1J5YA

Crystal structure of transcriptional regulator (tm1602) from thermotoga maritima at 2.3 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGGKSGVSRLVAVKHAPEEIKEELLCVVRNGGRIVDVIVEHPVYGEIRGIIDVSSEEEVLKFVNLMEMAKTEPLLTLSGGVHLHTIEAPDEETMERIMRELKKKGFLIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a transcription regulator (TM1602) from Thermotoga maritima at 2.3 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR, BIOTIN REPRESSOR FAMILY
total genus 51
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02829 3H 3H domain
A PF08279 HTH_11 HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j5yA01
3.30.1340.20 Alpha Beta 2-Layer Sandwich Histidine-containing Protein; Chain: A; 3H domain 1j5yA02
4HX7A 1HW1A 2EB7A 2WTEA 2KKOA 1P6RA 5L3CA 5HLGA 1BBYA 2O0YA 2X0LA 3IWZA 5ILSA 3V8LA 3FMQA 2ISZA 3WGHA 4WXCA 1CF7A 1SD5A 1R5HA 4EGYA 5LGUA 3KP2A 1U5TA 1FP2A 5K5RA 3CJNA 1SFEA 4BNCA 3DFGA 3HRTA 2EA2A 3M8EA 4FHTA 1FYKA 1PP7U 1S29A 1P4XA 3GZ6A 3ML6A 3VB2A 1QQIA 4ESJA 1CGPA 4PGHA 3ISPA 1R1UA 5CVRA 5JVTA 1OMIA 1K78B 1DPRA 4L9NA 1XN7A 4IRGA 3NQOA 1O3SA 3EETA 1YFHA 2P5KA 2PQ8A 1SAXA 1RIOH 4UHTA 2BGCA 4XLNF 4ESBA 1Q1HA 5E20A 4LG0A 1XSXA 2QQBA 1ZGAA 4MTEA 2EFOA 1ZAOA 5CVUA 1IN7A 4AVPA 3G73A 4A0XA 5HDKA 1SD7A 2FMYA 4RGUA 3CUQA 5ICEA 3LAJA 2P5VA 4M6XA 4RAYA 2CG4A 5FB2A 4CGZA 2P6TA 3VOEA 2OU2A 4BH9A 4XLPF 1YW9A 1JXSA 3U9GA 3SZPA 3ZQ7A 2A69F 3FM3A 4XRFA 1KU3A 2VN2A 4OIOF 3FZVA 4I09A 4B8XA 2H09A 2H6BA 2IA2A 4IPAA 3C18A 4GXOA 1YQAA 3ZN0A 5D5UB 2L01A 2J5PA 4LLNA 3RKXA 1MDMB 4EJTA 2HQNA 4LB6B 1LDDA 5DEQA 5JI6A 3TO9A 1FY7A 2DLLA 4CICA 5TRDA 2ADUA 2GIVA 1ULYA 2VOPA 1I5ZA 5LGNA 3L00A 1ZG3A 1RUOA 3K1PA 4I98B 1HXDA 2QQAA 5FLXK 4PGGA 1FNNA 4N9IA 3TKYA 2HYGD 1SFUA 1J2XA 4ETSA 1R22A 1Z6RA 3M7GA 4HDVA 2XAQA 1OR7A 3ZMZA 3KETA 3FX3A 3KLOA 3KEOA 2KJBA 3SZTA 3Q5FA 5DV5A 2JRTA 4ASNA 5K5OA 1KYZA 1AOYA 2NS0A 2IVMA 3HTUA 3KP4A 2HKXA 1G3SA 3LA2A 5LHIA 2YU3A 2FXAA 3KEQA 2ZO4A 2OZUA 3VODA 4NHJA 3VEPA 2PLYA 3F22A 1QO0D 3GWZA 3DEUA 4P5OA 1KYWA 3PQJA 3TDZC 3DPTA 2ZMEA 3BROA 5FO5A 1R7JA 1GXQA 3FMSA 2HYFA 4LGWA 3U2RA 5DYMA 3V7CA 1U3EM 1LB2A 5E8GA 3JAMZ 4UV8A 1O3TA 4KN4X 4LLGF 1HSTA 3WTZA 3QP6A 3J81K 2DQLA 3BPVA 4LK1F 3WTTC 1XSDA 4WXDA 2XUBA 2D45A 4PCQA 2FOKA 2XROA 2EV0A 4I2OA 4U0VA 2H6CA 5L3BA 2PFBA 3ROUA 5LRSA 2BBYA 4CHUA 2NRAC 5DCMA 4UVAA 2EA4A 3CUQB 5FD5A 3Q9SA 2B0LA 2P8TA 5E1XA 2BEOA 2K7LA 1P4WA 1HSJA 2CW0F 2FSWA 1ZN2A 2PJPA 2JSCA 2XKPA 3R61A 2NYXA 3T8TA 1E17A 2DK5A 2UZKA 2IT0A 5ICCA 2O3FA 2NNNA 3TDUC 3GFLA 5F64A 2CGPA 1J75A 3H92A 1MDMA 3AAFA 2LNBA 5L3FA 2VE8A 3WTUC 3CTAA 5DDGA 3GVAA 1O3QA 4UVBA 3V7SA 1BC7C 1KA8A 3DV8A 2W24A 1OPCA 1S8NA 2PBIA 1IZ1A 3EUHA 3RDIA 4DQ2A 2COMA 4KUMA 5HLHA 3FXQA 2DQRA 1JHFA 1YW8A 2RGVA 1B9MA 4YFNF 1FBQA 2Y0MA 4MQVA 4HW0A 4BHBA 1XGSA 3J7AO 5E8IA 4M71A 1IUYA 2Z99A 3FXUA 1T0FA 3E5QA 1WSUA 2PMUA 1R1VA 5JFRA 1KQ9A 3TO7A 4Q4ZF 2BE5F 2DPDA 1BI0A 3HHGA 2GWRA 1ZREA 2DFIA 1FBUA 5KK1A 2E1CA 4RB3C 3P9CA 3DF8A 3WE2A 1B4AA 4NQWA 4HBLA 3KLNA 4KICA 2LF7A 2WC2A 3E6MA 5JHUA 1XCVA 4EJVA 1NHAA 2PN6A 3BDDA 3BWGA 1FZPB 2XKOA 3R60A 4ZYDA 4UNOA 5K1YA 2IA1A 3J80Z 2DO7A 1IF1A 2DAOA 1XCBA 3MWMA 1LEAA 1OYIA 3QRFF 3ZP5A 2G7UA 4LJZF 2VBWA 4AIJA 1KQ0A 5BMZA 4Y15A 2FEZA 2F5CA 3F3XA 2HR3A 3LA3A 3HHHA 2XAFA 2VODA 1ON1A 3FXRA 1XB4A 1O7FA 1YLFA 1XGNA 2HWVA 3IHUA 1ZGJA 2JTVA 2FU4A 2VT3A 3H3UA 1LJ9A 3M1EA 5KVRA 4FX4A 3WG9A 1R58A 1LDJA 1XMAA 1ZG5A 1FX7A 4ENJA 3O6BB 2L3DA 1J9IA 2DPUA 3L9FA 1SMTA 5LHHA 3E5XA 5D6FA 2UXXA 4FX0A 2FA5A 1OYWA 3HSRA 1F4KA 4ZYHA 2QUFA 3WGIA 2STTA 3IL2A 4O6JA 1YG2A 1B9NA 3F8BA 5HDNA 3IWFA 3K9TA 4EJOA 4CYDA 4ENKA 2V1DA 4IJAA 3LAPA 5LRRA 1OYYA 1WQ2A 1FSEA 2XIGA 5E1ZB 3MZYA 5FFXA 3D0SA 3LFKA 1XD7A 4HF1A 4OU0A 2A6HF 1ZRFA 2IW5A 2CSOA 1IAWA 1T6SA 2K4BA 2Y48A 2MC3A 2V6CA 3FF5A 5DD4A 2FNPA 4U0YA 5DUKA 2P7VB 4EMSA 4ESFA 2WV0A 3GLXA 4I0AA 4U7DA 1U5TC 1Y0UA 3KP7A 4OINF 2FBHA 3E6BA 4L18B 3SFZA 3LWFA 3JTGA 2F5EA 1O3RA 1LNWA 2QYOA 3F8CA 4HX4A 2P4WA 5HS9A 3F6VA 3SQNA 5D6EA 2HTJA 1U5TB 2A3SA 4KFCA 4KA4A 2RDPA 3IKTA 1T98A 3BOQA 1FLIA 2XAHA 5BS6A 1YYVA 2VOOA 1LEBA 1I27A 2ESNA 2ZXJA 3RPQA 3GYHX 2YSRA 3V7RA 2AS5F 1J5YA 1FSHA 2HS5A 3F8FA 3T5XA 5IT3A 3BJOA 4ZH4F 5D4RA 2DW4A 1G6NA 2NAZA 2PEXA 4G7ZF 1H9TA 2A5YB 1J59A 2Q0OA 1S3JA 3RIRA 2H27A 3I59A 1ZYRF 2XAJA 4GGGA 2GQQA 4LK0F 3O2PE 1O7LA 4P96A 3ZMUA 3OOPA 4FT8A 3KFWX 2A68F 3EDPA 2RVCA 4K2EA 2VBZA 3M8FA 3WTVC 5IT9K 3E3VA 4Q47A 1REPC 4KMUX 3GO5A 5A2QK 3F23A 2EK5A 4YIIA 3GFJA 1FYMA 1Z6TA 2G7HA 1YS7A 3V8KA 2QBYA 3R4KA 1KU2A 3JSOA 3GZ5A 3I58A 1BM9A 2RKHA 3BJ6A 2L02A 5HVQC 1TQMA 1W5TA 3I53A 5EEHA 1R36A 1A04A 2H94A 4BXUA 3IKVA 4G6DA 1OKRA 2BYVE 3GFMA 2V1XA 2O6GE 1XSVA 2VBYA 1KU9A 3GW2A 4S05A 1R00A 3P9IA 3BY6A 4A5NA 2DT5A 3B73A 3CO6C 4B09A 4HAMA 2AXLA 1W5SA 4HYEA 3TGNA 3CO7C 2VC0A 2XRNA 1CF7B 2YX7A 2E7WA 3B02A 1BC8C 4A12A 1W7PA 3QP5A 2O8XA 5ICFA 3HOTA 3KP6A 2W25A 3IRRA 1XMKA 4MHGA 3KP5A 4CO8A 4YFXF 3CLOA 1TQPA 2M1BA 4WF2A 5LEKA 1G3TA 2GAUA 4IRIA 2F5FA 4ZZDA 4I0BA 1MJ9A 1D3YA 2KIUA 1ZRDA 5D8LB 2EV6A 3J80K 2FBIA 3R0AA 3HIFA 2DBBA 1HW5A 2HTSA 3PQKA 1SD6A 3L2CA 4M6YA 4Q48A 1F5TA 3KE2A 4ZYEA 4A0YA 1GVJA 4BQAA 3K2ZA 3ZPLA 2K4JA 3RYPA 1EH7A 5BQTA 5LBQA 5HS8A 5L3DA 1MJBA 4A6DA 1IN5A 2P6SA 1B6AA 2R7FA 2OD5A 2ETHA 4WCGA 1BN5A 1B1BA 3K69A 4I02A 4G8XA 2IRFG 4F7ZA 3L7WA 3TOBA 4U0WA 1F9NA 4JBAA 4HOBA 5LGTA 2L4AA 2JPCA 5FD6A 1R5GA 4ON0A 3P7NA 2YR2A 1LVAA 4UUVA 3LQQA 5HDGA 2MLKA 4AIHA 4AIKA 1UFMA 2D1HA 4CDGA 4MTDA 2HFHA 4AWXB 1IN6A 2Q8KA 3WGGA 4QWQA 3KP3A 1TLHB 4KIBA 1VTNC 1HKQA 1IN4A 4EM0B 2L4MA 4R8HA 4OOIA 1IW7F 2OAZA 3V8JA 1PUEE 4RB2C 1K7AA 3OV8A 2GA1A 3F8MA 4MEYF 3IC7A 5D5XB 2VONA 3QPTA 