1J5YA

Crystal structure of transcriptional regulator (tm1602) from thermotoga maritima at 2.3 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGGKSGVSRLVAVKHAPEEIKEELLCVVRNGGRIVDVIVEHPVYGEIRGIIDVSSEEEVLKFVNLMEMAKTEPLLTLSGGVHLHTIEAPDEETMERIMRELKKKGFLIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a transcription regulator (TM1602) from Thermotoga maritima at 2.3 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR, BIOTIN REPRESSOR FAMILY
total genus 51
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02829 3H 3H domain
A PF08279 HTH_11 HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j5yA01
3.30.1340.20 Alpha Beta 2-Layer Sandwich Histidine-containing Protein; Chain: A; 3H domain 1j5yA02
3QP6A 4NHJA 1FC3A 2L3DA 3HOSA 3U9GA 4OMZA 2XKOA 4QWQA 5JI6A 2VN2A 3C7JA 2J5OA 3E6BA 1WWXA 2NS0A 1J0RA 3HHHA 1ZARA 4RGUA 4HX7A 1KQ0A 5L3EA 2DFIA 2NNNA 3LA7A 4A6EA 5HLIA 4G6DA 3I53A 2LNBA 3W6JB 1W7PB 3QPTA 5BMZA 1YIOA 2QUFA 4ZYGA 2H6CA 2YSRA 2LDUA 2RC4A 4HBLA 4M9XA 2VODA 4U0VA 4L9NA 3CDHA 5BPIA 3BPXA 3EQLF 2IVMA 1U8RA 4IJAA 3GUDA 4KDPA 2H09A 2BGCA 2DQLA 1IN8A 1I1SA 5ICFA 2EFOA 1O7LA 5JVTA 1S29A 1QNTA 1LDKB 5TJJA 3SFZA 3ZN0A 4RB3C 1QZYA 4N9IA 3BDDA 4K2EA 1SD7A 2XROA 1IRFA 3HOTA 2XGXA 2VT2A 2VXZA 4JBAA 4HF0A 2VC0A 1KQ8A 4ZZDA 5HLGA 3BJOA 2QYOA 4N0BA 2M5WA 1MGTA 3V8LA 1SMYF 2ZJ2A 1BM9A 4KIGA 1AWCA 3IRQA 3E6DA 2P4WA 1J59A 1P92A 2VBZA 3RPUA 1JHFA 1U5TC 5DYMA 3WE2A 2QBYA 2QZ8A 2ZNYA 3QRFF 3WU1B 2HEOA 4NQWA 2NYXA 3N97A 4IXAA 4MNUA 4RB0A 2PMUA 3ZMZA 2VE8A 2YU3A 5D6FA 4PGGA 4IRIA 1ZRDA 2Z9OA 1T38A 3KP6A 2O0YA 2Y75A 1W5TA 4RB2C 1USTA 2FMYA 3Q5FA 2HOEA 1P4WA 3GYHX 3F8BA 4A5MA 4HX4A 3KLOA 4MTEA 3WE3A 3LAJA 4U0YA 2O6GE 1MD0A 3F22A 4EVIA 1Z6RA 2R7DA 4KA4A 1LEBA 5IT9K 4P55A 3WTVC 2CSOA 3VFZA 2Q0OA 2GXGA 3T8TA 4AWXB 3QPHA 2Q2EA 4BQAA 3NRVA 1ZREA 1Z9CA 3F6OA 4QLCU 1ZN2A 3B73A 4MEXF 4LB5A 5HVQC 4E70A 4P96A 1LNWA 5K5RA 1H9GA 4S04A 2R3SA 1PP8F 2PLYA 5E1ZB 2UXXA 4MQVA 4I0AA 1IXCA 1BBYA 2P5VA 2X4HA 4MHGA 2ZO4A 1LJ9A 4CGZA 2MLKA 2FBHA 4LB6B 1R58A 2ZNZA 4OIQF 3FM3A 5A2QZ 5L3BA 2L4AA 1YW9A 3WTXC 2H27A 4DNCA 2EV0A 1BC8C 5DUIA 1KYZA 4HAMA 4ON0A 1FZPB 1OR7A 2D2WA 3I64A 4KUMA 4TV7A 2XVCA 1I5ZA 2GIVA 4WXCA 2J5PA 2PQ8A 1XGNA 3REOA 4NB5A 4ENJA 2OAZA 4A2UA 5J8CA 2CO5A 3BJAA 4L9VA 4EM1A 3Q9VA 2YX7A 5D6EA 1FYLA 2JTVA 3MEXA 2DBBA 1XGOA 1BC7C 1S7OA 4RGXA 4KN4X 4F7ZA 1F9NA 2YX4A 2VBWA 2WV0A 4A6DA 2O03A 3GEZA 2ZXJA 3IL2A 3LFKA 4GXOA 2MLGA 5DCFA 4FHTA 3WTYC 1Z05A 4EV0A 1CF7B 4G7OF 1IN4A 2GXBA 4JQFA 1YW7A 1A04A 3K1PA 4G7HF 3KZZA 1FYKA 4YG2F 4RB1A 2KIMA 4XSXF 4BXUA 3RJPA 1KGSA 3BY6A 3GFMA 2BBYA 3J80Z 2V1XA 1DUXC 2FQ3A 1KQ9A 3WGGA 3R61A 4M73A 2FU4A 3K1NA 4WXHA 3DV8A 3E5QA 5E1WA 4YFNF 2COMA 4EM2A 4HDVA 3QP5A 1W4MA 2RN7A 1EV7A 2MH9A 2XAGA 1D8KA 3D0SA 3WTUC 5L3FA 3L00A 3B02A 4LJZF 5K5QA 2GZWA 3J7AO 5A2QK 2DT5A 5CVVA 1JHHA 4EJUA 5J8FA 5K1YA 1S8NA 1OPCA 2UZKA 1QZZA 2JPBA 3DEUA 4B8XA 1DP7P 3IKTA 2FNPA 2HQRA 5FO5A 1P4AA 5CVRA 1XDUA 3KP4A 2F5CA 5F6FA 3GFIA 3ZMTA 3RYPA 3LWFA 5FLXK 1GXPA 1QGPA 3PQJA 2QBYB 1PP7U 3VB2A 1ZLKA 5HS9A 1FPQA 1D5VA 2NRAC 1CGPA 2XAJA 1KA8A 5KK1A 5LGTA 4OIRF 2WTEA 2BV6A 4ASNA 2H6BA 3IKVA 3G73A 2DK8A 2XUBA 1R5HA 2AS5F 1R1TA 3FMRA 4KMFA 4HF1A 5BS6A 2XV4S 3J81Z 3KZYA 4A0ZA 4ZH4F 1YYVA 1BI1A 2QVOA 3FX3A 6PAXA 4UVBA 3F8FA 3MQ0A 2PG4A 2OD5A 2QQ9A 2M8EA 3FHZA 2FBKA 1Q1HA 3V4GA 1LQ1A 1ONVA 2W84A 1XGSA 1R5GA 5JR3A 3E6MA 2FBIA 2STWA 1B59A 4AIKA 3VOEA 5H6QA 4WK8F 1XMAA 1IN7A 1TQMA 3P9KA 3FM5A 3K1MA 4EJVA 1YTYA 3HSFA 4HV5A 3F6VA 2GA1A 2P6SA 2ZMEB 4FT8A 4HF2A 4O6JA 4A0YA 1UHWA 3RI4A 1E2XA 3KE2A 4BHCA 3JSPA 4UVAA 3HTUA 3I59A 2KJCA 1IN5A 1LB2A 4EGZA 3GF2A 5ILSA 2FNAA 1WQ2A 4JK1X 2RVCA 2Z99A 3M8EA 5F1RA 5ICEA 2Z5UA 4KNYA 4AD9A 3VODA 2CWEA 1MJAA 2GQQA 3I54A 1FP2A 4CDGA 2IP2A 5DV5A 2DO7A 2M87A 5E20A 4BYYA 1YG2A 5DCMA 4PCQA 2RQPA 3ABTA 1U3EM 3R0AA 1S6LA 1UFMA 1B9NA 4XLNF 4Y13A 3BPVA 3KP2A 2ZCWA 3DKWA 4EGYA 2LSOA 3O6BB 4CO8A 3FXUA 1P6RA 3J80K 3GWZA 1S7AA 3RPQA 1TLHB 3W6KB 3D5LA 4ENMA 2QQAA 4H0EA 1O3SA 2LF8A 4HW0A 3R6SA 1DDNA 2RGVA 3QOPA 1T98A 5LEJA 4PDKA 2GA2A 2JRTA 1UB9A 4WX9A 3WTZA 3CLOA 2HYFA 4OINF 2JSCA 2CQKA 3FXQA 3IRRA 1MZBA 1U5TB 2RNJA 3GFLA 1B1BA 2H94A 5ILUA 2TDXA 3EETA 2EFWA 2HTJA 2IW5A 3JTHA 4PGHA 3HRUA 2CFXA 3GXOA 4YIFA 2QWWA 3BOQA 4OOIA 1BI0A 3TOAA 2P8TA 4XLPF 3JTGA 5CVIA 2A6EF 3TDUC 4ZZLA 5JHUA 2FEZA 2P6TA 4WXDA 3ULQB 1U2WA 2L4MA 3WG9A 3L09A 1G3TA 2CGPA 3FMSA 3SXYA 4FX0A 3ABUA 3G3ZA 2RV8A 3MFKA 3ZQ7A 3V7CA 2E7XA 2PI0A 1O57A 1XCVA 1Z91A 2FOKA 2HWVA 5LEKA 2K4JA 3GZ5A 3SHFA 3HSRA 1RIOH 1SFUA 1XD7A 1XCBA 1G4DA 1WI9A 5CYVA 3T5XA 4ZYEA 1KU3A 2IA0A 1Z1DA 4BHPA 2L01A 3KETA 3BJ6A 1O3TA 2K27A 1FSEA 2C6YA 5K5OA 3MZHA 3ZMSA 5AIPA 2X0LA 1YFHA 3ROUA 3WTTC 3H92A 4MQ9F 3AAFA 1BI3A 5IT9Z 1R00A 2ISZA 2NAZA 2O8XA 1K78B 1KU2A 4ZYHA 2FSWA 1K6OA 3F8NA 4HDUA 1WRJA 5IT3A 1XMKA 3JSOA 5E8IA 4ESFA 5FFXA 4N9HA 3P7NA 3O3KA 2DTRA 1QPMA 3RYRA 3CUOA 1R1UA 4B09A 2W85A 5ICCA 4M72A 3WODF 2V9VA 1TNTA 3QU3A 5D5WB 1K78A 2L02A 2BYVE 1I1GA 1R36A 2ETHA 3FWEA 2HGCA 2GAUA 1FBSA 5LRSA 3PQKA 1REPC 2STTA 4PZJA 3EYYA 2OA4A 3F8CA 3FZVA 4P5OA 3M7GA 1FP1D 3S2WA 2V6CA 1EH7A 4RS8A 2D45A 1I6XA 4I7HA 5BQTA 2G7HA 1BIAA 3CTAA 2YR2A 3JW4A 1OYYA 1O3RA 2K4BA 4Q5SF 1WKMA 1PDNC 1QO0D 5HDGA 2MH2A 2DI3A 2EWNA 3M1EA 4LFUA 1W7PA 1SD5A 1FOKA 4KIFA 2W24A 4Y15A 1BJAA 4IF4A 2DW4A 2E1CA 4BHBA 3WTSC 4D0PA 4HLYA 2FE3A 5CLSA 3KP3A 2OU2A 4EMSA 4AIJA 2D1VA 2O61A 3I4PA 3I58A 3TDZC 1G3WA 2FRHA 4I02A 1DPUA 3SZPA 4UUVA 4G9YA 5FGMA 4AIHA 1ZGJA 4GO1A 4RAYA 4S05A 5FD6A 2HTSA 3N4MA 5HDKA 5BOXA 5LGNA 4G8XA 1YO5C 2F5FA 2HZTA 2EV5A 1ZH5A 4CHUA 3KP7A 1JGSA 2CG4A 1TBXA 2VBXA 4HOBA 3ELKA 4RAZA 4Q4ZF 1F4KA 2EFQA 4HA8A 3WU0A 1XGMA 1XDSA 5ILVA 2XIGA 3DF8A 4GYGA 1HBXG 2IA1A 4EJWA 3P9IA 4M9SA 5CJ9A 3M8FA 4A12A 3IWZA 3I71A 4HX8A 2KIFA 1L3LA 5ERIA 1FX7A 4HLXA 3LQQA 2PBIA 2PFBA 1XSDA 2L54A 3L2CA 2MC3A 3BROA 4I01A 2ZBKA 4KFCA 3CO7C 4ETSA 4I0BA 5L3DA 3Q9SA 2IRFG 2ESHA 4IHTA 2EV6A 3RIRA 3T8RA 2HKOA 1HKSA 2R7FA 2PEXA 3TQNA 2W57A 3V8JA 4ENKA 1AOYA 3M9AA 2QLZA 4U0WA 1G3SA 4CYDA 2XRNA 3DFGA 1P4XA 3EYIA 1IZ1A 3C1DA 4KYWA 2IA2A 4I2OA 1ZRCA 4GYIA 3DPLC 5DD4A 3EUHA 3BWGA 2OZ6A 2F5DA 1VTNC 4UV8A 3KFWX 3C18A 3PFIA 4UXNA 1G6NA 2HFHA 1USSA 3H3UA 1ZG3A 4L5IA 1J9IA 1Z7UA 3HRSA 1O3QA 2ZFWA 2ACJA 4ESJA 3HIFA 1MJBA 4WCGA 1R22A 3R60A 4LMYA 5FD5A 3F72A 5AIQA 5ICGA 3ECOA 1FY7A 3HTSB 4U7DA 3E6CC 2P7CB 3F21A 3RKWA 1I27A 2EFNA 1LVAA 2OQGA 4KICA 3LA2A 4G94A 3WGHA 1UCRA 2MBFA 3HRTA 4U7BA 1ZHFA 2P5LC 2IJLA 4IRGA 3RKXA 1TW2A 4XBFA 1J75A 1B4AA 4HV6A 3GZ6A 2DAOA 3IHUA 1H9TA 4BNCA 1D3YA 4EM0B 4MEYF 3GFJA 2O3FA 2G7UA 4EQQA 2CYYA 3FXRA 3T1BA 3HRMA 4Q48A 1ON2A 3KEOA 3F23A 2ADUA 4KT5C 1HKTA 1D8JA 5L3GA 3TGNA 2A69F 1ZYRF 2VE9A 2V1DA 3V7SA 2RKHA 1HSTA 1KU7A 4Y17A 3HHGA 2KRFA 1ZGAA 2F5EA 2M30A 3VEPA 1MKMA 1C0WA 1X3UA 3ZPLA 1HQCA 1K7AA 1KU9A 2BEOA 1V4RA 4UVCA 3WTWC 2PJPA 5HS7A 3QU6A 5E8GA 3LA3A 5EEGA 5LBQA 1HW2A 1S3JA 4ZYDA 4LLLA 2K86A 1BI2A 1IAWA 1IXSB 2FA5A 1HKQA 1ODDA 4XRFA 1HW5A 2DLLA 1F5TA 1TW3A 2HQNA 1YW8A 1T0FA 4M9ZA 3GO5A 3K0LA 4LD5A 2VC1A 1UHMA 4Q47A 1FBQA 3I59B 1O7FA 2DPUA 3H3ZA 1KYWA 4M6YA 5FFZA 1JE8A 1R1VA 5F64A 3GW2A 1IF1A 1TQPA 2IPQX 1YLFA 2ZKZA 2VONA 4G6QA 5DD8A 2XKPA 1QQIA 3OV8A 2M1BA 2G9WA 5ED4A 1RNLA 2XASA 4BH9A 5E18F 3LAPA 3GLXA 3OOPA 4WF2A 3FF5A 3E5XA 4IHSA 3NQOA 2D1HA 4RGRA 5BPDA 3SQNA 1HSJA 5FB2A 4KMUX 3DP7A 1NHAA 1RUNA 2VT3A 2EA2A 1R7JA 1BOAA 4LLNA 1F1ZA 4O5VA 3T0YA 3ZMVA 3U2RA 1FLIA 3E3VA 4L5JA 5D5XB 2EFPA 4A0XA 1SAXA 1XSVA 5FLXZ 3MAJA 3K69A 1XN7A 4HQMA 2JZYA 3HSEA 3U1DA 4EJTA 4UHTA 5DCMB 1YQAA 3K2ZA 3LQRA 1G3YA 2WC2A 2VOPA 4DQ2A 3E5UA 1TQIA 1K79A 2M45A 2W25A 3WGIA 3JAMZ 3F3XA 2Z33A 5E1XA 2BE5F 3MWMA 1GHCA 4UV9A 3RTRA 1IW7F 4O3MA 1V3FA 1R23A 1U78A 2QQBA 2LKPA 3ISPA 2P5KA 2XHKA 3R4KA 3TOBA 2OQRA 1FYMA 4MGRA 1FNNA 1EH8A 3F8MA 3O2PE 3MCZA 1JXSA 1IUYA 5DUKA 2LF7A 3ML6A 4YFKF 5LHIA 3ERED 3GX4X 1STZA 4M6XA 2F2EA 4P9FA 2RDPA 4OU0A 1P2FA 3JAMK 5LHGA 1BN5A 1BIBA 2K7LA 2ISYA 1OKRA 2P7VB 2YPRA 3CUQA 1RZ4A 2ESNA 3J81K 5LLQA 5CVJA 3CO6C 1SD6A 1DPRA 2EA4A 4L9TA 1IXRC 3TO6A 3CUQB 4R79A 2FF4A 2FMLA 2MD5A 3BZ6A 2XAQA 1Y0UA 1ULYA 3I5UA 5CVUA 1YS7A 4FX4A 3KP5A 4LGWA 1LDDA 1E17A 3R0JA 4OMYA 1L0OC 3QAHA 1GVJA 2A68F 1RUOA 3EDPA 5KVRA 3ZMDA 5JFRA 4LG0A 1MDMA 1W7PD 1W5SA 4WWCA 2V79A 1YS6A 5AONA 1FSHA 2FXAA 1SMTA 4HZFA 4LG0B 2A5YB 1J7KA 2XAFA 2XAHA 3MZYA 4LLGF 5LGUA 2Z3YA 3DXJF 2EB7A 2EJRA 4A5NA 2IT0A 1ZG5A 5HLHA 1EH6A 2A07F 5D4RA 1ZAOA 4M71A 4I09A 2A6HF 5DEQA 4U88A 4IVNA 2HR3A 3LSTA 4I98B 4IPAA 2HS5A 4YIIA 1SD4A 5D8KB 5LHHA 3K9TA 3ECHA 5D5UB 4IRHA 4P9UA 4L9JA 1FBUA 4M74A 4OIPF 3COAC 5DDGA 2E7WA 3CUQC 4ENNA 4ESBA 2OBPA 4AVPA 1OYIA 2DK5A 1H0MA 2UWMA 2AXLA 3I0TA 3V8KA 2JPCA 1FWZA 5HDNA 4UNOA 4LK0F 2ELHA 1B6AA 4KN7X 2HYGD 2DU9A 3GVAA 1TTYA 4OIOF 3L9FA 1TNSA 3L7WA 3HUGA 2UXNA 4EJOA 4HYEA 2CW0F 4HQEA 3TO7A 2OZUA 1LEAA 2ZMEA 5D4SA 2WWYA 1OMIA 1HW1A 5EEHA 2GWRA 2Y0MA 2A3SA 2PMHA 3KLNA 3DQVC 1IN6A 1SFEA 2Y48A 4CICA 1LDJA 3HYIA 2A61A 4L18B 4CZZA 1CF7A 1FT9A 3BP8A 1B9MA 3P9CA 2Q8KA 2VOOA 1WSUA 2PN6A 1OYWA 2KIUA 3IWFA 4R8HA 1T2KA 2DPDA 3KCCA 3RDIA 1T6SA 3V7RA 1Z6TA 1J5YA 2VBYA 5J6XA 4KIBA 2V1UA 2K02A 4XSZF 3TO9A 1T39A 1U6GA 4RGSA 2QM3A 5L3CA 1XB4A 3CJNA 5D5VB 3ZMUA 4Z2YA 3RKYA 4GCVA 1RI7A 3E97A 3C3WA 3ZP5A 4CXFA 5LRRA 4G7ZF 4MTDA 2JT1A 2HDCA 2MA3A 1MDMB 1QBJA 3NEUA 1MJ9A 5D8LB 1SFXA 3TKYA 2KJBA 2E1NA 3KEQA 5E17F 1ZLJA 1HXDA 4L0ZB 2QENA 5TRDA 2EK5A 3FMQA 1U5TA 3ZN1A 2DQRA 5HS8A 4GGGA 1ON1A 1GXQA 1ZG1A 2HKXA 1PUEE 5H6RA 4R1HA 1IRGA 3IC7A 4L0YB 3SZTA 4BAYA 2KKOA 2NNYA 5HOOA 3DPTA 5H20A 1ZRFA 2B0LA 4LK1F 4YFXF 1J2XA 1XSXA
chains in the Genus database with same CATH superfamily
2JRMA 1MMAA 3CQZJ 3QP6A 4NHJA 1FC3A 2L3DA 2ZMEC 3HOSA 3U9GA 4OMZA 3RZDJ 2XKOA 4QWQA 3BTJA 5JI6A 2VN2A 3C7JA 3G4SI 2J5OA 1BR1A 2MG4A 3E6BA 3PSIA 4ZDLA 1WWXA 2NS0A 1J0RA 3HHHA 4XM3A 5FRNA 4BBSJ 1ZARA 2VPLA 4RGUA 2XGCA 2IBDA 4HX7A 1KQ0A 3ZQIA 5L3EA 3LE3A 2ELKA 1ETYA 2DFIA 5JLWA 2NNNA 1JEMA 1Z0XA 1VQ7I 3LA7A 1Z21A 4IHVA 3MMYB 4A6EA 2KZGA 5HLIA 1X1PA 2LFBA 4FCYA 5IOZA 4G6DA 3LNQA 3I53A 4BEHB 1IGNA 4OAZA 3W2VA 1Y8RB 1IRXA 2LNBA 3W6JB 1H89C 1W7PB 4HEA2 3QPTA 4N4OB 5BMZA 1YIOA 2QUFA 3H35A 3K10A 4ZYGA 2DTZA 1JT0A 2H6CA 5GAGJ 1RR7A 3FXLA 2YSRA 1SVLA 1LPQA 2LDUA 2RC4A 4HBLA 4M9XA 4M3EA 5J1UA 1KZHA 2VODA 4U0VA 1X3WB 3QYFA 4L9NA 3CDHA 5BPIA 3BPXA 3EQLF 1JGGA 2E1OA 1Y6IA 2O7OA 1OR7C 2IVMA 5J47A 1U8RA 4IJAA 2MC4A 3GUDA 3DLLF 1AKHA 1I39A 4IEJA 2HVRA 2H09A 4KDPA 2BGCA 1VQKI 4BQQA 4OWRB 2DQLA 1A6QA 3VPRA 1IN8A 1I1SA 4PSXA 5ICFA 2EFOA 1O7LA 5JVTA 2HXOA 1S29A 1QNTA 1LDKB 3BCAA 5TJJA 3SFZA 1I6HJ 2R7XA 3ZN0A 3CCDA 2WBMA 4MFEA 4RB3C 1QZYA 4N9IA 3BDDA 4K2EA 1SD7A 4M3GA 2XROA 2KRCA 5DM7F 1IRFA 3HOTA 3BG5A 1A35A 3RZOJ 3E7LA 2IAIA 2W1OA 2VT2A 2VXZA 2XGXA 3K4MA 4JBAA 3ASNH 4HF0A 2VC0A 1RESA 1KQ8A 4ZZDA 5HLGA 1HOMA 3BJOA 2QYOA 2K9NA 3JRIA 4N0BA 1K1CA 3CD6I 1MU4A 3FXOA 2M5WA 1MGTA 3V8LA 1SMYF 2ZJ2A 3GTOJ 1BM9A 2TCTA 4XK4A 4KIGA 4DBRA 1AWCA 3IRQA 3E6DA 2P4WA 1IDYA 3K4KA 3HGYA 2GM4A 4V2GA 1J59A 1GLNA 1P92A 3GTLJ 2VBZA 3RPUA 3UR3C 1JHFA 3ZQFA 1U5TC 1QRYA 3A02A 4D7MA 3H1CA 5DYMA 3WE2A 1S5LC 2KIQA 2QBYA 2QZ8A 2ZNYA 4DZJA 3W2WA 2R7QA 2RQQA 3QRFF 4PJJA 1N77A 3BQYA 3WU1B 3I4NJ 2HEOA 4NQWA 2NYXA 3N97A 1B8IA 2PJRB 3OS2A 4IXAA 4MNUA 1ACIA 4RB0A 2PMUA 3ZMZA 2B9SA 1E3HA 1E3PA 4ANJA 2VE8A 2YU3A 2RLZA 5D6FA 4PGGA 4IRIA 4BDYA 3C2GA 1ZRDA 4V2FA 4GDFA 3AG4H 2Z9OA 5DM6F 1T38A 1WHUA 3CC4I 3KP6A 2E71A 2O0YA 4DYCA 4IZZA 3RKQA 2VL8A 2Y75A 1W5TA 3JRBA 4RB2C 1I3AA 3FDYA 5BNGA 1USTA 2FMYA 3Q5FA 2HOEA 2DOEA 4UUSB 1P4WA 3GYHX 3M8JA 3F8BA 4A5MA 4HX4A 3KLOA 4MTEA 1YI2I 3WE3A 2IS2A 3A4CA 3LAJA 3C2BA 4U0YA 3H9JA 4IHWA 2O6GE 1MD0A 3F22A 2DA1A 4EVIA 1Z3YA 3QPSA 4II3A 1Z6RA 2R7DA 2TRTA 