MA 1CFQB 1F00I 1BM3L 3W9DB 4AVHA 4Q9QH 1A5FL 1UOLA 3MRIA 3HC2A 4G8EA 3M07A 4WTZA 1GZPA 4E68A 3ZL4L 1RZ8B 5E9NA 5LQBH 3S5LG 4PP2A 2RBLA 4N3TA 3QFGA 1XL4A 1LMKA 3H9YA 1RMFH 35C8L 1E9OB 15C8L 3QDJA 3LPPA 4YWGL 3WNPA 4KUCF 5TDNA 4WEEA 2VLRD 2PWHA 4MNQA 1E65A 2RALA 3JZYA 5BV7H 1FG9C 3N41B 2WOBA 4FAAB 3HHRB 4MXVE 1XL6A 4WW2A 1CD8A 1C5CL 1H3GA 3I3BA 4X5PA 5EU5B 5KJ7E 1QWUA 4X6CF 3QZOA 3SDAD 2FJGB 1AO7A 3PYCA 3LXAA 2CRMA 1WYJA 4MXQD 3AXLA 1EJFA 1X5HA 3O2VL 3T0DA 1E3ZA 4HYTB 1HXYA 2EDJA 3CX5K 4LHUG 5FGCB 4CN1A 5D9SA 3D6GA 4FKHA 3FSVA 3WTTA 4NNXB 2AKRA 4P5TC 1XZ0B 4JPWL 3N43F 1CIDA 1J9RA 2UWEF 4X7DC 2K9UA 1F5WA 4YSOA 3ZGHA 1ZGLP 4CVXB 4PY8J 5DO2C 3GSVA 4N2AA 4JVPA 2E6QA 4W9CC 5AYTA 1FORH 5MI0B 4L4VA 4L1HA 1RFDL 5IUCA 1T5XA 2J5LC 5C0AA 2A6DB 2DLFH 1FZOB 4YSDA 1OD7A 3S35X 3SQOH 1KXTA 4K7PH 1I1AA 4HW6A 2XHNA 1DDTA 2GIXA 1MF2H 2R0KH 2DQFA 4RGNB 1UADC 2RCSL 2ZXCA 1OGAD 5E5LA 1E3FA 3NZHH 2OX5B 1G4MA 1OAZL 1ZANH 5D2NE 4KNQA 1OF2A 1AR1B 2X70A 3CHQA 4YHZL 1QYGL 4YBLC 5KSBB 2Y5TB 1B0IA 4JFQB 2DM3A 3FMGH 4WW1B 3HEIB 4HS3B 1IEHA 2ICES 3SY0B 4TPRL 4DCQA 5LDSA 5E1AB 3ZDXE 2CIIA 3LCYA 2DQGL 2EKSB 2QSCH 2XZAH 5DD3H 4AXWA 5L88L 3WFBH 4ANVA 4HEPG 4I4WA 1D2OA 2F7IA 3N1GC 2HJFB 4OCWL 2J71A 5I1EL 2UXVA 1CWVA 2KERA 2XPZA 3MRQA 5BO1L 4J6IA 4NXSA 3ZTJG 4PWIA 5M7QA 5I0DA 2YD4A 1FHNA 1RUML 2NY1B 3DJSA 4JMNA 5EULV 3SYQA 4FXGB 5B3SB 4HU2A 2NX5D 4NM8L 1U8NB 2CM6A 5DYOA 1T5WB 5D7IE 2BK8A 3EYUH 5JXAL 1G7JB 4C56E 3GRWL 3REWB 4NS0A 3GUTB 2G0LA 3MBXH 4XN2A 3NP3A 4M93B 4L0PB 4KK8D 4JGMA 3GMQB 1UOWA 3K72B 2N0MA 1ACZA 4OM0H 3VO0A 2HRPL 2QADD 4JRXE 4RGMC 2BC4B 2VC2L 4JAMB 1QRKA 5MHSE 1YQ2A 2PTUA 3GMOB 1LGVA 3NACL 4XX5A 1G7IB 2HX9A 3RU8L 3WFCH 1NKOA 4YSTA 1TYEB 2XZAL 2DMHA 4PJEF 1JTTA 4RMRA 4WFFE 3RWDB 1RP8A 4ODUB 2W0KA 3EDFA 3PY9A 1U30A 1LE5A 4S1QL 2AGJH 4KITB 1SLVA 5E8DL 1L9MA 2J6EA 3MRPB 4E5XB 1TVHB 2X7LA 4AG4H 1AZVA 1Q9OA 3L3IA 5JW5B 3EJCA 4W9FC 2VISA 4PLKC 2EILB 4EN3B 4XNUL 4MTMA 3SDXE 5GRUL 4IRSC 2AI0L 4G7SB 4NDMA 4G3YL 1R47A 2QDVA 2H5UA 4FGMA 3V0JA 4CVZA 3VRIA 1E4XI 2NNRA 2YXWA 3SYAA 1N26A 3QQDA 2E74C 3WG7B 3S96B 4DO4A 3O2DH 3QHFL 2GUOA 4HISA 3FQ1A 4LCWB 4PWKA 3CFIC 1K72A 4PHXA 4Y19E 4OFVA 1FO0H 5DK0A 3STLA 1NFDB 1XIWA 2CBOA 3GDCA 2CCVA 4GIAA 3C9NA 4QXGH 5CSBA 1RIHH 3RVVC 4LIQH 3NACH 1E4KC 2YZ8A 3FZUC 3P73A 4UQAA 3HFML 1BEYH 5FUCE 1QTSA 3C5JB 4Y2DD 2WJ5A 3SHSA 4UUJB 3QO1B 2WYTA 1F3DJ 1GGBH 1TZIB 1XB3A 3WIIL 4KJPC 1FSKB 2BHZA 2O26U 3FFDB 3FOMB 4FL4B 1TNMA 1ZWIB 1A3ZA 2A9MH 1ET8A 1KGCD 4U1MA 1B0WA 2PYEB 5J5EA 4OIAA 4OY9A 2WUCL 1MCEA 4LPTA 3CN0A 2CIKB 5DJCA 5E2UH 1X5XA 3UAAA 4BELD 1P7KB 2DL9A 4ZMXA 5E94A 4PJ6A 5I8EA 2WXQA 4EIZC 2CG9X 3BPCB 4EXKA 1D6EA 3V4VH 2OX5A 2BDNL 2W9DL 3IJEA 4YJZL 1A6TA 1QRND 2RR3A 3IBEA 3KM1A 5DHEA 2VDMB 3UTQB 1RSFA 4PVNA 2J8UB 1KUMA 3PWJB 3UMNA 4C4BA 3T1FA 5L8LB 1C5BL 3ZHKA 1INQB 3KPMA 1SN5A 5J1SC 4JFED 3MOAL 2J56A 2BVYA 4LCUA 3TVMC 1I9JH 4FQLL 5G4OA 4U1NB 1IBGL 1JP5A 3BLKA 2ZWNA 5LWYH 4JDVA 1KCKA 2YD8A 4PWEA 5EC2A 3WEMA 2EEFA 5CCGE 3WMPA 5HVWA 5F7LB 5FK9A 3BRDA 1ESOA 2X4TA 3BP6A 4QRSA 2FE0A 3ROLB 4FRWA 1Q72H 3HS0A 3KYMB 3OZKA 3OV6A 1RJZB 4PTUA 3K2UH 4GXUM 3FO2B 3MXWH 1DE4A 3W1ZA 2OCFD 4EPSA 3ZT5A 1JOIA 5EIQA 2AK4D 1JL8A 1U92A 2JIXA 4PM1A 4ZDHA 4OGXL 3UJTL 1S7UA 