3F8NA 3ZMTA 2CQKA 4LMYA 1J0RA 3QAHA 4M73A 3WTSC 3G3ZA 4UXNA 4A2UA 2OZ6A 4L5JA 2ESHA 1D5VA 4A5MA 2XHKA 2LKPA 4EJUA 2F5DA 4RB1A 4JK1X 2MD5A 2X4HA 4M9SA 3JSPA 1K6OA 3I54A 4A6EA 2O03A 2KIMA 2KIFA 2YX4A 4YFKF 3QOPA 1DP7P 2QZ8A 2QQ9A 1SD4A 5H6RA 3HSEA 1W4MA 4OMYA 3MFKA 3QU6A 2E1NA 2LDUA 5FLXZ 2RNJA 4R1HA 1U8RA 1TQIA 3MEXA 5CJ9A 1JE8A 2Z33A 5HS7A 1IXSB 1UHWA 2KRFA 4EV0A 2ACJA 3QU3A 3CUOA 3BZ6A 3N4MA 1MGTA 4WWCA 2OBPA 1FT9A 1T2KA 4CXFA 2MBFA 2MH2A 2W85A 3DXJF 3IRQA 1BI1A 1HQCA 2GA2A 4RGRA 1G4DA 4HQEA 2W84A 1G3WA 4R79A 2QWWA 5LHGA 2XGXA 1PDNC 3GX4X 3LA7A 5ICGA 2QVOA 2GZWA 2ZBKA 1DUXC 1S6LA 4ENMA 4G6QA 4UV9A 1HW2A 3KZYA 2OQRA 3I59B 2UWMA 5BPDA 2A07F 3ECOA 1QBJA 3ULQB 4L9JA 1B59A 4KIGA 1LDKB 4LG0B 4Y17A 1ONVA 2ZCWA 4IRHA 5CVVA 1R23A 2Q2EA 4ZZLA 1GHCA 5D8KB 1FYLA 3COAC 1MZBA 1JGSA 2HKOA 4HF2A 3LQRA 4UVCA 4WXHA 5ERIA 3JTHA 3TO6A 5ED4A 1FBSA 3S2WA 1SFXA 2ZKZA 2O61A 1H9GA 1IXRC 3FWEA 3W6JB 4OIQF 3F72A 4ZYGA 1BIBA 5JR3A 5DCMB 2MA3A 3VFZA 3RYRA 3BP8A 5L3EA 3M9AA 5TJJA 5AONA 2MLGA 2RV8A 4RS8A 4I7HA 4KMFA 2E7XA 1D8KA 4IHSA 1AWCA 4LFUA 2TDXA 4M72A 2PI0A 3N97A 5LLQA 1EH8A 3JAMK 1IXCA 1YS6A 1EV7A 1JHHA 3K1MA 2M5WA 1YTYA 4L5IA 2ZFWA 3MCZA 4MNUA 4Q5SF 3JW4A 4P9FA 3R6SA 3T1BA 2OA4A 2G9WA 4KDPA 4O5VA 1RUNA 2QM3A 2V79A 1S7OA 2D1VA 3LSTA 4O3MA 2K86A 4HQMA 1TW3A 5J8CA 2DU9A 2RQPA 4EM2A 2WWYA 2XVCA 3FHZA 2DTRA 2EFNA 2R3SA 5E17F 3DPLC 2CO5A 5FGMA 1K79A 5IT9Z 3PFIA 3ZMSA 2ZNYA 1V4RA 4EM1A 2K02A 4E70A 3R0JA 3FMRA 2HOEA 1TTYA 1TBXA 2VT2A 1I1SA 2M87A 2XV4S 1Z91A 2L54A 4GCVA 1BJAA 4IXAA 4EVIA 4RGSA 3E5UA 4BHPA 2IA0A 3NRVA 4JQFA 2W57A 5CVIA 3RI4A 2EV5A 3HRUA 3GUDA 5ILVA 5H20A 3RKWA 1V3FA 1YO5C 3EQLF 4GYIA 3EYIA 2QENA 3W6KB 5ILUA 1I6XA 2A6EF 1KGSA 2QLZA 3F6OA 2V9VA 2HDCA 4L0ZB 3I0TA 4PZJA 2UXNA 4EQQA 1D8JA 1QZYA 1WRJA 2QBYB 3KZZA 3MQ0A 5F6FA 2ISYA 4HX8A 1UHMA 5DD8A 1YIOA 3C7JA 3GXOA 4HV5A 5D5VB 1USTA 3CDHA 1LQ1A 2Z5UA 4M9ZA 1I1GA 3HSFA 2ELHA 2DI3A 1J7KA 3RJPA 3H3ZA 1WI9A 4QLCU 3I71A 4EJWA 4WK8F 5E18F 1H0MA 2FE3A 3HTSB 3QPHA 2VE9A 1QZZA 4KT5C 5FFZA 3E6DA 3RKYA 1ZRCA 4HDUA 4ENNA 5A2QZ 2Z9OA 2DK8A 5E1WA 1RNLA 3GEZA 1T38A 3C1DA 4BHCA 1F1ZA 1T39A 1ZLKA 1BOAA 3HUGA 2IP2A 5EEGA 1K78A 2HQRA 5BPIA 2GXBA 1USSA 2EFQA 3Q9VA 2XASA 2FF4A 3BPXA 4GYGA 5AIQA 1Z1DA 5BOXA 1GXPA 4L0YB 2EFWA 1QGPA 2ZMEB 4N9HA 2FBKA 3DP7A 4Y13A 4PDKA 2HGCA 1XDSA 1P92A 4BAYA 4N0BA 1RI7A 5L3GA 3ZN1A 2OQGA 1MD0A 4BYYA 2HZTA 4Z2YA 3K0LA 5F1RA 1IRFA 4MEXF 2FRHA 1TNSA 1FWZA 2F2EA 3I4PA 4XSXF 1ZARA 3I64A 2IJLA 3ZMDA 3BJAA 4HZFA 4P9UA 1FC3A 5D5WB 1STZA 1XDUA 4YG2F 2J5OA 4H0EA 4G7HF 3MZHA 3KCCA 1HKTA 5H6QA 1KU7A 1PP8F 1U6GA 1EH6A 1Z7UA 5CLSA 5CYVA 4OMZA 5K5QA 3P9KA 1IN8A 3WE3A 2VXZA 2ZJ2A 2Z3YA 1YW7A 4HLYA 1S7AA 4RAZA 4EGZA 1Z9CA 3REOA 3ABUA 4LD5A 3SXYA 4G9YA 3SHFA 3WU0A 1DPUA 3RPUA 4P55A 1FPQA 2M30A 2PG4A 3FM5A 4CZZA 3ECHA 4G7OF 3J81Z 4I01A 2FNAA 1P2FA 2CYYA 5J6XA 3ABTA 2P5LC 1U2WA 1FOKA 2EWNA 1FP1D 1E2XA 2M8EA 3O3KA 5J8FA 5LEJA 1QNTA 5HLIA 5DCFA 2MH9A 3WTXC 2CFXA 2JZYA 2LSOA 4YIFA 1ON2A 3U1DA 2V1UA 2A61A 1X3UA 1ZG1A 4KYWA 1TW2A 3L09A 1W7PD 3E97A 4OIPF 4U7BA 1P4AA 1O57A 1R1TA 4IF4A 1HKSA 3NEUA 4MQ9F 5AIPA 3E6CC 1QPMA 2GXGA 2IPQX 4L9TA 1MKMA 2JT1A 2BV6A 1WWXA 5DUIA 1L0OC 4A0ZA 3ZMVA 3T0YA 1UB9A 3HOSA 4M74A 3ELKA 2P7CB 4OIRF 1ODDA 3GF2A 1HBXG 3CUQC 4XBFA 2CWEA 2PMHA 3F21A 3DQVC 4U88A 3ERED 1XGMA 2VBXA 4KNYA 2LF8A 2HEOA 3TOAA 3MAJA 4HV6A 3DKWA 3V4GA 1ZLJA 2RC4A 1G3YA 3T8RA 4WX9A 4TV7A 4NB5A 4HLXA 3WU1B 2D2WA 3WTYC 4LB5A 1BI2A 2M45A 2XAGA 2EJRA 3RTRA 1RZ4A 3GFIA 5CVJA 4L9VA 1MJAA 4KN7X 1BI3A 4G94A 1ZH5A 3HRSA 4IVNA 2NNYA 4AD9A 3HRMA 3EYYA 4XSZF 3HYIA 1W7PB 1L3LA 2Y75A 1BIAA 1U78A 2YPRA 3WTWC 1DDNA 2RN7A 3TQNA 2C6YA 4RGXA 3K1NA 3WODF 1UCRA 5HOOA 4LLLA 1C0WA 2FMLA 3I5UA 1XGOA 4HA8A 1SMYF 2VC1A 4MGRA 1Z05A 4KIFA 4S04A 2FQ3A 6PAXA 4IHTA 4GO1A 1WKMA 4DNCA 1TNTA 4RB0A 2EFPA 2STWA 2KJCA 2ZNZA 4HF0A 2K27A 5D4SA 1IRGA 3D5LA 4M9XA 1ZHFA 2R7DA 1KQ8A 2JPBA 3C3WA 4D0PA
chains in the Genus database with same CATH superfamily
2VKEA 4HX7A 3RQIA 1HW1A 3OS0A 2EB7A 2WTEA 2KKOA 1YJ9I 1P6RA 2IAIA 1JI8A 5TISC 5L3CA 5HLGA 1VQ7I 1BBYA 2O0YA 4NC6A 2X0LA 3IWZA 5ILSA 3V8LA 2E2JJ 1QU3A 2V7FA 2F48A 3FMQA 2ISZA 3WGHA 1VQ4I 4RMNA 4WXCA 1CF7A 1JTXA 4MFEA 1SD5A 2ZJPF 1DGWY 4NQWB 2LR8A 2F4OB 3EPZA 1R5HA 3JRFA 1QZEA 4EGYA 2L7FP 3I4MJ 5F04A 2HXOA 2XSJC 5LGUA 3KP2A 1U5TA 2KRCA 4M3FA 5B5EC 5EGOA 1FP2A 5K5RA 3CJNA 2K3FA 1SFEA 3H36A 4BNCA 3BTIA 2WAQN 3DFGA 3HRTA 1YJNI 2DTZA 2EA2A 3M8EA 2RNGA 1KZHA 3C2HA 4FHTA 2R5YA 2X6WA 2BXZA 1FYKA 5FLVA 1PP7U 1S29A 1P4XA 3GZ6A 3BQYA 3ML6A 1Y8QB 4PJ0C 3VB2A 2OENL 3G1MA 3K4KA 3GBGA 1QQIA 3QOEA 3K2AA 4ESJA 3JRAA 4IHXA 1JJ6C 2M0MA 1CGPA 4PGHA 1G59A 1K1CA 3ISPA 3DWLE 2H8RA 1R1UA 5CVRA 4FASD 5IP9J 2LP0A 2LVSA 5JVTA 1OMIA 1K78B 3CC4I 5M5YJ 2M3AA 1DPRA 4L9NA 1XN7A 4IRGA 3GMEA 1WFXA 3LSMA 3NQOA 3ONQA 4BDYA 1O3SA 3EETA 1K83J 4DZJA 1YFHA 1OCCH 2E1OA 2P5KA 2PQ8A 1SAXA 1RIOH 4UHTA 2BGCA 4XLNF 4ESBA 1IV6A 5JLXA 1Q1HA 1X3WB 2OUMA 5E20A 3ABMH 1BA5A 4LG0A 1XSXA 2XSDC 4X1EA 2QQBA 1ZGAA 4W97A 1WPKA 1VQMI 2H1KA 4MTEA 3OYGA 2EFOA 3G2BA 2MYSA 4RLQA 1ZAOA 5CVUA 2WBMA 1IN7A 4P1WA 4AVPA 4A0XA 5GTHC 3G73A 1Y50A 3ZQCA 1NG6A 2ELJA 2IGOA 3TEDA 4NDLA 2HPRA 1S5LC 2DDAA 1Z0XA 2R5ZB 3Q0VA 5HDKA 1SD7A 4FETA 3ZOBA 1E0EA 1NG7A 2FMYA 3JRCA 4RGUA 3CUQA 5ICEA 2ZJRF 3LAJA 2P5VA 2HI3A 4M6XA 4RAYA 2CG4A 3SDGA 3FHNA 5FB2A 4XLFA 2OPTA 4CGZA 1LE8B 2P6TA 3VOEA 5FJ8J 2MGQA 2OU2A 2QSHX 4BH9A 4XLPF 1YW9A 4XLHA 4CCNA 4C2UA 1JXSA 5H2FC 2NZUL 3U9GA 1CM2A 3SZPA 1N77A 2NVYJ 3VWBA 3ZQ7A 2A69F 3FM3A 4XRFA 4CYCB 1TWFJ 1KU3A 3FXJA 2VN2A 4OIOF 2JELP 3FZVA 4I09A 4B8XA 3LNQA 2H09A 2H6BA 2IA2A 4YIRX 1VQOI 4IPAA 2HPMA 4IHWA 