4KA4A 3PUBA 1LEBA 4F3QA 1ERDA 5IT9K 4P55A 2XB5A 2CSOA 3WTVC 3VFZA 2Q0OA 1DGWY 2L5QA 2GXGA 3T8TA 4AWXB 5T1OA 3QPHA 2Q2EA 4BQAA 2DJIA 3NRVA 1ZREA 1Z9CA 3GTKJ 3F6OA 3VSKA 4QLCU 2LD5A 2IS6A 3WHCA 4DJAA 1ZN2A 4BACA 1XTAA 3B73A 1HC8A 4MEXF 2HOAA 3BR1A 4LB5A 3E1SA 1V55H 4BE0A 3JRCA 5IP9J 5HVQC 4E70A 4P96A 1Y1WJ 1LNWA 5K5RA 1H9GA 4S04A 4C3IJ 2R3SA 1PP8F 5E1ZB 2HPMA 2UXXA 2PLYA 1FU0A 4MQVA 3M07A 2DCEA 3OQOD 4I0AA 1IXCA 1VQ9I 3ASOH 1Y50A 1J6TB 2L7ZA 2BHZA 2P81A 2MW8A 1Y51A 1BBYA 2P5VA 4RA2A 2X4HA 4MHGA 2ZO4A 1LJ9A 4CGZA 3IP4B 4ITVA 2K40A 2EINH 2B7EA 3VSLA 1V5FA 2MLKA 2FBHA 4LB6B 1R58A 2ZNZA 1IG7A 4OIQF 3FM3A 3BC8A 5A2QZ 5L3BA 3K4JA 1JJ6C 2L4AA 3IH4A 4JX6A 2Z16A 1YW9A 1GV5A 3WTXC 2H27A 2M4KA 2HNHA 4ZYAA 1TXEA 3L2WA 4GFBA 4DNCA 2VKEA 3HPHA 3OYMA 2EV0A 1WJFA 1BC8C 5DUIA 1KYZA 1MSFC 4HAMA 2HVSA 1MSEC 4ON0A 1FZPB 4C3JJ 3GTQJ 1OR7A 4UB6C 2D2WA 3I64A 4KUMA 4Z6YA 4TV7A 2XVCA 2ZXHA 1I5ZA 2GIVA 5F1JA 4WXCA 2J5PA 2CUEA 4W97A 1ETOA 1JT6A 2PQ8A 4HRIA 1XGNA 3REOA 4NB5A 2OAZA 4ENJA 3K4NA 1ETKA 1QHHD 1RPWA 4BY1J 4A2UA 2KRHA 3BR3A 3OYAA 2KZVA 3K6GA 5J8CA 2CO5A 3BG9A 1MBFA 3BJAA 4L9VA 4EM1A 3Q9VA 2YX7A 5D6EA 5K7ZA 3CCVI 2NVYJ 1FYLA 2JTVA 3MEXA 2EH3A 4DBQA 5HLTA 4QIWN 4HSTA 2DBBA 1XGOA 1BC7C 1S7OA 4H4KC 3MKLA 4RGXA 4KN4X 2LH9A 4F7ZA 4RAFA 4E7HA 2LBFA 2W82A 1F9NA 2LLKA 2YX4A 1W0UA 2VBWA 2WV0A 3BZCA 1GDTA 4XMYA 2L9NA 3CP2A 4A6DA 2O03A 2JVHA 3GEZA 2ZXJA 2OUMA 3LFKA 4GXOA 3IL2A 2MLGA 5M3FJ 5DCFA 3NWSA 2PMZA 4FHTA 4QTRA 3WTYC 5EG0B 3PSFA 2OCCH 2MABA 5E3MA 1Z05A 3G1OA 4EV0A 2V7FA 1IN4A 1CF7B 4G7OF 1N25A 1R6RA 3G6EI 2GXBA 1MH4A 2IGNA 2BXYA 4DYQA 4JQFA 1YW7A 1A04A 3K1PA 4G7HF 3KZZA 2WY8Q 4C2TA 2VLAA 1FYKA 4YG2F 1HDNA 3G1MA 4RB1A 2KIMA 5GAHJ 4XSXF 3ZXSA 4BXUA 3RJPA 1KGSA 3BY6A 3TMOA 2LKXA 3TW7A 1MO1A 3F0CA 3GFMA 1NK2P 3I3LA 2BBYA 3FBIB 3J80Z 2V1XA 3CMYA 1DUXC 4RM3A 2FQ3A 5F0HA 4J00A 2LTPA 1KQ9A 3WGGA 1ETVA 1P9QC 2VIXA 3R61A 4M73A 4AIDA 4FTHA 2FU4A 3FXJA 3BR6A 3K1NA 4WXHA 1OJLA 3DV8A 3E5QA 3CMMA 5EZGA 2X6YA 2IS4A 1H8AC 5E1WA 3CLQA 4YFNF 2COMA 4BE1A 4YELA 4EM2A 2EZKA 4HDVA 3QP5A 1W4MA 2I10A 2JELP 2RN7A 2B63J 2AXTC 1EV7A 2MH9A 2XAGA 1IRZA 1D8KA 3D0SA 3F9KA 3WTUC 1IV8A 4A3KJ 5L3FA 3L00A 2GXAA 3B02A 4LJZF 2YUSA 5K5QA 3L2QA 5C4XJ 3JRDA 4XLEA 2GZWA 4PFOA 3J7AO 3LSHA 4BQOA 1TT5B 2R4GA 2Y9ZA 5A2QK 3UNGC 1KA5A 3W3CA 1WH7A 2DT5A 5CVVA 1UHSA 3K4LA 2CV1A 2WA0A 1JHHA 1T0FC 4EJUA 5J8FA 5K1YA 1MNEA 1S8NA 3OR2C 1OPCA 2UZKA 4I99C 3OMYA 4CCKA 5E79C 1QZZA 2JPBA 3DEUA 4B8XA 5K7FA 1DP7P 3GBGA 1X4PA 3IKTA 2FNPA 2VJJA 3GLLA 2EIJH 3GTPJ 2HQRA 4FQGA 5FO5A 2GIZA 1P4AA 5CVRA 2ZSHB 3JREA 5EDNA 3BT9A 1XDUA 3KP4A 3MKYB 2F5CA 2R7RA 5F6FA 5B66C 3ZMTA 3RYPA 3GFIA 2E5NA 3LWFA 2F6CA 1GXPA 5FLXK 4RBOA 1QGPA 3PQJA 2QBYB 3DKYA 2N8GA 2YS9A 3CF2A 3H5AA 1PP7U 1X1AA 1VQPI 3VB2A 1ZLKA 4A3BJ 2DT7B 3ZQCA 5HS9A 1D1BA 1FPQA 1D5VA 4BQNA 1FTZA 3S2DJ 1D0XA 3O8HA 2WAQA 2NRAC 1CGPA 2HYJA 2JVGA 2XAJA 1W36D 1KA8A 2I8DA 5IY5H 3DPUA 3RQIA 4BGDA 5KK1A 4HPQA 1NG7A 5LGTA 4OIRF 3L2RA 2WTEA 2NVUB 2BV6A 1BOBA 2IEKA 4ASNA 2H6BA 3IKVA 1X4OA 3G73A 2DK8A 2F4IA 2XUBA 1BW6A 1R5HA 4UUSA 5M3MJ 1ZR4A 2JMWA 1Q1VA 5FKKA 5EEAA 1FIAA 4N4NB 2AS5F 4C9YA 1R1TA 3OYCA 2IGMA 3WG7H 4L5EA 1MBEA 3FMRA 2DFEA 4KMFA 4HF1A 2L9VA 5B5EC 3G71I 5BS6A 1AHDP 1ZKGA 5F0CA 2AK7A 2XV4S 3CJRB 4A3EJ 1SANA 3J81Z 3PFYA 3KZYA 1WGXA 4A0ZA 4ZH4F 2ZJRF 2R0QC 1YYVA 1UAAA 1BI1A 4PUSA 1WJCA 1BL0A 2CUJA 2QVOA 3FX3A 6PAXA 3CJTB 4UVBA 3OYBA 3S1MJ 3F8FA 4P1WA 4C30A 3ERMA 2ECBA 2CW8A 3MQ0A 2COBA 4AC0A 2PG4A 3O8GA 2OD5A 5DS9A 3AG2H 2PX9A 1LKXA 2QQ9A 1X2NA 2M8EA 2JA7J 3FHZA 2FBKA 1Q1HA 3V4GA 3MN2A 1LQ1A 1ONVA 3JRHA 2W84A 1XGSA 9ANTA 3HOXJ 1R5GA 5JR3A 2NOJB 3E6MA 2HQ5A 1W1WE 2FBIA 2QKMB 2STWA 2BY1A 4F93B 3GMEA 1B59A 4CCOA 3VOEA 4AIKA 5H6QA 1WFXA 4WK8F 2E1MB 3GCMA 1XMAA 2K9SA 1IN7A 3K70C 1TQMA 3P9KA 3FM5A 2VKHA 4A3FJ 1X3ZB 3K1MA 4EJVA 1TL8A 1Z77A 1YTYA 2IGKA 1SFOJ 3HSFA 4HV5A 2K9LA 3F6VA 1UZCA 2GA1A 2P6SA 2ZMEB 3BR0A 4RDUA 4FT8A 4CH7A 4HF2A 2RNGA 4O6JA 4A0YA 4EATA 1UHWA 3OYDA 2XC7A 3RI4A 1E2XA 3EZEB 4B47A 3KE2A 4BHCA 2ZJQF 3JSPA 1K4SA 4UVAA 4BEHA 3A0HC 2E2HJ 1QFRA 3M4OJ 3HTUA 3I59A 5B3SH 1P7JA 1NH3A 1R4MB 3LOCA 4XRMA 2JA2A 3D5RC 4MO7A 1VQLI 2M8GX 4QPOA 2WB1A 2X85A 4UB8C 4BUPA 2KJCA 3BR2A 1IN5A 2DT6A 1LB2A 4EGZA 5T17A 5C4JJ 3S3NA 4NDLA 3GF2A 2GOMA 5ILSA 1WQ2A 2FNAA 4G6TB 4JK1X 5FKOA 2RVCA 1MBHA 2Z99A 3M8EA 5F1RA 5ICEA 1N78A 2Z5UA 2DMPA 4KNYA 4AD9A 3H36A 3VODA 1LFPA 1QU3A 3OYGA 5EGOA 2CWEA 1MJAA 2GQQA 3I54A 1FP2A 4CDGA 2LBFB 2IP2A 5DV5A 2VJ5A 3MVPA 2DO7A 2K85A 2M87A 2DDBA 5E20A 4BYYA 1YG2A 5DCMA 4X1EA 2WAFA 4PCQA 3AFHA 2RQPA 3ABTA 1U3EM 1LUJB 4Y52J 3R0AA 2AO9A 1S6LA 1UFMA 1VQNI 3QQAA 4AYBN 2JQ7A 1B9NA 1XG1A 4XLNF 4Y13A 3BPVA 3KP2A 2R7WA 1PUFA 1WJEA 2K5CA 1CM2A 2ZCWA 2LK2A 3L1PA 2CV2A 2LKSA 3HXLA 2CFOA 2H8WA 2LY1A 2R5YB 4BXXJ 2IS1A 2FX0A 3DKWA 4EGYA 3S15J 2LSOA 3M3YJ 4MLOA 3O6BB 4CO8A 5F27A 2X1EA 1MBJA 3FXUA 3OSFA 1R49A 3L2UA 2HI3A 3VWBA 1D1CA 2X1CA 3LSGA 3S14J 3Q0WA 2Z2SB 3DLAA 2DA2A 1WJDA 3OIPA 1P6RA 3J80K 2V1NA 3GWZA 1S7AA 1YJWI 3ABMH 3HGGA 4XLFA 3KYLA 1DU6A 1IO2A 4Y33A 3RPQA 2Y30A 1TLHB 3W6KB 1DP3A 4BBRJ 3D5LA 4ENMA 2QQAA 4H0EA 3HOYJ 3S93A 1O3SA 2LF8A 4HW0A 3R6SA 4XORA 2E34A 1VQOI 1DDNA 2RGVA 3QOPA 4PJMA 1T98A 5J4YA 3OYHA 1WI3A 5LEJA 2XAUA 4PDKA 2WV1A 3G2BA 2GA2A 1D1AA 2JRTA 1UB9A 4BJ5C 4WX9A 3WTZA 3CLOA 2EILH 2HYFA 5FROA 4OINF 2JSCA 2CQKA 3FXQA 3QYBA 3IRRA 1MZBA 1U5TB 2RNJA 3GFLA 4PJLA 2QSHX 1B1BA 2H94A 5ILUA 4AM3A 3DTIA 3LSIA 2DA4A 2TDXA 3EETA 4A3IJ 2Y9YA 3HBLA 1RC9A 4I6ZA 2EFWA 5J3LA 2HTJA 2IXSA 4E7KA 2IW5A 3JTHA 4PGHA 4IX7A 2VQGA 3HRUA 2F4OB 5H2FC 1Y1VJ 2CFXA 4D5FA 3IV5A 3I9V2 3GXOA 5F0FA 3U1KA 4YIFA 2QWWA 2QF7A 3BOQA 4OOIA 4CUGA 4XICA 1BI0A 4D7NA 3S1RJ 4IOCF 3TOAA 2P8TA 4XLPF 3JTGA 5CVIA 2X48A 4ZDOA 2BHYA 2HDWA 2JUCA 4F91B 1BA5A 2A6EF 3SEZA 5C3EJ 1B72B 3KZIC 4NQWB 2DJNA 3PL8A 3TDUC 4ZZLA 5JHUA 3FXKA 3HUGB 2FEZA 2P6TA 3ZQLA 4WXDA 2O5RA 2HU9A 2VPRA 4A93J 3UKGA 3ULQB 1U2WA 2GLOA 2L4MA 4E7JA 3L09A 2VQHA 1G3TA 3V42A 3WG9A 2CGPA 3FMSA 3SXYA 4FX0A 3AL0C 3ABUA 3G3ZA 2RV8A 3MFKA 3ZQ7A 3V7CA 3MKZA 2E7XA 2PI0A 4PK4A 1O57A 1OCPA 1XCVA 1PFHA 1Z91A 2FOKA 2QCOA 2YU9J 2OTLI 3GTGJ 2HWVA 3KEYA 2CMPA 5LEKA 2K4JA 3GZ5A 3CZ6A 3SHFA 3AG3H 2HXIA 1R4NB 3HSRA 1OCTC 2A05A 1SEUA 1RIOH 4X6AJ 3HL2A 1SFUA 3B6CA 1XD7A 1XCBA 1G4DA 3LFGA 2E35A 1WI9A 5IP7J 5CYVA 1GT0C 5KCMA 1G8XA 3T5XA 4ZYEA 2ZJPF 2R7VA 1KU3A 2ID3A 2IA0A 1Z1DA 4BHPA 2M9HA 1YIJI 3CC7I 3LE1A 2L01A 3ZQHA 2QA4I 3D5SC 3KETA 3H9GA 3BJ6A 1O3TA 3H0DA 2K27A 1Z67A 3DKXA 3CP8A 1FSEA 2W00A 2DFHA 3DTEA 2C6YA 5K5OA 3MZHA 4V19K 3ZMSA 5AIPA 4FASD 1JKQC 2GBYA 3QOEA 2X0LA 1YFHA 1RR8C 3ROUA 3WTTC 3H92A 3TP0A 4MQ9F 4X0GA 3AAFA 5JHFA 2E60A 1BI3A 1ETWA 3KX2A 1S72I 1R71A 5IT9Z 1R00A 4JYKA 2ISZA 2NAZA 2O8XA 1K78B 1PTFA 5GAEJ 2BXZA 1KU2A 3EUKL 4ZYHA 2FSWA 1K6OA 1ZQ3P 3F8NA 2PMZN 4HDUA 4RM2A 1WRJA 5IT3A 2Y69H 1XMKA 1IV6A 1MBKA 5E8IA 3JSOA 3LSPA 4IO9F 3VYRB 1BJZA 2AQFA 5GPCA 4ESFA 5FFXA 5IYDJ 4N9HA 2EZIA 3P7NA 1TP4A 3IUOA 3O3KA 3QWLA 3HJEA 2DTRA 1QPMA 4NNJA 3RYRA 3CUOA 1TC3C 1R1UA 5FRMA 1MMGA 4B09A 3KYCB 1FJLA 2W85A 1TWHJ 3VYSB 3FISA 1OFCX 5ICCA 1RRJA 4M72A 3WODF 2V9VA 1TNTA 1MW7A 3QU3A 4CSWA 5D5WB 1K78A 1T08B 2L02A 2BYVE 5FKLA 1I1GA 1R36A 2ETHA 3FWEA 2HGCA 2GAUA 1FBSA 3IAM2 5LRSA 3EUHC 1SVOA 2KDOA 3PQKA 1REPC 2STTA 4PZJA 3EYYA 2OA4A 3F8CA 3HOWJ 3FZVA 4P5OA 3M7GA 1FP1D 3S2WA 3LSRA 3Q0UA 1MMDA 2V6CA 3CCQI 5HNHA 1WPKA 4UUTA 1G59A 2R7SA 2X1DA 2VI6A 3HDDA 1ZVVJ 1EH7A 2JWTA 5J4VA 3B6AA 4DZPA 1AU7A 4RS8A 2D45A 4EEFG 1I6XA 3PO2J 4I7HA 5BQTA 4C3HJ 2G7HA 2ZXIA 4AU7A 1BIAA 4U87A 3PNYA 3JCUC 5IYBJ 3CTAA 1M1EB 2YR2A 1YJ9I 1OCRH 1V54H 3JW4A 4KJZA 2JA6J 1OYYA 1D0ZA 3HOZJ 1O3RA 2K4BA 4A3DJ 1H88C 2OENL 1VFCA 4Q5SF 1WKMA 1PDNC 1QO0D 5HDGA 3GZNB 2R7UA 1Y39A 2MH2A 2DI3A 1ZR2A 2EWNA 3M1EA 4LFUA 2OV7A 4NBQA 3J7ZI 1W7PA 3WU2C 1SD5A 3IHSA 1FOKA 4KIFA 2W24A 2CQNA 1TZLA 1BJAA 4Y15A 4IF4A 2DW4A 2E1CA 1NG6A 4BHBA 2EIKH 3WTSC 3CCYA 4D0PA 4HLYA 2FE3A 5CLSA 3KP3A 2DA6A 3FKJA 2OU2A 4EMSA 4AIJA 2D1VA 2O61A 2ZXWH 3I4PA 3OS0A 3I58A 3S2HJ 3TDZC 4IKFA 1G3WA 2E36A 2BW3A 2NZVL 5TISC 2FRHA 4I02A 2JA5J 1DPUA 3SZPA 4UUVA 4G9YA 2KDZA 2A5WA 5FGMA 1OLTA 4AIHA 1ZGJA 4BE2A 4GO1A 4RAYA 4QPQA 4S05A 4ZTJA 3H9QA 3BG7A 4XN3A 2QQ8A 1JTXA 3DWLE 5FD6A 2HTSA 2KQRA 5K7HA 4JOMA 3N4MA 1JUSA 3HOVJ 5HDKA 4A3GJ 5BOXA 5LGNA 3J7YJ 4G8XA 1VQ6I 1V5EA 2RAEA 2ME0A 1YO5C 2BOLA 2F5FA 2KFDA 2HZTA 3DEWA 2EV5A 1ZH5A 3FK6A 4CHUA 3KP7A 1MIJA 4IQ4A 1JGSA 2DDAA 2CG4A 1TBXA 1Z7LA 2VBXA 4D9JA 2KP6A 4E7IA 1CM3A 4HOBA 3ELKA 1XPXA 4RAZA 3SDGA 2CRGA 2E2IJ 4Q4ZF 1F4KA 2EPFA 2EFQA 4HA8A 2DN0A 2LG4A 2LREA 3WU0A 1XGMA 1AA7A 1XDSA 4QSHA 5ILVA 2FOWA 2XIGA 1YRNA 3DF8A 4GYGA 3S8PA 1HBXG 3OSGA 1LVKA 2QKLB 2IA1A 4BJTA 2BY3A 2LY9A 2ZC2A 4EJWA 1ETXA 3P9IA 4M9SA 1QR5A 5CJ9A 3M8FA 4A12A 5JVGF 2P0WA 1ORKA 3IWZA 1IUFA 3I71A 4HX8A 2KIFA 3RCOA 5IP6A 3H0GJ 4C2MJ 4RAGA 5ERIA 1L3LA 1FX7A 4AYBA 4F55A 5J1RA 4HLXA 1MNDA 1FOXA 3LQQA 2M3AA 2PBIA 4II2A 2HQAA 2PFBA 2BW3B 4XRSA 2CUFA 1XSDA 2OPTA 3OQMD 2ZFUA 2L54A 4KITB 2MGQA 3L2CA 2MC3A 3K70D 3BROA 4RMNA 4I01A 2HIDA 3NAUA 3CJQB 2ZBKA 4OAYA 2CQXA 4YRVA 4KFCA 3CO7C 5GTHC 4ETSA 4I0BA 5L3DA 3Q9SA 2IRFG 1GV2A 2ESHA 4BJ6C 4IHTA 1IC8A 2EV6A 3SZGA 3RIRA 1QHGA 3T8RA 3CDIA 2HKOA 3RPUD 4GRIA 1Y56A 1HKSA 3ABKH 4XNFA 2R7FA 4CCLA 2PEXA 3TQNA 2W57A 3V8JA 4ENKA 2X9DA 3Q3SA 3ZRGA 4IHYA 2M7BA 1DU0A 4E7ZA 1AOYA 3M9AA 2QLZA 4U0WA 2KPMA 1G3SA 4CYDA 3PJRA 2XRNA 4B43A 5J1YA 3DFGA 1YOVB 2L7KA 2Y2ZA 1X19A 1P4XA 3HEFA 3W6VA 3EYIA 1IZ1A 1YITI 3C1DA 5CQEA 1LE8B 4KYWA 2IA2A 4I2OA 1ZRCA 4GYIA 3DPLC 5DD4A 3EUHA 3BWGA 2OZ6A 2F5DA 1SC7A 3VYTB 3S3MA 1VTNC 3HOUJ 3DU6A 2DYSH 4UV8A 2JUGA 3KFWX 1VI0A 3C18A 3PFIA 4HNVA 2NS7A 4UXNA 1G6NA 4HG2A 1TWCJ 4B4CA 2HFHA 4F92B 1USSA 2BZTA 3H3UA 5F04A 1SFKA 4JX5A 1ZGWA 2HDDA 1ZG3A 2CS3A 2ZB9A 4L5IA 1J9IA 1Z7UA 3HRSA 3QODA 2EBIA 1PCHA 1PUFB 3OIQA 1O3QA 4ZTFA 2ZFWA 2ACJA 1JI8A 3HC7A 2R7OA 4ESJA 1N75A 4B48A 3HIFA 1MJBA 3ZQGA 2H1KA 4WCGA 1W36C 1R22A 3ZCOA 3OWTA 3R60A 2MYSA 4LMYA 1FOYA 4LOCA 2R93J 2VKVA 5FD5A 1B8IB 3F72A 5AIQA 5ICGA 3ECOA 1FY7A 4HNTA 3HTSB 2OC6A 4U7DA 3E6CC 2P7CB 4IQJA 2ELJA 5B1AH 3F21A 3RKWA 1I27A 4IOAF 2KL4A 3MKWB 4NC7A 2JA8J 3HKZN 2EFNA 1LVAA 4XWJB 2OQGA 4KICA 3DEEA 3LA2A 4BKXA 2DODA 4G94A 3WGHA 2CUZA 4FE4A 1UCRA 3K7AJ 3BZKA 1QPIA 3EZBB 2MBFA 3FXMA 3U21A 2L7MP 3HRTA 1B72A 2FEPS 2VB6A 4M3DA 2F4MB 1ZTRA 4U7BA 1ZHFA 2P5LC 2IJLA 4RLQA 2DMTA 4IRGA 3RKXA 1TW2A 5E3NA 3CMAI 4XBFA 1J75A 1B4AA 1HLVA 1RKWA 4HV6A 2OCEA 3EZAB 3GZ6A 2DAOA 3IHUA 1H9TA 4BNCA 2M7AA 1SAUA 1D3YA 3RQ4A 4EM0B 4B1RA 3OL4A 4MEYF 3NARA 4XR6A 3CCRI 3GFJA 2O3FA 1P7IA 2G7UA 3JRFA 3OL3A 4EQQA 5IOYA 3FXRA 2CYYA 2BVLA 2K9QA 3T1BA 3HRMA 4Q48A 2XF6A 1ON2A 2W7NA 3CCUI 1MH3A 3KEOA 3F23A 2ADUA 4D1QA 5EF6A 2E19A 1UG0A 2DMNA 4KT5C 1HKTA 2BY0A 2R7TA 1D8JA 5L3GA 3E0JB 4LIVA 3CDLA 3TGNA 5C44J 1WJBA 4YEJA 4Y7NJ 3LFUA 2LRDA 2A69F 2ICWG 2D5VA 1TWGJ 4M6VA 1ZYRF 4BXFA 2VE9A 2V1DA 3V7SA 4B3XA 2RKHA 1YE9A 1HSTA 3N05A 2CQQA 1KU7A 4Y17A 3HHGA 2KRFA 4NC8A 1ZGAA 3A0BC 2F5EA 2FD5A 2M30A 3VEPA 2NVQJ 3KIOA 3LSMA 1MKMA 5M5YJ 1C0WA 1X3UA 1JKOC 3ZPLA 1RETA 2DYRH 1HQCA 1K7AA 1KU9A 1FTTA 2KT0A 5FLVA 2BEOA 3ZOBA 4BL0B 3FK7A 1V4RA 3H5RA 2DFFA 4CCMA 2FJ1A 4UVCA 1S7EA 4HSRA 3WTWC 2R92J 2PJPA 3ZQQA 3JRGA 5HS7A 3QU6A 5E8GA 3LA3A 5EEGA 4CA0A 3SFIA 4MIMA 3OY9A 5EG0A 3JR9A 5LBQA 2QGUA 1HW2A 1S3JA 2L2OA 4ZYDA 4LLLA 2K86A 1BI2A 2OF7A 3BQZA 1MMNA 1IAWA 1IXSB 3A01B 2OTJI 2CQ7A 2FA5A 1HKQA 1ODDA 4XRFA 1VQ4I 2LYCA 1HW5A 3QPLA 2DLLA 3K2AA 1PYVA 1LE8A 1F5TA 1TW3A 2HQNA 1YW8A 1XS9A 1T0FA 2WAEA 4M9ZA 3GO5A 3K0LA 4LD5A 2VC1A 3CCEI 1UHMA 5KNLA 4Q47A 3EPZA 1FBQA 3I59B 1O7FA 4DOZA 2DPUA 3H3ZA 1KYWA 2XGEA 4M6YA 5FFZA 1HCRA 1JE8A 1R1VA 5F64A 3GW2A 3A01A 1IF1A 1TQPA 2IPQX 1YLFA 2ZKZA 2VONA 1BW5A 4G6QA 