4S1SH 2VL5A 4CBPA 3F7QA 1XAKA 5CP7B 5LNGA 3FCGA 3UZQB 3VGAC 3W9EB 4NQXB 5DD0H 3V4UH 2OV0A 1LK2A 4MXWL 1CB4A 4ODVH 1HYSC 1GGYA 4N0CD 3L45A 1ZLUK 2ISDA 1VEPA 4CGUB 2F53D 2XU9A 1G9HA 4MRCA 3RWIA 2BNRA 1QLFB 2X3CA 3ARRA 5JNYB 1QW8A 5AALA 3FHQA 3NBNA 4IU2B 4B9KC 1ZT7B 3WUWB 4JM2D 3MLVH 2Q10A 4DN4L 3VXNA 1RIUL 2NYYD 4GB9A 1CQYA 5GSRA 1JE6A 1JGIA 1KYOK 3P2BA 1AXTL 4YIQB 3AQZA 2EUZA 3ZZQA 4UDTA 1QO3B 3QWOB 4HALA 2H8PA 3OKLA 2XQBH 2EDHA 3GSOA 5JPNA 2NXZC 3ARYA 1UG9A 4OW6A 3Q2VA 4B41A 1MCJA 1O7VA 3D18A 3FL7A 5D4JA 4Y4FD 1MN4A 4M5YL 3DJRA 2KYIA 4MAZA 1Z3GL 4KI5E 2PO6D 5K9KB 1FAIL 1DR9A 1JJUA 3MNZB 3FPYA 4DUWA 1P6WA 1Q9LB 4KKCC 2WLIB 3KNBB 5DVOA 5EWIH 1DQDL 4HG4J 1KYUA 1NCOA 3GO1L 2OL3A 1NCJA 4XWGL 3EBAA 3V4UL 4APQD 4LVHB 1Q0EA 3GSNB 1JPGB 1FNSH 1NH6A 2KL6A 2F7RA 4JG0H 4EBQL 5IIEB 4HETA 3U36B 3RIAK 4ZOCA 2H45A 4RMTA 3GB7B 3MV8E 2R29L 3HZYB 3EIFA 3SIKA 3O3DA 1NGPH 4YC2C 3NJXA 1GOGA 5DYOB 3BJ91 2MQCA 3CFTA 1Y6NR 2E6JA 2QV4A 4O2CB 1DQJB 1A2YA 2F1AA 5CD5C 4WWNA 1PCXA 5TE6H 5B38G 5FM4A 4YHKH 3U30B 5GIRA 3ULUC 4TNWF 4OI9A 1NL0L 3O6FA 3VXMA 2C4XA 2NNXA 2JB6A 4L4VD 2VW6A 1WBZA 2CA3A 2MIZA 4TVPL 1HSBA 1CK0H 4FNPA 1GS6X 3CMOL 1BW8A 1IAIM 1KN4L 2YEQA 1I7RA 4BSWA 4G9FE 4KJYA 5DK2A 3VX0A 2JB5L 2P5EB 3PFUA 1JCKA 4G42B 2X2UA 4NRZA 1BJ1H 4WU5A 1S5HA 2ADIA 1U3HD 3SGEI 2FZ3A 4YHIA 2VLLB 1BLNB 3CZJA 4HJEA 2DYRB 4K71B 1CD1B 1MH5B 3VH8G 5CHNB 5ELIA 3L1FA 1WTLA 5E5MA 4Z7VB 1KYAA 4UDUA 4UQ9A 2VMDA 2IH3A 1M7IB 1JGDB 43CAA 3BMWA 1ZHKA 3I2CL 3MJ7A 3ZE0B 4YC2B 3KBEA 3X1EA 2EINB 1T89C 1MJJB 1NSNH 1XB6A 3OAYH 1TFHA 2BP0A 3MJGX 3T4AA 4QPEA 3TYFB 1HYSD 1EUTA 3EZ8A 3TIEA 1ACYH 3UPRB 1CBVL 3O6MH 2BOBA 3T8XB 3H2WA 4G9FA 4QXGL 2MRYA 4NQED 4QRTA 1URLA 4R26H 3CPLB 4H2CA 2EICA 2AFNA 4Y5XB 5E51A 4OLEA 4BDVB 5JOFB 2NYYC 2C4FU 1VLXA 4FMVA 1IL1A 5A6IA 1YY8B 2DYPD 5I0XA 4HS6B 3MRNA 3CCHB 1NLDH 4G7QB 1EAJA 3IDYB 5J3HD 2H9GA 2H3NA 3FYIB 4HIXL 1BXAA 3IDXH 4HIIB 3MV11 5K93A 3VXRB 4QTIH 5F1SA 1OV8A 1GRWA 4W9EC 3FZUD 5C09B 4GP8B 2IPTH 4QTFA 4ZXBC 3S37H 4JZJA 4ODSH 1T20A 4L4TA 2QKSA 3OB0H 2AJSH 4GRLD 1CLOL 2NZ9D 2ZSVB 3E6HB 4UQEA 4M61A 4OZFB 2BHFA 5KZCB 2QFPA 4FNLH 4BQ6A 2EXWD 2M8XA 4Y19B 1PLCA 4BFIA 4HQQL 5FDYA 4B96A 1U8HA 1SRDA 2I07A 3FSOA 3HI6H 4OQTH 3TJHC 4N2GA 4XNBA 5I30L 5IB4B 1RJCA 3F62A 4JDTH 1WISA 1HT6A 3TEWA 4ZX3A 3BLPX 3CHSA 2KLSA 1XR9B 4JE0A 4M5SA 4MYWB 1KBKA 1M7DA 4O02H 4ODTL 3SCMA 1UJ3C 4CKVX 2R2CA 2HT3D 3GIZL 4NQEB 3U7WL 1K2DA 1VB9A 1FO0A 5GS1C 3N04A 3QJHA 1AHWA 4OZFH 2OW6A 2VDQB 4OZIE 1HKFA 1JHLH 4NN6B 5IROC 5LBSL 4ELDA 1CC3A 4KMTL 4Z3TA 2G4GA 4N8CH 5PAZA 3ILDA 4PSPA 2ZUUA 1RUAL 4XCFH 1D6VL 3JUYA 4U1IB 1IM3A 5IEHB 3IU3B 2YAEA 3GIVA 4QXVA 3TN0A 2PPDA 2VH5H 2XZZA 5F89B 5E00A 4Z7NE 2Y23A 2XWJA 3ZT6A 3EXJA 3MLUH 4L8CB 3ZE0E 2KBGA 1T3FA 2G2NA 4N0UA 8PAZA 1NCWH 2UY7A 4LRIA 1Q0YL 2QPEB 1PX4A 2GJRA 3D3VA 1AXSB 2HKHL 4PV1C 1USQA 2DH3A 4GI9A 3T04D 1QG3A 5DRWB 1OAQL 4JFDA 3W39B 4YXHH 5I5RA 3MOQA 5HGAA 3SKOB 5JNYA 4M1CD 1OAXL 5DVPA 5F7AA 2X44D 3LRLA 1YNTA 3PP4H 5EF2A 4GKSB 2WVVA 3FQNA 5I1IL 3D1MC 1YEIL 3WNMA 4UOZA 5IVOA 4Z7UE 1A1OB 5CLYA 3P3TA 3UJIH 4HIHB 2DLFL 5I0YA 1PD0A 4OF7A 4HKZA 4HPYL 3AADB 3ZK0A 1A9VA 1WK0A 3UAFA 1DQTA 3CFUA 4U33A 4UNIA 4P5KA 3QUYA 3H0TA 4PGDA 4YHPB 5CFHA 1R3HB 2GJ6E 5HDQL 