3C18A 4GXOA 1YQAA 3BR6A 3HM5A 3ZN0A 1OLTA 1FEXA 5D5UB 2LYCA 2L01A 3F9KA 2J5PA 3PSFA 4F3QA 1V54H 2VQHA 4LLNA 1FOXA 2VKHA 3RKXA 1MDMB 4EJTA 2HQNA 4LB6B 2CV1A 1LDDA 5DEQA 5JI6A 1OCPA 3E7LA 3TO9A 2AQFA 1FY7A 1KKMH 2DLLA 3IV5A 4CICA 5TRDA 2KHMA 2ADUA 4E7LA 2F6CA 2GIVA 1ULYA 2VOPA 2K5CA 3TL4X 1I5ZA 3LE5A 5LGNA 3L00A 2K3PA 1ZG3A 1RUOA 3K1PA 4I98B 3HOZJ 2L9SA 4A3DJ 5C4XJ 1X19A 1HXDA 2CU7A 2Y0SA 3OYFA 2QQAA 1ETXA 5FLXK 1BW6A 4PGGA 1FNNA 3OR1C 4N9IA 3FXLA 3TKYA 2IS1A 1VQPI 2HYGD 1SFUA 1J2XA 2KFDA 4ETSA 1R22A 3VSKA 1Z6RA 3M7GA 4CA0A 3UKGA 3BCBA 4HDVA 1VI0A 2DMQA 2XAQA 1OR7A 2OJED 3ZMZA 3OR2C 2MG4A 9ANTA 3KETA 3FX3A 3MMYB 1V5FA 3KLOA 1AHDP 4Y4RA 1HA8A 2ME0A 3KEOA 2KJBA 4RAFA 4A3MJ 3SZTA 3Q5FA 5DV5A 5T17A 1MMAA 4D9JA 2XGDA 2AXTC 2JRTA 4ASNA 5K5OA 1KYZA 1AOYA 2NS0A 2IVMA 3HTUA 1N75A 2HKXA 3KP4A 1G3SA 4FE7A 1VQKI 3LA2A 5LHIA 1OQYA 2YU3A 2FXAA 4IQ4A 3KEQA 2R7ZJ 2KZGA 1ETOA 2ZO4A 2OZUA 3VODA 1GDTA 4NHJA 3ZGKA 3VEPA 1OJLA 3F22A 2PLYA 1QO0D 3GWZA 3DEUA 4P5OA 1VQ5I 1KYWA 3PQJA 3TDZC 3DPTA 3GTMJ 3ABLH 5FKOA 2ZMEA 3BROA 5FO5A 1R7JA 1GXQA 1OR7C 2I8DA 3FMSA 1DU0A 2HYFA 3GTOJ 4LGWA 3U2RA 2HDDA 3HOYJ 1MMNA 5DYMA 3V7CA 2Z16A 3VDXA 1U3EM 1DP3A 1U9NA 1LB2A 1M1EB 5E8GA 2FJ1A 4UV8A 3JAMZ 1O3TA 1JUSA 2IXSA 4D5FA 1SEUA 4XIDA 3TW7A 1J09A 4KN4X 3S14J 4LLGF 1HSTA 3WTZA 3QP6A 2X1CA 4UUTA 3J81K 4BBSJ 3J7ZI 5IP7J 2DQLA 3BPVA 4LK1F 1CM3A 1SVMA 1XC5A 2LKSA 4WXDA 3WTTC 1XSDA 2GXAA 4L5EA 3U1KA 2XUBA 3HC7A 2D45A 1ACIA 4PCQA 2FOKA 1TT5B 2LD5A 2E1MC 2XROA 2EV0A 4I2OA 4QTRA 4HNTA 4U0VA 2H6CA 1IRZA 3OQMD 2WAEA 5L3BA 2PFBA 3ROUA 5LRSA 2BBYA 4CHUA 2NRAC 4XK4A 5DCMA 4V19K 1I3AA 4UVAA 2EA4A 3CUQB 5FD5A 3Q9SA 2B0LA 2VJJA 2P8TA 5E1XA 2BEOA 2K7LA 3PO3J 1P4WA 1HSJA 3H9GA 2CW0F 1WH5A 3CCLI 4HF1A 2FSWA 1ZN2A 4Y3OA 2PJPA 1LVKA 2HOTA 3B6AA 2JSCA 4A69C 2XKPA 3NARA 2V9PA 1FJLA 3R61A 2E71A 2NYXA 3W2AA 3T8TA 4RM2A 1VQNI 4BXFA 1KKLH 2BY3A 1E17A 2DK5A 1X3ZB 1YRNA 2UZKA 1UZCA 2IT0A 4CUGA 1TL8A 5ICCA 2PMZN 2O3FA 2NNNA 3TDUC 3M1CA 3OYLA 1WZ2A 2X1EA 3NAUA 5EDNA 3OOUA 3GFLA 3PNVA 5F27A 5F64A 2HZDA 2CGPA 1J75A 4E6KG 1I3QJ 3JR9A 3H92A 1MDMA 3WHBA 2NVQJ 1ORKA 3AAFA 2LNBA 5L3FA 1ZKGA 3DTKA 2VE8A 1JT6A 3WTUC 2WY7Q 3CTAA 5F1JA 5DDGA 2R92J 2ZXHA 2AQEA 3GVAA 2TCTA 1YITI 4UB8C 2CQ7A 4UVBA 1KA8A 3V7SA 3DV8A 1O3QA 2W24A 1OPCA 3K4NA 1BC7C 1S8NA 2PBIA 3KX2A 2KIQA 4BEHB 1JGGA 1IZ1A 3EUHA 3RDIA 4DQ2A 3CCDA 2COMA 2NOJB 4KUMA 5IPAA 2EZKA 5HLHA 1T8IA 5K7FA 2ID3A 2ZXIA 3FXQA 2DQRA 4I6ZA 1JHFA 1YW8A 2RGVA 1B9MA 3CD6I 1Y0NA 1S72I 4YFNF 3F0CA 1FBQA 4CCKA 2Y0MA 2LTPA 4DGWB 4MQVA 4HW0A 4BHBA 1XGSA 4B4CA 3I3LA 3J7AO 5E8IA 2P81A 1FMVA 2F4MB 4M71A 4BL0B 4IKFA 1X58A 3S15J 2EPFA 4FTHA 2JA2A 2FEPS 1IUYA 3K4LA 2Z99A 3FXUA 3A03A 1YHQI 1T0FA 3OYHA 3E5QA 1W1WE 2PMUA 2Z2SB 1WSUA 1R1VA 5JFRA 5DS9A 4RAGA 1KQ9A 3TO7A 2DXIA 4N4NB 4Q4ZF 2BE5F 2R7OA 3DU6A 2DPDA 2VKDA 1BI0A 3HHGA 2GWRA 5IY5H 1ZREA 2DFIA 1FBUA 5KK1A 4EATA 3ZQIA 2Y69H 2H1LA 2E1CA 3QYBA 3BTCA 4RB3C 5F0HA 3IH4A 4XKCA 3P9CA 3DF8A 3WE2A 3C2BA 1B4AA 4NQWA 4HBLA 3KLNA 5KAIC 2E34A 2LF7A 4KICA 2COBA 2WC2A 4AYBA 1GV2A 3E6MA 5JHUA 1XCVA 4Y33A 2GLOA 1LFBA 2P0WA 4EJVA 3J7YJ 1NHAA 1OISA 2PN6A 3BDDA 3BWGA 1E3HA 1ETQA 3MKLA 3CCJI 1FZPB 2JMWA 2DCEA 2RAEA 2XKOA 4MO7A 2MD0A 2KP6A 4F93B 3R60A 1X1CA 4XR6A 3QYEA 4ZYDA 4UNOA 5K1YA 2ZSHB 2LBFB 1N25A 2IA1A 3J80Z 2DO7A 3LSRA 2EINH 5EG0B 1IF1A 2WAQA 1VQ9I 2IEKA 2DAOA 2OTJI 1XCBA 2XB0X 3MWMA 3OYKA 3A02A 1UELB 2DOAA 3BT9A 2DT7B 1LEAA 2LK2A 1OYIA 3BR3A 3ABKH 1HF0A 3TBIA 3QRFF 1XMXA 3QYFA 3ZP5A 2G7UA 4LJZF 4B3AA 2VBWA 1SFOJ 2I10A 4AIJA 1KQ0A 5BMZA 1HDNA 3S1NJ 2EH3A 4Y15A 2FEZA 2F5CA 3K4JA 4XLEA 1O4XA 2RQQA 5M5WJ 3F3XA 3CF2A 2HR3A 3LA3A 3JRGA 3HHHA 2GOXB 2W7NA 2XAFA 2VODA 1ON1A 1NK3P 4C2TA 3FXRA 1XB4A 5FKMA 2DA4A 5EEAA 1O7FA 1FIAA 4F91B 2LRKD 2R7WA 1YJWI 1RZRL 1YLFA 2BW3A 4IZZA 3LE1A 1XGNA 4XL9A 2HWVA 3CMMA 4G12A 3IHUA 1ZGJA 2JTVA 3JRIA 3OYNA 2FU4A 2VT3A 3H3UA 1LJ9A 3M1EA 5KVRA 3TMOA 4E7ZA 4FX4A 2ID6A 3WG9A 1R58A 3OYIA 1I50J 1LDJA 2VB6A 2NVTJ 1XMAA 4XONA 2Q1ZB 1ZG5A 3H9QA 5KCMA 2NOGA 1FX7A 5IYCJ 4ENJA 3O6BB 2L3DA 1J9IA 2DPUA 3L9FA 1Y51A 1SMTA 5GP9A 3HBLA 5LHHA 3E5XA 3CCEI 5D6FA 2UXXA 4FX0A 4NUBA 1Z21A 2FA5A 3IHSA 2LC2A 3IAM2 4ITVA 4C3IJ 1OYWA 3HSRA 1F4KA 4ZYHA 2LKXA 3VYUB 3L2WA 2QUFA 3WGIA 2STTA 3IL2A 4O6JA 1YG2A 4JX5A 1IDYA 1GLNA 2ZFUA 1B9NA 3FBNB 1H89C 3UNGC 2HOAA 3F8BA 3DPUA 3JRBA 5HDNA 2R5ZA 4E7IA 4BJTA 2DMNA 3A2KA 3PL8A 4KISA 3QQAA 4M3EA 2I5UA 3OL4A 2XPWA 3OWTA 3IWFA 3K9TA 4EJOA 4CYDA 4ENKA 3H1CA 5IP6A 4J19A 2V1DA 4IJAA 3G6EI 3CCSI 3LAPA 5LRRA 2DFFA 2L7KA 1OYYA 1WQ2A 3BG7A 1FSEA 1EKEA 2XIGA 5E1ZB 3CCQI 3OIOA 4A3GJ 1HCRA 2EBIA 2XB5A 3MZYA 5FFXA 3D0SA 3LFKA 2Y9ZA 1OCOH 4UB6C 4MIMA 1I39A 5FKKA 1XD7A 3JRDA 1SFKA 3K4CA 4OU0A 2XDVA 1P7JA 4RLFA 4QIWN 2A6HF 5GAHJ 1ZRFA 3SDBA 2K9QA 4AC0A 5J4YA 2IW5A 2CSOA 2DYRH 1IAWA 1JKPC 1T6SA 1WGXA 1YE9A 2KL4A 2K4BA 2Y48A 5GADJ 3CCUI 2MC3A 2DA3A 2V6CA 3FF5A 1D5YA 5DD4A 3RZOJ 2FNPA 2L9VA 1XX5A 4U0YA 2AK7A 5DUKA 3MN2A 2P7VB 4EMSA 4ESFA 2WV0A 3GLXA 4I0AA 4U7DA 1U5TC 3BR2A 1AU7A 1Y0UA 2E60A 3KP7A 4OINF 2FBHA 2MSYA 3E6BA 4LIUA 4L18B 3WG7H 3SFZA 3LWFA 3JTGA 5J1UA 2F5EA 1O3RA 1LNWA 1D0ZA 1CQTA 3BR0A 5FLMJ 2EIJH 1N78A 2QYOA 3F8CA 4HX4A 4A3EJ 2P4WA 5HS9A 3F6VA 3DEWA 1H88C 3SQNA 1VZ0A 5D6EA 2HTJA 1U5TB 4RM3A 2A3SA 4KFCA 2GIZA 4KA4A 2RDPA 4BQNA 5JLWA 3IKTA 1X1DA 2QCOA 1T98A 5FROA 3BOQA 5HLTA 1T95A 1FLIA 1LUJB 2XAHA 5BS6A 1YYVA 3O8GA 4IOAF 2VOOA 2XRLA 1LEBA 3H35A 1I27A 2ESNA 3HGGA 2ZXJA 3RQ4A 3RPQA 3GYHX 2YSRA 3S3MA 3V7RA 2AS5F 2HU9A 1FTZA 2FOWA 2QGUA 3FISA 1J5YA 2MC4A 3DCFA 1FSHA 2HS5A 3NWTA 3A01A 3B6CA 3F8FA 3IP4B 3T5XA 1X4OA 3K10A 3CZ6A 2QA4I 4E4HA 2LREA 3EZAB 5IT3A 3BJOA 