5DD8A 3DU5A 2V6EA 1GUUA 2XKPA 3OQND 1KKLH 1QQIA 1TT0A 3OV8A 2M1BA 2G9WA 4W1UA 5F08A 3TL4X 5ED4A 4XLCA 3I55I 1DQUA 1RNLA 2XASA 4BH9A 5E18F 3SJMA 1VF9A 3LAPA 3GLXA 3OOPA 2KLOA 4PSWA 2QSGX 5DTDA 2K3PA 2V9KA 3AKZA 4KISA 4XIDA 1FMVA 4UY8I 2L9SA 4WF2A 2NZUL 5EZHA 2KISA 3AG1H 2DOFA 2BVMA 4XL9A 1MBGA 3FF5A 3E5XA 4IHSA 3NQOA 4XKVA 3PIPF 2D1HA 3NWTA 4RGRA 5BPDA 4NC6A 3WHBA 3SQNA 5KAFC 1HSJA 5FB2A 2X6OA 4KMUX 3DP7A 3SEQA 1NHAA 4B44A 3LMMA 2G0EA 3PO3J 1QVUA 4JP0A 2CW7A 3OS1A 1X58A 1RUNA 2VT3A 2EA2A 1R7JA 1BOAA 2IGOA 1HA8A 4LLNA 1F1ZA 3BR5A 3ESWB 4O5VA 4M3BA 3SDBA 3T0YA 2FQ4A 3ZMVA 4PJNA 3U2RA 1FLIA 5JLXA 1WH5A 3E3VA 4L5JA 1T33A 2EFPA 5D5XB 1XMXA 1JKPC 2DXIA 4XLHA 4A0XA 1SAXA 1XSVA 2MFZA 2LR8A 3MAJA 5FLXZ 3K69A 1XN7A 2VJIA 4HQMA 1TWFJ 1DGRM 2JZYA 3OYEA 3HSEA 3U1DA 4EJTA 3LSJA 1U9NA 4UHTA 2EZHA 5DCMB 4BY7J 1YQAA 3K2ZA 3LQRA 3OYKA 1TWAJ 1U9OA 3ABLH 1QVTA 4BS9A 1G3YA 4XKCA 2WC2A 4JX4A 1R9TJ 3FIWA 2VOPA 2UV1A 2L9RA 1KKMH 4LG3A 4DQ2A 3P5JA 3E5UA 3HM5A 2XB0X 1TQIA 4DIQA 1K79A 3PNVA 3OYJA 2M45A 2W25A 1QZEA 2ZSIB 4XKWA 1E0EA 2W4SA 1UELB 5GP9A 3WGIA 1I50J 3JAMZ 3F3XA 2Z33A 5E1XA 3D1NI 2BE5F 3MWMA 1W5CC 1YX3A 1WCMJ 1U0JA 2LRLD 1JUPA 2UUZA 5CKTA 4RLFA 1GHCA 5GPAA 4UV9A 2XGDA 2F48A 3IAS2 3RTRA 1IW7F 2DA3A 4O3MA 2XF5A 2W48A 2QSFX 2OJED 3A03A 1V3FA 1R23A 1U78A 2QQBA 2LKPA 2M34A 3Q0VA 1RZRL 2EZLA 3BTLA 3ISPA 2RREA 1APLC 3LL7A 2P5KA 4CCNA 2XHKA 1UG2A 3R4KA 3TOBA 1A31A 2OQRA 1FYMA 5EGOB 4MGRA 1FNNA 1EH8A 3F8MA 3TEDA 3O2PE 3MCZA 1JXSA 2HVQA 3W2AA 1IUYA 5DUKA 2LF7A 3QYEA 4XKBA 1F43A 5FLMJ 2AQEA 3CESA 3ML6A 4ZDPA 4YFKF 2V4JC 5LHIA 3ERED 3CC2I 1UJ8A 2DA7A 3GX4X 3OIOA 1STZA 1MO1B 3BG6A 2XSJC 4M6XA 2F2EA 2LVSA 4P9FA 3ONQA 3CF5F 5FKMA 2RDPA 4ABZA 3S1QJ 2XPWA 4OU0A 1P2FA 2XDFC 3JAMK 1JJ8C 5LHGA 1BN5A 2NS8A 1BIBA 5E3OA 2K7LA 2ISYA 2VKDA 3K4BA 1OKRA 2P7VB 2CV0A 1FOWA 2YPRA 3PNTA 4S0HB 1WJAA 3CUQA 3PIOF 4A3CJ 1RZ4A 2WB1N 2ESNA 4ZJZA 3J81K 5LLQA 5CVJA 3CO6C 3S16J 1SD6A 3BG3A 3CCMI 1IJWC 1DPRA 4FISA 4XOPA 2EA4A 4L9TA 1IXRC 1OCCH 3TO6A 3CUQB 4R79A 2FF4A 4CYCA 3X2QH 2FMLA 2MD5A 3K4CA 2VQCA 3BZ6A 2XAQA 1T95A 1NTCA 1Y0UA 2FUG2 1ULYA 3I5UA 5CVUA 1GGRB 3CCSI 1YS7A 1EF4A 1PVEA 1MMSA 3OYFA 4A3JJ 1RKTA 2QEXI 2NXNB 4FX4A 1YJNI 3KP5A 4LGWA 4C2UA 4LITA 1LDDA 2JSPA 1YHQI 2H1LA 1E17A 3R0JA 1POHA 2R5YA 4OMYA 1L0OC 3BLYA 3TBIA 3ZGKA 1A5JA 1X1CA 3QAHA 2XSDC 1GVJA 2A68F 5KAIC 3OYLA 1RUOA 1D0YA 1LFBA 4XOTA 2Y0SA 1HDPA 3EDPA 5KVRA 2Q2EB 3ZMDA 1ITYA 5JFRA 4Y4RA 3M1CA 2XRLA 4LG0A 1FIPA 1MDMA 3BCBA 3I56I 1W7PD 2HPIA 4E6KG 1QA6A 1W5SA 4WWCA 2V79A 1YS6A 5AONA 4M3FA 3A2KA 1FSHA 2FXAA 1JKRC 3HB9A 2VASA 1VQ5I 1SMTA 4HZFA 4LG0B 3IH3A 1K6YA 2A5YB 4B3AA 2M0CA 1J7KA 2LP0A 2XAFA 2XAHA 5M5WJ 1AKHB 3EUAA 2ID6A 3MZYA 2R5ZA 4LLGF 5LGUA 3PM1A 3C2HA 2Z3YA 3DXJF 2EB7A 2EJRA 4A5NA 2IT0A 1ZG5A 5HLHA 2X6XA 1EH6A 3TP3A 4YIRX 1BR4A 3DTKA 3GTJJ 2A07F 2CH0A 2X51A 4F52A 2EIMH 5LD2C 5D4RA 2KMUA 1ZAOA 4M71A 4I09A 2A6HF 1YRNB 4J01A 5DEQA 4U88A 5E3LA 4IVNA 3S32A 1WVRA 2HR3A 1WJ5A 2I5UA 2PJRA 1PJRA 1W0TA 2ECCA 3LSTA 3H5NA 1EJ9A 3KYDB 4I98B 4IPAA 2HS5A 4YIIA 1K4TA 1XC5A 3JRAA 1SD4A 5D8KB 5LHHA 3K9TA 3J7AY 5GTIC 3ECHA 5D5UB 4IRHA 1J09A 4P9UA 3PUFA 4L9JA 1FBUA 3DCFA 1ETQA 1D5YA 1KONA 4M74A 2VQLA 4OIPF 3MZ8A 3COAC 4XN0A 2M4GA 5DDGA 2E7WA 2VUMJ 3CUQC 4ENNA 4ESBA 3TW6A 2OBPA 4IL6C 2E2JJ 1YX5A 4AVPA 1OYIA 3FKIJ 2HOSA 2DK5A 1H0MA 2UWMA 2AXLA 3OOUA 5FJ8J 3I0TA 1VZ0A 3V8KA 4XQFA 2JPCA 2K3FA 3HKZA 1FWZA 5HDNA 4ZC3A 1T8IA 2CJJA 5KHDA 5EYRA 1BR2A 4LK0F 4UNOA 4AUXA 2ELHA 3CMEI 1B6AA 2XPVA 1X1DA 2VJ4A 1SVMA 5TGTA 4KN7X 2HYGD 1V5GA 2DU9A 2XDVA 1HDDC 2V26A 1FMWA 3GVAA 1TTYA 4OIOF 1VQMI 3L9FA 1R5ID 1TNSA 3L7WA 5T1NA 1VRCC 3HUGA 2AHQA 2UXNA 4EJOA 1Y8QB 3KPHA 2MSYA 4G12A 3RSNA 1MNMC 2L0KA 2F5VA 3AL0B 1G2HA 4HYEA 3VYUB 2CW0F 1Y0NA 2LMDA 4HQEA 3TO7A 4XLAA 2OZUA 1Z3XA 1LEAA 4DW6A 2ZMEA 4PFPA 1IDZA 1K83J 1OISA 5D4SA 1OQYA 2LC2A 2WWYA 1OMIA 1Y4YA 1HW1A 5EEHA 5CQGA 2GWRA 2Y0MA 2M0MA 2A3SA 2PMHA 3DBLB 3LSKA 3G1LA 3KLNA 5HODA 2Y31A 2VXDA 3DQVC 1IN6A 1SFEA 2Y48A 5HNFA 3S17J 4CICA 1LDJA 3HYIA 1FEXA 2GOXB 3A1YA 3L2VA 3OYIA 2A61A 2XF7A 4L18B 5B1BH 4I76A 1K61A 1T56A 4E4HA 1X2MA 4CZZA 3OYNA 1CF7A 1FT9A 2R7ZJ 3BP8A 1B9MA 3P9CA 2DA5A 2Q8KA 1WSUA 2VOOA 2PN6A 3SYTA 5IYCJ 2JK3A 2CU7A 1VQ8I 1JTYA 4PJ0C 1EKEA 1OCOH 1OYWA 2KIUA 3IWFA 4R8HA 1T2KA 2O9LA 2DOAA 1VNDA 2DPDA 3KCCA 3HG9A 3RDIA 2V9PA 3S3OA 3HZJA 1T6SA 3VDXA 1ZK8A 3V7RA 3BTIA 1OPDA 4FE7A 1Z6TA 3H3VK 3ZR8X 2O8KA 1J5YA 2VBYA 3GTMJ 4J19A 5J6XA 4KIBA 4E7LA 2V1UA 2K02A 1SPHA 4MFDA 5EJCA 4XSZF 2Z1DA 2WADA 3TO9A 4AVZA 4LIUA 1T39A 1U6GA 2KHMA 3CCLI 4RGSA 4CCJA 1OCZH 2BY2A 2QM3A 3LNWA 4A69C 5L3CA 2JN6A 2K9MA 4HNUA 1XB4A 4CYCB 3CJNA 2MD0A 5D5VB 3ZMUA 4Z2YA 2LY2A 4FETA 3RKYA 4DYRA 3LE5A 1S9HA 4GCVA 2Q1ZB 1GVDA 5M5XJ 2HOTA 1RI7A 3E97A 2HZDA 3C3WA 3ZP5A 1A36A 4CXFA 4NUBA 1O4XA 5LRRA 3HPGA 4A3LJ 4G7ZF 4MTDA 2M2EA 1ENHA 2JT1A 2HDCA 2MA3A 1JUMA 4KT6A 2E1MC 2LRKD 3IH2A 3OR1C 1MDMB 2NVTJ 3NEUA 1QBJA 1MJ9A 4DGWB 4BDZA 4A3MJ 1A6IA 5D8LB 1SFXA 1EA3A 1NK3P 4XONA 3TKYA 2KJBA 5LFAA 2ME6A 2E1NA 2L7FP 2DMQA 3KEQA 2LOOA 2E5ZA 4BU2A 1CQTA 1E3OC 2H8RA 5E17F 1ZLJA 3DBRB 1HXDA 5IPAA 1X1BA 4L0ZB 2QENA 4Y3OA 3DBHB 5TRDA 2EK5A 1ZELA 3BTCA 1I3QJ 2DMUA 2X6WA 3FMQA 4IHXA 2WAQN 1U5TA 3I4MJ 1POGA 3ZN1A 2DQRA 5HS8A 4GGGA 1ON1A 4D5CA 1GXQA 1ZG1A 2HKXA 1PUEE 3FHNA 5H6RA 4R1HA 1F36A 1IRGA 2NVXJ 5FKNA 2XPUA 3MD2A 2R5ZB 3IC7A 4L0YB 4E7SA 3SZTA 5J40A 1XX5A 1UMQA 3FBNB 1LFUP 3S1NJ 2A6TA 4BAYA 1WZ2A 2JJ7A 1U8BA 2HPRA 2KKOA 5GADJ 2EQRA 2NNYA 5HOOA 3DPTA 5H20A 4XRSG 3CCJI 4CZCA 1ZRFA 2NOGA 1HF0A 2B0LA 4LK1F 4YFXF 1J2XA 5CPRB 1XSXA 2Y0SN 2WY7Q
chains in the Genus database with same CATH topology
3QP6A 4NHJA 1FC3A 2L3DA 3HOSA 3U9GA 4OMZA 2XKOA 4QWQA 5JI6A 2VN2A 3C7JA 2J5OA 3E6BA 1WWXA 2NS0A 1J0RA 3HHHA 1ZARA 4RGUA 4HX7A 1KQ0A 5L3EA 2DFIA 2NNNA 3LA7A 4A6EA 5HLIA 4G6DA 3I53A 2LNBA 3W6JB 1W7PB 3QPTA 5BMZA 1YIOA 2QUFA 4ZYGA 2H6CA 2YSRA 2LDUA 2RC4A 4HBLA 4M9XA 2VODA 4U0VA 4L9NA 3CDHA 5BPIA 3BPXA 3EQLF 2IVMA 1U8RA 4IJAA 3GUDA 4KDPA 2H09A 2BGCA 2DQLA 1IN8A 1I1SA 5ICFA 2EFOA 1O7LA 5JVTA 1S29A 1QNTA 1LDKB 5TJJA 3SFZA 3ZN0A 4RB3C 1QZYA 4N9IA 3BDDA 4K2EA 1SD7A 2XROA 1IRFA 3HOTA 2XGXA 2VT2A 2VXZA 4JBAA 4HF0A 2VC0A 1KQ8A 4ZZDA 5HLGA 3BJOA 2QYOA 4N0BA 2M5WA 1MGTA 3V8LA 1SMYF 2ZJ2A 1BM9A 4KIGA 1AWCA 3IRQA 3E6DA 2P4WA 1J59A 1P92A 2VBZA 3RPUA 1JHFA 1U5TC 5DYMA 3WE2A 2QBYA 2QZ8A 2ZNYA 3QRFF 3WU1B 2HEOA 4NQWA 2NYXA 3N97A 4IXAA 4MNUA 4RB0A 2PMUA 3ZMZA 2VE8A 2YU3A 5D6FA 4PGGA 4IRIA 1ZRDA 2Z9OA 1T38A 3KP6A 2O0YA 2Y75A 1W5TA 4RB2C 1USTA 2FMYA 3Q5FA 2HOEA 1P4WA 3GYHX 3F8BA 4A5MA 4HX4A 3KLOA 4MTEA 3WE3A 3LAJA 4U0YA 2O6GE 1MD0A 3F22A 4EVIA 1Z6RA 2R7DA 4KA4A 1LEBA 5IT9K 4P55A 3WTVC 2CSOA 3VFZA 2Q0OA 2GXGA 3T8TA 4AWXB 3QPHA 2Q2EA 4BQAA 3NRVA 1ZREA 1Z9CA 3F6OA 4QLCU 1ZN2A 3B73A 4MEXF 4LB5A 5HVQC 4E70A 4P96A 1LNWA 5K5RA 1H9GA 4S04A 2R3SA 1PP8F 2PLYA 5E1ZB 2UXXA 4MQVA 4I0AA 1IXCA 1BBYA 2P5VA 2X4HA 4MHGA 2ZO4A 1LJ9A 4CGZA 2MLKA 2FBHA 4LB6B 1R58A 2ZNZA 4OIQF 3FM3A 5A2QZ 5L3BA 2L4AA 1YW9A 3WTXC 2H27A 4DNCA 2EV0A 1BC8C 5DUIA 1KYZA 4HAMA 4ON0A 1FZPB 1OR7A 2D2WA 3I64A 4KUMA 4TV7A 2XVCA 1I5ZA 2GIVA 4WXCA 2J5PA 2PQ8A 1XGNA 3REOA 4NB5A 4ENJA 2OAZA 4A2UA 5J8CA 2CO5A 3BJAA 4L9VA 4EM1A 3Q9VA 2YX7A 5D6EA 1FYLA 2JTVA 3MEXA 2DBBA 1XGOA 1BC7C 1S7OA 4RGXA 4KN4X 4F7ZA 1F9NA 2YX4A 2VBWA 2WV0A 4A6DA 2O03A 3GEZA 2ZXJA 3IL2A 3LFKA 4GXOA 2MLGA 5DCFA 4FHTA 3WTYC 1Z05A 4EV0A 1CF7B 4G7OF 1IN4A 2GXBA 4JQFA 1YW7A 1A04A 3K1PA 4G7HF 3KZZA 1FYKA 4YG2F 4RB1A 2KIMA 4XSXF 4BXUA 3RJPA 1KGSA 3BY6A 3GFMA 2BBYA 3J80Z 2V1XA 1DUXC 2FQ3A 1KQ9A 3WGGA 3R61A 4M73A 2FU4A 3K1NA 4WXHA 3DV8A 3E5QA 5E1WA 4YFNF 2COMA 4EM2A 4HDVA 3QP5A 1W4MA 2RN7A 1EV7A 2MH9A 2XAGA 1D8KA 3D0SA 3WTUC 5L3FA 3L00A 3B02A 4LJZF 5K5QA 2GZWA 3J7AO 5A2QK 2DT5A 5CVVA 1JHHA 4EJUA 5J8FA 5K1YA 1S8NA 1OPCA 2UZKA 1QZZA 2JPBA 3DEUA 4B8XA 1DP7P 3IKTA 2FNPA 2HQRA 5FO5A 1P4AA 5CVRA 1XDUA 3KP4A 2F5CA 5F6FA 3GFIA 3ZMTA 3RYPA 3LWFA 5FLXK 1GXPA 1QGPA 3PQJA 2QBYB 1PP7U 3VB2A 1ZLKA 5HS9A 1FPQA 1D5VA 2NRAC 1CGPA 2XAJA 1KA8A 5KK1A 5LGTA 4OIRF 2WTEA 2BV6A 4ASNA 2H6BA 3IKVA 3G73A 2DK8A 2XUBA 1R5HA 2AS5F 1R1TA 3FMRA 4KMFA 4HF1A 5BS6A 2XV4S 3J81Z 3KZYA 4A0ZA 4ZH4F 1YYVA 1BI1A 2QVOA 3FX3A 6PAXA 4UVBA 3F8FA 3MQ0A 2PG4A 2OD5A 2QQ9A 2M8EA 3FHZA 2FBKA 1Q1HA 3V4GA 1LQ1A 1ONVA 2W84A 1XGSA 1R5GA 5JR3A 3E6MA 2FBIA 2STWA 1B59A 4AIKA 3VOEA 5H6QA 4WK8F 1XMAA 1IN7A 1TQMA 3P9KA 3FM5A 3K1MA 4EJVA 1YTYA 3HSFA 4HV5A 3F6VA 2GA1A 2P6SA 2ZMEB 4FT8A 4HF2A 4O6JA 4A0YA 1UHWA 3RI4A 1E2XA 3KE2A 4BHCA 3JSPA 4UVAA 3HTUA 3I59A 2KJCA 1IN5A 1LB2A 4EGZA 3GF2A 5ILSA 2FNAA 1WQ2A 4JK1X 2RVCA 2Z99A 3M8EA 5F1RA 5ICEA 2Z5UA 4KNYA 4AD9A 3VODA 2CWEA 1MJAA 2GQQA 3I54A 1FP2A 4CDGA 2IP2A 5DV5A 2DO7A 2M87A 5E20A 4BYYA 1YG2A 5DCMA 4PCQA 2RQPA 3ABTA 1U3EM 3R0AA 1S6LA 1UFMA 1B9NA 4XLNF 4Y13A 3BPVA 3KP2A 2ZCWA 3DKWA 4EGYA 2LSOA 3O6BB 4CO8A 3FXUA 1P6RA 3J80K 3GWZA 1S7AA 3RPQA 1TLHB 3W6KB 3D5LA 4ENMA 2QQAA 4H0EA 1O3SA 2LF8A 4HW0A 3R6SA 1DDNA 2RGVA 3QOPA 1T98A 5LEJA 4PDKA 2GA2A 2JRTA 1UB9A 4WX9A 3WTZA 3CLOA 2HYFA 4OINF 2JSCA 2CQKA 3FXQA 3IRRA 1MZBA 1U5TB 2RNJA 3GFLA 1B1BA 2H94A 5ILUA 2TDXA 3EETA 2EFWA 2HTJA 2IW5A 3JTHA 4PGHA 3HRUA 2CFXA 3GXOA 4YIFA 2QWWA 3BOQA 4OOIA 1BI0A 3TOAA 2P8TA 4XLPF 3JTGA 5CVIA 2A6EF 3TDUC 4ZZLA 5JHUA 2FEZA 2P6TA 4WXDA 3ULQB 1U2WA 2L4MA 3WG9A 3L09A 1G3TA 2CGPA 3FMSA 3SXYA 4FX0A 3ABUA 3G3ZA 2RV8A 3MFKA 3ZQ7A 3V7CA 2E7XA 2PI0A 1O57A 1XCVA 1Z91A 2FOKA 2HWVA 5LEKA 2K4JA 3GZ5A 3SHFA 3HSRA 1RIOH 1SFUA 1XD7A 1XCBA 1G4DA 1WI9A 5CYVA 3T5XA 4ZYEA 1KU3A 2IA0A 1Z1DA 4BHPA 2L01A 3KETA 3BJ6A 1O3TA 2K27A 1FSEA 2C6YA 5K5OA 3MZHA 3ZMSA 5AIPA 2X0LA 1YFHA 3ROUA 3WTTC 3H92A 4MQ9F 3AAFA 1BI3A 5IT9Z 1R00A 2ISZA 2NAZA 2O8XA 1K78B 1KU2A 4ZYHA 2FSWA 1K6OA 3F8NA 4HDUA 1WRJA 5IT3A 1XMKA 3JSOA 5E8IA 4ESFA 5FFXA 4N9HA 3P7NA 3O3KA 2DTRA 1QPMA 3RYRA 3CUOA 1R1UA 4B09A 2W85A 5ICCA 4M72A 3WODF 2V9VA 1TNTA 3QU3A 5D5WB 1K78A 2L02A 2BYVE 1I1GA 1R36A 2ETHA 3FWEA 2HGCA 2GAUA 1FBSA 5LRSA 3PQKA 1REPC 2STTA 4PZJA 3EYYA 2OA4A 3F8CA 3FZVA 4P5OA 3M7GA 1FP1D 3S2WA 2V6CA 1EH7A 4RS8A 2D45A 1I6XA 4I7HA 5BQTA 2G7HA 1BIAA 3CTAA 2YR2A 3JW4A 1OYYA 1O3RA 2K4BA 4Q5SF 1WKMA 1PDNC 1QO0D 5HDGA 2MH2A 2DI3A 2EWNA 3M1EA 4LFUA 1W7PA 1SD5A 1FOKA 4KIFA 2W24A 4Y15A 1BJAA 4IF4A 2DW4A 2E1CA 4BHBA 3WTSC 4D0PA 4HLYA 2FE3A 5CLSA 3KP3A 2OU2A 4EMSA 4AIJA 2D1VA 2O61A 3I4PA 3I58A 3TDZC 1G3WA 2FRHA 4I02A 1DPUA 3SZPA 4UUVA 4G9YA 5FGMA 4AIHA 1ZGJA 4GO1A 4RAYA 4S05A 5FD6A 2HTSA 3N4MA 5HDKA 5BOXA 5LGNA 4G8XA 1YO5C 2F5FA 2HZTA 2EV5A 1ZH5A 4CHUA 3KP7A 1JGSA 2CG4A 1TBXA 2VBXA 4HOBA 3ELKA 4RAZA 4Q4ZF 1F4KA 2EFQA 4HA8A 3WU0A 1XGMA 1XDSA 5ILVA 2XIGA 3DF8A 4GYGA 1HBXG 2IA1A 4EJWA 3P9IA 4M9SA 5CJ9A 3M8FA 4A12A 3IWZA 3I71A 4HX8A 2KIFA 1L3LA 5ERIA 1FX7A 4HLXA 3LQQA 2PBIA 2PFBA 1XSDA 2L54A 3L2CA 2MC3A 3BROA 4I01A 2ZBKA 4KFCA 3CO7C 4ETSA 4I0BA 5L3DA 3Q9SA 2IRFG 2ESHA 4IHTA 2EV6A 3RIRA 3T8RA 2HKOA 1HKSA 2R7FA 2PEXA 3TQNA 2W57A 3V8JA 4ENKA 1AOYA 3M9AA 2QLZA 4U0WA 1G3SA 4CYDA 2XRNA 3DFGA 1P4XA 3EYIA 1IZ1A 3C1DA 4KYWA 2IA2A 4I2OA 1ZRCA 4GYIA 3DPLC 5DD4A 3EUHA 3BWGA 2OZ6A 2F5DA 1VTNC 4UV8A 3KFWX 3C18A 3PFIA 4UXNA 1G6NA 2HFHA 1USSA 3H3UA 1ZG3A 4L5IA 1J9IA 1Z7UA 3HRSA 1O3QA 2ZFWA 2ACJA 4ESJA 3HIFA 1MJBA 4WCGA 1R22A 3R60A 4LMYA 5FD5A 3F72A 5AIQA 5ICGA 3ECOA 1FY7A 3HTSB 4U7DA 3E6CC 2P7CB 3F21A 3RKWA 1I27A 2EFNA 1LVAA 2OQGA 4KICA 3LA2A 4G94A 3WGHA 1UCRA 2MBFA 3HRTA 4U7BA 1ZHFA 2P5LC 2IJLA 4IRGA 3RKXA 1TW2A 4XBFA 1J75A 1B4AA 4HV6A 3GZ6A 2DAOA 3IHUA 1H9TA 4BNCA 1D3YA 4EM0B 4MEYF 3GFJA 2O3FA 2G7UA 4EQQA 2CYYA 3FXRA 3T1BA 3HRMA 4Q48A 1ON2A 3KEOA 3F23A 2ADUA 4KT5C 1HKTA 1D8JA 5L3GA 3TGNA 2A69F 1ZYRF 2VE9A 2V1DA 3V7SA 2RKHA 1HSTA 1KU7A 4Y17A 3HHGA 2KRFA 1ZGAA 2F5EA 2M30A 3VEPA 1MKMA 1C0WA 1X3UA 