4J3OD 2B1HL 2DJUA 1OZUA 1DUZA 3HC4L 2BS71 3QI9B 4QRUA 1QX1A 5TFSL 1S7XA 4RAVB 1O7DC 3ZLQC 3QDAA 3VVWA 1D5IH 2R0LH 3D2UB 4N90E 4TM9A 8FABB 5AWNH 3KYNA 3LN4A 1A4KB 4YSQA 1UM5H 4P4RB 4U6XB 5LBGA 3GTNA 2BW5A 1U8NA 1UA3A 2H0EA 3UPAA 1WSST 4MA3A 7TAAA 3QEUB 5ESQA 1UKSA 2YLKA 5HDBF 1XD1A 3KXFB 4M9OA 4DUXA 3L4VA 1MCFA 2F58L 1DVXA 3DTUB 1YEHH 3I50L 2O6CA 5DQ9A 1EHLH 1C12B 2E6PA 1OCCB 3ZZLA 3CZUB 3PJSB 1NFDA 1BF2A 3OKNA 5TH2B 1RZKH 4HP5A 3WNLA 3H9HA 2Q7NA 4ANKA 3MNWB 3LZRA 3QDGB 2Y5QA 1H6TA 2FUTA 2G30A 2FSDA 4M6NL 4P5TA 4XPTL 5FYJD 5GGUA 3UOAB 4BSVA 3VH8B 3UTSE 3SDXF 4I0CC 2W95A 1UASA 5I1LA 2MCMA 5G5DA 1BD2E 1GKOA 5F8QC 3ZE2B 3IS0X 2F1BA 4P4KA 1KZQA 3GGWB 1VF5C 1I8IB 3EFDH 1HWWA 3PXJA 4OJDH 4A6YA 5IW1A 2VR7A 2OW7A 5C07E 5TDPA 4UILH 3TBYB 1S6NA 3P40A 3IETA 2K6WA 2HWZL 3D2UD 4LFHD 1WG3A 4GI8A 4HJJL 4N25A 4FL4C 1WD9A 4W93A 5J0BA 1PGRB 4TNVK 4N8VA 2BOCB 2WIIA 1R24A 4BK5A 4PGBA 2IH1B 4R90L 1PD1A 2EEBA 2GJ6B 4XOEA 2ID5A 1JZDC 3K2IA 2O6DA 5EOQH 4RSYA 3QAZC 2DQEH 2OMTA 4LASH 4NZTL 2SEBA 3SGKA 3V6ZB 4JFZH 3B9KC 3PWLB 5FFOA 4EUPB 1P2CB 5B7MA 3WKML 4LEEA 2J3SA 4B0MB 3Q2CA 4G8AC 1XF5B 3H1ZA 5I26A 4R4NC 3MUGA 1P7QD 3GLAA 4OKDA 4GKOA 3K2MC 3HE6C 1XSKA 2VO5A 5IMOB 3NFNA 3VWKA 2P5EE 3VJ6A 4APXA 1A9EB 2HJKA 4JY6A 4FQQB 2FYYA 2F8OA 2VZUA 4G7YL 2X9XA 1IBFA 3VI4F 4HPYH 3HE6A 3UPCA 4X8XA 1BLIA 2QQNL 3CFKB 4OCRH 5SV4A 3IFOA 4ATTA 1JPTH 5CBAA 3FU9A 1NPUA 1UM4H 32C2B 5E24E 3EO9H 1YMHB 1CLYH 3FRPA 3P9LB 4H8UA 4R7LA 4TRPL 3WKYA 1GJIA 3BPLB 3QEQE 5I1IH 4XZUB 3TM6A 1PY9A 1AJ7H 5KS9E 1D6EB 5AW4B 4LHUD 2YD7A 3HUJE 3DMMC 2YA2A 3CHRA 4R5XA 2AXHA 2D3LA 4HUXA 4OLZH 1RZJL 4PJHF 3WSQL 5ITBL 2E75C 1JNHB 3H9SD 4PJGF 1MZZA 2ZZUT 3F83A 3JWNC 2VUOA 4GQQA 4N0YH 3MBWB 4KZDH 2CR0A 1V55B 1M6UA 5AKTA 2J6EL 5AOMA 5GRJL 2VITB 4RGMB 3M17B 5DDHB 1P7BA 3UYOD 5HDQH 1YJDH 1MFBL 2IBBA 5F3HA 2ERJC 4LKXA 1ORSA 3C6SB 5HPMB 4Q6KA 2V33A 2J1YA 5I5MA 4AJYV 4PV9B 3HG1D 3CNKA 1U95A 1BIIB 3BQUA 1J10A 1NDTA 3FULA 5EUKB 1NIBA 3ZKXC 2OYMA 4P5RA 5BRZA 5DJDB 3VI3B 4YLQT 3WO4B 1PG7W 1RZFH 3ULUL 3MCKB 4P23D 4WUKH 1EFXA 1G9MC 2DQMA 4NN6C 1I8LC 1T22A 4PJBA 4DTGH 2KHAA 3DX7A 2BNRD 3GSRA 3MV7D 1QLRB 4KO5A 5FWQA 1FNFA 4K3DL 1AQ8A 1KZYA 2HG0A 1TLKA 1LO4H 3FQ2A 3UBXG 3EYVA 4X0KA 3ORJA 3EYFB 5TE7H 3CIAA 3TTYA 4M6NH 5CBAB 1I85C 3PGCA 2FD6L 5B39G 2HRGA 3WJMB 4ZJ9A 4B9CA 3JWNG 5BUPA 2YUVA 3OVUB 4TL4A 3G5YA 2CKNA 4M61B 4TTGA 5ACLA 2NT1A 2GW5A 1MRCL 3DV6B 4I1NB 4U6TA 3W5MA 3AFLA 3B9AA 4HHAA 1T80A 4NRYA 1OSPL 3T6ZA 4H1LG 4G6AC 4K9EL 3ECQA 3IE4A 2Q76A 2PO6A 4BHUA 3IETB 1BZQK 5LHDA 2BNQE 3VCLB 1CF8H 1AP2B 3QFDA 1KTLA 5MERB 5GZOA 2B59A 5MI0C 4P3CL 1DUYA 3VGHA 1MWAL 3QW9A 4QT5B 3GD1C 3POHA 3SE9H 4EI5C 3P0VL 5E6SB 5F7YC 2VMJA 4JPIA 4A7SA 4YFDB 3U82B 3OJMB 4HOMA 2XLLA 3VWJD 1HL9A 5JUEL 3ULVE 4MA8H 4PV8A 2H4EA 5IT2L 2VDNL 3QXTA 2WVTA 2WPGA 3ESOA 4BINA 3G6JF 2E86A 4ZG1A 1DJZA 5DHDA 2NZ1A 4KTDH 3VRJB 1FGNL 1HL8A 1OCWH 3MU3A 4Z7VA 4FLHA 3HS0C 2PPEA 2NY4D 1N0XL 4O9HL 4PWHA 1SVBA 1V3MA 3GS0A 3F7YB 5DC0A 1AXSA 3SDCB 2FWOB 4DF9A 5CCKH 3FT4A 2FX8H 4BKLB 5D1ZB 1O7DE 4MQSB 1E28B 1N7MH 2CPUA 4L3CB 4QRFA 1CZ8L 4YDNA 1GW6A 3ES6A 4M5TA 3VQLA 1BGXL 4PGCA 3TVMA 1HQRA 3QH3A 4X6CE 2CHZA 1QNZL 3GINA 3IAPA 1AZNA 3W0WE 3IVKA 4AM0Q 4U6HB 1H6UA 1SOSA 1A4JA 1LK2B 