4Y52J 2GBYA 4ZH4F 5D4RA 2DW4A 1G6NA 2NAZA 2XPVA 3H5AA 2PEXA 3A1YA 2VXDA 4G7ZF 1H9TA 3E1SA 2A5YB 4JX6A 1J59A 2Q0OA 1S3JA 3RIRA 2H27A 5HNFA 3I59A 2DJIA 2CUZA 1ZYRF 2XAJA 4GGGA 2NVXJ 5J1RA 2GQQA 1V5GA 4LK0F 1NTCA 3O2PE 1O7LA 2XF7A 4P96A 5HNHA 3ZMUA 3OOPA 4FT8A 1MNEA 3ESWB 2DYSH 4QPQA 3KFWX 2A68F 5J40A 3EDPA 2RVCA 4K2EA 2VBZA 2M0CA 3A4CA 3M8FA 3WTVC 1ZGWA 5IT9K 3E3VA 2JK3A 4Q47A 1REPC 2HIDA 1VFCA 4KMUX 3GO5A 4PSXA 5A2QK 3F23A 2EK5A 4YIIA 2XDFC 3AG4H 1UHSA 4GFBA 3GFJA 1FYMA 1Z6TA 1IRXA 2G7HA 2QSFX 2R7TA 1SVLA 1AKHB 2BVMA 2A6TA 4V2GA 4IX7A 1IGNA 3HOUJ 3S2DJ 1YS7A 3RKQA 3V8KA 2QBYA 1W36C 2LG4A 3R4KA 1KU2A 3JSOA 3GZ5A 4Y7NJ 2BHZA 3I58A 1BM9A 2RKHA 3DLLF 3BJ6A 1Y8RB 2L02A 5HVQC 2ZJQF 1QRYA 1UG0A 1TQMA 1W5TA 3I53A 2V9KA 3M8JA 3CP8A 3AG2H 3DU5A 2DA6A 1VQ6I 4M3DA 2Q2EB 4E7KA 3SEQA 2IS4A 1OCRH 5EEHA 4DJAA 1R36A 1A04A 1X1BA 1RC9A 2H94A 2K9NA 1Y4YA 4BXUA 3IKVA 4XRSA 4G6DA 2VI6A 1OKRA 2W82A 5GPAA 2DA5A 2BYVE 1WHUA 3GFMA 4HPQA 2V1XA 3CCVI 2QKLB 3LOCA 1XSVA 2VBYA 3ZXSA 4A3IJ 2O6GE 4CZCA 1JT0A 4B3XA 1FOYA 2ZXWH 3ZCOA 1KU9A 3GW2A 4D7NA 4S05A 1U0JA 1UG2A 2E36A 1R00A 3P9IA 2CQXA 4BKXA 3BY6A 4A5NA 2DT5A 3B73A 5GPCA 1JJ8C 2RREA 3CO6C 1ZVVJ 2B7EA 4B09A 2CJJA 4HAMA 2AXLA 4YELA 4J01A 4U87A 1W5SA 2CUEA 4HYEA 3CJTB 4J00A 3HG9A 3EZEB 2M2EA 3BZKA 3HKZA 2V1NA 2A05A 1MNDA 2BOLA 3TGNA 1X1AA 3CO7C 2VC0A 3CQZJ 1QPIA 5M3FJ 4GDFA 1D1BA 2E5ZA 1MBEA 2XRNA 4LOCA 2YX7A 2E7WA 3B02A 4XKBA 1BC8C 1CF7B 2R93J 3CDIA 4A12A 1W7PA 1WJAA 2F4IA 4CYCA 3QP5A 2O8XA 5ICFA 3HOTA 3KP6A 1LE8A 2W25A 3IRRA 1XMKA 4MHGA 2OV7A 3KP5A 2UUZA 2V6EA 4CO8A 4YFXF 2B9SA 1IC8A 2K85A 3CLOA 4MLOA 1VRCC 1TQPA 2M1BA 2ZC2A 3OYJA 3MVPA 1POGA 4WF2A 1WJBA 3UR3C 5LEKA 2KLOA 1G3TA 2GAUA 1R49A 2QF7A 4IRIA 2F5FA 4ZZDA 4I0BA 1MJ9A 3BLYA 1D3YA 2VQCA 2KIUA 1ZRDA 4C3JJ 1G8XA 5D8LB 4XICA 3K4BA 2EV6A 3J80K 2KDOA 1UMQA 2FBIA 3RCOA 1JKRC 3R0AA 3HIFA 1IO2A 4CSWA 2M34A 4GRIA 2DBBA 1HW5A 2HTSA 1MSFC 3PQKA 3D5RC 1SD6A 5BNGA 3L2CA 2O5RA 4M6YA 4Q48A 1F5TA 3IAS2 3KE2A 4ZYEA 4A0YA 1VQ8I 1GVJA 4BQAA 3KIOA 3K2ZA 4W1UA 3ZPLA 3A0BC 3KPHA 1Z3YA 2K4JA 4H4KC 5C4JJ 3RYPA 3S3NA 1EH7A 5BQTA 5LBQA 4CCOA 2OCEA 3EZBB 5HS8A 4A3CJ 3CESA 5C44J 5L3DA 1MJBA 4A6DA 2KT0A 2XGEA 1IN5A 2P6SA 4IEJA 1B6AA 1ENHA 2IBDA 2QKMB 4CCLA 2HQ5A 1RR8C 2R7FA 5DM7F 2OD5A 2ETHA 4I99C 4WCGA 3L2VA 1BN5A 1B1BA 3K69A 2R7SA 4I02A 1ZTRA 1DGRM 3BQZA 4B44A 4G8XA 1ZELA 1VQLI 1MIJA 5E3OA 2IRFG 1JKOC 4F7ZA 3L7WA 4AUXA 1MBKA 3L1PA 3LNWA 4UY8I 3TOBA 4U0WA 4HG2A 1FOWA 2O7OA 4XKWA 1F9NA 4JBAA 4HOBA 5LGTA 2JJ7A 2L4AA 2JPCA 2CUFA 2LMDA 5FD6A 3TP3A 4D5CA 1R5GA 4ON0A 3P7NA 2YR2A 5IYDJ 1LVAA 4UUVA 3LQQA 1T56A 3GLLA 1WJCA 2DMPA 2WADA 1W0TA 3GCMA 5HDGA 3LL7A 2MLKA 4AIHA 4BQQA 4AIKA 1MU4A 1UFMA 5EF6A 5EG0A 4IHVA 2D1HA 4F92B 2QSGX 2XC7A 4CDGA 2D5VA 4PK4A 1AKHA 4MTDA 2HFHA 3OIPA 4AWXB 3BR5A 1KA5A 3K4MA 1IN6A 1A6QA 2Q8KA 3WGGA 4ZC3A 4QWQA 1ETVA 3CF5F 3KP3A 1B8IB 3GTGJ 1TLHB 4KIBA 4FISA 1VTNC 1BR1A 1PVEA 1HKQA 1IN4A 3JCUC 4EM0B 2L4MA 4R8HA 3NWSA 2DOEA 4OOIA 3PNYA 1IW7F 1TWGJ 2OAZA 3V8JA 1YRNB 5M3MJ 1PUEE 4RB2C 1K7AA 3OV8A 3HXLA 3OS2A 3ZQFA 3PSIA 2JA7J 5DTDA 2JVGA 2GA1A 3F8MA 3OSGA 4MEYF 4Z6YA 3IC7A 4LITA 5D5XB 2VONA 3S17J 3QPTA 3DTIA 3F8NA 4BJ5C 1PUFB 3ZMTA 2KDZA 3BZCA 2CQKA 2K9MA 5E3NA 4PJNA 4LMYA 3D5SC 1J0RA 2JSPA 2DA2A 2EIMH 4I76A 1VNDA 3QAHA 4FE4A 4M73A 3WTSC 3G3ZA 4UXNA 2JRMA 4XOPA 2EZIA 4A2UA 3IH2A 2OZ6A 2NS8A 4L5JA 1TWAJ 2M9HA 2CUJA 2ESHA 3K6GA 4A3JJ 2YUSA 3ASOH 2Y0SN 2JA8J 4XORA 4A5MA 1SANA 1D5VA 5IOYA 1WJ5A 2XHKA 2ECBA 2F5VA 3DLAA 5E3LA 5T1OA 1D0YA 2LKPA 2LRDA 4EJUA 2F5DA 4D1QA 3OYCA 3LMMA 4RB1A 2XGCA 1GVDA 3U21A 3N05A 3PFYA 1WI3A 2MD5A 2X4HA 4JK1X 4M9SA 3JSPA 5HODA 2PJRB 1SAUA 1PYVA 1YX3A 1K6OA 3I54A 4PJLA 4A6EA 2O03A 5J47A 3VPRA 1XPXA 2Y30A 3H3VK 2K40A 2KIMA 5E79C 4HRIA 1IDZA 3HOVJ 2KIFA 2YX4A 4YFKF 2OTLI 2VJ5A 3QOPA 1Q1VA 4C2MJ 3JREA 2R7RA 4DYQA 1B72B 1DP7P 1DU6A 2QZ8A 3BTJA 3HOWJ 1Y6IA 2QQ9A 1SD4A 5H6RA 3AL0C 2Y31A 1QVTA 3HSEA 1W4MA 1F36A 5EZHA 3H9JA 5J3LA 5GAEJ 4OMYA 5CQEA 2X6XA 2HNHA 3MFKA 1R6RA 2VL8A 3FK7A 3QU6A 2E1NA 2M4KA 4NBQA 1RKTA 2LDUA 3S1MJ 1WJEA 3BG5A 5FLXZ 2RNJA 1E3PA 3CCMI 4R1HA 2R7VA 1U8RA 3QPLA 3LSHA 1TQIA 3OMYA 5FKLA 3MEXA 5CJ9A 1JE8A 1A35A 2Z33A 4XLAA 5HS7A 3OQND 2VPLA 2X51A 1TC3C 2LFBA 1JTYA 1IXSB 1UHWA 2KRFA 3PUBA 4HSRA 4EV0A 2X6YA 2JUGA 1EJ9A 1MW7A 2L2OA 2ACJA 3HJEA 3QU3A 2ZB9A 1A36A 3CUOA 1UAAA 3BZ6A 1HDPA 3CJQB 3N4MA 4JYKA 1MGTA 3GTKJ 3AL0B 4AIDA 4HNVA 5KAFC 4WWCA 3GTJJ 2OBPA 1FT9A 3MKWB 2CW7A 1T2KA 4CXFA 2L0KA 3X2QH 2MBFA 2MH2A 2W85A 3OYAA 3D1NI 3MKYB 3DXJF 3IRQA 3CCRI 5E3MA 3CMEI 1BI1A 1HQCA 2GA2A 4RGRA 1G4DA 4HQEA 2W84A 3K7AJ 1G3WA 4R79A 2QWWA 5LHGA 1HC8A 2O8KA 2HXIA 3DBHB 3G1LA 2EIKH 3GZNB 3W2WA 5K7ZA 2XGXA 4ZTFA 3GX4X 1PDNC 3LA7A 4QSHA 5EZGA 1IJWC 4BUPA 3BG9A 1P7IA 3M4OJ 1ERDA 3LE3A 5ICGA 2QVOA 3S32A 2GZWA 3O8HA 2ZBKA 1DUXC 1S6LA 1R4MB 4ENMA 4G6QA 2V4JC 3OYMA 3CMYA 2JWTA 4LG3A 4UV9A 2OC6A 1APLC 1E3OC 3KZYA 1HW2A 2OQRA 2XPUA 3LSIA 3I59B 2UWMA 3LSKA 3E0JB 2AO9A 5BPDA 1JKQC 2A07F 2R7UA 2G0EA 3ECOA 1QBJA 2VPRA 2NVUB 4L9JA 2PX9A 3ULQB 4RDUA 5JVGF 1B59A 4KIGA 2CQNA 4BE2A 2E1MB 1LDKB 4LG0B 4Y17A 5TGTA 1ONVA 2ZCWA 4IQJA 4IRHA 5CVVA 4C3HJ 1BL0A 1WJFA 1BJZA 2LLKA 1R23A 2Q2EA 3VYRB 4ZZLA 1GHCA 2DA7A 3ERMA 1U9OA 5D8KB 1FYLA 3S2HJ 3G1OA 3COAC 1MZBA 1TWCJ 1JGSA 2HKOA 4HF2A 3LQRA 4UVCA 4WXHA 5ERIA 3JTHA 3TO6A 5ED4A 1FBSA 4ZDOA 3S2WA 1SFXA 2ZKZA 2O61A 3QODA 2CQQA 3CC2I 1H9GA 1IXRC 3FWEA 3S1RJ 2YS9A 3W6JB 4OIQF 5EGOB 3F72A 4ZYGA 1BIBA 4DBQA 5JR3A 5DCMB 2MA3A 3VFZA 3RYRA 4XRSG 3BP8A 3CDLA 2LBFA 1PFHA 5L3EA 1JEMA 2LY9A 1FIPA 5KHDA 2DDBA 3OYBA 3CLQA 3M9AA 5TJJA 3VYSB 5AONA 1LKXA 2MLGA 2E2HJ 2RV8A 4RS8A 4I7HA 2AHQA 4KMFA 