3ZPLA 1HQCA 1K7AA 1KU9A 2BEOA 1V4RA 4UVCA 3WTWC 2PJPA 5HS7A 3QU6A 5E8GA 3LA3A 5EEGA 5LBQA 1HW2A 1S3JA 4ZYDA 4LLLA 2K86A 1BI2A 1IAWA 1IXSB 2FA5A 1HKQA 1ODDA 4XRFA 1HW5A 2DLLA 1F5TA 1TW3A 2HQNA 1YW8A 1T0FA 4M9ZA 3GO5A 3K0LA 4LD5A 2VC1A 1UHMA 4Q47A 1FBQA 3I59B 1O7FA 2DPUA 3H3ZA 1KYWA 4M6YA 5FFZA 1JE8A 1R1VA 5F64A 3GW2A 1IF1A 1TQPA 2IPQX 1YLFA 2ZKZA 2VONA 4G6QA 5DD8A 2XKPA 1QQIA 3OV8A 2M1BA 2G9WA 5ED4A 1RNLA 2XASA 4BH9A 5E18F 3LAPA 3GLXA 3OOPA 4WF2A 3FF5A 3E5XA 4IHSA 3NQOA 2D1HA 4RGRA 5BPDA 3SQNA 1HSJA 5FB2A 4KMUX 3DP7A 1NHAA 1RUNA 2VT3A 2EA2A 1R7JA 1BOAA 4LLNA 1F1ZA 4O5VA 3T0YA 3ZMVA 3U2RA 1FLIA 3E3VA 4L5JA 5D5XB 2EFPA 4A0XA 1SAXA 1XSVA 5FLXZ 3MAJA 3K69A 1XN7A 4HQMA 2JZYA 3HSEA 3U1DA 4EJTA 4UHTA 5DCMB 1YQAA 3K2ZA 3LQRA 1G3YA 2WC2A 2VOPA 4DQ2A 3E5UA 1TQIA 1K79A 2M45A 2W25A 3WGIA 3JAMZ 3F3XA 2Z33A 5E1XA 2BE5F 3MWMA 1GHCA 4UV9A 3RTRA 1IW7F 4O3MA 1V3FA 1R23A 1U78A 2QQBA 2LKPA 3ISPA 2P5KA 2XHKA 3R4KA 3TOBA 2OQRA 1FYMA 4MGRA 1FNNA 1EH8A 3F8MA 3O2PE 3MCZA 1JXSA 1IUYA 5DUKA 2LF7A 3ML6A 4YFKF 5LHIA 3ERED 3GX4X 1STZA 4M6XA 2F2EA 4P9FA 2RDPA 4OU0A 1P2FA 3JAMK 5LHGA 1BN5A 1BIBA 2K7LA 2ISYA 1OKRA 2P7VB 2YPRA 3CUQA 1RZ4A 2ESNA 3J81K 5LLQA 5CVJA 3CO6C 1SD6A 1DPRA 2EA4A 4L9TA 1IXRC 3TO6A 3CUQB 4R79A 2FF4A 2FMLA 2MD5A 3BZ6A 2XAQA 1Y0UA 1ULYA 3I5UA 5CVUA 1YS7A 4FX4A 3KP5A 4LGWA 1LDDA 1E17A 3R0JA 4OMYA 1L0OC 3QAHA 1GVJA 2A68F 1RUOA 3EDPA 5KVRA 3ZMDA 5JFRA 4LG0A 1MDMA 1W7PD 1W5SA 4WWCA 2V79A 1YS6A 5AONA 1FSHA 2FXAA 1SMTA 4HZFA 4LG0B 2A5YB 1J7KA 2XAFA 2XAHA 3MZYA 4LLGF 5LGUA 2Z3YA 3DXJF 2EB7A 2EJRA 4A5NA 2IT0A 1ZG5A 5HLHA 1EH6A 2A07F 5D4RA 1ZAOA 4M71A 4I09A 2A6HF 5DEQA 4U88A 4IVNA 2HR3A 3LSTA 4I98B 4IPAA 2HS5A 4YIIA 1SD4A 5D8KB 5LHHA 3K9TA 3ECHA 5D5UB 4IRHA 4P9UA 4L9JA 1FBUA 4M74A 4OIPF 3COAC 5DDGA 2E7WA 3CUQC 4ENNA 4ESBA 2OBPA 4AVPA 1OYIA 2DK5A 1H0MA 2UWMA 2AXLA 3I0TA 3V8KA 2JPCA 1FWZA 5HDNA 4UNOA 4LK0F 2ELHA 1B6AA 4KN7X 2HYGD 2DU9A 3GVAA 1TTYA 4OIOF 3L9FA 1TNSA 3L7WA 3HUGA 2UXNA 4EJOA 4HYEA 2CW0F 4HQEA 3TO7A 2OZUA 1LEAA 2ZMEA 5D4SA 2WWYA 1OMIA 1HW1A 5EEHA 2GWRA 2Y0MA 2A3SA 2PMHA 3KLNA 3DQVC 1IN6A 1SFEA 2Y48A 4CICA 1LDJA 3HYIA 2A61A 4L18B 4CZZA 1CF7A 1FT9A 3BP8A 1B9MA 3P9CA 2Q8KA 2VOOA 1WSUA 2PN6A 1OYWA 2KIUA 3IWFA 4R8HA 1T2KA 2DPDA 3KCCA 3RDIA 1T6SA 3V7RA 1Z6TA 1J5YA 2VBYA 5J6XA 4KIBA 2V1UA 2K02A 4XSZF 3TO9A 1T39A 1U6GA 4RGSA 2QM3A 5L3CA 1XB4A 3CJNA 5D5VB 3ZMUA 4Z2YA 3RKYA 4GCVA 1RI7A 3E97A 3C3WA 3ZP5A 4CXFA 5LRRA 4G7ZF 4MTDA 2JT1A 2HDCA 2MA3A 1MDMB 1QBJA 3NEUA 1MJ9A 5D8LB 1SFXA 3TKYA 2KJBA 2E1NA 3KEQA 5E17F 1ZLJA 1HXDA 4L0ZB 2QENA 5TRDA 2EK5A 3FMQA 1U5TA 3ZN1A 2DQRA 5HS8A 4GGGA 1ON1A 1GXQA 1ZG1A 2HKXA 1PUEE 5H6RA 4R1HA 1IRGA 3IC7A 4L0YB 3SZTA 4BAYA 2KKOA 2NNYA 5HOOA 3DPTA 5H20A 1ZRFA 2B0LA 4LK1F 4YFXF 1J2XA 1XSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QP6 A;  4NHJ A;  1FC3 A;  2L3D A;  3HOS A;  3U9G A;  4OMZ A;  2XKO A;  4QWQ A;  5JI6 A;  2VN2 A;  3C7J A;  2J5O A;  3E6B A;  1WWX A;  2NS0 A;  1J0R A;  3HHH A;  1ZAR A;  4RGU A;  4HX7 A;  1KQ0 A;  5L3E A;  2DFI A;  2NNN A;  3LA7 A;  4A6E A;  5HLI A;  4G6D A;  3I53 A;  2LNB A;  3W6J B;  1W7P B;  3QPT A;  5BMZ A;  1YIO A;  2QUF A;  4ZYG A;  2H6C A;  2YSR A;  2LDU A;  2RC4 A;  4HBL A;  4M9X A;  2VOD A;  4U0V A;  4L9N A;  3CDH A;  5BPI A;  3BPX A;  3EQL F;  2IVM A;  1U8R A;  4IJA A;  3GUD A;  4KDP A;  2H09 A;  2BGC A;  2DQL A;  1IN8 A;  1I1S A;  5ICF A;  2EFO A;  1O7L A;  5JVT A;  1S29 A;  1QNT A;  1LDK B;  5TJJ A;  3SFZ A;  3ZN0 A;  4RB3 C;  1QZY A;  4N9I A;  3BDD A;  4K2E A;  1SD7 A;  2XRO A;  1IRF A;  3HOT A;  2XGX A;  2VT2 A;  2VXZ A;  4JBA A;  4HF0 A;  2VC0 A;  1KQ8 A;  4ZZD A;  5HLG A;  3BJO A;  2QYO A;  4N0B A;  2M5W A;  1MGT A;  3V8L A;  1SMY F;  2ZJ2 A;  1BM9 A;  4KIG A;  1AWC A;  3IRQ A;  3E6D A;  2P4W A;  1J59 A;  1P92 A;  2VBZ A;  3RPU A;  1JHF A;  1U5T C;  5DYM A;  3WE2 A;  2QBY A;  2QZ8 A;  2ZNY A;  3QRF F;  3WU1 B;  2HEO A;  4NQW A;  2NYX A;  3N97 A;  4IXA A;  4MNU A;  4RB0 A;  2PMU A;  3ZMZ A;  2VE8 A;  2YU3 A;  5D6F A;  4PGG A;  4IRI A;  1ZRD A;  2Z9O A;  1T38 A;  3KP6 A;  2O0Y A;  2Y75 A;  1W5T A;  4RB2 C;  1UST A;  2FMY A;  3Q5F A;  2HOE A;  1P4W A;  3GYH X;  3F8B A;  4A5M A;  4HX4 A;  3KLO A;  4MTE A;  3WE3 A;  3LAJ A;  4U0Y A;  2O6G E;  1MD0 A;  3F22 A;  4EVI A;  1Z6R A;  2R7D A;  4KA4 A;  1LEB A;  5IT9 K;  4P55 A;  3WTV C;  2CSO A;  3VFZ A;  2Q0O A;  2GXG A;  3T8T A;  4AWX B;  3QPH A;  2Q2E A;  4BQA A;  3NRV A;  1ZRE A;  1Z9C A;  3F6O A;  4QLC U;  1ZN2 A;  3B73 A;  4MEX F;  4LB5 A;  5HVQ C;  4E70 A;  4P96 A;  1LNW A;  5K5R A;  1H9G A;  4S04 A;  2R3S A;  1PP8 F;  2PLY A;  5E1Z B;  2UXX A;  4MQV A;  4I0A A;  1IXC A;  1BBY A;  2P5V A;  2X4H A;  4MHG A;  2ZO4 A;  1LJ9 A;  4CGZ A;  2MLK A;  2FBH A;  4LB6 B;  1R58 A;  2ZNZ A;  4OIQ F;  3FM3 A;  5A2Q Z;  5L3B A;  2L4A A;  1YW9 A;  3WTX C;  2H27 A;  4DNC A;  2EV0 A;  1BC8 C;  5DUI A;  1KYZ A;  4HAM A;  4ON0 A;  1FZP B;  1OR7 A;  2D2W A;  3I64 A;  4KUM A;  4TV7 A;  2XVC A;  1I5Z A;  2GIV A;  4WXC A;  2J5P A;  2PQ8 A;  1XGN A;  3REO A;  4NB5 A;  4ENJ A;  2OAZ A;  4A2U A;  5J8C A;  2CO5 A;  3BJA A;  4L9V A;  4EM1 A;  3Q9V A;  2YX7 A;  5D6E A;  1FYL A;  2JTV A;  3MEX A;  2DBB A;  1XGO A;  1BC7 C;  1S7O A;  4RGX A;  4KN4 X;  4F7Z A;  1F9N A;  2YX4 A;  2VBW A;  2WV0 A;  4A6D A;  2O03 A;  3GEZ A;  2ZXJ A;  3IL2 A;  3LFK A;  4GXO A;  2MLG A;  5DCF A;  4FHT A;  3WTY C;  1Z05 A;  4EV0 A;  1CF7 B;  4G7O F;  1IN4 A;  2GXB A;  4JQF A;  1YW7 A;  1A04 A;  3K1P A;  4G7H F;  3KZZ A;  1FYK A;  4YG2 F;  4RB1 A;  2KIM A;  4XSX F;  4BXU A;  3RJP A;  1KGS A;  3BY6 A;  3GFM A;  2BBY A;  3J80 Z;  2V1X A;  1DUX C;  2FQ3 A;  1KQ9 A;  3WGG A;  3R61 A;  4M73 A;  2FU4 A;  3K1N A;  4WXH A;  3DV8 A;  3E5Q A;  5E1W A;  4YFN F;  2COM A;  4EM2 A;  4HDV A;  3QP5 A;  1W4M A;  2RN7 A;  1EV7 A;  2MH9 A;  2XAG A;  1D8K A;  3D0S A;  3WTU C;  5L3F A;  3L00 A;  3B02 A;  4LJZ F;  5K5Q A;  2GZW A;  3J7A O;  5A2Q K;  2DT5 A;  5CVV A;  1JHH A;  4EJU A;  5J8F A;  5K1Y A;  1S8N A;  1OPC A;  2UZK A;  1QZZ A;  2JPB A;  3DEU A;  4B8X A;  1DP7 P;  3IKT A;  2FNP A;  2HQR A;  5FO5 A;  1P4A A;  5CVR A;  1XDU A;  3KP4 A;  2F5C A;  5F6F A;  3GFI A;  3ZMT A;  3RYP A;  3LWF A;  5FLX K;  1GXP A;  1QGP A;  3PQJ A;  2QBY B;  1PP7 U;  3VB2 A;  1ZLK A;  5HS9 A;  1FPQ A;  1D5V A;  2NRA C;  1CGP A;  2XAJ A;  1KA8 A;  5KK1 A;  5LGT A;  4OIR F;  2WTE A;  2BV6 A;  4ASN A;  2H6B A;  3IKV A;  3G73 A;  2DK8 A;  2XUB A;  1R5H A;  2AS5 F;  1R1T A;  3FMR A;  4KMF A;  4HF1 A;  5BS6 A;  2XV4 S;  3J81 Z;  3KZY A;  4A0Z A;  4ZH4 F;  1YYV A;  1BI1 A;  2QVO A;  3FX3 A;  6PAX A;  4UVB A;  3F8F A;  3MQ0 A;  2PG4 A;  2OD5 A;  2QQ9 A;  2M8E A;  3FHZ A;  2FBK A;  1Q1H A;  3V4G A;  1LQ1 A;  1ONV A;  2W84 A;  1XGS A;  1R5G A;  5JR3 A;  3E6M A;  2FBI A;  2STW A;  1B59 A;  4AIK A;  3VOE A;  5H6Q A;  4WK8 F;  1XMA A;  1IN7 A;  1TQM A;  3P9K A;  3FM5 A;  3K1M A;  4EJV A;  1YTY A;  3HSF A;  4HV5 A;  3F6V A;  2GA1 A;  2P6S A;  2ZME B;  4FT8 A;  4HF2 A;  4O6J A;  4A0Y A;  1UHW A;  3RI4 A;  1E2X A;  3KE2 A;  4BHC A;  3JSP A;  4UVA A;  3HTU A;  3I59 A;  2KJC A;  1IN5 A;  1LB2 A;  4EGZ A;  3GF2 A;  5ILS A;  2FNA A;  1WQ2 A;  4JK1 X;  2RVC A;  2Z99 A;  3M8E A;  5F1R A;  5ICE A;  2Z5U A;  4KNY A;  4AD9 A;  3VOD A;  2CWE A;  1MJA A;  2GQQ A;  3I54 A;  1FP2 A;  4CDG A;  2IP2 A;  5DV5 A;  2DO7 A;  2M87 A;  5E20 A;  4BYY A;  1YG2 A;  5DCM A;  4PCQ A;  2RQP A;  3ABT A;  1U3E M;  3R0A A;  1S6L A;  1UFM A;  1B9N A;  4XLN F;  4Y13 A;  3BPV A;  3KP2 A;  2ZCW A;  3DKW A;  4EGY A;  2LSO A;  3O6B B;  4CO8 A;  3FXU A;  1P6R A;  3J80 K;  3GWZ A;  1S7A A;  3RPQ A;  1TLH B;  3W6K B;  3D5L A;  4ENM A;  2QQA A;  4H0E A;  1O3S A;  2LF8 A;  4HW0 A;  3R6S A;  1DDN A;  2RGV A;  3QOP A;  1T98 A;  5LEJ A;  4PDK A;  2GA2 A;  2JRT A;  1UB9 A;  4WX9 A;  3WTZ A;  3CLO A;  2HYF A;  4OIN F;  2JSC A;  2CQK A;  3FXQ A;  3IRR A;  1MZB A;  1U5T B;  2RNJ A;  3GFL A;  1B1B A;  2H94 A;  5ILU A;  2TDX A;  3EET A;  2EFW A;  2HTJ A;  2IW5 A;  3JTH A;  4PGH A;  3HRU A;  2CFX A;  3GXO A;  4YIF A;  2QWW A;  3BOQ A;  4OOI A;  1BI0 A;  3TOA A;  2P8T A;  4XLP F;  3JTG A;  5CVI A;  2A6E F;  3TDU C;  4ZZL A;  5JHU A;  2FEZ A;  2P6T A;  4WXD A;  3ULQ B;  1U2W A;  2L4M A;  3WG9 A;  3L09 A;  1G3T A;  2CGP A;  3FMS A;  3SXY A;  4FX0 A;  3ABU A;  3G3Z A;  2RV8 A;  3MFK A;  3ZQ7 A;  3V7C A;  2E7X A;  2PI0 A;  1O57 A;  1XCV A;  1Z91 A;  2FOK A;  2HWV A;  5LEK A;  2K4J A;  3GZ5 A;  3SHF A;  3HSR A;  1RIO H;  1SFU A;  1XD7 A;  1XCB A;  1G4D A;  1WI9 A;  5CYV A;  3T5X A;  4ZYE A;  1KU3 A;  2IA0 A;  1Z1D A;  4BHP A;  2L01 A;  3KET A;  3BJ6 A;  1O3T A;  2K27 A;  1FSE A;  2C6Y A;  5K5O A;  3MZH A;  3ZMS A;  5AIP A;  2X0L A;  1YFH A;  3ROU A;  3WTT C;  3H92 A;  4MQ9 F;  3AAF A;  1BI3 A;  5IT9 Z;  1R00 A;  2ISZ A;  2NAZ A;  2O8X A;  1K78 B;  1KU2 A;  4ZYH A;  2FSW A;  1K6O A;  3F8N A;  4HDU A;  1WRJ A;  5IT3 A;  1XMK A;  3JSO A;  5E8I A;  4ESF A;  5FFX A;  4N9H A;  3P7N A;  3O3K A;  2DTR A;  1QPM A;  3RYR A;  3CUO A;  1R1U A;  4B09 A;  2W85 A;  5ICC A;  4M72 A;  3WOD F;  2V9V A;  1TNT A;  3QU3 A;  5D5W B;  1K78 A;  2L02 A;  2BYV E;  1I1G A;  1R36 A;  2ETH A;  3FWE A;  2HGC A;  2GAU A;  1FBS A;  5LRS A;  3PQK A;  1REP C;  2STT A;  4PZJ A;  3EYY A;  2OA4 A;  3F8C A;  3FZV A;  4P5O A;  3M7G A;  1FP1 D;  3S2W A;  2V6C A;  1EH7 A;  4RS8 A;  2D45 A;  1I6X A;  4I7H A;  5BQT A;  2G7H A;  1BIA A;  3CTA A;  2YR2 A;  3JW4 A;  1OYY A;  1O3R A;  2K4B A;  4Q5S F;  1WKM A;  1PDN C;  1QO0 D;  5HDG A;  2MH2 A;  2DI3 A;  2EWN A;  3M1E A;  4LFU A;  1W7P A;  1SD5 A;  1FOK A;  4KIF A;  2W24 A;  4Y15 A;  1BJA A;  4IF4 A;  2DW4 A;  2E1C A;  4BHB A;  3WTS C;  4D0P A;  4HLY A;  2FE3 A;  5CLS A;  3KP3 A;  2OU2 A;  4EMS A;  4AIJ A;  2D1V A;  2O61 A;  3I4P A;  3I58 A;  3TDZ C;  1G3W A;  2FRH A;  4I02 A;  1DPU A;  3SZP A;  4UUV A;  4G9Y A;  5FGM A;  4AIH A;  1ZGJ A;  4GO1 A;  4RAY A;  4S05 A;  5FD6 A;  2HTS A;  3N4M A;  5HDK A;  5BOX A;  5LGN A;  4G8X A;  1YO5 C;  2F5F A;  2HZT A;  2EV5 A;  1ZH5 A;  4CHU A;  3KP7 A;  1JGS A;  2CG4 A;  1TBX A;  2VBX A;  4HOB A;  3ELK A;  4RAZ A;  4Q4Z F;  1F4K A;  2EFQ A;  4HA8 A;  3WU0 A;  1XGM A;  1XDS A;  5ILV A;  2XIG A;  3DF8 A;  4GYG A;  1HBX G;  2IA1 A;  4EJW A;  3P9I A;  4M9S A;  5CJ9 A;  3M8F A;  4A12 A;  3IWZ A;  3I71 A;  4HX8 A;  2KIF A;  1L3L A;  5ERI A;  1FX7 A;  4HLX A;  3LQQ A;  2PBI A;  2PFB A;  1XSD A;  2L54 A;  3L2C A;  2MC3 A;  3BRO A;  4I01 A;  2ZBK A;  4KFC A;  3CO7 C;  4ETS A;  4I0B A;  5L3D A;  3Q9S A;  2IRF G;  2ESH A;  4IHT A;  2EV6 A;  3RIR A;  3T8R A;  2HKO A;  1HKS A;  2R7F A;  2PEX A;  3TQN A;  2W57 A;  3V8J A;  4ENK A;  1AOY A;  3M9A A;  2QLZ A;  4U0W A;  1G3S A;  4CYD A;  2XRN A;  3DFG A;  1P4X A;  3EYI A;  1IZ1 A;  3C1D A;  4KYW A;  2IA2 A;  4I2O A;  1ZRC A;  4GYI A;  3DPL C;  5DD4 A;  3EUH A;  3BWG A;  2OZ6 A;  2F5D A;  1VTN C;  4UV8 A;  3KFW X;  3C18 A;  3PFI A;  4UXN A;  1G6N A;  2HFH A;  1USS A;  3H3U A;  1ZG3 A;  4L5I A;  1J9I A;  1Z7U A;  3HRS A;  1O3Q A;  2ZFW A;  2ACJ A;  4ESJ A;  3HIF A;  1MJB A;  4WCG A;  1R22 A;  3R60 A;  4LMY A;  5FD5 A;  3F72 A;  5AIQ A;  5ICG A;  3ECO A;  1FY7 A;  3HTS B;  4U7D A;  3E6C C;  2P7C B;  3F21 A;  3RKW A;  1I27 A;  2EFN A;  1LVA A;  2OQG A;  4KIC A;  3LA2 A;  4G94 A;  3WGH A;  1UCR A;  2MBF A;  3HRT A;  4U7B A;  1ZHF A;  2P5L C;  2IJL A;  4IRG A;  3RKX A;  1TW2 A;  4XBF A;  1J75 A;  1B4A A;  4HV6 A;  3GZ6 A;  2DAO A;  3IHU A;  1H9T A;  4BNC A;  1D3Y A;  4EM0 B;  4MEY F;  3GFJ A;  2O3F A;  2G7U A;  4EQQ A;  2CYY A;  3FXR A;  3T1B A;  3HRM A;  4Q48 A;  1ON2 A;  3KEO A;  3F23 A;  2ADU A;  4KT5 C;  1HKT