1VSCA 2E76C 2V17L 1PZSA 2JB6B 2X5PA 5DRZB 1EGJA 3D4ZA 3RTQA 5E6ZA 2A9CA 2ZX7A 2WLYA 1BEXA 2FZ3B 2QADC 5KS9B 3M8OL 1FNHA 4GO6B 5F72S 3G5WA 2YXMA 3VXNB 1UYWL 2XDHA 4NGHL 4PRIA 4FKKA 4HJJH 1JGLH 3PP3K 4HAKA 2Q0ZX 2AABL 3QUYD 3QZBA 1SUHA 3FT9A 4YSSA 3ETBJ 5D5MB 4ZMAT 4ZPVB 2OMZB 1PX8A 2XCMC 4B9GA 1P9MC 3PGDA 4N86A 3HFFA 3KL5A 4NN7C 3U36A 2JE8A 1TCRA 3QRFM 2G3NA 1JWSA 3NG5A 2EC9U 3DETC 3IDGB 1MQKL 3RL1A 4JDTL 4ZFQA 1U93A 1VRSA 2JCCF 2VZ3A 4MYPA 1P6AB 2VDLH 1DQJA 1DEEB 3LDBB 1E4WH 1LP9B 1OAJA 2BY0A 3H42H 2B9BA 1PSKH 1JDAA 5E56A 3ESMA 3FO2A 3DC0A 5LWYL 1CF8L 3CSBA 3QWQB 4IKLA 3NIGF 4PJ7E 3GBMH 2Z31B 4AMKL 4XBGB 4TOYL 3FAWA 5D1ZA 3PPSA 3N2JA 5A2LH 3RLSA 4CA4A 2VR9A 4HHAB 1URIA 1EA9C 3D39B 3VXUB 1QUNA 2X4SA 3TNNA 5J1AB 3WLBA 2ZSWA 4L0YA 3WNOA 2W1NA 4GSXA 4IU3B 5SWSD 1I3GL 1F8TL 3WJLA 2A38A 1CR9L 3KDPB 5K69A 1ACXA 2VJ0A 4FLQA 5HGBA 3DROA 2PO6C 5D7KE 4TVPE 1AIZA 4ZFFA 1IGJA 3MMEB 4JFUA 4L3EA 4MKMA 5T5FA 2Z3FA 3G04B 4N8VG 1WBZB 2QSTA 5EZOH 5I17B 3P3UA 5LN8A 3FN0L 4HIEA 3RFZB 3ZYJA 4AGQA 4C56D 1DQKA 2CXKA 4PJAF 5FECB 3ARUA 3N06B 2YPLA 3AG4B 5MENA 3T2PA 2IC2A 5HDBE 3WMQA 4OB5H 5IVXE 1ZY9A 2IAMA 5FLUA 1K3ZA 2GJZA 3RDTB 2NY4B 2X1OA 2ITCA 1FGNH 3UZEC 4S11A 1T0NB 1YCSA 2A77H 1WUZA 5IJVA 4V33A 1C5DA 2FWUA 1OAKL 4LPYA 1BQRA 1OD9A 4GUPA 1I3RB 4GRWH 3SJVA 3VGDA 5JOFA 2AXGB 4GIPD 2BNUB 3LRHA 1J0IA 1YNKH 4XP1L 2Z34A 4MNQB 4U1GC 1FAKT 3RPKA 3GKWL 4J4PD 5CJQH 5EF0A 5ITFB 3BP4A 3GMRA 2W88A 1A2YB 1K9TA 2ZICA 2R23A 4X6DA 3E2HC 1PZUB 3EBIA 3A6BL 4YDIL 3QYNA 3U48A 2H1XA 3VI3E 4HPOH 3DRQA 1BFSA 1UOVA 3MRJB 4MBOA 1AH1A 2NY6D 3TT3L 5IVXA 3P4LA 3S88H 1MHPH 3WEOA 2HPOA 3KPQA 1S9VA 2OQJB 3NZ8A 4I0KA 4NQTA 5HYJB 3DRTA 1UJ3B 4W6WB 4L23A 5CD3B 3OKMA 4K23L 3B6SB 1Z32X 2CUAA 3G6DH 1JGVH 2IADB 5BJTB 1NCDL 1OTSC 2EQDA 1AC0A 1Z1WA 3D69A 1OAXH 1OB0A 3OZ9H 1URZA 3RKDC 4RFEB 2EIZA 1JK9A 5CLZA 1LVEA 3F2LA 5HGGS 2M2DA 2X40A 1AHMA 1QBLL 1SFDA 4LPWA 4HWUA 2FATH 4EI5A 3E3QC 1BIIA 4N9OB 4C59B 4HX1B 2A2QT 2KLRA 3V9CA 4U6VL 3VTMA 2Z92B 5DA4A 5EO9B 3TASA 1NAMA 1G1CA 1AE6L 1L7TL 3LQZA 3NJMA 3MO1B 4P07A 4ZSOE 2NR6A 5DYFA 1Q1JH 4BFFA 2ENPA 1CICD 3BDYH 4PMEA 4LGPB 3BCFA 5F9JA 4OBRA 2DMBA 1NCCH 2OLDA 4R8WL 3WS3A 4EMZA 3EXLA 3WKPA 1B4RA 4WGVB 1G7QB 2FT8A 3IJHA 3NABH 3MV8A 2XJKA 2DIBA 4PPTA 3IKCA 2YAMA 4NRXA 1HOEA 4X8CA 4YLBA 3D3VB 4FQPA 1LTXA 3MN8A 2UWEA 4LLDA 4MMXC 3WE6A 1J5OH 4X5XB 5EBMB 1JNNH 2YSSB 4QOKB 3T3ME 1QSZA 1IGIL 2OMBA 3MRQB 4HCRH 1G1OA 4N0RA 1U3ZA 4RAUB 3HE7B 2UZYB 1C12A 5HYSG 3CXHK 1N5YH 1KN2H 2YD0A 3N85L 2X42A 1YSOA 3HG1E 2BINA 1IM3B 1GGBL 3ZO0A 4XMWA 2XQ0A 1AMYA 4ZFGH 1K8IB 3QQXA 1MW0A 3NFPB 2YARA 1Q94A 1YYMH 4UZGA 4Z78B 2LE9A 3EO1A 1EBPA 3BEWB 1M1SA 1OGAA 2P24B 2A6IA 5JHLL 2ZONA 4F3FB 4RVBA 4BZ1L 2ALWA 2R4RH 2ZUTA 1DJSA 3QZNA 1PIGA 1IBDA 1OP5K 4IDJL 4MQXD 2X2YA 4E2OA 3O3EB 1MVUA 2BFVH 3BVWA 3IKKA 3MZTA 3TBSB 1NC2D 5GS1B 3SYCA 2FEJA 3MLYH 3P0VH 5CILL 1W0YT 5M95B 1L0XA 3GJFA 2BP8B 2EYRB 4RBPH 3IMVA 3FOLB 4XPHH 3UEQA 2WANA 1TOXA 4PWGA 2X4OB 5EBGA 3MXVL 4I9WD 2R1WA 4HH8A 4X6CA 2J73A 2C9SA 3GK8L 5DJZA 1NMCB 4JLRA 2VXUL 2XA8L 2NY2B 3GI8L 4XNXH 5DRNB 1FPTH 1W6LA 1TT6A 5DHVH 5IB1B 2DTML 5F21B 5KYXB 2ADFH 1XH3A 3U30C 3U9WA 5BVPL 3K2KA 1MHCB 4NZDA 2KH2B 1GGCH 3B2PA 2JKTM 1A1MA 3H0TB 2Z1PA 2Z4TA 