2E7XA 1PUFA 5EYRA 1D8KA 4ZDPA 3L2UA 3KEYA 4IHSA 1BW5A 4XKVA 1JUMA 1D1AA 4LFUA 3LSPA 1AWCA 2K9SA 2BXYA 2WA0A 4A93J 2TDXA 4M72A 4X6AJ 2E35A 1LFUP 1A31A 1BR4A 4OAYA 2PI0A 1K6YA 3N97A 5LLQA 1W0UA 1EH8A 3JAMK 4AM3A 1TZLA 1IXCA 1YS6A 1EV7A 3PO2J 1JHHA 3K1MA 2M5WA 3K70C 1YTYA 1S9HA 4AVZA 2XF6A 4L5IA 2ZFWA 1TWHJ 4DW6A 3MCZA 4MNUA 4A3BJ 4Q5SF 3V42A 2VUMJ 4JP0A 4XOTA 3JW4A 4P9FA 3OSFA 3R6SA 3IUOA 3T1BA 1SC7A 2OA4A 2G9WA 4KDPA 4UUSB 3LFUA 4AU7A 4O5VA 1RUNA 2QM3A 2NS7A 1S7OA 2D1VA 2V79A 3LSTA 4O3MA 2K86A 1GGRB 4HQMA 1XTAA 1LPQA 1TW3A 5J8CA 4XN0A 4KITB 1RRJA 4B1RA 4ZTJA 2FUG2 1S7EA 2DFEA 2DU9A 3OYDA 1MBJA 1FTTA 5F08A 4CCJA 3RZDJ 2RQPA 1FMWA 2KISA 1B8IA 2FQ4A 3HUGB 2BVLA 4F55A 1X2MA 5B66C 4EM2A 3PJRA 2WWYA 2M8GX 1PJRA 2XVCA 3FHZA 4EEFG 4UUSA 2DTRA 3AG3H 2EFNA 2R3SA 5E17F 3DPLC 2CO5A 4YRVA 2WB1N 5M5XJ 1T33A 2X1DA 1W36D 4C9YA 3OL3A 3LSJA 2DODA 5FGMA 2OCCH 1K79A 1QA6A 5IT9Z 4HSTA 4FCYA 4C30A 3JRHA 3PFIA 4BS9A 3ZMSA 2ZNYA 4ZDLA 2E2IJ 4XWJB 3PUFA 3CJRB 1V4RA 4EM1A 2K02A 2A5WA 4E70A 3R0JA 2YU9J 4ANJA 2L7MP 3FMRA 2CH0A 2HOEA 2L5QA 2LY1A 1X2NA 4BGDA 4BE1A 3W6VA 1TTYA 3OYEA 2ICWG 2WB1A 2BW3B 1TBXA 2VT2A 1I1SA 2M87A 3CP2A 2XV4S 2DOFA 1TXEA 1RPWA 1Z91A 2L54A 4GCVA 1BJAA 4IXAA 1MO1A 1MMGA 4EVIA 1YX5A 4RGSA 1MSEC 1YI2I 3E5UA 4PFPA 4ABZA 4BHPA 4E7HA 2IA0A 3NRVA 2VASA 4JQFA 2W57A 5CVIA 3RI4A 2EV5A 5IOZA 3WU2C 3GTQJ 3HRUA 3EUAA 2VJ4A 1A6IA 3GUDA 5ILVA 5H20A 3RKWA 1V3FA 2KZVA 1YO5C 5FRNA 3EQLF 2XAUA 3I56I 4G6TB 4GYIA 2OF7A 3Q3SA 3EYIA 2QENA 2X48A 3ZQHA 3W6KB 5ILUA 1I6XA 2A6EF 3LFGA 2W48A 1KGSA 3MKZA 2QLZA 3F6OA 2O9LA 2V9VA 2R7XA 2HDCA 4DOZA 4L0ZB 1Z3XA 3PM1A 3I0TA 4JOMA 5CPRB 4F52A 3L2RA 1MBGA 4PZJA 1R71A 2UXNA 4EQQA 1D8JA 1OCZH 1QZYA 3I55I 1WRJA 2QBYB 3KZZA 4IL6C 2ELKA 2CW8A 4B48A 2CV2A 3FDYA 1R5ID 3FXKA 3MQ0A 5LFAA 2PJRA 5F6FA 5FRMA 2ISYA 2DA1A 2HYJA 4HX8A 1YIJI 4X0GA 1UHMA 3ASNH 2WAFA 1J6TB 1R4NB 2MABA 5DD8A 1YIOA 2M7AA 3OQOD 3C7JA 3KYCB 3GXOA 4HV5A 5D5VB 1USTA 4B43A 3CDHA 1JUPA 2HQAA 3FBIB 1K61A 4PJJA 1LQ1A 2VJIA 3BR1A 2Z5UA 3BG6A 4M9ZA 3GTPJ 2QEXI 2NXNB 2CS3A 1I1GA 3HPHA 2WY8Q 3HSFA 2ELHA 2HVSA 2DI3A 3SFIA 1J7KA 3DBRB 4PJMA 2VIXA 1SVOA 2VQLA 3DEEA 3RJPA 3H3ZA 1WI9A 2CFOA 4HNUA 4QLCU 1MH4A 3I71A 4EJWA 4WK8F 3A0HC 2N8GA 5E18F 4XMYA 2FE3A 1H0MA 3HTSB 1T08B 3QPSA 2VQGA 3QPHA 2VE9A 1QZZA 3WHCA 4KT5C 5FFZA 3E6DA 3RKYA 4LIVA 4JX4A 4HDUA 1ZRCA 4BJ6C 4ENNA 3PNTA 5A2QZ 4XLCA 2Z9OA 2DK8A 4M3BA 1QFRA 5E1WA 1RNLA 3TW6A 3GEZA 4M3GA 4XN3A 1OCTC 2HDWA 1T38A 3C1DA 4BHCA 1F1ZA 1T39A 1ZLKA 1BOAA 2V26A 3QWLA 3HUGA 1TT0A 3DBLB 2IP2A 3ZRGA 4AYBN 5EEGA 2X9DA 2BY1A 4DZPA 1K78A 1WH7A 2HQRA 3OIQA 5BPIA 4XRMA 2GXBA 1USSA 2EFQA 3Q9VA 3VYTB 2TRTA 4XM3A 1Y1WJ 1F43A 4BEHA 2XASA 2CV0A 2FF4A 2X6OA 1X1PA 3BPXA 1ZR2A 2E5NA 3AG1H 3BCAA 5KNLA 2ZMEC 2DN0A 4GYGA 5AIQA 3AFHA 4IOCF 3LSGA 1Z1DA 3KYDB 5BOXA 1GXPA 4L0YB 3S93A 1SPHA 2DMTA 4CH7A 2IGKA 3PIOF 1P9QC 4A3FJ 2EFWA 5FKNA 2FD5A 2KPMA 4BACA 1QGPA 5CQGA 2ZMEB 4N9HA 2FBKA 3DP7A 4Y13A 4PDKA 3J7AY 1Z77A 2JA6J 1QR5A 2KMUA 2HGCA 2Y2ZA 1XDSA 1Y39A 2JN6A 1NH3A 4NC8A 1P92A 4BAYA 4N0BA 1RI7A 1V55H 5LD2C 5L3GA 3ZN1A 4E7JA 2OQGA 1MD0A 2HZTA 4BYYA 3BC8A 2L9NA 4BY7J 2R4GA 4Z2YA 2BHYA 3K0LA 5F1RA 1IRFA 5GAGJ 3I4NJ 4MEXF 4MFDA 2JQ7A 3H0DA 2FRHA 3K70D 1TNSA 1FWZA 2F2EA 1BR2A 3I4PA 3M07A 4XSXF 4RA2A 1ZARA 3I64A 2H8WA 2IJLA 3ZMDA 3BJAA 4HZFA 2JVHA 4P9UA 3Q0WA 1FC3A 1WCMJ 5D5WB 1STZA 1XDUA 2BY2A 4YG2F 1HDDC 2HOSA 2J5OA 5B3SH 4H0EA 1R9TJ 4G7HF 2IS2A 2M7BA 3MZHA 2QQ8A 3KCCA 2CRGA 1HKTA 1Y56A 3HDDA 2MW8A 5H6QA 2DJNA 1KU7A 1OFCX 1PP8F 1U6GA 2XF5A 1EH6A 1Z7UA 5CLSA 1MMSA 5CYVA 4OMZA 5K5QA 3VSLA 1G2HA 3P9KA 3HOXJ 1IN8A 3SJMA 3WE3A 1UJ8A 2VXZA 2ZJ2A 2Y9YA 2Z3YA 5JHFA 1QHHD 1YW7A 2X85A 4HLYA 1ITYA 1S7AA 4RAZA 4EGZA 1Z9CA 3REOA 3ABUA 4LD5A 1MNMC 4BE0A 2DT6A 3RSNA 3SXYA 4G9YA 3SHFA 1GV5A 3DTEA 3WU0A 1DPUA 1A5JA 3RPUA 4P55A 3HZJA 1ETYA 3ZQQA 1FPQA 2M30A 2PG4A 3FM5A 4CZZA 3ECHA 5B1AH 3H5NA 4G7OF 2PMZA 3J81Z 2UV1A 4CCMA 4I01A 2FNAA 1GT0C 1EF4A 1D0XA 5F0FA 1P2FA 2CYYA 1EA3A 1GUUA 5J6XA 3HB9A 3ABTA 3SYTA 1XG1A 2P5LC 4KT6A 3TP0A 1U2WA 1FOKA 2IS6A 2EWNA 1FP1D 3FXMA 1E2XA 2DMUA 1QVUA 2M8EA 3O3KA 5T1NA 1XS9A 1DQUA 5J8FA 5LEJA 1I6HJ 1QNTA 5HLIA 5DCFA 2MH9A 1X4PA 3EUHC 3WTXC 2CFXA 1MBFA 2JZYA 4NC7A 2LSOA 4E7SA 2R0QC 1K4TA 4YIFA 1ON2A 3U1DA 4DIQA 3EUKL 2V1UA 1MO1B 2A61A 3HPGA 1ETWA 2VKVA 1X3UA 1ZG1A 4KYWA 1TW2A 3L09A 1W7PD 3E97A 4OIPF 2RLZA 4U7BA 1NK2P 1PTFA 3HKZN 1P4AA 1O57A 1IG7A 1R1TA 1FU0A 4IF4A 4BY1J 3SZGA 1HKSA 3NEUA 4MQ9F 5AIPA 3E6CC 3SEZA 1KONA 1QPMA 2GXGA 2IPQX 1T0FC 1Z67A 4L9TA 3FKIJ 1MKMA 2HVQA 2JT1A 2BV6A 2MFZA 1WWXA 4XNFA 3HEFA 2R5YB 4D7MA 5DUIA 1RR7A 1L0OC 2EZHA 2R7QA 4A0ZA 3ZMVA 3Q0UA 3S16J 3FIWA 4BBRJ 3T0YA 5CKTA 2IGMA 2JA5J 2ZSIB 2W00A 1UB9A 3W2VA 4BU2A 3HOSA 4M74A 3ELKA 2P7CB 4OIRF 1D1CA 4BXXJ 4FQGA 1ODDA 4IHYA 3GF2A 3M3YJ 1HBXG 3CUQC 4XBFA 2CWEA 2PMHA 3CMAI 4PUSA 3F21A 3G71I 3DQVC 3H0GJ 3KZIC 1VF9A 4OAZA 4S0HB 4U88A 1H8AC 3ERED 1XGMA 4HEA2 3CCYA 3S8PA 4DBRA 2E19A 1MH3A 4RBOA 2VBXA 2WV1A 3P5JA 4KNYA 1Y1VJ 5J1YA 2LF8A 2HEOA 3DKYA 3L2QA 4II2A 3TOAA 3MAJA 4HV6A 3DKWA 3V4GA 1ZLJA 2RC4A 3H5RA 5GTIC 1K4SA 1G3YA 1YOVB 3IH3A 3T8RA 4WX9A 4TV7A 4NB5A 1OPDA 3ZR8X 2LY2A 4HLXA 3WU1B 4M6VA 1WVRA 5K7HA 3CC7I 2D2WA 5J4VA 3BTLA 2EILH 3WTYC 2GOMA 4LB5A 3MZ8A 2KQRA 1BI2A 2M45A 2LRLD 3PIPF 4BQOA 2XAGA 2DFHA 4DYRA 4A3LJ 2BZTA 3OS1A 2EJRA 3S3OA 3RTRA 1RZ4A 1ZR4A 3GFIA 1HOMA 5CVJA 4KJZA 2K9LA 2L9RA 4L9VA 3G4SI 1MJAA 4KN7X 1POHA 3C2GA 1BI3A 1V5EA 2NZVL 1AA7A 2KRHA 3AKZA 3HL2A 1U8BA 4G94A 1WJDA 1ZK8A 2VLAA 1TP4A 1ZH5A 3HRSA 3KYLA 2ECCA 3ZQGA 4IVNA 2NNYA 4AD9A 4B47A 3HRMA 2HVRA 2LOOA 3FK6A 3EYYA 3FKJA 5EJCA 1MMDA 4XSZF 3HYIA 3W3CA 1W7PB 1L3LA 1HLVA 2Y75A 1BIAA 2LH9A 2JUCA 4PFOA 1U78A 3DKXA 2YPRA 3WTWC 1W5CC 2B63J 1ETKA 3S1QJ 1ZQ3P 3RPUD 2FX0A 1DDNA 2RN7A 5B1BH 2EZLA 3MD2A 3ZQLA 4ZYAA 3TQNA 2C6YA 4RGXA 2Z1DA 3I9V2 1BOBA 4PSWA 4NNJA 3K1NA 3WODF 1UCRA 5HOOA 2CMPA 2W1OA 3GTLJ 1PCHA 4LLLA 1QHGA 4A3KJ 1C0WA 2FMLA 3I5UA 1XGOA 4HA8A 1RKWA 1SMYF 4N4OB 2VC1A 4YEJA 4MGRA 1Z05A 4KIFA 4S04A 4BDZA 2FQ3A 2ME6A 4IHTA 6PAXA 4ZJZA 1RESA 1IUFA 1Z7LA 4GO1A 1B72A 2BY0A 1LFPA 1WKMA 3BG3A 4DNCA 1TNTA 5IYBJ 4RB0A 5C3EJ 2HPIA 2EFPA 5F0CA 2M4GA 4V2FA 2STWA 2KJCA 2ZNZA 4HF0A 4QPOA 3HGYA 1MBHA 4II3A 2K27A 2GM4A 1RETA 1IV8A 3A01B 5D4SA 1IRGA 3D5LA 4M9XA 2EQRA 4OWRB 2W4SA 4XQFA 3OY9A 4DYCA 1ZHFA 2R7DA 4IO9F 1KQ8A 5DM6F 2JPBA 3FXOA 2L7ZA 3C3WA 2IGNA 4D0PA