A;  1D8J A;  5L3G A;  3TGN A;  2A69 F;  1ZYR F;  2VE9 A;  2V1D A;  3V7S A;  2RKH A;  1HST A;  1KU7 A;  4Y17 A;  3HHG A;  2KRF A;  1ZGA A;  2F5E A;  2M30 A;  3VEP A;  1MKM A;  1C0W A;  1X3U A;  3ZPL A;  1HQC A;  1K7A A;  1KU9 A;  2BEO A;  1V4R A;  4UVC A;  3WTW C;  2PJP A;  5HS7 A;  3QU6 A;  5E8G A;  3LA3 A;  5EEG A;  5LBQ A;  1HW2 A;  1S3J A;  4ZYD A;  4LLL A;  2K86 A;  1BI2 A;  1IAW A;  1IXS B;  2FA5 A;  1HKQ A;  1ODD A;  4XRF A;  1HW5 A;  2DLL A;  1F5T A;  1TW3 A;  2HQN A;  1YW8 A;  1T0F A;  4M9Z A;  3GO5 A;  3K0L A;  4LD5 A;  2VC1 A;  1UHM A;  4Q47 A;  1FBQ A;  3I59 B;  1O7F A;  2DPU A;  3H3Z A;  1KYW A;  4M6Y A;  5FFZ A;  1JE8 A;  1R1V A;  5F64 A;  3GW2 A;  1IF1 A;  1TQP A;  2IPQ X;  1YLF A;  2ZKZ A;  2VON A;  4G6Q A;  5DD8 A;  2XKP A;  1QQI A;  3OV8 A;  2M1B A;  2G9W A;  5ED4 A;  1RNL A;  2XAS A;  4BH9 A;  5E18 F;  3LAP A;  3GLX A;  3OOP A;  4WF2 A;  3FF5 A;  3E5X A;  4IHS A;  3NQO A;  2D1H A;  4RGR A;  5BPD A;  3SQN A;  1HSJ A;  5FB2 A;  4KMU X;  3DP7 A;  1NHA A;  1RUN A;  2VT3 A;  2EA2 A;  1R7J A;  1BOA A;  4LLN A;  1F1Z A;  4O5V A;  3T0Y A;  3ZMV A;  3U2R A;  1FLI A;  3E3V A;  4L5J A;  5D5X B;  2EFP A;  4A0X A;  1SAX A;  1XSV A;  5FLX Z;  3MAJ A;  3K69 A;  1XN7 A;  4HQM A;  2JZY A;  3HSE A;  3U1D A;  4EJT A;  4UHT A;  5DCM B;  1YQA A;  3K2Z A;  3LQR A;  1G3Y A;  2WC2 A;  2VOP A;  4DQ2 A;  3E5U A;  1TQI A;  1K79 A;  2M45 A;  2W25 A;  3WGI A;  3JAM Z;  3F3X A;  2Z33 A;  5E1X A;  2BE5 F;  3MWM A;  1GHC A;  4UV9 A;  3RTR A;  1IW7 F;  4O3M A;  1V3F A;  1R23 A;  1U78 A;  2QQB A;  2LKP A;  3ISP A;  2P5K A;  2XHK A;  3R4K A;  3TOB A;  2OQR A;  1FYM A;  4MGR A;  1FNN A;  1EH8 A;  3F8M A;  3O2P E;  3MCZ A;  1JXS A;  1IUY A;  5DUK A;  2LF7 A;  3ML6 A;  4YFK F;  5LHI A;  3ERE D;  3GX4 X;  1STZ A;  4M6X A;  2F2E A;  4P9F A;  2RDP A;  4OU0 A;  1P2F A;  3JAM K;  5LHG A;  1BN5 A;  1BIB A;  2K7L A;  2ISY A;  1OKR A;  2P7V B;  2YPR A;  3CUQ A;  1RZ4 A;  2ESN A;  3J81 K;  5LLQ A;  5CVJ A;  3CO6 C;  1SD6 A;  1DPR A;  2EA4 A;  4L9T A;  1IXR C;  3TO6 A;  3CUQ B;  4R79 A;  2FF4 A;  2FML A;  2MD5 A;  3BZ6 A;  2XAQ A;  1Y0U A;  1ULY A;  3I5U A;  5CVU A;  1YS7 A;  4FX4 A;  3KP5 A;  4LGW A;  1LDD A;  1E17 A;  3R0J A;  4OMY A;  1L0O C;  3QAH A;  1GVJ A;  2A68 F;  1RUO A;  3EDP A;  5KVR A;  3ZMD A;  5JFR A;  4LG0 A;  1MDM A;  1W7P D;  1W5S A;  4WWC A;  2V79 A;  1YS6 A;  5AON A;  1FSH A;  2FXA A;  1SMT A;  4HZF A;  4LG0 B;  2A5Y B;  1J7K A;  2XAF A;  2XAH A;  3MZY A;  4LLG F;  5LGU A;  2Z3Y A;  3DXJ F;  2EB7 A;  2EJR A;  4A5N A;  2IT0 A;  1ZG5 A;  5HLH A;  1EH6 A;  2A07 F;  5D4R A;  1ZAO A;  4M71 A;  4I09 A;  2A6H F;  5DEQ A;  4U88 A;  4IVN A;  2HR3 A;  3LST A;  4I98 B;  4IPA A;  2HS5 A;  4YII A;  1SD4 A;  5D8K B;  5LHH A;  3K9T A;  3ECH A;  5D5U B;  4IRH A;  4P9U A;  4L9J A;  1FBU A;  4M74 A;  4OIP F;  3COA C;  5DDG A;  2E7W A;  3CUQ C;  4ENN A;  4ESB A;  2OBP A;  4AVP A;  1OYI A;  2DK5 A;  1H0M A;  2UWM A;  2AXL A;  3I0T A;  3V8K A;  2JPC A;  1FWZ A;  5HDN A;  4UNO A;  4LK0 F;  2ELH A;  1B6A A;  4KN7 X;  2HYG D;  2DU9 A;  3GVA A;  1TTY A;  4OIO F;  3L9F A;  1TNS A;  3L7W A;  3HUG A;  2UXN A;  4EJO A;  4HYE A;  2CW0 F;  4HQE A;  3TO7 A;  2OZU A;  1LEA A;  2ZME A;  5D4S A;  2WWY A;  1OMI A;  1HW1 A;  5EEH A;  2GWR A;  2Y0M A;  2A3S A;  2PMH A;  3KLN A;  3DQV C;  1IN6 A;  1SFE A;  2Y48 A;  4CIC A;  1LDJ A;  3HYI A;  2A61 A;  4L18 B;  4CZZ A;  1CF7 A;  1FT9 A;  3BP8 A;  1B9M A;  3P9C A;  2Q8K A;  2VOO A;  1WSU A;  2PN6 A;  1OYW A;  2KIU A;  3IWF A;  4R8H A;  1T2K A;  2DPD A;  3KCC A;  3RDI A;  1T6S A;  3V7R A;  1Z6T A;  1J5Y A;  2VBY A;  5J6X A;  4KIB A;  2V1U A;  2K02 A;  4XSZ F;  3TO9 A;  1T39 A;  1U6G A;  4RGS A;  2QM3 A;  5L3C A;  1XB4 A;  3CJN A;  5D5V B;  3ZMU A;  4Z2Y A;  3RKY A;  4GCV A;  1RI7 A;  3E97 A;  3C3W A;  3ZP5 A;  4CXF A;  5LRR A;  4G7Z F;  4MTD A;  2JT1 A;  2HDC A;  2MA3 A;  1MDM B;  1QBJ A;  3NEU A;  1MJ9 A;  5D8L B;  1SFX A;  3TKY A;  2KJB A;  2E1N A;  3KEQ A;  5E17 F;  1ZLJ A;  1HXD A;  4L0Z B;  2QEN A;  5TRD A;  2EK5 A;  3FMQ A;  1U5T A;  3ZN1 A;  2DQR A;  5HS8 A;  4GGG A;  1ON1 A;  1GXQ A;  1ZG1 A;  2HKX A;  1PUE E;  5H6R A;  4R1H A;  1IRG A;  3IC7 A;  4L0Y B;  3SZT A;  4BAY A;  2KKO A;  2NNY A;  5HOO A;  3DPT A;  5H20 A;  1ZRF A;  2B0L A;  4LK1 F;  4YFX F;  1J2X A;  1XSX A; 
#chains in the Genus database with same CATH topology
 2JRM A;  1MMA A;  3CQZ J;  3QP6 A;  4NHJ A;  1FC3 A;  2L3D A;  2ZME C;  3HOS A;  3U9G A;  4OMZ A;  3RZD J;  2XKO A;  4QWQ A;  3BTJ A;  5JI6 A;  2VN2 A;  3C7J A;  3G4S I;  2J5O A;  1BR1 A;  2MG4 A;  3E6B A;  3PSI A;  4ZDL A;  1WWX A;  2NS0 A;  1J0R A;  3HHH A;  4XM3 A;  5FRN A;  4BBS J;  1ZAR A;  2VPL A;  4RGU A;  2XGC A;  2IBD A;  4HX7 A;  1KQ0 A;  3ZQI A;  5L3E A;  3LE3 A;  2ELK A;  1ETY A;  2DFI A;  5JLW A;  2NNN A;  1JEM A;  1Z0X A;  1VQ7 I;  3LA7 A;  1Z21 A;  4IHV A;  3MMY B;  4A6E A;  2KZG A;  5HLI A;  1X1P A;  2LFB A;  4FCY A;  5IOZ A;  4G6D A;  3LNQ A;  3I53 A;  4BEH B;  1IGN A;  4OAZ A;  3W2V A;  1Y8R B;  1IRX A;  2LNB A;  3W6J B;  1H89 C;  1W7P B;  4HEA 2;  3QPT A;  4N4O B;  5BMZ A;  1YIO A;  2QUF A;  3H35 A;  3K10 A;  4ZYG A;  2DTZ A;  1JT0 A;  2H6C A;  5GAG J;  1RR7 A;  3FXL A;  2YSR A;  1SVL A;  1LPQ A;  2LDU A;  2RC4 A;  4HBL A;  4M9X A;  4M3E A;  5J1U A;  1KZH A;  2VOD A;  4U0V A;  1X3W B;  3QYF A;  4L9N A;  3CDH A;  5BPI A;  3BPX A;  3EQL F;  1JGG A;  2E1O A;  1Y6I A;  2O7O A;  1OR7 C;  2IVM A;  5J47 A;  1U8R A;  4IJA A;  2MC4 A;  3GUD A;  3DLL F;  1AKH A;  1I39 A;  4IEJ A;  2HVR A;  2H09 A;  4KDP A;  2BGC A;  1VQK I;  4BQQ A;  4OWR B;  2DQL A;  1A6Q A;  3VPR A;  1IN8 A;  1I1S A;  4PSX A;  5ICF A;  2EFO A;  1O7L A;  5JVT A;  2HXO A;  1S29 A;  1QNT A;  1LDK B;  3BCA A;  5TJJ A;  3SFZ A;  1I6H J;  2R7X A;  3ZN0 A;  3CCD A;  2WBM A;  4MFE A;  4RB3 C;  1QZY A;  4N9I A;  3BDD A;  4K2E A;  1SD7 A;  4M3G A;  2XRO A;  2KRC A;  5DM7 F;  1IRF A;  3HOT A;  3BG5 A;  1A35 A;  3RZO J;  3E7L A;  2IAI A;  2W1O A;  2VT2 A;  2VXZ A;  2XGX A;  3K4M A;  4JBA A;  3ASN H;  4HF0 A;  2VC0 A;  1RES A;  1KQ8 A;  4ZZD A;  5HLG A;  1HOM A;  3BJO A;  2QYO A;  2K9N A;  3JRI A;  4N0B A;  1K1C A;  3CD6 I;  1MU4 A;  3FXO A;  2M5W A;  1MGT A;  3V8L A;  1SMY F;  2ZJ2 A;  3GTO J;  1BM9 A;  2TCT A;  4XK4 A;  4KIG A;  4DBR A;  1AWC A;  3IRQ A;  3E6D A;  2P4W A;  1IDY A;  3K4K A;  3HGY A;  2GM4 A;  4V2G A;  1J59 A;  1GLN A;  1P92 A;  3GTL J;  2VBZ A;  3RPU A;  3UR3 C;  1JHF A;  3ZQF A;  1U5T C;  1QRY A;  3A02 A;  4D7M A;  3H1C A;  5DYM A;  3WE2 A;  1S5L C;  2KIQ A;  2QBY A;  2QZ8 A;  2ZNY A;  4DZJ A;  3W2W A;  2R7Q A;  2RQQ A;  3QRF F;  4PJJ A;  1N77 A;  3BQY A;  3WU1 B;  3I4N J;  2HEO A;  4NQW A;  2NYX A;  3N97 A;  1B8I A;  2PJR B;  3OS2 A;  4IXA A;  4MNU A;  1ACI A;  4RB0 A;  2PMU A;  3ZMZ A;  2B9S A;  1E3H A;  1E3P A;  4ANJ A;  2VE8 A;  2YU3 A;  2RLZ A;  5D6F A;  4PGG A;  4IRI A;  4BDY A;  3C2G A;  1ZRD A;  4V2F A;  4GDF A;  3AG4 H;  2Z9O A;  5DM6 F;  1T38 A;  1WHU A;  3CC4 I;  3KP6 A;  2E71 A;  2O0Y A;  4DYC A;  4IZZ A;  3RKQ A;  2VL8 A;  2Y75 A;  1W5T A;  3JRB A;  4RB2 C;  1I3A A;  3FDY A;  5BNG A;  1UST A;  2FMY A;  3Q5F A;  2HOE A;  2DOE A;  4UUS B;  1P4W A;  3GYH X;  3M8J A;  3F8B A;  4A5M A;  4HX4 A;  3KLO A;  4MTE A;  1YI2 I;  3WE3 A;  2IS2 A;  3A4C A;  3LAJ A;  3C2B A;  4U0Y A;  3H9J A;  4IHW A;  2O6G E;  1MD0 A;  3F22 A;  2DA1 A;  4EVI A;  1Z3Y A;  3QPS A;  4II3 A;  1Z6R A;  2R7D A;  2TRT A;  4KA4 A;  3PUB A;  1LEB A;  4F3Q A;  1ERD A;  5IT9 K;  4P55 A;  2XB5 A;  2CSO A;  3WTV C;  3VFZ A;  2Q0O A;  1DGW Y;  2L5Q A;  2GXG A;  3T8T A;  4AWX B;  5T1O A;  3QPH A;  2Q2E A;  4BQA A;  2DJI A;  3NRV A;  1ZRE A;  1Z9C A;  3GTK J;  3F6O A;  3VSK A;  4QLC U;  2LD5 A;  2IS6 A;  3WHC A;  4DJA A;  1ZN2 A;  4BAC A;  1XTA A;  3B73 A;  1HC8 A;  4MEX F;  2HOA A;  3BR1 A;  4LB5 A;  3E1S A;  1V55 H;  4BE0 A;  3JRC A;  5IP9 J;  5HVQ C;  4E70 A;  4P96 A;  1Y1W J;  1LNW A;  5K5R A;  1H9G A;  4S04 A;  4C3I J;  2R3S A;  1PP8 F;  5E1Z B;  2HPM A;  2UXX A;  2PLY A;  1FU0 A;  4MQV A;  3M07 A;  2DCE A;  3OQO D;  4I0A A;  1IXC A;  1VQ9 I;  3ASO H;  1Y50 A;  1J6T B;  2L7Z A;  2BHZ A;  2P81 A;  2MW8 A;  1Y51 A;  1BBY A;  2P5V A;  4RA2 A;  2X4H A;  4MHG A;  2ZO4 A;  1LJ9 A;  4CGZ A;  3IP4 B;  4ITV A;  2K40 A;  2EIN H;  2B7E A;  3VSL A;  1V5F A;  2MLK A;  2FBH A;  4LB6 B;  1R58 A;  2ZNZ A;  1IG7 A;  4OIQ F;  3FM3 A;  3BC8 A;  5A2Q Z;  5L3B A;  3K4J A;  1JJ6 C;  2L4A A;  3IH4 A;  4JX6 A;  2Z16 A;  1YW9 A;  1GV5 A;  3WTX C;  2H27 A;  2M4K A;  2HNH A;  4ZYA A;  1TXE A;  3L2W A;  4GFB A;  4DNC A;  2VKE A;  3HPH A;  3OYM A;  2EV0 A;  1WJF A;  1BC8 C;  5DUI A;  1KYZ A;  1MSF C;  4HAM A;  2HVS A;  1MSE C;  4ON0 A;  1FZP B;  4C3J J;  3GTQ J;  1OR7 A;  4UB6 C;  2D2W A;  3I64 A;  4KUM A;  4Z6Y A;  4TV7 A;  2XVC A;  2ZXH A;  1I5Z A;  2GIV A;  5F1J A;  4WXC A;  2J5P A;  2CUE A;  4W97 A;  1ETO A;  1JT6 A;  2PQ8 A;  4HRI A;  1XGN A;  3REO A;  4NB5 A;  2OAZ A;  4ENJ A;  3K4N A;  1ETK A;  1QHH D;  1RPW A;  4BY1 J;  4A2U A;  2KRH A;  3BR3 A;  3OYA A;  2KZV A;  3K6G A;  5J8C A;  2CO5 A;  3BG9 A;  1MBF A;  3BJA A;  4L9V A;  4EM1 A;  3Q9V A;  2YX7 A;  5D6E A;  5K7Z A;  3CCV I;  2NVY J;  1FYL A;  2JTV A;  3MEX A;  2EH3 A;  4DBQ A;  5HLT A;  4QIW N;  4HST A;  2DBB A;  1XGO A;  1BC7 C;  1S7O A;  4H4K C;  3MKL A;  4RGX A;  4KN4 X;  2LH9 A;  4F7Z A;  4RAF A;  4E7H A;  2LBF A;  2W82 A;  1F9N A;  2LLK A;  2YX4 A;  1W0U A;  2VBW A;  2WV0 A;  3BZC A;  1GDT A;  4XMY A;  2L9N A;  3CP2 A;  4A6D A;  2O03 A;  2JVH A;  3GEZ A;  2ZXJ A;  2OUM A;  3LFK A;  4GXO A;  3IL2 A;  2MLG A;  5M3F J;  5DCF A;  3NWS A;  2PMZ A;  4FHT A;  4QTR A;  3WTY C;  5EG0 B;  3PSF A;  2OCC H;  2MAB A;  5E3M A;  1Z05 A;  3G1O A;  4EV0 A;  2V7F A;  1IN4 A;  1CF7 B;  4G7O F;  1N25 A;  1R6R A;  3G6E I;  2GXB A;  1MH4 A;  2IGN A;  2BXY A;  4DYQ A;  4JQF A;  1YW7 A;  1A04 A;  3K1P A;  4G7H F;  3KZZ A;  2WY8 Q;  4C2T A;  2VLA A;  1FYK A;  4YG2 F;  1HDN A;  3G1M A;  4RB1 A;  2KIM A;  5GAH J;  4XSX F;  3ZXS A;  4BXU A;  3RJP A;  1KGS A;  3BY6 A;  3TMO A;  2LKX A;  3TW7 A;  1MO1 A;  3F0C A;  3GFM A;  1NK2 P;  3I3L A;  2BBY A;  3FBI B;  3J80 Z;  2V1X A;  3CMY A;  1DUX C;  4RM3 A;  2FQ3 A;  5F0H A;  4J00 A;  2LTP A;  1KQ9 A;  3WGG A;  1ETV A;  1P9Q C;  2VIX A;  3R61 A;  4M73 A;  4AID A;  4FTH A;  2FU4 A;  3FXJ A;  3BR6 A;  3K1N A;  4WXH A;  1OJL A;  3DV8 A;  3E5Q A;  3CMM A;  5EZG A;  2X6Y A;  2IS4 A;  1H8A C;  5E1W A;  3CLQ A;  4YFN F;  2COM A;  4BE1 A;  4YEL A;  4EM2 A;  2EZK A;  4HDV A;  3QP5 A;  1W4M A;  2I10 A;  2JEL P;  2RN7 A;  2B63 J;  2AXT C;  1EV7 A;  2MH9 A;  2XAG A;  1IRZ A;  1D8K A;  3D0S A;  3F9K A;  3WTU C;  1IV8 A;  4A3K J;  5L3F A;  3L00 A;  2GXA A;  3B02 A;  4LJZ F;  2YUS A;  5K5Q A;  3L2Q A;  5C4X J;  3JRD A;  4XLE A;  2GZW A;  4PFO A;  3J7A O;  3LSH A;  4BQO A;  1TT5 B;  2R4G A;  2Y9Z A;  5A2Q K;  3UNG C;  1KA5 A;  3W3C A;  1WH7 A;  2DT5 A;  5CVV A;  1UHS A;  3K4L A;  2CV1 A;  2WA0 A;  1JHH A;  1T0F C;  4EJU A;  5J8F A;  5K1Y A;  1MNE A;  1S8N A;  3OR2 C;  1OPC A;  2UZK A;  4I99 C;  3OMY A;  4CCK A;  5E79 C;  1QZZ A;  2JPB A;  3DEU A;  4B8X A;  5K7F A;  1DP7 P;  3GBG A;  1X4P A;  3IKT A;  2FNP A;  2VJJ A;  3GLL A;  2EIJ H;  3GTP J;  2HQR A;  4FQG A;  5FO5 A;  2GIZ A;  1P4A A;  5CVR A;  2ZSH B;  3JRE A;  5EDN A;  3BT9 A;  1XDU A;  3KP4 A;  3MKY B;  2F5C A;  2R7R A;  5F6F A;  5B66 C;  3ZMT A;  3RYP A;  3GFI A;  2E5N A;  3LWF A;  2F6C A;  1GXP A;  5FLX K;  4RBO A;  1QGP A;  3PQJ A;  2QBY B;  3DKY A;  2N8G A;  2YS9 A;  3CF2 A;  3H5A A;  1PP7 U;  1X1A A;  1VQP I;  3VB2 A;  1ZLK A;  4A3B J;  