4HS6A 3QUKB 3BAKA 4DKTA 4TUKL 1DZBA 4M48L 1H5BB 1CFSB 4I9XA 5FCUH 1R19A 2FVNA 4MQTB 5ECJE 2FNWA 5KVFE 1WWBX 5ECGA 1CG9B 4AEIH 4P46A 3MNWA 5C0CB 2HWZH 1D5BA 3A23A 4E9TA 1M57B 4R5TA 1JYWA 3DK2A 3IFPA 2HLAA 2FRGP 2ZUVA 1JZ2A 5SWSB 5DQDH 4IBQA 4IEFA 4Y0GA 2FTAA 2G75B 3EUDA 4ODBD 3ULSB 3VGGA 5ADPL 1KDIA 2HVKA 4WI6A 5F44A 4KTEH 5D8JL 1TUPA 2PCXA 4YUEH 4IRJC 1IAOA 32C2A 4LP4A 3NCCB 2W80C 3TFKD 1MRFH 2XV3A 5T1MA 3DXAE 1JK9B 3ZKMD 5HHME 3EJTA 1FVDB 1RQ5A 2EADA 1Z5LB 1M71B 3S3DB 2D8KA 2B39A 4GJTB 3WU1A 4IDLA 1FJ1A 4JQIH 4WIQA 3TA3A 3ILPA 1KTLB 1X44A 2Q3ZA 4Y2DA 3S36L 4KNUA 2A9BA 4HUWA 4K71C 3SPIA 1HSAA 2DIEA 3MUHL 3RDTD 3W0WA 1G9MH 5DMJB 3THML 3GZOA 3MRPA 4PJ7B 3MQIA 4U3XA 2JH2A 2VZ1A 4YHNA 1M05B 1RUAH 4JG1L 3L17A 4N2HA 4RQQA 5F7WC 2HA1A 2MHAB 1CGUA 1YJDL 2A73A 2JWYA 2R83A 4HJ0C 4AQAA 2EDNA 1UXSA 4O00A 4ZS6C 5F1KC 5IMOA 4RGND 5C0GA 3JV5A 3FCTB 2CHNA 4AQEA 4JFPA 1S7XB 3ATEA 3JTTA 3HS8A 4ZTPL 2J6EH 2UZYA 2Y06L 1WBXB 3FUHA 3RNQB 3CVBA 1K8DA 3X3GH 5DK0B 3STLB 2QKIB 4MB1A 4R7VA 2OMTB 3HZYA 5J7CC 5GS2H 1NGYB 1CBJA 3BZ4A 4ADJA 4Q9QL 2EUWA 4LGSB 4L37A 3UTZB 3VFOA 4NKQB 1G6RH 4UTBL 1TZIA 4YHYB 5GGUB 1HTYA 4XO5A 5H4ZA 2EEXA 4FG0A 4KHXH 5K59F 1ZGLB 1X7TA 5JXEC 4R2GC 4RIRB 3NCWA 4H26B 5DUJA 5AYUL 4NLAA 5AD0A 4DP6X 2R7EB 2HVBA 5K33A 4ZTOH 1A21A 2C1PB 3ARGC 3FU7B 4LVHC 4N5EC 5C0IA 3QCUL 1IGJB 3TBYA 1OGSA 3D85B 4TULL 5KAQF 3TVMB 4P04A 1CDCA 5JORA 3ETTA 3MV9E 3WS6C 2V3FA 2WXKA 3LKNB 4Q8BA 1B2WL 5T1KB 3M1OA 3Q1SL 1TEYA 4IBZA 2ADGB 2J57A 2B8OT 4HUVB 5JHDA 3CAFA 5LG1A 1NOAA 3RZCC 1THAA 1M6OB 4GAGH 3EH3B 4LMQI 3C6LA 4JHUA 2E9BA 4P9HH 4WHYH 1FA4A 2YPVL 1D3CA 1QFWM 2VABA 2FO4B 4KTGA 2O1AA 4UU9B 4EN3D 5F7MC 1TXKA 2OKMA 3CLWA 2JVUA 1FG2A 4KKRA 3B2DC 4LLMA 1VGKB 1U8QB 2F53A 5AW0B 2CLVA 1T04B 4KZDL 4J2QA 4LNRB 2R0KL 4U3HA 1MCQA 1JG9A 3ABLB 2E7HA 3QDHA 1UB5B 5BNXD 1CT8A 1A1NB 4YHZH 3R7QA 3WD5L 1L9TA 5DFVC 3FBQA 1I8AA 5GZOC 4FXLA 3QVAA 4WCYL 1F42A 2XI9A 1DQMH 4G8FA 5I16A 1J0ZA 2A9DA 1OGAB 1OT1A 2P24A 3G6AA 4PS3A 1FRGH 1FHGA 1YA5A 4FQXB 5C86A 4ZO7A 3FTUA 3TCLB 4V1DE 4DVBB 5F88A 1EEQA 4WO4A 1ES0B 3MRHB 4PRID 2FWLB 3MGTB 1PAMA 2FIKA 2NQCA 5CUSH 1MXDA 4WSKA 2C9UA 2K8QA 3NCJL 3OKEB 4FA7B 4JPIB 3AGVA 1IBZA 1B90A 3HMXL 2IDCA 1TTUA 4L3FA 3CPUA 3X11B 4L3EB 3O8XB 4MX7B 4N85A 4ZW6A 1KTJA 5DVLA 4NKOA 5TTRA 2BNQA 3OPZH 3BRFA 1QR1A 3QDJE 1E9PB 2XOTA 3VD7A 1HL4A 1A3RL 2EEDA 4XVSH 1MZYA 4O02L 5CP3A 2WXHA 1ZLWK 4HWEH 1Z0NA 2ZG3A 4UM8B 3HLAB 3RVWD 3QIBB 3WKNA 1K2DB 2OMVA 1LYQA 3BIKB 4PWFA 3WSQH 2XVKA 3M88A 4OD2B 4HIEB 3SBRA 2WLIA 1JV5A 4X6BA 1W91A 3QXDA 5GHWH 2X28A 2XY2A 4HH9B 3G6JA 2KQMA 1MEXL 4UINH 1SDYA 5I66A 3LZNA 1CLYL 5EUKA 1JMZA 2HH0L 4FQJL 1YN6A 4HJGB 4LCYB 1NCCL 3BESR 1R5IA 2A0LD 2FT7A 2TRYA 1YHPA 4Y4HD 4L3CA 1KIRB 1T7YA 5HHQB 1DSYA 3U6XA 1KFGA 1LK3H 5DURD 4FNUA 1E6JH 4J3VA 1MHEA 4EI0A 3MRKB 2CO6B 5DLMH 3DX7B 5BVJA 3D3VD 2NT0A 2LU5A 3LN5A 1CGWA 4YQXL 5SX4H 1S7VB 5DZAA 4FZEH 2R4SL 4OTXL 5CO1A 4HGWA 4MAYD 1OP3K 4S0SD 3W11D 3DHJA 3G6AB 4PJXF 1LO0L 1XT5A 4GEIA 4Y1SA 5CIPH 2H3NB 2WVSA 1IGYB 3PL6C 3B2MA 1IGCH 4K8RC 1ZS2A 5EZIL 4HHWA 2UVEA 5EEZA 3DUUA 2ZUQC 1C16A 3VCLA 4NFDA 4FADA 2ARJQ 1TQBC 4CJ0A 4JFXB 4QLWA 2P5WE 3OKEA 3INUL 4M00A 4OGQC 2W5PA 4LSDA 5F6HI 5D7LD 1WRFA 5IJBC 1H9VA 4L0ZA 4JPVH 2GI7A 