chains in the Genus database with same CATH topology
4HX7A 1HW1A 2EB7A 2WTEA 2KKOA 1P6RA 5L3CA 5HLGA 1BBYA 2O0YA 2X0LA 3IWZA 5ILSA 3V8LA 3FMQA 2ISZA 3WGHA 4WXCA 1CF7A 1SD5A 1R5HA 4EGYA 5LGUA 3KP2A 1U5TA 1FP2A 5K5RA 3CJNA 1SFEA 4BNCA 3DFGA 3HRTA 2EA2A 3M8EA 4FHTA 1FYKA 1PP7U 1S29A 1P4XA 3GZ6A 3ML6A 3VB2A 1QQIA 4ESJA 1CGPA 4PGHA 3ISPA 1R1UA 5CVRA 5JVTA 1OMIA 1K78B 1DPRA 4L9NA 1XN7A 4IRGA 3NQOA 1O3SA 3EETA 1YFHA 2P5KA 2PQ8A 1SAXA 1RIOH 4UHTA 2BGCA 4XLNF 4ESBA 1Q1HA 5E20A 4LG0A 1XSXA 2QQBA 1ZGAA 4MTEA 2EFOA 1ZAOA 5CVUA 1IN7A 4AVPA 3G73A 4A0XA 5HDKA 1SD7A 2FMYA 4RGUA 3CUQA 5ICEA 3LAJA 2P5VA 4M6XA 4RAYA 2CG4A 5FB2A 4CGZA 2P6TA 3VOEA 2OU2A 4BH9A 4XLPF 1YW9A 1JXSA 3U9GA 3SZPA 3ZQ7A 2A69F 3FM3A 4XRFA 1KU3A 2VN2A 4OIOF 3FZVA 4I09A 4B8XA 2H09A 2H6BA 2IA2A 4IPAA 3C18A 4GXOA 1YQAA 3ZN0A 5D5UB 2L01A 2J5PA 4LLNA 3RKXA 1MDMB 4EJTA 2HQNA 4LB6B 1LDDA 5DEQA 5JI6A 3TO9A 1FY7A 2DLLA 4CICA 5TRDA 2ADUA 2GIVA 1ULYA 2VOPA 1I5ZA 5LGNA 3L00A 1ZG3A 1RUOA 3K1PA 4I98B 1HXDA 2QQAA 5FLXK 4PGGA 1FNNA 4N9IA 3TKYA 2HYGD 1SFUA 1J2XA 4ETSA 1R22A 1Z6RA 3M7GA 4HDVA 2XAQA 1OR7A 3ZMZA 3KETA 3FX3A 3KLOA 3KEOA 2KJBA 3SZTA 3Q5FA 5DV5A 2JRTA 4ASNA 5K5OA 1KYZA 1AOYA 2NS0A 2IVMA 3HTUA 3KP4A 2HKXA 1G3SA 3LA2A 5LHIA 2YU3A 2FXAA 3KEQA 2ZO4A 2OZUA 3VODA 4NHJA 3VEPA 2PLYA 3F22A 1QO0D 3GWZA 3DEUA 4P5OA 1KYWA 3PQJA 3TDZC 3DPTA 2ZMEA 3BROA 5FO5A 1R7JA 1GXQA 3FMSA 2HYFA 4LGWA 3U2RA 5DYMA 3V7CA 1U3EM 1LB2A 5E8GA 3JAMZ 4UV8A 1O3TA 4KN4X 4LLGF 1HSTA 3WTZA 3QP6A 3J81K 2DQLA 3BPVA 4LK1F 3WTTC 1XSDA 4WXDA 2XUBA 2D45A 4PCQA 2FOKA 2XROA 2EV0A 4I2OA 4U0VA 2H6CA 5L3BA 2PFBA 3ROUA 5LRSA 2BBYA 4CHUA 2NRAC 5DCMA 4UVAA 2EA4A 3CUQB 5FD5A 3Q9SA 2B0LA 2P8TA 5E1XA 2BEOA 2K7LA 1P4WA 1HSJA 2CW0F 2FSWA 1ZN2A 2PJPA 2JSCA 2XKPA 3R61A 2NYXA 3T8TA 1E17A 2DK5A 2UZKA 2IT0A 5ICCA 2O3FA 2NNNA 3TDUC 3GFLA 5F64A 2CGPA 1J75A 3H92A 1MDMA 3AAFA 2LNBA 5L3FA 2VE8A 3WTUC 3CTAA 5DDGA 3GVAA 1O3QA 4UVBA 3V7SA 1BC7C 1KA8A 3DV8A 2W24A 1OPCA 1S8NA 2PBIA 1IZ1A 3EUHA 3RDIA 4DQ2A 2COMA 4KUMA 5HLHA 3FXQA 2DQRA 1JHFA 1YW8A 2RGVA 1B9MA 4YFNF 1FBQA 2Y0MA 4MQVA 4HW0A 4BHBA 1XGSA 3J7AO 5E8IA 4M71A 1IUYA 2Z99A 3FXUA 1T0FA 3E5QA 1WSUA 2PMUA 1R1VA 5JFRA 1KQ9A 3TO7A 4Q4ZF 2BE5F 2DPDA 1BI0A 3HHGA 2GWRA 1ZREA 2DFIA 1FBUA 5KK1A 2E1CA 4RB3C 3P9CA 3DF8A 3WE2A 1B4AA 4NQWA 4HBLA 3KLNA 4KICA 2LF7A 2WC2A 3E6MA 5JHUA 1XCVA 4EJVA 1NHAA 2PN6A 3BDDA 3BWGA 1FZPB 2XKOA 3R60A 4ZYDA 4UNOA 5K1YA 2IA1A 3J80Z 2DO7A 1IF1A 2DAOA 1XCBA 3MWMA 1LEAA 1OYIA 3QRFF 3ZP5A 2G7UA 4LJZF 2VBWA 4AIJA 1KQ0A 5BMZA 4Y15A 2FEZA 2F5CA 3F3XA 2HR3A 3LA3A 3HHHA 2XAFA 2VODA 1ON1A 3FXRA 1XB4A 1O7FA 1YLFA 1XGNA 2HWVA 3IHUA 1ZGJA 2JTVA 2FU4A 2VT3A 3H3UA 1LJ9A 3M1EA 5KVRA 4FX4A 3WG9A 1R58A 1LDJA 1XMAA 1ZG5A 1FX7A 4ENJA 3O6BB 2L3DA 1J9IA 2DPUA 3L9FA 1SMTA 5LHHA 3E5XA 5D6FA 2UXXA 4FX0A 2FA5A 1OYWA 3HSRA 1F4KA 4ZYHA 2QUFA 3WGIA 2STTA 3IL2A 4O6JA 1YG2A 1B9NA 3F8BA 5HDNA 3IWFA 3K9TA 4EJOA 4CYDA 4ENKA 2V1DA 4IJAA 3LAPA 5LRRA 1OYYA 1WQ2A 1FSEA 2XIGA 5E1ZB 3MZYA 5FFXA 3D0SA 3LFKA 1XD7A 4HF1A 4OU0A 2A6HF 1ZRFA 2IW5A 2CSOA 1IAWA 1T6SA 2K4BA 2Y48A 2MC3A 2V6CA 3FF5A 5DD4A 2FNPA 4U0YA 5DUKA 2P7VB 4EMSA 4ESFA 2WV0A 3GLXA 4I0AA 4U7DA 1U5TC 1Y0UA 3KP7A 4OINF 2FBHA 3E6BA 4L18B 3SFZA 3LWFA 3JTGA 2F5EA 1O3RA 1LNWA 2QYOA 3F8CA 4HX4A 2P4WA 5HS9A 3F6VA 3SQNA 5D6EA 2HTJA 1U5TB 2A3SA 4KFCA 4KA4A 2RDPA 3IKTA 1T98A 3BOQA 1FLIA 2XAHA 5BS6A 1YYVA 2VOOA 1LEBA 1I27A 2ESNA 2ZXJA 3RPQA 3GYHX 2YSRA 3V7RA 2AS5F 1J5YA 1FSHA 2HS5A 3F8FA 3T5XA 5IT3A 3BJOA 4ZH4F 5D4RA 2DW4A 1G6NA 2NAZA 2PEXA 4G7ZF 1H9TA 2A5YB 1J59A 2Q0OA 1S3JA 3RIRA 2H27A 3I59A 1ZYRF 2XAJA 4GGGA 2GQQA 4LK0F 3O2PE 1O7LA 4P96A 3ZMUA 3OOPA 4FT8A 3KFWX 2A68F 3EDPA 2RVCA 4K2EA 2VBZA 3M8FA 3WTVC 5IT9K 3E3VA 4Q47A 1REPC 4KMUX 3GO5A 5A2QK 3F23A 2EK5A 4YIIA 3GFJA 1FYMA 1Z6TA 2G7HA 1YS7A 3V8KA 2QBYA 3R4KA 1KU2A 3JSOA 3GZ5A 3I58A 1BM9A 2RKHA 3BJ6A 2L02A 5HVQC 1TQMA 1W5TA 3I53A 5EEHA 1R36A 1A04A 2H94A 4BXUA 3IKVA 4G6DA 1OKRA 2BYVE 3GFMA 2V1XA 2O6GE 1XSVA 2VBYA 1KU9A 3GW2A 4S05A 1R00A 3P9IA 3BY6A 4A5NA 2DT5A 3B73A 3CO6C 4B09A 4HAMA 2AXLA 1W5SA 4HYEA 3TGNA 3CO7C 2VC0A 2XRNA 1CF7B 2YX7A 2E7WA 3B02A 1BC8C 4A12A 1W7PA 3QP5A 2O8XA 5ICFA 3HOTA 3KP6A 2W25A 3IRRA 1XMKA 4MHGA 3KP5A 4CO8A 4YFXF 3CLOA 1TQPA 2M1BA 4WF2A 5LEKA 1G3TA 2GAUA 4IRIA 2F5FA 4ZZDA 4I0BA 1MJ9A 1D3YA 2KIUA 1ZRDA 5D8LB 2EV6A 3J80K 2FBIA 3R0AA 3HIFA 2DBBA 1HW5A 2HTSA 3PQKA 1SD6A 3L2CA 4M6YA 4Q48A 1F5TA 3KE2A 4ZYEA 4A0YA 1GVJA 4BQAA 3K2ZA 3ZPLA 2K4JA 3RYPA 1EH7A 5BQTA 5LBQA 5HS8A 5L3DA 1MJBA 4A6DA 1IN5A 2P6SA 1B6AA 2R7FA 2OD5A 2ETHA 4WCGA 1BN5A 1B1BA 3K69A 4I02A 4G8XA 2IRFG 4F7ZA 3L7WA 3TOBA 4U0WA 1F9NA 4JBAA 4HOBA 5LGTA 2L4AA 2JPCA 5FD6A 1R5GA 4ON0A 3P7NA 2YR2A 1LVAA 4UUVA 3LQQA 5HDGA 2MLKA 4AIHA 4AIKA 1UFMA 2D1HA 4CDGA 4MTDA 2HFHA 4AWXB 1IN6A 2Q8KA 3WGGA 4QWQA 3KP3A 1TLHB 4KIBA 1VTNC 1HKQA 1IN4A 4EM0B 2L4MA 4R8HA 4OOIA 1IW7F 2OAZA 3V8JA 1PUEE 4RB2C 1K7AA 3OV8A 