2DT7 B;  3ZQC A;  5HS9 A;  1D1B A;  1FPQ A;  1D5V A;  4BQN A;  1FTZ A;  3S2D J;  1D0X A;  3O8H A;  2WAQ A;  2NRA C;  1CGP A;  2HYJ A;  2JVG A;  2XAJ A;  1W36 D;  1KA8 A;  2I8D A;  5IY5 H;  3DPU A;  3RQI A;  4BGD A;  5KK1 A;  4HPQ A;  1NG7 A;  5LGT A;  4OIR F;  3L2R A;  2WTE A;  2NVU B;  2BV6 A;  1BOB A;  2IEK A;  4ASN A;  2H6B A;  3IKV A;  1X4O A;  3G73 A;  2DK8 A;  2F4I A;  2XUB A;  1BW6 A;  1R5H A;  4UUS A;  5M3M J;  1ZR4 A;  2JMW A;  1Q1V A;  5FKK A;  5EEA A;  1FIA A;  4N4N B;  2AS5 F;  4C9Y A;  1R1T A;  3OYC A;  2IGM A;  3WG7 H;  4L5E A;  1MBE A;  3FMR A;  2DFE A;  4KMF A;  4HF1 A;  2L9V A;  5B5E C;  3G71 I;  5BS6 A;  1AHD P;  1ZKG A;  5F0C A;  2AK7 A;  2XV4 S;  3CJR B;  4A3E J;  1SAN A;  3J81 Z;  3PFY A;  3KZY A;  1WGX A;  4A0Z A;  4ZH4 F;  2ZJR F;  2R0Q C;  1YYV A;  1UAA A;  1BI1 A;  4PUS A;  1WJC A;  1BL0 A;  2CUJ A;  2QVO A;  3FX3 A;  6PAX A;  3CJT B;  4UVB A;  3OYB A;  3S1M J;  3F8F A;  4P1W A;  4C30 A;  3ERM A;  2ECB A;  2CW8 A;  3MQ0 A;  2COB A;  4AC0 A;  2PG4 A;  3O8G A;  2OD5 A;  5DS9 A;  3AG2 H;  2PX9 A;  1LKX A;  2QQ9 A;  1X2N A;  2M8E A;  2JA7 J;  3FHZ A;  2FBK A;  1Q1H A;  3V4G A;  3MN2 A;  1LQ1 A;  1ONV A;  3JRH A;  2W84 A;  1XGS A;  9ANT A;  3HOX J;  1R5G A;  5JR3 A;  2NOJ B;  3E6M A;  2HQ5 A;  1W1W E;  2FBI A;  2QKM B;  2STW A;  2BY1 A;  4F93 B;  3GME A;  1B59 A;  4CCO A;  3VOE A;  4AIK A;  5H6Q A;  1WFX A;  4WK8 F;  2E1M B;  3GCM A;  1XMA A;  2K9S A;  1IN7 A;  3K70 C;  1TQM A;  3P9K A;  3FM5 A;  2VKH A;  4A3F J;  1X3Z B;  3K1M A;  4EJV A;  1TL8 A;  1Z77 A;  1YTY A;  2IGK A;  1SFO J;  3HSF A;  4HV5 A;  2K9L A;  3F6V A;  1UZC A;  2GA1 A;  2P6S A;  2ZME B;  3BR0 A;  4RDU A;  4FT8 A;  4CH7 A;  4HF2 A;  2RNG A;  4O6J A;  4A0Y A;  4EAT A;  1UHW A;  3OYD A;  2XC7 A;  3RI4 A;  1E2X A;  3EZE B;  4B47 A;  3KE2 A;  4BHC A;  2ZJQ F;  3JSP A;  1K4S A;  4UVA A;  4BEH A;  3A0H C;  2E2H J;  1QFR A;  3M4O J;  3HTU A;  3I59 A;  5B3S H;  1P7J A;  1NH3 A;  1R4M B;  3LOC A;  4XRM A;  2JA2 A;  3D5R C;  4MO7 A;  1VQL I;  2M8G X;  4QPO A;  2WB1 A;  2X85 A;  4UB8 C;  4BUP A;  2KJC A;  3BR2 A;  1IN5 A;  2DT6 A;  1LB2 A;  4EGZ A;  5T17 A;  5C4J J;  3S3N A;  4NDL A;  3GF2 A;  2GOM A;  5ILS A;  1WQ2 A;  2FNA A;  4G6T B;  4JK1 X;  5FKO A;  2RVC A;  1MBH A;  2Z99 A;  3M8E A;  5F1R A;  5ICE A;  1N78 A;  2Z5U A;  2DMP A;  4KNY A;  4AD9 A;  3H36 A;  3VOD A;  1LFP A;  1QU3 A;  3OYG A;  5EGO A;  2CWE A;  1MJA A;  2GQQ A;  3I54 A;  1FP2 A;  4CDG A;  2LBF B;  2IP2 A;  5DV5 A;  2VJ5 A;  3MVP A;  2DO7 A;  2K85 A;  2M87 A;  2DDB A;  5E20 A;  4BYY A;  1YG2 A;  5DCM A;  4X1E A;  2WAF A;  4PCQ A;  3AFH A;  2RQP A;  3ABT A;  1U3E M;  1LUJ B;  4Y52 J;  3R0A A;  2AO9 A;  1S6L A;  1UFM A;  1VQN I;  3QQA A;  4AYB N;  2JQ7 A;  1B9N A;  1XG1 A;  4XLN F;  4Y13 A;  3BPV A;  3KP2 A;  2R7W A;  1PUF A;  1WJE A;  2K5C A;  1CM2 A;  2ZCW A;  2LK2 A;  3L1P A;  2CV2 A;  2LKS A;  3HXL A;  2CFO A;  2H8W A;  2LY1 A;  2R5Y B;  4BXX J;  2IS1 A;  2FX0 A;  3DKW A;  4EGY A;  3S15 J;  2LSO A;  3M3Y J;  4MLO A;  3O6B B;  4CO8 A;  5F27 A;  2X1E A;  1MBJ A;  3FXU A;  3OSF A;  1R49 A;  3L2U A;  2HI3 A;  3VWB A;  1D1C A;  2X1C A;  3LSG A;  3S14 J;  3Q0W A;  2Z2S B;  3DLA A;  2DA2 A;  1WJD A;  3OIP A;  1P6R A;  3J80 K;  2V1N A;  3GWZ A;  1S7A A;  1YJW I;  3ABM H;  3HGG A;  4XLF A;  3KYL A;  1DU6 A;  1IO2 A;  4Y33 A;  3RPQ A;  2Y30 A;  1TLH B;  3W6K B;  1DP3 A;  4BBR J;  3D5L A;  4ENM A;  2QQA A;  4H0E A;  3HOY J;  3S93 A;  1O3S A;  2LF8 A;  4HW0 A;  3R6S A;  4XOR A;  2E34 A;  1VQO I;  1DDN A;  2RGV A;  3QOP A;  4PJM A;  1T98 A;  5J4Y A;  3OYH A;  1WI3 A;  5LEJ A;  2XAU A;  4PDK A;  2WV1 A;  3G2B A;  2GA2 A;  1D1A A;  2JRT A;  1UB9 A;  4BJ5 C;  4WX9 A;  3WTZ A;  3CLO A;  2EIL H;  2HYF A;  5FRO A;  4OIN F;  2JSC A;  2CQK A;  3FXQ A;  3QYB A;  3IRR A;  1MZB A;  1U5T B;  2RNJ A;  3GFL A;  4PJL A;  2QSH X;  1B1B A;  2H94 A;  5ILU A;  4AM3 A;  3DTI A;  3LSI A;  2DA4 A;  2TDX A;  3EET A;  4A3I J;  2Y9Y A;  3HBL A;  1RC9 A;  4I6Z A;  2EFW A;  5J3L A;  2HTJ A;  2IXS A;  4E7K A;  2IW5 A;  3JTH A;  4PGH A;  4IX7 A;  2VQG A;  3HRU A;  2F4O B;  5H2F C;  1Y1V J;  2CFX A;  4D5F A;  3IV5 A;  3I9V 2;  3GXO A;  5F0F A;  3U1K A;  4YIF A;  2QWW A;  2QF7 A;  3BOQ A;  4OOI A;  4CUG A;  4XIC A;  1BI0 A;  4D7N A;  3S1R J;  4IOC F;  3TOA A;  2P8T A;  4XLP F;  3JTG A;  5CVI A;  2X48 A;  4ZDO A;  2BHY A;  2HDW A;  2JUC A;  4F91 B;  1BA5 A;  2A6E F;  3SEZ A;  5C3E J;  1B72 B;  3KZI C;  4NQW B;  2DJN A;  3PL8 A;  3TDU C;  4ZZL A;  5JHU A;  3FXK A;  3HUG B;  2FEZ A;  2P6T A;  3ZQL A;  4WXD A;  2O5R A;  2HU9 A;  2VPR A;  4A93 J;  3UKG A;  3ULQ B;  1U2W A;  2GLO A;  2L4M A;  4E7J A;  3L09 A;  2VQH A;  1G3T A;  3V42 A;  3WG9 A;  2CGP A;  3FMS A;  3SXY A;  4FX0 A;  3AL0 C;  3ABU A;  3G3Z A;  2RV8 A;  3MFK A;  3ZQ7 A;  3V7C A;  3MKZ A;  2E7X A;  2PI0 A;  4PK4 A;  1O57 A;  1OCP A;  1XCV A;  1PFH A;  1Z91 A;  2FOK A;  2QCO A;  2YU9 J;  2OTL I;  3GTG J;  2HWV A;  3KEY A;  2CMP A;  5LEK A;  2K4J A;  3GZ5 A;  3CZ6 A;  3SHF A;  3AG3 H;  2HXI A;  1R4N B;  3HSR A;  1OCT C;  2A05 A;  1SEU A;  1RIO H;  4X6A J;  3HL2 A;  1SFU A;  3B6C A;  1XD7 A;  1XCB A;  1G4D A;  3LFG A;  2E35 A;  1WI9 A;  5IP7 J;  5CYV A;  1GT0 C;  5KCM A;  1G8X A;  3T5X A;  4ZYE A;  2ZJP F;  2R7V A;  1KU3 A;  2ID3 A;  2IA0 A;  1Z1D A;  4BHP A;  2M9H A;  1YIJ I;  3CC7 I;  3LE1 A;  2L01 A;  3ZQH A;  2QA4 I;  3D5S C;  3KET A;  3H9G A;  3BJ6 A;  1O3T A;  3H0D A;  2K27 A;  1Z67 A;  3DKX A;  3CP8 A;  1FSE A;  2W00 A;  2DFH A;  3DTE A;  2C6Y A;  5K5O A;  3MZH A;  4V19 K;  3ZMS A;  5AIP A;  4FAS D;  1JKQ C;  2GBY A;  3QOE A;  2X0L A;  1YFH A;  1RR8 C;  3ROU A;  3WTT C;  3H92 A;  3TP0 A;  4MQ9 F;  4X0G A;  3AAF A;  5JHF A;  2E60 A;  1BI3 A;  1ETW A;  3KX2 A;  1S72 I;  1R71 A;  5IT9 Z;  1R00 A;  4JYK A;  2ISZ A;  2NAZ A;  2O8X A;  1K78 B;  1PTF A;  5GAE J;  2BXZ A;  1KU2 A;  3EUK L;  4ZYH A;  2FSW A;  1K6O A;  1ZQ3 P;  3F8N A;  2PMZ N;  4HDU A;  4RM2 A;  1WRJ A;  5IT3 A;  2Y69 H;  1XMK A;  1IV6 A;  1MBK A;  5E8I A;  3JSO A;  3LSP A;  4IO9 F;  3VYR B;  1BJZ A;  2AQF A;  5GPC A;  4ESF A;  5FFX A;  5IYD J;  4N9H A;  2EZI A;  3P7N A;  1TP4 A;  3IUO A;  3O3K A;  3QWL A;  3HJE A;  2DTR A;  1QPM A;  4NNJ A;  3RYR A;  3CUO A;  1TC3 C;  1R1U A;  5FRM A;  1MMG A;  4B09 A;  3KYC B;  1FJL A;  2W85 A;  1TWH J;  3VYS B;  3FIS A;  1OFC X;  5ICC A;  1RRJ A;  4M72 A;  3WOD F;  2V9V A;  1TNT A;  1MW7 A;  3QU3 A;  4CSW A;  5D5W B;  1K78 A;  1T08 B;  2L02 A;  2BYV E;  5FKL A;  1I1G A;  1R36 A;  2ETH A;  3FWE A;  2HGC A;  2GAU A;  1FBS A;  3IAM 2;  5LRS A;  3EUH C;  1SVO A;  2KDO A;  3PQK A;  1REP C;  2STT A;  4PZJ A;  3EYY A;  2OA4 A;  3F8C A;  3HOW J;  3FZV A;  4P5O A;  3M7G A;  1FP1 D;  3S2W A;  3LSR A;  3Q0U A;  1MMD A;  2V6C A;  3CCQ I;  5HNH A;  1WPK A;  4UUT A;  1G59 A;  2R7S A;  2X1D A;  2VI6 A;  3HDD A;  1ZVV J;  1EH7 A;  2JWT A;  5J4V A;  3B6A A;  4DZP A;  1AU7 A;  4RS8 A;  2D45 A;  4EEF G;  1I6X A;  3PO2 J;  4I7H A;  5BQT A;  4C3H J;  2G7H A;  2ZXI A;  4AU7 A;  1BIA A;  4U87 A;  3PNY A;  3JCU C;  5IYB J;  3CTA A;  1M1E B;  2YR2 A;  1YJ9 I;  1OCR H;  1V54 H;  3JW4 A;  4KJZ A;  2JA6 J;  1OYY A;  1D0Z A;  3HOZ J;  1O3R A;  2K4B A;  4A3D J;  1H88 C;  2OEN L;  1VFC A;  4Q5S F;  1WKM A;  1PDN C;  1QO0 D;  5HDG A;  3GZN B;  2R7U A;  1Y39 A;  2MH2 A;  2DI3 A;  1ZR2 A;  2EWN A;  3M1E A;  4LFU A;  2OV7 A;  4NBQ A;  3J7Z I;  1W7P A;  3WU2 C;  1SD5 A;  3IHS A;  1FOK A;  4KIF A;  2W24 A;  2CQN A;  1TZL A;  1BJA A;  4Y15 A;  4IF4 A;  2DW4 A;  2E1C A;  1NG6 A;  4BHB A;  2EIK H;  3WTS C;  3CCY A;  4D0P A;  4HLY A;  2FE3 A;  5CLS A;  3KP3 A;  2DA6 A;  3FKJ A;  2OU2 A;  4EMS A;  4AIJ A;  2D1V A;  2O61 A;  2ZXW H;  3I4P A;  3OS0 A;  3I58 A;  3S2H J;  3TDZ C;  4IKF A;  1G3W A;  2E36 A;  2BW3 A;  2NZV L;  5TIS C;  2FRH A;  4I02 A;  2JA5 J;  1DPU A;  3SZP A;  4UUV A;  4G9Y A;  2KDZ A;  2A5W A;  5FGM A;  1OLT A;  4AIH A;  1ZGJ A;  4BE2 A;  4GO1 A;  4RAY A;  4QPQ A;  4S05 A;  4ZTJ A;  3H9Q A;  3BG7 A;  4XN3 A;  2QQ8 A;  1JTX A;  3DWL E;  5FD6 A;  2HTS A;  2KQR A;  5K7H A;  4JOM A;  3N4M A;  1JUS A;  3HOV J;  5HDK A;  4A3G J;  5BOX A;  5LGN A;  3J7Y J;  4G8X A;  1VQ6 I;  1V5E A;  2RAE A;  2ME0 A;  1YO5 C;  2BOL A;  2F5F A;  2KFD A;  2HZT A;  3DEW A;  2EV5 A;  1ZH5 A;  3FK6 A;  4CHU A;  3KP7 A;  1MIJ A;  4IQ4 A;  1JGS A;  2DDA A;  2CG4 A;  1TBX A;  1Z7L A;  2VBX A;  4D9J A;  2KP6 A;  4E7I A;  1CM3 A;  4HOB A;  3ELK A;  1XPX A;  4RAZ A;  3SDG A;  2CRG A;  2E2I J;  4Q4Z F;  1F4K A;  2EPF A;  2EFQ A;  4HA8 A;  2DN0 A;  2LG4 A;  2LRE A;  3WU0 A;  1XGM A;  1AA7 A;  1XDS A;  4QSH A;  5ILV A;  2FOW A;  2XIG A;  1YRN A;  3DF8 A;  4GYG A;  3S8P A;  1HBX G;  3OSG A;  1LVK A;  2QKL B;  2IA1 A;  4BJT A;  2BY3 A;  2LY9 A;  2ZC2 A;  4EJW A;  1ETX A;  3P9I A;  4M9S A;  1QR5 A;  5CJ9 A;  3M8F A;  4A12 A;  5JVG F;  2P0W A;  1ORK A;  3IWZ A;  1IUF A;  3I71 A;  4HX8 A;  2KIF A;  3RCO A;  5IP6 A;  3H0G J;  4C2M J;  4RAG A;  5ERI A;  1L3L A;  1FX7 A;  4AYB A;  4F55 A;  5J1R A;  4HLX A;  1MND A;  1FOX A;  3LQQ A;  2M3A A;  2PBI A;  4II2 A;  2HQA A;  2PFB A;  2BW3 B;  4XRS A;  2CUF A;  1XSD A;  2OPT A;  3OQM D;  2ZFU A;  2L54 A;  4KIT B;  2MGQ A;  3L2C A;  2MC3 A;  3K70 D;  3BRO A;  4RMN A;  4I01 A;  2HID A;  3NAU A;  3CJQ B;  2ZBK A;  4OAY A;  2CQX A;  4YRV A;  4KFC A;  3CO7 C;  5GTH C;  4ETS A;  4I0B A;  5L3D A;  3Q9S A;  2IRF G;  1GV2 A;  2ESH A;  4BJ6 C;  4IHT A;  1IC8 A;  2EV6 A;  3SZG A;  3RIR A;  1QHG A;  3T8R A;  3CDI A;  2HKO A;  3RPU D;  4GRI A;  1Y56 A;  1HKS A;  3ABK H;  4XNF A;  2R7F A;  4CCL A;  2PEX A;  3TQN A;  2W57 A;  3V8J A;  4ENK A;  2X9D A;  3Q3S A;  3ZRG A;  4IHY A;  2M7B A;  1DU0 A;  4E7Z A;  1AOY A;  3M9A A;  2QLZ A;  4U0W A;  2KPM A;  1G3S A;  4CYD A;  3PJR A;  2XRN A;  4B43 A;  5J1Y A;  3DFG A;  1YOV B;  2L7K A;  2Y2Z A;  1X19 A;  1P4X A;  3HEF A;  3W6V A;  3EYI A;  1IZ1 A;  1YIT I;  3C1D A;  5CQE A;  1LE8 B;  4KYW A;  2IA2 A;  4I2O A;  1ZRC A;  4GYI A;  3DPL C;  5DD4 A;  3EUH A;  3BWG A;  2OZ6 A;  2F5D A;  1SC7 A;  3VYT B;  3S3M A;  1VTN C;  3HOU J;  3DU6 A;  2DYS H;  4UV8 A;  2JUG A;  3KFW X;  1VI0 A;  3C18 A;  3PFI A;  4HNV A;  2NS7 A;  4UXN A;  1G6N A;  4HG2 A;  1TWC J;  4B4C A;  2HFH A;  4F92 B;  1USS A;  2BZT A;  3H3U A;  5F04 A;  1SFK A;  4JX5 A;  1ZGW A;  2HDD A;  1ZG3 A;  2CS3 A;  2ZB9 A;  4L5I A;  1J9I A;  1Z7U A;  3HRS A;  3QOD A;  2EBI A;  1PCH A;  1PUF B;  3OIQ A;  1O3Q A;  4ZTF A;  2ZFW A;  2ACJ A;  1JI8 A;  3HC7 A;  2R7O A;  4ESJ A;  1N75 A;  4B48 A;  3HIF A;  1MJB A;  3ZQG A;  2H1K A;  4WCG A;  1W36 C;  1R22 A;  3ZCO A;  3OWT A;  3R60 A;  2MYS A;  4LMY A;  1FOY A;  4LOC A;  2R93 J;  2VKV A;  5FD5 A;  1B8I B;  3F72 A;  5AIQ A;  5ICG A;  3ECO A;  1FY7 A;  4HNT A;  3HTS B;  2OC6 A;  4U7D A;  3E6C C;  2P7C B;  4IQJ A;  2ELJ A;  5B1A H;  3F21 A;  3RKW A;  1I27 A;  4IOA F;  2KL4 A;  3MKW B;  4NC7 A;  2JA8 J;  3HKZ N;  2EFN A;  1LVA A;  4XWJ B;  2OQG A;  4KIC A;  3DEE A;  3LA2 A;  4BKX A;  2DOD A;  4G94 A;  3WGH A;  2CUZ A;  4FE4 A;  1UCR A;  3K7A J;  3BZK A;  1QPI A;  3EZB B;  2MBF A;  3FXM A;  3U21 A;  2L7M P;  3HRT A;  1B72 A;  2FEP S;  2VB6 A;  4M3D A;  2F4M B;  1ZTR A;  4U7B A;  1ZHF A;  2P5L C;  2IJL A;  4RLQ A;  2DMT A;  4IRG A;  3RKX A;  1TW2 A;  5E3N A;  3CMA I;  4XBF A;  1J75 A;  1B4A A;  1HLV A;  1RKW A;  4HV6 A;  2OCE A;  3EZA B;  3GZ6 A;  2DAO A;  3IHU A;  1H9T A;  4BNC A;  2M7A A;  1SAU A;  1D3Y A;  3RQ4 A;  4EM0 B;  4B1R A;  3OL4 A;  4MEY F;  3NAR A;  4XR6 A;  3CCR I;  3GFJ A;  2O3F A;  1P7I A;  2G7U A;  3JRF A;  3OL3 A;  4EQQ A;  5IOY A;  3FXR A;  2CYY A;  