3NA9H 4U1NA 4C4KT 4JHAH 4O4YL 2CRIA 4W81A 4GRLC 2VXQA 2XSKA 5EOCL 4PJIE 5FUOL 3D34A 3WN5A 4MA1C 3U46B 3AUWB 3GXIA 1F4YH 4XZ4A 5E2WH 1BGXH 5KYUB 2IAMB 1U8JA 4KO6A 3QXDB 5IHWA 1A3LH 3BAYA 4FQIH 5HJ3B 1DBBH 1J8SA 3RWFB 4L29A 2CLVB 1L7IH 2VERA 2RFXB 3LRGA 3MRMB 4DERA 4LPUA 2VLJA 1CGXA 1IAIH 5F3BA 1NFIB 2IBZY 5SWQB 3QO1A 4P2AA 4JRLA 4E9LA 4PBXA 1WZKA 3CVHL 3T6WA 3RWCB 4FD0A 3ES6B 4R7DA 2F08A 4I1RA 2Y7SA 4JS7A 1HWGB 4QF1B 1MJ7H 2OMXB 3DJTA 4X8JA 1QLEB 3QP3A 2YSSA 3HG4A 4H1LA 3RIFF 3VU1A 5DJCB 4KDTA 3TO2B 4I2XB 1HYRC 3LJ3A 3C6LC 2CMRL 3PWVB 2LLGA 1HHJB 3P2DA 4UOW1 1X4ZA 1O5DT 5TDOB 4ODXB 1UZ6F 1DLFH 2Y3AA 2ZF9A 1UWEH 4UZUA 3Q9QA 3MCLL 4HOZA 3RUGA 3VB8A 5HJDA 1IM9D 4QRRE 4ZNEA 2JKIS 2P5WB 2HFFB 3EJJX 1O6SA 5KSBA 4BFIB 4PRPA 3R18A 4OZIF 4L1SA 3HR5A 3BKCL 4QRPD 4WWKA 5C07A 4KGLA 1QSEE 3I6KB 3JWDL 3K6NA 1A6VH 4FG2A 3EYQD 1TQBB 1M2VB 5A3ID 4K94L 5DZJA 4GRWB 4XH2B 1V8HA 3QI9D 3VM7A 1XH2A 4RWYL 4Y4HC 3BP5A 3T2LA 3ARFB 4WTXA 3AXHA 1QSFA 1U58B 3D39D 3VXUD 3BPOB 4H88H 4CN6A 4XNYL 1EGJH 1K8DB 4UYQA 3U4EB 4OQTA 4Y9EA 4UM9B 5IMMB 4IMLB 2WC7A 4BKLA 3AU1A 2FX7H 5CJ8A 1KGIA 4XPGL 2IXQB 1T04A 4ZW3A 4XNZC 3US0A 3EG9B 4M8RA 5D2NB 1HAWA 3F58H 3TIEB 1XGRA 4JY5H 5LBSH 1SDDB 3TV3H 3UPRA 2CRZA 4UZSA 5C3IA 4YHML 1TJIH 5FYKD 1AE6H 4QO1A 3N41F 4JJHA 1F4AA 4AY0A 43C9B 3NA9L 4HK3N 2Z65C 2J6WA 1A7BA 1SJHA 1MI5A 1DSWA 4HKBA 2RHEA 3NCEB 4JB9H 4MLSA 1FH5L 2NNAB 1Y0LA 1BPVA 5HHPA 5EN2B 3KLHD 1E4JA 4ZMOA 2I5YH 4S1RH 1E4WL 1B3IA 2YIHA 5CZVH 5AVUB 3TC9A 3O3AA 2JCWA 2GG1A 4LL4A 1M7UA 1Z5LA 3LKNA 3QNZB 1NWOA 4B7IA 4CADA 5DGQA 4XI5C 3QA3B 2Z8VC 1KIQB 2B08A 4MAUL 4ES8A 3MRFA 4HKZB 4QXTB 2VXSL 2G60L 2VAAA 2VQTA 5HD8C 1A6UL 2GY7B 2CDGB 2KZKA 1AGDB 1EK3A 1KYFA 2YN5A 3LZOA 4N5ED 5A16B 3RG1C 4X6EA 3KM2A 3F7LA 5I17A 1XH3B 4HPOL 1OALA 2I9LB 5KBKA 5DS2A 4J6RH 1KLGB 1PG7H 2WNKA 3PJNA 3QDJD 4HCFA 2JKWA 4F93B 5ID0B 5E1AA 2GEEA 1E4XL 5IB3A 3QARA 4J1UA 4ZAKC 3QK0A 1GIGH 4FF9A 4GBXD 4LLWB 4U0RB 2V3EA 3QFJA 3ZYIA 4NM4H 1B3JA 3QORD 1GZQA 3OKKB 1MNUL 4HFUL 3AITA 3DVFA 4NQCE 3L4CA 4BA8A 4DN3H 2EVGA 1OCZB 1ADQH 3RY4A 2AJ3B 4NQCA 4MMZA 3KMDA 1P53A 1KYOJ 1E9QB 4LDCA 4NNXA 4R9HA 1JERA 1PJWA 2WLMA 4AQEB 1EJOH 3OJ2C 2Q6WA 4DN4H 1CD9B 1IQDA 4XPAH 2PKDA 3LKOB 3HE7C 4M7KH 2VLRE 4PGEA 4RMSA 4WDIB 2A4ZA 3EGSA 3V5HA 2GSIB 1OAKH 2JKRM 2DL2A 4LHUB 3WFHB 2CR3A 3SO3C 4AEEA 1TMQA 5EORH 5E6IC 5HYQA 4KK6C 4ELMB 1OARL 1NJ9A 1F6LL 4L4TB 3DI2B 2IPUG 4WTQA 3MR9B 2BM3A 5KSBE 1FF5A 4XHQA 4PI2A 4HG4K 4BQBA 3VDBA 1A8ZA 2QHLA 4KRNA 3K72A 4MDIB 5BPPA 3G5XA 5GZOD 4Y2OA 3VA6A 3HI5H 5EUOB 4AE1A 1GAFH 4NIKB 4BA0A 3NA4A 4EIGB 2WXPA 4JFWA 2MMXA 1ZT4B 1N0LB 3PJLA 5HHNB 3WEXB 4HSAC 2VLKB 2VAAB 1NCTA 3DIFB 2VXVH 4NC2B 1RZ7H 3T5WA 3TFKC 3HPJA 4EIBA 4PJ9C 4YGVB 2Q86B 3T6VA 3FT1A 3M1BB 2WB1A 2YD3A 4NCC2 3ABKB 4IHOB 3MXWL 1WIPA 1LQBC 3L6FA 3II1A 2YEZB 3OXRB 1JGVL 3G08A 2J2ZB 2JTDA 2X7LB 3QZMA 4FTVA 4L9LC 4RSVA 1R5IB 5HDRA 1RZ8A 3NJHA 4HEMA 4PN6A 5DRNA 5EO1B 5IBLC 3CC5A 1PZ5A 3TO4A 3IJHB 3E1ZA 5FYLL 1Z9MA 4OF6A 1OB1B 1L0QA 1XIWC 1XCQB 2DI8A 5DJYA 1P9MA 4K5OA 2XJLA 1CLCA 3M7FB 1CE1L 5ICUA 3ZTCC 1WA0X 1I9IH 2EIJB 3VM5A 2Y22A 5B8CA 3S4SB 3E7JA 5A2JH 1IQDB 1UZ6E 3GBLA 5JHDE 4HC1A 1HNYA 3PRZA 3HI5L 4YE4L 5DLLA 4PRAB 1ZVNA 3SE6A 3RAJH 5I8OL 1TTGA 1CZ8H 