2GA1A 3F8MA 4MEYF 3IC7A 5D5XB 2VONA 3QPTA 3F8NA 3ZMTA 2CQKA 4LMYA 1J0RA 3QAHA 4M73A 3WTSC 3G3ZA 4UXNA 4A2UA 2OZ6A 4L5JA 2ESHA 1D5VA 4A5MA 2XHKA 2LKPA 4EJUA 2F5DA 4RB1A 4JK1X 2MD5A 2X4HA 4M9SA 3JSPA 1K6OA 3I54A 4A6EA 2O03A 2KIMA 2KIFA 2YX4A 4YFKF 3QOPA 1DP7P 2QZ8A 2QQ9A 1SD4A 5H6RA 3HSEA 1W4MA 4OMYA 3MFKA 3QU6A 2E1NA 2LDUA 5FLXZ 2RNJA 4R1HA 1U8RA 1TQIA 3MEXA 5CJ9A 1JE8A 2Z33A 5HS7A 1IXSB 1UHWA 2KRFA 4EV0A 2ACJA 3QU3A 3CUOA 3BZ6A 3N4MA 1MGTA 4WWCA 2OBPA 1FT9A 1T2KA 4CXFA 2MBFA 2MH2A 2W85A 3DXJF 3IRQA 1BI1A 1HQCA 2GA2A 4RGRA 1G4DA 4HQEA 2W84A 1G3WA 4R79A 2QWWA 5LHGA 2XGXA 1PDNC 3GX4X 3LA7A 5ICGA 2QVOA 2GZWA 2ZBKA 1DUXC 1S6LA 4ENMA 4G6QA 4UV9A 1HW2A 3KZYA 2OQRA 3I59B 2UWMA 5BPDA 2A07F 3ECOA 1QBJA 3ULQB 4L9JA 1B59A 4KIGA 1LDKB 4LG0B 4Y17A 1ONVA 2ZCWA 4IRHA 5CVVA 1R23A 2Q2EA 4ZZLA 1GHCA 5D8KB 1FYLA 3COAC 1MZBA 1JGSA 2HKOA 4HF2A 3LQRA 4UVCA 4WXHA 5ERIA 3JTHA 3TO6A 5ED4A 1FBSA 3S2WA 1SFXA 2ZKZA 2O61A 1H9GA 1IXRC 3FWEA 3W6JB 4OIQF 3F72A 4ZYGA 1BIBA 5JR3A 5DCMB 2MA3A 3VFZA 3RYRA 3BP8A 5L3EA 3M9AA 5TJJA 5AONA 2MLGA 2RV8A 4RS8A 4I7HA 4KMFA 2E7XA 1D8KA 4IHSA 1AWCA 4LFUA 2TDXA 4M72A 2PI0A 3N97A 5LLQA 1EH8A 3JAMK 1IXCA 1YS6A 1EV7A 1JHHA 3K1MA 2M5WA 1YTYA 4L5IA 2ZFWA 3MCZA 4MNUA 4Q5SF 3JW4A 4P9FA 3R6SA 3T1BA 2OA4A 2G9WA 4KDPA 4O5VA 1RUNA 2QM3A 2V79A 1S7OA 2D1VA 3LSTA 4O3MA 2K86A 4HQMA 1TW3A 5J8CA 2DU9A 2RQPA 4EM2A 2WWYA 2XVCA 3FHZA 2DTRA 2EFNA 2R3SA 5E17F 3DPLC 2CO5A 5FGMA 1K79A 5IT9Z 3PFIA 3ZMSA 2ZNYA 1V4RA 4EM1A 2K02A 4E70A 3R0JA 3FMRA 2HOEA 1TTYA 1TBXA 2VT2A 1I1SA 2M87A 2XV4S 1Z91A 2L54A 4GCVA 1BJAA 4IXAA 4EVIA 4RGSA 3E5UA 4BHPA 2IA0A 3NRVA 4JQFA 2W57A 5CVIA 3RI4A 2EV5A 3HRUA 3GUDA 5ILVA 5H20A 3RKWA 1V3FA 1YO5C 3EQLF 4GYIA 3EYIA 2QENA 3W6KB 5ILUA 1I6XA 2A6EF 1KGSA 2QLZA 3F6OA 2V9VA 2HDCA 4L0ZB 3I0TA 4PZJA 2UXNA 4EQQA 1D8JA 1QZYA 1WRJA 2QBYB 3KZZA 3MQ0A 5F6FA 2ISYA 4HX8A 1UHMA 5DD8A 1YIOA 3C7JA 3GXOA 4HV5A 5D5VB 1USTA 3CDHA 1LQ1A 2Z5UA 4M9ZA 1I1GA 3HSFA 2ELHA 2DI3A 1J7KA 3RJPA 3H3ZA 1WI9A 4QLCU 3I71A 4EJWA 4WK8F 5E18F 1H0MA 2FE3A 3HTSB 3QPHA 2VE9A 1QZZA 4KT5C 5FFZA 3E6DA 3RKYA 1ZRCA 4HDUA 4ENNA 5A2QZ 2Z9OA 2DK8A 5E1WA 1RNLA 3GEZA 1T38A 3C1DA 4BHCA 1F1ZA 1T39A 1ZLKA 1BOAA 3HUGA 2IP2A 5EEGA 1K78A 2HQRA 5BPIA 2GXBA 1USSA 2EFQA 3Q9VA 2XASA 2FF4A 3BPXA 4GYGA 5AIQA 1Z1DA 5BOXA 1GXPA 4L0YB 2EFWA 1QGPA 2ZMEB 4N9HA 2FBKA 3DP7A 4Y13A 4PDKA 2HGCA 1XDSA 1P92A 4BAYA 4N0BA 1RI7A 5L3GA 3ZN1A 2OQGA 1MD0A 4BYYA 2HZTA 4Z2YA 3K0LA 5F1RA 1IRFA 4MEXF 2FRHA 1TNSA 1FWZA 2F2EA 3I4PA 4XSXF 1ZARA 3I64A 2IJLA 3ZMDA 3BJAA 4HZFA 4P9UA 1FC3A 5D5WB 1STZA 1XDUA 4YG2F 2J5OA 4H0EA 4G7HF 3MZHA 3KCCA 1HKTA 5H6QA 1KU7A 1PP8F 1U6GA 1EH6A 1Z7UA 5CLSA 5CYVA 4OMZA 5K5QA 3P9KA 1IN8A 3WE3A 2VXZA 2ZJ2A 2Z3YA 1YW7A 4HLYA 1S7AA 4RAZA 4EGZA 1Z9CA 3REOA 3ABUA 4LD5A 3SXYA 4G9YA 3SHFA 3WU0A 1DPUA 3RPUA 4P55A 1FPQA 2M30A 2PG4A 3FM5A 4CZZA 3ECHA 4G7OF 3J81Z 4I01A 2FNAA 1P2FA 2CYYA 5J6XA 3ABTA 2P5LC 1U2WA 1FOKA 2EWNA 1FP1D 1E2XA 2M8EA 3O3KA 5J8FA 5LEJA 1QNTA 5HLIA 5DCFA 2MH9A 3WTXC 2CFXA 2JZYA 2LSOA 4YIFA 1ON2A 3U1DA 2V1UA 2A61A 1X3UA 1ZG1A 4KYWA 1TW2A 3L09A 1W7PD 3E97A 4OIPF 4U7BA 1P4AA 1O57A 1R1TA 4IF4A 1HKSA 3NEUA 4MQ9F 5AIPA 3E6CC 1QPMA 2GXGA 2IPQX 4L9TA 1MKMA 2JT1A 2BV6A 1WWXA 5DUIA 1L0OC 4A0ZA 3ZMVA 3T0YA 1UB9A 3HOSA 4M74A 3ELKA 2P7CB 4OIRF 1ODDA 3GF2A 1HBXG 3CUQC 4XBFA 2CWEA 2PMHA 3F21A 3DQVC 4U88A 3ERED 1XGMA 2VBXA 4KNYA 2LF8A 2HEOA 3TOAA 3MAJA 4HV6A 3DKWA 3V4GA 1ZLJA 2RC4A 1G3YA 3T8RA 4WX9A 4TV7A 4NB5A 4HLXA 3WU1B 2D2WA 3WTYC 4LB5A 1BI2A 2M45A 2XAGA 2EJRA 3RTRA 1RZ4A 3GFIA 5CVJA 4L9VA 1MJAA 4KN7X 1BI3A 4G94A 1ZH5A 3HRSA 4IVNA 2NNYA 4AD9A 3HRMA 3EYYA 4XSZF 3HYIA 1W7PB 1L3LA 2Y75A 1BIAA 1U78A 2YPRA 3WTWC 1DDNA 2RN7A 3TQNA 2C6YA 4RGXA 3K1NA 3WODF 1UCRA 5HOOA 4LLLA 1C0WA 2FMLA 3I5UA 1XGOA 4HA8A 1SMYF 2VC1A 4MGRA 1Z05A 4KIFA 4S04A 2FQ3A 6PAXA 4IHTA 4GO1A 1WKMA 4DNCA 1TNTA 4RB0A 2EFPA 2STWA 2KJCA 2ZNZA 4HF0A 2K27A 5D4SA 1IRGA 3D5LA 4M9XA 1ZHFA 2R7DA 1KQ8A 2JPBA 3C3WA 4D0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HX7 A;  1HW1 A;  2EB7 A;  2WTE A;  2KKO A;  1P6R A;  5L3C A;  5HLG A;  1BBY A;  2O0Y A;  2X0L A;  3IWZ A;  5ILS A;  3V8L A;  3FMQ A;  2ISZ A;  3WGH A;  4WXC A;  1CF7 A;  1SD5 A;  1R5H A;  4EGY A;  5LGU A;  3KP2 A;  1U5T A;  1FP2 A;  5K5R A;  3CJN A;  1SFE A;  4BNC A;  3DFG A;  3HRT A;  2EA2 A;  3M8E A;  4FHT A;  1FYK A;  1PP7 U;  1S29 A;  1P4X A;  3GZ6 A;  3ML6 A;  3VB2 A;  1QQI A;  4ESJ A;  1CGP A;  4PGH A;  3ISP A;  1R1U A;  5CVR A;  5JVT A;  1OMI A;  1K78 B;  1DPR A;  4L9N A;  1XN7 A;  4IRG A;  3NQO A;  1O3S A;  3EET A;  1YFH A;  2P5K A;  2PQ8 A;  1SAX A;  1RIO H;  4UHT A;  2BGC A;  4XLN F;  4ESB A;  1Q1H A;  5E20 A;  4LG0 A;  1XSX A;  2QQB A;  1ZGA A;  4MTE A;  2EFO A;  1ZAO A;  5CVU A;  1IN7 A;  4AVP A;  3G73 A;  4A0X A;  5HDK A;  1SD7 A;  2FMY A;  4RGU A;  3CUQ A;  5ICE A;  3LAJ A;  2P5V A;  4M6X A;  4RAY A;  2CG4 A;  5FB2 A;  4CGZ A;  2P6T A;  3VOE A;  2OU2 A;  4BH9 A;  4XLP F;  1YW9 A;  1JXS A;  3U9G A;  3SZP A;  3ZQ7 A;  2A69 F;  3FM3 A;  4XRF A;  1KU3 A;  2VN2 A;  4OIO F;  3FZV A;  4I09 A;  4B8X A;  2H09 A;  2H6B A;  2IA2 A;  4IPA A;  3C18 A;  4GXO A;  1YQA A;  3ZN0 A;  5D5U B;  2L01 A;  2J5P A;  4LLN A;  3RKX A;  1MDM B;  4EJT A;  2HQN A;  4LB6 B;  1LDD A;  5DEQ A;  5JI6 A;  3TO9 A;  1FY7 A;  2DLL A;  4CIC A;  5TRD A;  2ADU A;  2GIV A;  1ULY A;  2VOP A;  1I5Z A;  5LGN A;  3L00 A;  1ZG3 A;  1RUO A;  3K1P A;  4I98 B;  1HXD A;  2QQA A;  5FLX K;  4PGG A;  1FNN A;  4N9I A;  3TKY A;  2HYG D;  1SFU A;  1J2X A;  4ETS A;  1R22 A;  1Z6R A;  3M7G A;  4HDV A;  2XAQ A;  1OR7 A;  3ZMZ A;  3KET A;  3FX3 A;  3KLO A;  