2BVL A;  2K9Q A;  3T1B A;  3HRM A;  4Q48 A;  2XF6 A;  1ON2 A;  2W7N A;  3CCU I;  1MH3 A;  3KEO A;  3F23 A;  2ADU A;  4D1Q A;  5EF6 A;  2E19 A;  1UG0 A;  2DMN A;  4KT5 C;  1HKT A;  2BY0 A;  2R7T A;  1D8J A;  5L3G A;  3E0J B;  4LIV A;  3CDL A;  3TGN A;  5C44 J;  1WJB A;  4YEJ A;  4Y7N J;  3LFU A;  2LRD A;  2A69 F;  2ICW G;  2D5V A;  1TWG J;  4M6V A;  1ZYR F;  4BXF A;  2VE9 A;  2V1D A;  3V7S A;  4B3X A;  2RKH A;  1YE9 A;  1HST A;  3N05 A;  2CQQ A;  1KU7 A;  4Y17 A;  3HHG A;  2KRF A;  4NC8 A;  1ZGA A;  3A0B C;  2F5E A;  2FD5 A;  2M30 A;  3VEP A;  2NVQ J;  3KIO A;  3LSM A;  1MKM A;  5M5Y J;  1C0W A;  1X3U A;  1JKO C;  3ZPL A;  1RET A;  2DYR H;  1HQC A;  1K7A A;  1KU9 A;  1FTT A;  2KT0 A;  5FLV A;  2BEO A;  3ZOB A;  4BL0 B;  3FK7 A;  1V4R A;  3H5R A;  2DFF A;  4CCM A;  2FJ1 A;  4UVC A;  1S7E A;  4HSR A;  3WTW C;  2R92 J;  2PJP A;  3ZQQ A;  3JRG A;  5HS7 A;  3QU6 A;  5E8G A;  3LA3 A;  5EEG A;  4CA0 A;  3SFI A;  4MIM A;  3OY9 A;  5EG0 A;  3JR9 A;  5LBQ A;  2QGU A;  1HW2 A;  1S3J A;  2L2O A;  4ZYD A;  4LLL A;  2K86 A;  1BI2 A;  2OF7 A;  3BQZ A;  1MMN A;  1IAW A;  1IXS B;  3A01 B;  2OTJ I;  2CQ7 A;  2FA5 A;  1HKQ A;  1ODD A;  4XRF A;  1VQ4 I;  2LYC A;  1HW5 A;  3QPL A;  2DLL A;  3K2A A;  1PYV A;  1LE8 A;  1F5T A;  1TW3 A;  2HQN A;  1YW8 A;  1XS9 A;  1T0F A;  2WAE A;  4M9Z A;  3GO5 A;  3K0L A;  4LD5 A;  2VC1 A;  3CCE I;  1UHM A;  5KNL A;  4Q47 A;  3EPZ A;  1FBQ A;  3I59 B;  1O7F A;  4DOZ A;  2DPU A;  3H3Z A;  1KYW A;  2XGE A;  4M6Y A;  5FFZ A;  1HCR A;  1JE8 A;  1R1V A;  5F64 A;  3GW2 A;  3A01 A;  1IF1 A;  1TQP A;  2IPQ X;  1YLF A;  2ZKZ A;  2VON A;  1BW5 A;  4G6Q A;  5DD8 A;  3DU5 A;  2V6E A;  1GUU A;  2XKP A;  3OQN D;  1KKL H;  1QQI A;  1TT0 A;  3OV8 A;  2M1B A;  2G9W A;  4W1U A;  5F08 A;  3TL4 X;  5ED4 A;  4XLC A;  3I55 I;  1DQU A;  1RNL A;  2XAS A;  4BH9 A;  5E18 F;  3SJM A;  1VF9 A;  3LAP A;  3GLX A;  3OOP A;  2KLO A;  4PSW A;  2QSG X;  5DTD A;  2K3P A;  2V9K A;  3AKZ A;  4KIS A;  4XID A;  1FMV A;  4UY8 I;  2L9S A;  4WF2 A;  2NZU L;  5EZH A;  2KIS A;  3AG1 H;  2DOF A;  2BVM A;  4XL9 A;  1MBG A;  3FF5 A;  3E5X A;  4IHS A;  3NQO A;  4XKV A;  3PIP F;  2D1H A;  3NWT A;  4RGR A;  5BPD A;  4NC6 A;  3WHB A;  3SQN A;  5KAF C;  1HSJ A;  5FB2 A;  2X6O A;  4KMU X;  3DP7 A;  3SEQ A;  1NHA A;  4B44 A;  3LMM A;  2G0E A;  3PO3 J;  1QVU A;  4JP0 A;  2CW7 A;  3OS1 A;  1X58 A;  1RUN A;  2VT3 A;  2EA2 A;  1R7J A;  1BOA A;  2IGO A;  1HA8 A;  4LLN A;  1F1Z A;  3BR5 A;  3ESW B;  4O5V A;  4M3B A;  3SDB A;  3T0Y A;  2FQ4 A;  3ZMV A;  4PJN A;  3U2R A;  1FLI A;  5JLX A;  1WH5 A;  3E3V A;  4L5J A;  1T33 A;  2EFP A;  5D5X B;  1XMX A;  1JKP C;  2DXI A;  4XLH A;  4A0X A;  1SAX A;  1XSV A;  2MFZ A;  2LR8 A;  3MAJ A;  5FLX Z;  3K69 A;  1XN7 A;  2VJI A;  4HQM A;  1TWF J;  1DGR M;  2JZY A;  3OYE A;  3HSE A;  3U1D A;  4EJT A;  3LSJ A;  1U9N A;  4UHT A;  2EZH A;  5DCM B;  4BY7 J;  1YQA A;  3K2Z A;  3LQR A;  3OYK A;  1TWA J;  1U9O A;  3ABL H;  1QVT A;  4BS9 A;  1G3Y A;  4XKC A;  2WC2 A;  4JX4 A;  1R9T J;  3FIW A;  2VOP A;  2UV1 A;  2L9R A;  1KKM H;  4LG3 A;  4DQ2 A;  3P5J A;  3E5U A;  3HM5 A;  2XB0 X;  1TQI A;  4DIQ A;  1K79 A;  3PNV A;  3OYJ A;  2M45 A;  2W25 A;  1QZE A;  2ZSI B;  4XKW A;  1E0E A;  2W4S A;  1UEL B;  5GP9 A;  3WGI A;  1I50 J;  3JAM Z;  3F3X A;  2Z33 A;  5E1X A;  3D1N I;  2BE5 F;  3MWM A;  1W5C C;  1YX3 A;  1WCM J;  1U0J A;  2LRL D;  1JUP A;  2UUZ A;  5CKT A;  4RLF A;  1GHC A;  5GPA A;  4UV9 A;  2XGD A;  2F48 A;  3IAS 2;  3RTR A;  1IW7 F;  2DA3 A;  4O3M A;  2XF5 A;  2W48 A;  2QSF X;  2OJE D;  3A03 A;  1V3F A;  1R23 A;  1U78 A;  2QQB A;  2LKP A;  2M34 A;  3Q0V A;  1RZR L;  2EZL A;  3BTL A;  3ISP A;  2RRE A;  1APL C;  3LL7 A;  2P5K A;  4CCN A;  2XHK A;  1UG2 A;  3R4K A;  3TOB A;  1A31 A;  2OQR A;  1FYM A;  5EGO B;  4MGR A;  1FNN A;  1EH8 A;  3F8M A;  3TED A;  3O2P E;  3MCZ A;  1JXS A;  2HVQ A;  3W2A A;  1IUY A;  5DUK A;  2LF7 A;  3QYE A;  4XKB A;  1F43 A;  5FLM J;  2AQE A;  3CES A;  3ML6 A;  4ZDP A;  4YFK F;  2V4J C;  5LHI A;  3ERE D;  3CC2 I;  1UJ8 A;  2DA7 A;  3GX4 X;  3OIO A;  1STZ A;  1MO1 B;  3BG6 A;  2XSJ C;  4M6X A;  2F2E A;  2LVS A;  4P9F A;  3ONQ A;  3CF5 F;  5FKM A;  2RDP A;  4ABZ A;  3S1Q J;  2XPW A;  4OU0 A;  1P2F A;  2XDF C;  3JAM K;  1JJ8 C;  5LHG A;  1BN5 A;  2NS8 A;  1BIB A;  5E3O A;  2K7L A;  2ISY A;  2VKD A;  3K4B A;  1OKR A;  2P7V B;  2CV0 A;  1FOW A;  2YPR A;  3PNT A;  4S0H B;  1WJA A;  3CUQ A;  3PIO F;  4A3C J;  1RZ4 A;  2WB1 N;  2ESN A;  4ZJZ A;  3J81 K;  5LLQ A;  5CVJ A;  3CO6 C;  3S16 J;  1SD6 A;  3BG3 A;  3CCM I;  1IJW C;  1DPR A;  4FIS A;  4XOP A;  2EA4 A;  4L9T A;  1IXR C;  1OCC H;  3TO6 A;  3CUQ B;  4R79 A;  2FF4 A;  4CYC A;  3X2Q H;  2FML A;  2MD5 A;  3K4C A;  2VQC A;  3BZ6 A;  2XAQ A;  1T95 A;  1NTC A;  1Y0U A;  2FUG 2;  1ULY A;  3I5U A;  5CVU A;  1GGR B;  3CCS I;  1YS7 A;  1EF4 A;  1PVE A;  1MMS A;  3OYF A;  4A3J J;  1RKT A;  2QEX I;  2NXN B;  4FX4 A;  1YJN I;  3KP5 A;  4LGW A;  4C2U A;  4LIT A;  1LDD A;  2JSP A;  1YHQ I;  2H1L A;  1E17 A;  3R0J A;  1POH A;  2R5Y A;  4OMY A;  1L0O C;  3BLY A;  3TBI A;  3ZGK A;  1A5J A;  1X1C A;  3QAH A;  2XSD C;  1GVJ A;  2A68 F;  5KAI C;  3OYL A;  1RUO A;  1D0Y A;  1LFB A;  4XOT A;  2Y0S A;  1HDP A;  3EDP A;  5KVR A;  2Q2E B;  3ZMD A;  1ITY A;  5JFR A;  4Y4R A;  3M1C A;  2XRL A;  4LG0 A;  1FIP A;  1MDM A;  3BCB A;  3I56 I;  1W7P D;  2HPI A;  4E6K G;  1QA6 A;  1W5S A;  4WWC A;  2V79 A;  1YS6 A;  5AON A;  4M3F A;  3A2K A;  1FSH A;  2FXA A;  1JKR C;  3HB9 A;  2VAS A;  1VQ5 I;  1SMT A;  4HZF A;  4LG0 B;  3IH3 A;  1K6Y A;  2A5Y B;  4B3A A;  2M0C A;  1J7K A;  2LP0 A;  2XAF A;  2XAH A;  5M5W J;  1AKH B;  3EUA A;  2ID6 A;  3MZY A;  2R5Z A;  4LLG F;  5LGU A;  3PM1 A;  3C2H A;  2Z3Y A;  3DXJ F;  2EB7 A;  2EJR A;  4A5N A;  2IT0 A;  1ZG5 A;  5HLH A;  2X6X A;  1EH6 A;  3TP3 A;  4YIR X;  1BR4 A;  3DTK A;  3GTJ J;  2A07 F;  2CH0 A;  2X51 A;  4F52 A;  2EIM H;  5LD2 C;  5D4R A;  2KMU A;  1ZAO A;  4M71 A;  4I09 A;  2A6H F;  1YRN B;  4J01 A;  5DEQ A;  4U88 A;  5E3L A;  4IVN A;  3S32 A;  1WVR A;  2HR3 A;  1WJ5 A;  2I5U A;  2PJR A;  1PJR A;  1W0T A;  2ECC A;  3LST A;  3H5N A;  1EJ9 A;  3KYD B;  4I98 B;  4IPA A;  2HS5 A;  4YII A;  1K4T A;  1XC5 A;  3JRA A;  1SD4 A;  5D8K B;  5LHH A;  3K9T A;  3J7A Y;  5GTI C;  3ECH A;  5D5U B;  4IRH A;  1J09 A;  4P9U A;  3PUF A;  4L9J A;  1FBU A;  3DCF A;  1ETQ A;  1D5Y A;  1KON A;  4M74 A;  2VQL A;  4OIP F;  3MZ8 A;  3COA C;  4XN0 A;  2M4G A;  5DDG A;  2E7W A;  2VUM J;  3CUQ C;  4ENN A;  4ESB A;  3TW6 A;  2OBP A;  4IL6 C;  2E2J J;  1YX5 A;  4AVP A;  1OYI A;  3FKI J;  2HOS A;  2DK5 A;  1H0M A;  2UWM A;  2AXL A;  3OOU A;  5FJ8 J;  3I0T A;  1VZ0 A;  3V8K A;  4XQF A;  2JPC A;  2K3F A;  3HKZ A;  1FWZ A;  5HDN A;  4ZC3 A;  1T8I A;  2CJJ A;  5KHD A;  5EYR A;  1BR2 A;  4LK0 F;  4UNO A;  4AUX A;  2ELH A;  3CME I;  1B6A A;  2XPV A;  1X1D A;  2VJ4 A;  1SVM A;  5TGT A;  4KN7 X;  2HYG D;  1V5G A;  2DU9 A;  2XDV A;  1HDD C;  2V26 A;  1FMW A;  3GVA A;  1TTY A;  4OIO F;  1VQM I;  3L9F A;  1R5I D;  1TNS A;  3L7W A;  5T1N A;  1VRC C;  3HUG A;  2AHQ A;  2UXN A;  4EJO A;  1Y8Q B;  3KPH A;  2MSY A;  4G12 A;  3RSN A;  1MNM C;  2L0K A;  2F5V A;  3AL0 B;  1G2H A;  4HYE A;  3VYU B;  2CW0 F;  1Y0N A;  2LMD A;  4HQE A;  3TO7 A;  4XLA A;  2OZU A;  1Z3X A;  1LEA A;  4DW6 A;  2ZME A;  4PFP A;  1IDZ A;  1K83 J;  1OIS A;  5D4S A;  1OQY A;  2LC2 A;  2WWY A;  1OMI A;  1Y4Y A;  1HW1 A;  5EEH A;  5CQG A;  2GWR A;  2Y0M A;  2M0M A;  2A3S A;  2PMH A;  3DBL B;  3LSK A;  3G1L A;  3KLN A;  5HOD A;  2Y31 A;  2VXD A;  3DQV C;  1IN6 A;  1SFE A;  2Y48 A;  5HNF A;  3S17 J;  4CIC A;  1LDJ A;  3HYI A;  1FEX A;  2GOX B;  3A1Y A;  3L2V A;  3OYI A;  2A61 A;  2XF7 A;  4L18 B;  5B1B H;  4I76 A;  1K61 A;  1T56 A;  4E4H A;  1X2M A;  4CZZ A;  3OYN A;  1CF7 A;  1FT9 A;  2R7Z J;  3BP8 A;  1B9M A;  3P9C A;  2DA5 A;  2Q8K A;  1WSU A;  2VOO A;  2PN6 A;  3SYT A;  5IYC J;  2JK3 A;  2CU7 A;  1VQ8 I;  1JTY A;  4PJ0 C;  1EKE A;  1OCO H;  1OYW A;  2KIU A;  3IWF A;  4R8H A;  1T2K A;  2O9L A;  2DOA A;  1VND A;  2DPD A;  3KCC A;  3HG9 A;  3RDI A;  2V9P A;  3S3O A;  3HZJ A;  1T6S A;  3VDX A;  1ZK8 A;  3V7R A;  3BTI A;  1OPD A;  4FE7 A;  1Z6T A;  3H3V K;  3ZR8 X;  2O8K A;  1J5Y A;  2VBY A;  3GTM J;  4J19 A;  5J6X A;  4KIB A;  4E7L A;  2V1U A;  2K02 A;  1SPH A;  4MFD A;  5EJC A;  4XSZ F;  2Z1D A;  2WAD A;  3TO9 A;  4AVZ A;  4LIU A;  1T39 A;  1U6G A;  2KHM A;  3CCL I;  4RGS A;  4CCJ A;  1OCZ H;  2BY2 A;  2QM3 A;  3LNW A;  4A69 C;  5L3C A;  2JN6 A;  2K9M A;  4HNU A;  1XB4 A;  4CYC B;  3CJN A;  2MD0 A;  5D5V B;  3ZMU A;  4Z2Y A;  2LY2 A;  4FET A;  3RKY A;  4DYR A;  3LE5 A;  1S9H A;  4GCV A;  2Q1Z B;  1GVD A;  5M5X J;  2HOT A;  1RI7 A;  3E97 A;  2HZD A;  3C3W A;  3ZP5 A;  1A36 A;  4CXF A;  4NUB A;  1O4X A;  5LRR A;  3HPG A;  4A3L J;  4G7Z F;  4MTD A;  2M2E A;  1ENH A;  2JT1 A;  2HDC A;  2MA3 A;  1JUM A;  4KT6 A;  2E1M C;  2LRK D;  3IH2 A;  3OR1 C;  1MDM B;  2NVT J;  3NEU A;  1QBJ A;  1MJ9 A;  4DGW B;  4BDZ A;  4A3M J;  1A6I A;  5D8L B;  1SFX A;  1EA3 A;  1NK3 P;  4XON A;  3TKY A;  2KJB A;  5LFA A;  2ME6 A;  2E1N A;  2L7F P;  2DMQ A;  3KEQ A;  2LOO A;  2E5Z A;  4BU2 A;  1CQT A;  1E3O C;  2H8R A;  5E17 F;  1ZLJ A;  3DBR B;  1HXD A;  5IPA A;  1X1B A;  4L0Z B;  2QEN A;  4Y3O A;  3DBH B;  5TRD A;  2EK5 A;  1ZEL A;  3BTC A;  1I3Q J;  2DMU A;  2X6W A;  3FMQ A;  4IHX A;  2WAQ N;  1U5T A;  3I4M J;  1POG A;  3ZN1 A;  2DQR A;  5HS8 A;  4GGG A;  1ON1 A;  4D5C A;  1GXQ A;  1ZG1 A;  2HKX A;  1PUE E;  3FHN A;  5H6R A;  4R1H A;  1F36 A;  1IRG A;  2NVX J;  5FKN A;  2XPU A;  3MD2 A;  2R5Z B;  3IC7 A;  4L0Y B;  4E7S A;  3SZT A;  5J40 A;  1XX5 A;  1UMQ A;  3FBN B;  1LFU P;  3S1N J;  2A6T A;  4BAY A;  1WZ2 A;  2JJ7 A;  1U8B A;  2HPR A;  2KKO A;  5GAD J;  2EQR A;  2NNY A;  5HOO A;  3DPT A;  5H20 A;  4XRS G;  3CCJ I;  4CZC A;  1ZRF A;  2NOG A;  1HF0 A;  2B0L A;  4LK1 F;  4YFX F;  1J2X A;  5CPR B;  1XSX A;  2Y0S N;  2WY7 Q; 
#chains in the Genus database with same CATH homology