3AXLB 3KDMB 3MA9H 4QHUA 3HVNA 1HI6B 1Z5YD 2PW1B 2WBKA 1J8HE 3PPEA 1XSOA 2XQBL 3SKJL 4F33A 3LAFA 3LRSB 5FAAA 4A63A 2AXFB 2EDWA 3SDYL 2X4NA 4GLRI 2W59A 2JQZA 2WQXA 3BQVA 4Y88A 2NNCA 2XVGA 2BX5A 2YQBA 3RVWC 5GS1A 1AIFA 3LEYL 1DANU 5EEVA 1X6LA 4CDGC 3HG0A 2FK9A 4JUTA 4HLJA 1WC7A 1XH0A 3V4PH 3GHBH 1ED3A 3VFNB 2OMZA 3QUYB 1IAMA 3ET9F 4R4ND 1RVFL 1JGUL 4NRXB 4G8EB 4GMSH 4NN7B 1P1ZB 5E8DH 5J9PA 1INDL 5CMAA 1K5NA 3SN6N 2OTWB 1IO4C 3N9GH 3GEFA 4X7TB 3B5HA 2VCOA 4OCMC 5GQBA 2DYSB 1ADQL 4YDMA 3U1PA 2XBZA 4G3YH 4MASA 1G6RB 3UERA 5DD6B 1IZKA 2VDLL 1X5MA 1CN4A 3HMXA 4ZD3H 4MB4A 1QTPA 2V5MA 5CCHE 2DIAA 5EDXA 5GJTH 3IMRA 3KHOA 1WHPA 3FO0L 3MUUA 1RHHB 3BYTA 4E9RA 4MWFA 2CLZA 2G5BB 3PP3H 1J88A 4NB7A 1MRDH 1PZAA 4JN1H 2WCGA 3FT4B 1KPVB 1XMEB 1SN0A 4FXKA 3DV4B 4IBTA 2P43B 3BWUC 3P9MB 1DBMH 3BZDA 4M6OH 1NIDA 2GVYA 4OFQA 5DK2B 1J1OH 2K3HA 3PWPA 4KK5D 4H25A 4C57C 1KCWA 1FYTA 3FFCE 4YEFA 2BNQB 4WUUB 4Z1PA 1E4HA 2JELL 2BMKA 3RWIB 2A6DA 2WBJD 1AQDA 3IGLA 5IOPB 3NCBB 1M4KA 1JYNA 2C1PA 1IGCL 5E2TL 1TLMA 1GGCL 2ZX6A 1IGTB 5ADPH 2OJEB 3L4WA 3QIBA 4ALAC 2XWDA 5GS0L 3M17A 5DDHA 1M7DB 1PYWB 3NEEA 4Y4FB 3SCMB 4L8BB 4F7EA 4X98A 2ENYA 3AJ7A 3W3BA 2NR6C 1RPKA 1KIPB 2ZOOA 4BZ2L 5B4MC 5IY5B 3DOHA 3KLSA 1JPST 4K15A 2X4PA 2AJUL 1KEMH 3EOTH 4ZFOL 1E2VA 2YWYA 1GIGL 4TUUA 2A77L 3FQRA 2F7OA 4PREA 1YYLH 4WY7L 3BZ5A 4JPWH 3V5KB 2D7QA 3GI9L 4X83A 3EFDL 5CN1A 4HKJB 4Q97A 3BAIA 5MEPB 5EOTB 5JHBA 3FW6A 1KPUB 2PCYA 3FT2B 2ZP0T 3UTTA 1ACYL 4HWNA 1T0OA 1KJVA 5FO9B 1WJ3A 5M94B 1I9RH 4FQHA 1RURH 2X1WL 4R7DB 3RIFK 3VD2A 1ZHNA 3IAGC 3RWEB 4BH7A 1BZ9A 5D7SL 4Q6YA 2RCSH 3LXBA 3BDBA 4NUQA 3BPNC 3VFGH 3MLZH 3UTQA 1ZXKA 5EZJB 1THCA 5SX5K 5C0FA 3WY1A 1IKNC 5I6XC 5T1DH 3AREC 2WINA 4O51A 3VYPA 5ABZA 1QFWL 1PJ9A 2AV7A 3MAWA 3G5YB 4P23B 1HCVA 3RTQB 5E6YA 1IAKB 4PJBE 1N70A 3WUWG 4HJ1A 1YO4A 4LSVH 5BS0B 2JB5H 3I02A 1ZTMA 5I1EH 4N2MA 4K5LA 4XN8A 2NTFB 4G72B 1SUJA 4I1PA 4PI0A 1BMZA 4HH9A 2EDKA 1HCYA 2E4TA 3ECVA 1BHGA 5D7JC 4AC4A 4MZ2A 3KYOA 4F9LC 1CDYA 5D1ZI 1JS4A 1SJXA 2G3ZA 3BFOA 2IAMC 2A7BA 3P1VA 1S7UB 2DQDH 1NAKH 3ARWA 3UC0L 5G4NA 4F1SA 4C58B 4AGNA 1UHVA 2OMWA 5FO8B 1JRHI 4GEJA 4JPVL 4R4BB 3GBEA 1NZRA 1MF2L 3JT2A 3KBPA 5A40E 1NM9A 1VESA 2E7LC 2IAMD 3MI6A 1MQKH 1XWVA 3OX8A 3P69A 4IM8A 5C3TA 3QUGA 4ZQKB 2VDMH 5AOZA 3FSWA 3HNTL 4OLVL 4RA3A 4ZUWB 3WV0A 2C7FA 2Z91B 5CXPA 4LSTL 3OAUH 1MHHB 3HNSL 2LU7A 1U92B 3VTAA 1TVBA 3ZDWA 4GT7A 4W70A 1CYGA 1IT9H 4LOUC 1I7ZA 1BG1A 4L9LB 2FO8A 2WLKA 5FGCE 1BVKB 3GSXA 2J1ZA 2PN5A 3O2DL 4RRPG 4YHMH 4HXBL 2VW7A 1QPKA 5JYLA 1RK7A 2NY5H 4Z77B 3KJ6H 5T5FH 1OW0A 3RL2A 1ZMYA 3I74A 4JMXA 1IV8A 2Y1VA 3HKFA 3ZT7A 2X4RB 3RWHA 2OJEA 2VLLA 5F6HJ 5EF1A 1YVLA 4IQHA 4U1JB 1Q9LA 1OE3A 3SKUD 3MRDA 4KMLB 4PRHE 1H3WM 5FGBC 1N8ZB 3KHQA 3BP5B 2QSVA 3IDUA 5F9DC 4ZMZA 5CGYD 1AD9A 5I5IA 3Q6FA 4N8VB 1UWXK 1BWWA 1JGDA 1WWWX 3JWDH 3KS0H 1B0RA 3Q13A 4EDWH 1EDQA 1S9XA 4K94H 4K73A 5HYSA 1OTTC 5EEYA 4KI5D 1CGSL 2IH8A 3C9NB 5AL8A 3A4FA 1DLHB 1KNOB 3NJIA 3NPZB 4G43A 2FEEL 2QV2A 5CINL 1MJ8L 5D6CA 1C5CH 1JDDA 3CVIL 4WI3A 3ARPA 2VL5B 5ANHA 1EXHA 4G2AA 1JZ4A 4ORGA 2WQWA 3C08L 4P46D 1ECYA 5IB3B 5IFJB 1E6OH 2VSCA 3JWNH 4KOBA 4TNWK 5IB5B 4N0UB 2GK0A 1COBA 3Q2WA 2HLFD 3E9TA 3ZQ9A 5EU3A 4LLVA 1FN4A 1ECZA 4JFVA 2DZEA 1F4XH 