 3QP6 A;  4NHJ A;  1FC3 A;  2L3D A;  3HOS A;  3U9G A;  4OMZ A;  2XKO A;  4QWQ A;  5JI6 A;  2VN2 A;  3C7J A;  2J5O A;  3E6B A;  1WWX A;  2NS0 A;  1J0R A;  3HHH A;  1ZAR A;  4RGU A;  4HX7 A;  1KQ0 A;  5L3E A;  2DFI A;  2NNN A;  3LA7 A;  4A6E A;  5HLI A;  4G6D A;  3I53 A;  2LNB A;  3W6J B;  1W7P B;  3QPT A;  5BMZ A;  1YIO A;  2QUF A;  4ZYG A;  2H6C A;  2YSR A;  2LDU A;  2RC4 A;  4HBL A;  4M9X A;  2VOD A;  4U0V A;  4L9N A;  3CDH A;  5BPI A;  3BPX A;  3EQL F;  2IVM A;  1U8R A;  4IJA A;  3GUD A;  4KDP A;  2H09 A;  2BGC A;  2DQL A;  1IN8 A;  1I1S A;  5ICF A;  2EFO A;  1O7L A;  5JVT A;  1S29 A;  1QNT A;  1LDK B;  5TJJ A;  3SFZ A;  3ZN0 A;  4RB3 C;  1QZY A;  4N9I A;  3BDD A;  4K2E A;  1SD7 A;  2XRO A;  1IRF A;  3HOT A;  2XGX A;  2VT2 A;  2VXZ A;  4JBA A;  4HF0 A;  2VC0 A;  1KQ8 A;  4ZZD A;  5HLG A;  3BJO A;  2QYO A;  4N0B A;  2M5W A;  1MGT A;  3V8L A;  1SMY F;  2ZJ2 A;  1BM9 A;  4KIG A;  1AWC A;  3IRQ A;  3E6D A;  2P4W A;  1J59 A;  1P92 A;  2VBZ A;  3RPU A;  1JHF A;  1U5T C;  5DYM A;  3WE2 A;  2QBY A;  2QZ8 A;  2ZNY A;  3QRF F;  3WU1 B;  2HEO A;  4NQW A;  2NYX A;  3N97 A;  4IXA A;  4MNU A;  4RB0 A;  2PMU A;  3ZMZ A;  2VE8 A;  2YU3 A;  5D6F A;  4PGG A;  4IRI A;  1ZRD A;  2Z9O A;  1T38 A;  3KP6 A;  2O0Y A;  2Y75 A;  1W5T A;  4RB2 C;  1UST A;  2FMY A;  3Q5F A;  2HOE A;  1P4W A;  3GYH X;  3F8B A;  4A5M A;  4HX4 A;  3KLO A;  4MTE A;  3WE3 A;  3LAJ A;  4U0Y A;  2O6G E;  1MD0 A;  3F22 A;  4EVI A;  1Z6R A;  2R7D A;  4KA4 A;  1LEB A;  5IT9 K;  4P55 A;  3WTV C;  2CSO A;  3VFZ A;  2Q0O A;  2GXG A;  3T8T A;  4AWX B;  3QPH A;  2Q2E A;  4BQA A;  3NRV A;  1ZRE A;  1Z9C A;  3F6O A;  4QLC U;  1ZN2 A;  3B73 A;  4MEX F;  4LB5 A;  5HVQ C;  4E70 A;  4P96 A;  1LNW A;  5K5R A;  1H9G A;  4S04 A;  2R3S A;  1PP8 F;  2PLY A;  5E1Z B;  2UXX A;  4MQV A;  4I0A A;  1IXC A;  1BBY A;  2P5V A;  2X4H A;  4MHG A;  2ZO4 A;  1LJ9 A;  4CGZ A;  2MLK A;  2FBH A;  4LB6 B;  1R58 A;  2ZNZ A;  4OIQ F;  3FM3 A;  5A2Q Z;  5L3B A;  2L4A A;  1YW9 A;  3WTX C;  2H27 A;  4DNC A;  2EV0 A;  1BC8 C;  5DUI A;  1KYZ A;  4HAM A;  4ON0 A;  1FZP B;  1OR7 A;  2D2W A;  3I64 A;  4KUM A;  4TV7 A;  2XVC A;  1I5Z A;  2GIV A;  4WXC A;  2J5P A;  2PQ8 A;  1XGN A;  3REO A;  4NB5 A;  4ENJ A;  2OAZ A;  4A2U A;  5J8C A;  2CO5 A;  3BJA A;  4L9V A;  4EM1 A;  3Q9V A;  2YX7 A;  5D6E A;  1FYL A;  2JTV A;  3MEX A;  2DBB A;  1XGO A;  1BC7 C;  1S7O A;  4RGX A;  4KN4 X;  4F7Z A;  1F9N A;  2YX4 A;  2VBW A;  2WV0 A;  4A6D A;  2O03 A;  3GEZ A;  2ZXJ A;  3IL2 A;  3LFK A;  4GXO A;  2MLG A;  5DCF A;  4FHT A;  3WTY C;  1Z05 A;  4EV0 A;  1CF7 B;  4G7O F;  1IN4 A;  2GXB A;  4JQF A;  1YW7 A;  1A04 A;  3K1P A;  4G7H F;  3KZZ A;  1FYK A;  4YG2 F;  4RB1 A;  2KIM A;  4XSX F;  4BXU A;  3RJP A;  1KGS A;  3BY6 A;  3GFM A;  2BBY A;  3J80 Z;  2V1X A;  1DUX C;  2FQ3 A;  1KQ9 A;  3WGG A;  3R61 A;  4M73 A;  2FU4 A;  3K1N A;  4WXH A;  3DV8 A;  3E5Q A;  5E1W A;  4YFN F;  2COM A;  4EM2 A;  4HDV A;  3QP5 A;  1W4M A;  2RN7 A;  1EV7 A;  2MH9 A;  2XAG A;  1D8K A;  3D0S A;  3WTU C;  5L3F A;  3L00 A;  3B02 A;  4LJZ F;  5K5Q A;  2GZW A;  3J7A O;  5A2Q K;  2DT5 A;  5CVV A;  1JHH A;  4EJU A;  5J8F A;  5K1Y A;  1S8N A;  1OPC A;  2UZK A;  1QZZ A;  2JPB A;  3DEU A;  4B8X A;  1DP7 P;  3IKT A;  2FNP A;  2HQR A;  5FO5 A;  1P4A A;  5CVR A;  1XDU A;  3KP4 A;  2F5C A;  5F6F A;  3GFI A;  3ZMT A;  3RYP A;  3LWF A;  5FLX K;  1GXP A;  1QGP A;  3PQJ A;  2QBY B;  1PP7 U;  3VB2 A;  1ZLK A;  5HS9 A;  1FPQ A;  1D5V A;  2NRA C;  1CGP A;  2XAJ A;  1KA8 A;  5KK1 A;  5LGT A;  4OIR F;  2WTE A;  2BV6 A;  4ASN A;  2H6B A;  3IKV A;  3G73 A;  2DK8 A;  2XUB A;  1R5H A;  2AS5 F;  1R1T A;  3FMR A;  4KMF A;  4HF1 A;  5BS6 A;  2XV4 S;  3J81 Z;  3KZY A;  4A0Z A;  4ZH4 F;  1YYV A;  1BI1 A;  2QVO A;  3FX3 A;  6PAX A;  4UVB A;  3F8F A;  3MQ0 A;  2PG4 A;  2OD5 A;  2QQ9 A;  2M8E A;  3FHZ A;  2FBK A;  1Q1H A;  3V4G A;  1LQ1 A;  1ONV A;  2W84 A;  1XGS A;  1R5G A;  5JR3 A;  3E6M A;  2FBI A;  2STW A;  1B59 A;  4AIK A;  3VOE A;  5H6Q A;  4WK8 F;  1XMA A;  1IN7 A;  1TQM A;  3P9K A;  3FM5 A;  3K1M A;  4EJV A;  1YTY A;  3HSF A;  4HV5 A;  3F6V A;  2GA1 A;  2P6S A;  2ZME B;  4FT8 A;  4HF2 A;  4O6J A;  4A0Y A;  1UHW A;  3RI4 A;  1E2X A;  3KE2 A;  4BHC A;  3JSP A;  4UVA A;  3HTU A;  3I59 A;  2KJC A;  1IN5 A;  1LB2 A;  4EGZ A;  3GF2 A;  5ILS A;  2FNA A;  1WQ2 A;  4JK1 X;  2RVC A;  2Z99 A;  3M8E A;  5F1R A;  5ICE A;  2Z5U A;  4KNY A;  4AD9 A;  3VOD A;  2CWE A;  1MJA A;  2GQQ A;  3I54 A;  1FP2 A;  4CDG A;  2IP2 A;  5DV5 A;  2DO7 A;  2M87 A;  5E20 A;  4BYY A;  1YG2 A;  5DCM A;  4PCQ A;  2RQP A;  3ABT A;  1U3E M;  3R0A A;  1S6L A;  1UFM A;  1B9N A;  4XLN F;  4Y13 A;  3BPV A;  3KP2 A;  2ZCW A;  3DKW A;  4EGY A;  2LSO A;  3O6B B;  4CO8 A;  3FXU A;  1P6R A;  3J80 K;  3GWZ A;  1S7A A;  3RPQ A;  1TLH B;  3W6K B;  3D5L A;  4ENM A;  2QQA A;  4H0E A;  1O3S A;  2LF8 A;  4HW0 A;  3R6S A;  1DDN A;  2RGV A;  3QOP A;  1T98 A;  5LEJ A;  4PDK A;  2GA2 A;  2JRT A;  1UB9 A;  4WX9 A;  3WTZ A;  3CLO A;  2HYF A;  4OIN F;  2JSC A;  2CQK A;  3FXQ A;  3IRR A;  1MZB A;  1U5T B;  2RNJ A;  3GFL A;  1B1B A;  2H94 A;  5ILU A;  2TDX A;  3EET A;  2EFW A;  2HTJ A;  2IW5 A;  3JTH A;  4PGH A;  3HRU A;  2CFX A;  3GXO A;  4YIF A;  2QWW A;  3BOQ A;  4OOI A;  1BI0 A;  3TOA A;  2P8T A;  4XLP F;  3JTG A;  5CVI A;  2A6E F;  3TDU C;  4ZZL A;  5JHU A;  2FEZ A;  2P6T A;  4WXD A;  3ULQ B;  1U2W A;  2L4M A;  3WG9 A;  3L09 A;  1G3T A;  2CGP A;  3FMS A;  3SXY A;  4FX0 A;  3ABU A;  3G3Z A;  2RV8 A;  3MFK A;  3ZQ7 A;  3V7C A;  2E7X A;  2PI0 A;  1O57 A;  1XCV A;  1Z91 A;  2FOK A;  2HWV A;  5LEK A;  2K4J A;  3GZ5 A;  3SHF A;  3HSR A;  1RIO H;  1SFU A;  1XD7 A;  1XCB A;  1G4D A;  1WI9 A;  5CYV A;  3T5X A;  4ZYE A;  1KU3 A;  2IA0 A;  1Z1D A;  4BHP A;  2L01 A;  3KET A;  3BJ6 A;  1O3T A;  2K27 A;  1FSE A;  2C6Y A;  5K5O A;  3MZH A;  3ZMS A;  5AIP A;  2X0L A;  1YFH A;  3ROU A;  3WTT C;  3H92 A;  4MQ9 F;  3AAF A;  1BI3 A;  5IT9 Z;  1R00 A;  2ISZ A;  2NAZ A;  2O8X A;  1K78 B;  1KU2 A;  4ZYH A;  2FSW A;  1K6O A;  3F8N A;  4HDU A;  1WRJ A;  5IT3 A;  1XMK A;  3JSO A;  5E8I A;  4ESF A;  5FFX A;  4N9H A;  3P7N A;  3O3K A;  2DTR A;  1QPM A;  3RYR A;  3CUO A;  1R1U A;  4B09 A;  2W85 A;  5ICC A;  4M72 A;  3WOD F;  2V9V A;  1TNT A;  3QU3 A;  5D5W B;  1K78 A;  2L02 A;  2BYV E;  1I1G A;  1R36 A;  2ETH A;  3FWE A;  2HGC A;  2GAU A;  1FBS A;  5LRS A;  3PQK A;  1REP C;  2STT A;  4PZJ A;  3EYY A;  2OA4 A;  3F8C A;  3FZV A;  4P5O A;  3M7G A;  1FP1 D;  3S2W A;  2V6C A;  1EH7 A;  4RS8 A;  2D45 A;  1I6X A;  4I7H A;  5BQT A;  2G7H A;  1BIA A;  3CTA A;  2YR2 A;  3JW4 A;  1OYY A;  1O3R A;  2K4B A;  4Q5S F;  1WKM A;  1PDN C;  1QO0 D;  5HDG A;  2MH2 A;  2DI3 A;  2EWN A;  3M1E A;  4LFU A;  1W7P A;  1SD5 A;  1FOK A;  4KIF A;  2W24 A;  4Y15 A;  1BJA A;  4IF4 A;  2DW4 A;  2E1C A;  4BHB A;  3WTS C;  4D0P A;  4HLY A;  2FE3 A;  5CLS A;  3KP3 A;  2OU2 A;  4EMS A;  4AIJ A;  2D1V A;  2O61 A;  3I4P A;  3I58 A;  3TDZ C;  1G3W A;  2FRH A;  4I02 A;  1DPU A;  3SZP A;  4UUV A;  4G9Y A;  5FGM A;  4AIH A;  1ZGJ A;  4GO1 A;  4RAY A;  4S05 A;  5FD6 A;  2HTS A;  3N4M A;  5HDK A;  5BOX A;  5LGN A;  4G8X A;  1YO5 C;  2F5F A;  2HZT A;  2EV5 A;  1ZH5 A;  4CHU A;  3KP7 A;  1JGS A;  2CG4 A;  1TBX A;  2VBX A;  4HOB A;  3ELK A;  4RAZ A;  4Q4Z F;  1F4K A;  2EFQ A;  4HA8 A;  3WU0 A;  1XGM A;  1XDS A;  5ILV A;  2XIG A;  3DF8 A;  4GYG A;  1HBX G;  2IA1 A;  4EJW A;  3P9I A;  4M9S A;  5CJ9 A;  3M8F A;  4A12 A;  3IWZ A;  3I71 A;  4HX8 A;  2KIF A;  1L3L A;  5ERI A;  1FX7 A;  4HLX A;  3LQQ A;  2PBI A;  2PFB A;  1XSD A;  2L54 A;  3L2C A;  2MC3 A;  3BRO A;  4I01 A;  2ZBK A;  4KFC A;  3CO7 C;  4ETS A;  4I0B A;  5L3D A;  3Q9S A;  2IRF G;  2ESH A;  4IHT A;  2EV6 A;  3RIR A;  3T8R A;  2HKO A;  1HKS A;  2R7F A;  2PEX A;  3TQN A;  2W57 A;  3V8J A;  4ENK A;  1AOY A;  3M9A A;  2QLZ A;  4U0W A;  1G3S A;  4CYD A;  2XRN A;  3DFG A;  1P4X A;  3EYI A;  1IZ1 A;  3C1D A;  4KYW A;  2IA2 A;  4I2O A;  1ZRC A;  4GYI A;  3DPL C;  5DD4 A;  3EUH A;  3BWG A;  2OZ6 A;  2F5D A;  1VTN C;  4UV8 A;  3KFW X;  3C18 A;  3PFI A;  4UXN A;  1G6N A;  2HFH A;  1USS A;  3H3U A;  1ZG3 A;  4L5I A;  1J9I A;  1Z7U A;  3HRS A;  1O3Q A;  2ZFW A;  2ACJ A;  4ESJ A;  3HIF A;  1MJB A;  4WCG A;  1R22 A;  3R60 A;  4LMY A;  5FD5 A;  3F72 A;  5AIQ A;  5ICG A;  3ECO A;  1FY7 A;  3HTS B;  4U7D A;  3E6C C;  2P7C B;  3F21 A;  3RKW A;  1I27 A;  2EFN A;  1LVA A;  2OQG A;  4KIC A;  3LA2 A;  4G94 A;  3WGH A;  1UCR A;  2MBF A;  3HRT A;  4U7B A;  1ZHF A;  2P5L C;  2IJL A;  4IRG A;  3RKX A;  1TW2 A;  4XBF A;  1J75 A;  1B4A A;  4HV6 A;  3GZ6 A;  2DAO A;  3IHU A;  1H9T A;  4BNC A;  1D3Y A;  4EM0 B;  4MEY F;  3GFJ A;  2O3F A;  2G7U A;  4EQQ A;  2CYY A;  3FXR A;  3T1B A;  3HRM A;  4Q48 A;  1ON2 A;  3KEO A;  3F23 A;  2ADU A;  4KT5 C;  1HKT A;  1D8J A;  5L3G A;  3TGN A;  2A69 F;  1ZYR F;  2VE9 A;  2V1D A;  3V7S A;  2RKH A;  1HST A;  1KU7 A;  4Y17 A;  3HHG A;  2KRF A;  1ZGA A;  2F5E A;  2M30 A;  3VEP A;  1MKM A;  1C0W A;  1X3U A;  3ZPL A;  1HQC A;  1K7A A;  1KU9 A;  2BEO A;  1V4R A;  4UVC A;  3WTW C;  2PJP A;  5HS7 A;  3QU6 A;  5E8G A;  3LA3 A;  5EEG A;  5LBQ A;  1HW2 A;  1S3J A;  4ZYD A;  4LLL A;  2K86 A;  1BI2 A;  1IAW A;  1IXS B;  2FA5 A;  1HKQ A;  1ODD A;  4XRF A;  1HW5 A;  2DLL A;  1F5T A;  1TW3 A;  2HQN A;  1YW8 A;  1T0F A;  4M9Z A;  3GO5 A;  3K0L A;  4LD5 A;  2VC1 A;  1UHM A;  4Q47 A;  1FBQ A;  3I59 B;  1O7F A;  2DPU A;  3H3Z A;  1KYW A;  4M6Y A;  5FFZ A;  1JE8 A;  1R1V A;  5F64 A;  3GW2 A;  1IF1 A;  1TQP A;  2IPQ X;  1YLF A;  2ZKZ A;  2VON A;  4G6Q A;  5DD8 A;  2XKP A;  1QQI A;  3OV8 A;  2M1B A;  2G9W A;  5ED4 A;  1RNL A;  2XAS A;  4BH9 A;  5E18 F;  3LAP A;  3GLX A;  3OOP A;  4WF2 A;  3FF5 A;  3E5X A;  4IHS A;  3NQO A;  2D1H A;  4RGR A;  5BPD A;  3SQN A;  1HSJ A;  5FB2 A;  4KMU X;  3DP7 A;  1NHA A;  1RUN A;  2VT3 A;  2EA2 A;  1R7J A;  1BOA A;  4LLN A;  1F1Z A;  4O5V A;  3T0Y A;  3ZMV A;  3U2R A;  1FLI A;  3E3V A;  4L5J A;  5D5X B;  2EFP A;  4A0X A;  1SAX A;  1XSV A;  5FLX Z;  3MAJ A;  3K69 A;  1XN7 A;  4HQM A;  2JZY A;  3HSE A;  3U1D A;  4EJT A;  4UHT A;  5DCM B;  1YQA A;  3K2Z A;  3LQR A;  1G3Y A;  2WC2 A;  2VOP A;  4DQ2 A;  3E5U A;  1TQI A;  1K79 A;  2M45 A;  2W25 A;  3WGI A;  3JAM Z;  3F3X A;  2Z33 A;  5E1X A;  2BE5 F;  3MWM A;  1GHC A;  4UV9 A;  3RTR A;  1IW7 F;  4O3M A;  1V3F A;  1R23 A;  1U78 A;  2QQB A;  2LKP A;  3ISP A;  2P5K A;  2XHK A;  3R4K A;  3TOB A;  2OQR A;  1FYM A;  4MGR A;  1FNN A;  1EH8 A;  3F8M A;  3O2P E;  3MCZ A;  1JXS A;  1IUY A;  5DUK A;  2LF7 A;  3ML6 A;  4YFK F;  5LHI A;  3ERE D;  3GX4 X;  1STZ A;  4M6X A;  2F2E A;  4P9F A;  2RDP A;  4OU0 A;  1P2F A;  3JAM K;  5LHG A;  1BN5 A;  1BIB A;  2K7L A;  2ISY A;  1OKR A;  2P7V B;  2YPR A;  3CUQ A;  1RZ4 A;  2ESN A;  3J81 K;  5LLQ A;  5CVJ A;  3CO6 C;  1SD6 A;  1DPR A;  2EA4 A;  4L9T A;  1IXR C;  3TO6 A;  3CUQ B;  4R79 A;  2FF4 A;  2FML A;  2MD5 A;  3BZ6 A;  2XAQ A;  1Y0U A;  1ULY A;  3I5U A;  5CVU A;  1YS7 A;  4FX4 A;  3KP5 A;  4LGW A;  1LDD A;  1E17 A;  3R0J A;  4OMY A;  1L0O C;  3QAH A;  1GVJ A;  2A68 F;  1RUO A;  3EDP A;  5KVR A;  3ZMD A;  5JFR A;  4LG0 A;  1MDM A;  1W7P D;  1W5S A;  4WWC A;  2V79 A;  1YS6 A;  5AON A;  1FSH A;  2FXA A;  1SMT A;  4HZF A;  4LG0 B;  2A5Y B;  1J7K A;  2XAF A;  2XAH A;  3MZY A;  4LLG F;  5LGU A;  2Z3Y A;  3DXJ F;  2EB7 A;  2EJR A;  4A5N A;  2IT0 A;  1ZG5 A;  5HLH A;  1EH6 A;  2A07 F;  5D4R A;  1ZAO A;  4M71 A;  4I09 A;  2A6H F;  5DEQ A;  4U88 A;  4IVN A;  2HR3 A;  3LST A;  4I98 B;  4IPA A;  2HS5 A;  4YII A;  1SD4 A;  5D8K B;  5LHH A;  3K9T A;  3ECH A;  5D5U B;  4IRH A;  4P9U A;  4L9J A;  1FBU A;  4M74 A;  4OIP F;  3COA C;  5DDG A;  2E7W A;  3CUQ C;  4ENN A;  4ESB A;  2OBP A;  4AVP A;  1OYI A;  2DK5 A;  1H0M A;  2UWM A;  2AXL A;  3I0T A;  3V8K A;  2JPC A;  1FWZ A;  5HDN A;  4UNO A;  4LK0 F;  2ELH A;  1B6A A;  4KN7 X;  2HYG D;  2DU9 A;  3GVA A;  1TTY A;  4OIO F;  3L9F A;  1TNS A;  3L7W A;  3HUG A;  2UXN A;  4EJO A;  4HYE A;  2CW0 F;  4HQE A;  3TO7 A;  2OZU A;  1LEA A;  2ZME A;  5D4S A;  2WWY A;  1OMI A;  1HW1 A;  5EEH A;  2GWR A;  2Y0M A;  2A3S A;  2PMH A;  3KLN A;  3DQV C;  1IN6 A;  1SFE A;  2Y48 A;  4CIC A;  1LDJ A;  3HYI A;  2A61 A;  4L18 B;  4CZZ A;  1CF7 A;  1FT9 A;  3BP8 A;  1B9M A;  3P9C A;  2Q8K A;  2VOO A;  1WSU A;  2PN6 A;  1OYW A;  2KIU A;  3IWF A;  4R8H A;  1T2K A;  2DPD A;  3KCC A;  3RDI A;  1T6S A;  3V7R A;  1Z6T A;  1J5Y A;  2VBY A;  5J6X A;  4KIB A;  2V1U A;  2K02 A;  4XSZ F;  3TO9 A;  1T39 A;  1U6G A;  4RGS A;  2QM3 A;  5L3C A;  1XB4 A;  3CJN A;  5D5V B;  3ZMU A;  4Z2Y A;  3RKY A;  4GCV A;  1RI7 A;  3E97 A;  3C3W A;  3ZP5 A;  4CXF A;  5LRR A;  4G7Z F;  4MTD A;  2JT1 A;  2HDC A;  2MA3 A;  1MDM B;  1QBJ A;  3NEU A;  1MJ9 A;  5D8L B;  1SFX A;  3TKY A;  2KJB A;  2E1N A;  3KEQ A;  5E17 F;  1ZLJ A;  1HXD A;  4L0Z B;  2QEN A;  5TRD A;  2EK5 A;  3FMQ A;  1U5T A;  3ZN1 A;  2DQR A;  5HS8 A;  4GGG A;  1ON1 A;  1GXQ A;  1ZG1 A;  2HKX A;  1PUE E;  5H6R A;  4R1H A;  1IRG A;  3IC7 A;  4L0Y B;  3SZT A;  4BAY A;  2KKO A;  2NNY A;  5HOO A;  3DPT A;  5H20 A;  1ZRF A;  2B0L A;  4LK1 F;  4YFX F;  1J2X A;  1XSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...