5T1DL 5L2JB 3F8UB 4P5SA 3A6CL 4PRHD 4B0MM 1MCKA 4Z3FA 1OAQH 2BWIA 2QPUA 2OM5A 3LH8A 4K8RH 3B9KB 2X4NB 4EI5D 4P57A 1WWCA 4OFYA 3O6ML 1OP5H 1RZGB 4HMDA 1DUYB 1J0YA 3TA3D 4LQ1A 1ZLSH 4XX1E 3FCSB 4PJ9D 2A74B 2EVHA 1CFMA 1CICA 3F58L 3HNVL 2G2RB 4BK4A 1G1KA 5EBWA 4MNQE 3W0WB 2W38A 3DIVA 3TWCH 2QGCA 1JI2A 4GI6A 4LBEA 2IF7A 4PG2C 1LEGA 3MBED 5I8EB 2XWTA 3EFFB 1FZKA 3HB3D 3SCMD 5IWLA 3L95B 4LLUA 5FKPA 3T08A 3DX2A 4IKIA 1II4E 5DJ0B 3D0AA 1A3QA 3FUMA 2ZXEB 3EJQA 1JRHL 2A6KA 4Z0BL 4LLWA 4N2BA 1OQXA 1SBBA 4Q2ZA 3A21A 2JTYA 4N2FA 3T09A 3TYGL 2IPKA 4DFIA 1J8RA 2X6UA 3CN4A 5FHBL 4EZJA 3S4SG 3Q01A 1QAWA 3INOA 1F4XL 3HB3C 2E7DA 5PCYA 1TR7A 2Q3XA 3P3SA 1U21A 1DQVA 1R3JA 4LLYB 1E9QA 1KLUA 3T0VA 4OCSL 3L6FB 4ZK8A 1NUDA 5JXEA 1NBZB 1KBGL 2GUOB 2BHUA 2GBTA 3GZQA 5IFJA 2YFOA 2VDPH 4POZD 2EXTA 1T5WA 2NY3C 2VH5L 5D7HA 5HHXH 5LXVA 3TZVD 3H7BB 4NHCH 4TVPD 3CC5B 1K8IA 4RISH 4I5BB 1TENA 5EIIA 5DUBB 2FECI 5EA0H 3TESA 4XXWC 2NUTB 3MLTA 2OMXA 2G75A 3GFUA 5TK2A 4LDLB 3HZMB 4NM4L 4M4RA 4R2GB 2ZQKA 2EAEA 1I1YA 1O6SB 4PS4L 1OHQA 4OM1H 2HG5B 4BUGA 1LILA 3N5AA 4ELMA 3QEHB 2R56L 4UT7H 1QRNA 2XTJB 3T8VA 1DVFA 3OGCB 2IOOA 2WKOF 4PH8A 1V7NL 3V0WH 5H37A 2XRAL 4CUCA 4CC4C 5JR1H 4GRMA 3BD4A 1TCMA 4P23C 3T1FB 1FZKB 1WC7B 2C3HA 3ALWA 1RHFA 1JWUA 2FGZA 2IQAA 3B9KD 1I7UB 5IB1A 3IU3A 3VFSA 1HXMB 5GGQL 3VWJA 1IEAB 2VDPL 1T2XA 5DMYA 4HMCA 3MFGB 4ZFZA 5D5ME 2AANA 1VZIA 4ZW7A 2L7JA 2OTUB 4MNHA 5ETUA 4AQ1B 3E1F1 4A66A 2BOCA 2W65B 2WIIB 4AWJC 4OUUA 3CFJB 1KPUA 2V8LA 4NM8H 1TTFA 4EXPX 1DEDA 3ASOB 2E7LA 3D2UA 2N59A 3ESUF 1PQZA 4NO2A 2ATKA 4F2ME 4FYSA 3EHBB 3EUUA 3DURA 2EH8L 4P2QA 3ZUNC 4HLEA 1MRCH 3VXRA 3DO7A 2HLAB 3TJEH 4ODWA 4UM9D 2VN4A 2O61B 4NJAL 2DYPB 1J05A 2PCFA 2F6AA 3ZKMC 1M9WA 3ILQD 1WEJH 2NCEA 5G5DB 5HI4D 3L1EA 3IDMB 2QTEA 3QT2A 3IDYC 4HGWB 4P2RB 3W0WD 5T3XH 3RTLA 4JCMA 5BUGA 1SZNA 5AVXB 2P49B 1GJUA 3VAEA 3SPVB 3V6OC 1CL7H 2WGNB 3O41A 3W37A 1XF2A 1MCSA 3WJJA 3Q1EA 4GUQA 1I31A 3B4NA 4XBMA 1HCZA 4EBQH 5LDUA 1MCPH 1KXVA 1JSYA 3OHXA 1I8KB 3PFQA 4UT9L 3UACA 4JRYD 3AMKA 3MLWH 1FI8C 1YDPA 1S2EA 3QYMA 3KWXA 4LEXH 4D7BA 2E4FA 1FLTX 3P3YA 4LRNL 4R4FL 2WM0A 2PXYB 1U3HB 1JV2B 1ZT4A 2DJMA 3ARFC 4N2EA 5HHNA 5JHAA 4BH8B 3CSYB 1S5HB 2ADIB 1BFOA 2P5ED 3DUHA 2I9TB 4B7LA 3KPOB 3WGVB 4LLYA 2O93L 4WWID 4H8QA 2PYFB 4LMQE 4NJAH 3H3PL 3RA7H 3GKWH 2OMUA 3TN0B 1A47A 4PP1C 2OXGB 5EBLA 4HEPA 4H4NA 2CCWA 2OI9C 3KVPA 3D9AH 1Z66A 2QZ5A 1P5VA 1NGZB 1YNLL 4IRJB 2EH7H 1LWJA 3B2VH 1G6RA 1PEZA 2FX9H 2P48B 1MHHA 3DSFH 5FO7A 5TFSH 3QZWB 4U31A 1FZJA 5CWSB 2EECA 1M42A 3DXAD 4FI7A 4NAQA 2BOLA 1D5IL 3CU7A 4MJHA 3S8FB 2OQJA 2WIMA 3NZ8B 1E4XH 2UZXB 1UH4A 4F92B 1MCPL 3GMQA 3LHAA 4Y16A 3NRFA 4KH2A 3VMPA 1TJMA 2NRDA 4RETB 4ERSL 1XSJA 4P49A 4NHUB 2I07B 3S97C 2CD0A 3HRZA 4NUPA 3A3YB 4AUJA 3W39A 3X1GA 1OP3H 3MV7A 3Q0HA 1HDMA 4NWTL 3X3FL 2A9NL 3JV4A 2R2EB 3V4PB 4PJ8C 1A7RH 1T7WA 4FNQA 4TUJB 1NGWA 4WENB 5JIQA 3GHPA 4XN7A 3WLWC 1EQWA 2XKSA 5C0JB 4PYGA 4OT1H 2NY5L 3KLHC 5AVVB 4LF3A 5HGHB 3DV6A 4JZJB 3VWJC 4IRJD 3LYRA 1U2YA 1PBYA 2IANB 1CE1H 4O4YH 3WELA 1UM4L 2MNUA 2PR4L 1SXBA 2OXHA 1NANI 5E8OB 5HYIA 3VG9B 4G70B 1I1CA 4KPHH 3RU8H 2EH8H 4R8WH 5MERA 3APDA 3E80A 1R0AL 4M6OL 1G7QA 1SBSL 2YJLA 3GYRA 1W8NA 1J5CA 1WAPA 1CD1A 1MH5A 1WEJL 5DWUH 5FHBH 4F7