3KEO A;  2KJB A;  3SZT A;  3Q5F A;  5DV5 A;  2JRT A;  4ASN A;  5K5O A;  1KYZ A;  1AOY A;  2NS0 A;  2IVM A;  3HTU A;  3KP4 A;  2HKX A;  1G3S A;  3LA2 A;  5LHI A;  2YU3 A;  2FXA A;  3KEQ A;  2ZO4 A;  2OZU A;  3VOD A;  4NHJ A;  3VEP A;  2PLY A;  3F22 A;  1QO0 D;  3GWZ A;  3DEU A;  4P5O A;  1KYW A;  3PQJ A;  3TDZ C;  3DPT A;  2ZME A;  3BRO A;  5FO5 A;  1R7J A;  1GXQ A;  3FMS A;  2HYF A;  4LGW A;  3U2R A;  5DYM A;  3V7C A;  1U3E M;  1LB2 A;  5E8G A;  3JAM Z;  4UV8 A;  1O3T A;  4KN4 X;  4LLG F;  1HST A;  3WTZ A;  3QP6 A;  3J81 K;  2DQL A;  3BPV A;  4LK1 F;  3WTT C;  1XSD A;  4WXD A;  2XUB A;  2D45 A;  4PCQ A;  2FOK A;  2XRO A;  2EV0 A;  4I2O A;  4U0V A;  2H6C A;  5L3B A;  2PFB A;  3ROU A;  5LRS A;  2BBY A;  4CHU A;  2NRA C;  5DCM A;  4UVA A;  2EA4 A;  3CUQ B;  5FD5 A;  3Q9S A;  2B0L A;  2P8T A;  5E1X A;  2BEO A;  2K7L A;  1P4W A;  1HSJ A;  2CW0 F;  2FSW A;  1ZN2 A;  2PJP A;  2JSC A;  2XKP A;  3R61 A;  2NYX A;  3T8T A;  1E17 A;  2DK5 A;  2UZK A;  2IT0 A;  5ICC A;  2O3F A;  2NNN A;  3TDU C;  3GFL A;  5F64 A;  2CGP A;  1J75 A;  3H92 A;  1MDM A;  3AAF A;  2LNB A;  5L3F A;  2VE8 A;  3WTU C;  3CTA A;  5DDG A;  3GVA A;  1O3Q A;  4UVB A;  3V7S A;  1BC7 C;  1KA8 A;  3DV8 A;  2W24 A;  1OPC A;  1S8N A;  2PBI A;  1IZ1 A;  3EUH A;  3RDI A;  4DQ2 A;  2COM A;  4KUM A;  5HLH A;  3FXQ A;  2DQR A;  1JHF A;  1YW8 A;  2RGV A;  1B9M A;  4YFN F;  1FBQ A;  2Y0M A;  4MQV A;  4HW0 A;  4BHB A;  1XGS A;  3J7A O;  5E8I A;  4M71 A;  1IUY A;  2Z99 A;  3FXU A;  1T0F A;  3E5Q A;  1WSU A;  2PMU A;  1R1V A;  5JFR A;  1KQ9 A;  3TO7 A;  4Q4Z F;  2BE5 F;  2DPD A;  1BI0 A;  3HHG A;  2GWR A;  1ZRE A;  2DFI A;  1FBU A;  5KK1 A;  2E1C A;  4RB3 C;  3P9C A;  3DF8 A;  3WE2 A;  1B4A A;  4NQW A;  4HBL A;  3KLN A;  4KIC A;  2LF7 A;  2WC2 A;  3E6M A;  5JHU A;  1XCV A;  4EJV A;  1NHA A;  2PN6 A;  3BDD A;  3BWG A;  1FZP B;  2XKO A;  3R60 A;  4ZYD A;  4UNO A;  5K1Y A;  2IA1 A;  3J80 Z;  2DO7 A;  1IF1 A;  2DAO A;  1XCB A;  3MWM A;  1LEA A;  1OYI A;  3QRF F;  3ZP5 A;  2G7U A;  4LJZ F;  2VBW A;  4AIJ A;  1KQ0 A;  5BMZ A;  4Y15 A;  2FEZ A;  2F5C A;  3F3X A;  2HR3 A;  3LA3 A;  3HHH A;  2XAF A;  2VOD A;  1ON1 A;  3FXR A;  1XB4 A;  1O7F A;  1YLF A;  1XGN A;  2HWV A;  3IHU A;  1ZGJ A;  2JTV A;  2FU4 A;  2VT3 A;  3H3U A;  1LJ9 A;  3M1E A;  5KVR A;  4FX4 A;  3WG9 A;  1R58 A;  1LDJ A;  1XMA A;  1ZG5 A;  1FX7 A;  4ENJ A;  3O6B B;  2L3D A;  1J9I A;  2DPU A;  3L9F A;  1SMT A;  5LHH A;  3E5X A;  5D6F A;  2UXX A;  4FX0 A;  2FA5 A;  1OYW A;  3HSR A;  1F4K A;  4ZYH A;  2QUF A;  3WGI A;  2STT A;  3IL2 A;  4O6J A;  1YG2 A;  1B9N A;  3F8B A;  5HDN A;  3IWF A;  3K9T A;  4EJO A;  4CYD A;  4ENK A;  2V1D A;  4IJA A;  3LAP A;  5LRR A;  1OYY A;  1WQ2 A;  1FSE A;  2XIG A;  5E1Z B;  3MZY A;  5FFX A;  3D0S A;  3LFK A;  1XD7 A;  4HF1 A;  4OU0 A;  2A6H F;  1ZRF A;  2IW5 A;  2CSO A;  1IAW A;  1T6S A;  2K4B A;  2Y48 A;  2MC3 A;  2V6C A;  3FF5 A;  5DD4 A;  2FNP A;  4U0Y A;  5DUK A;  2P7V B;  4EMS A;  4ESF A;  2WV0 A;  3GLX A;  4I0A A;  4U7D A;  1U5T C;  1Y0U A;  3KP7 A;  4OIN F;  2FBH A;  3E6B A;  4L18 B;  3SFZ A;  3LWF A;  3JTG A;  2F5E A;  1O3R A;  1LNW A;  2QYO A;  3F8C A;  4HX4 A;  2P4W A;  5HS9 A;  3F6V A;  3SQN A;  5D6E A;  2HTJ A;  1U5T B;  2A3S A;  4KFC A;  4KA4 A;  2RDP A;  3IKT A;  1T98 A;  3BOQ A;  1FLI A;  2XAH A;  5BS6 A;  1YYV A;  2VOO A;  1LEB A;  1I27 A;  2ESN A;  2ZXJ A;  3RPQ A;  3GYH X;  2YSR A;  3V7R A;  2AS5 F;  1J5Y A;  1FSH A;  2HS5 A;  3F8F A;  3T5X A;  5IT3 A;  3BJO A;  4ZH4 F;  5D4R A;  2DW4 A;  1G6N A;  2NAZ A;  2PEX A;  4G7Z F;  1H9T A;  2A5Y B;  1J59 A;  2Q0O A;  1S3J A;  3RIR A;  2H27 A;  3I59 A;  1ZYR F;  2XAJ A;  4GGG A;  2GQQ A;  4LK0 F;  3O2P E;  1O7L A;  4P96 A;  3ZMU A;  3OOP A;  4FT8 A;  3KFW X;  2A68 F;  3EDP A;  2RVC A;  4K2E A;  2VBZ A;  3M8F A;  3WTV C;  5IT9 K;  3E3V A;  4Q47 A;  1REP C;  4KMU X;  3GO5 A;  5A2Q K;  3F23 A;  2EK5 A;  4YII A;  3GFJ A;  1FYM A;  1Z6T A;  2G7H A;  1YS7 A;  3V8K A;  2QBY A;  3R4K A;  1KU2 A;  3JSO A;  3GZ5 A;  3I58 A;  1BM9 A;  2RKH A;  3BJ6 A;  2L02 A;  5HVQ C;  1TQM A;  1W5T A;  3I53 A;  5EEH A;  1R36 A;  1A04 A;  2H94 A;  4BXU A;  3IKV A;  4G6D A;  1OKR A;  2BYV E;  3GFM A;  2V1X A;  2O6G E;  1XSV A;  2VBY A;  1KU9 A;  3GW2 A;  4S05 A;  1R00 A;  3P9I A;  3BY6 A;  4A5N A;  2DT5 A;  3B73 A;  3CO6 C;  4B09 A;  4HAM A;  2AXL A;  1W5S A;  4HYE A;  3TGN A;  3CO7 C;  2VC0 A;  2XRN A;  1CF7 B;  2YX7 A;  2E7W A;  3B02 A;  1BC8 C;  4A12 A;  1W7P A;  3QP5 A;  2O8X A;  5ICF A;  3HOT A;  3KP6 A;  2W25 A;  3IRR A;  1XMK A;  4MHG A;  3KP5 A;  4CO8 A;  4YFX F;  3CLO A;  1TQP A;  2M1B A;  4WF2 A;  5LEK A;  1G3T A;  2GAU A;  4IRI A;  2F5F A;  4ZZD A;  4I0B A;  1MJ9 A;  1D3Y A;  2KIU A;  1ZRD A;  5D8L B;  2EV6 A;  3J80 K;  2FBI A;  3R0A A;  3HIF A;  2DBB A;  1HW5 A;  2HTS A;  3PQK A;  1SD6 A;  3L2C A;  4M6Y A;  4Q48 A;  1F5T A;  3KE2 A;  4ZYE A;  4A0Y A;  1GVJ A;  4BQA A;  3K2Z A;  3ZPL A;  2K4J A;  3RYP A;  1EH7 A;  5BQT A;  5LBQ A;  5HS8 A;  5L3D A;  1MJB A;  4A6D A;  1IN5 A;  2P6S A;  1B6A A;  2R7F A;  2OD5 A;  2ETH A;  4WCG A;  1BN5 A;  1B1B A;  3K69 A;  4I02 A;  4G8X A;  2IRF G;  4F7Z A;  3L7W A;  3TOB A;  4U0W A;  1F9N A;  4JBA A;  4HOB A;  5LGT A;  2L4A A;  2JPC A;  5FD6 A;  1R5G A;  4ON0 A;  3P7N A;  2YR2 A;  1LVA A;  4UUV A;  3LQQ A;  5HDG A;  2MLK A;  4AIH A;  4AIK A;  1UFM A;  2D1H A;  4CDG A;  4MTD A;  2HFH A;  4AWX B;  1IN6 A;  2Q8K A;  3WGG A;  4QWQ A;  3KP3 A;  1TLH B;  4KIB A;  1VTN C;  1HKQ A;  1IN4 A;  4EM0 B;  2L4M A;  4R8H A;  4OOI A;  1IW7 F;  2OAZ A;  3V8J A;  1PUE E;  4RB2 C;  1K7A A;  3OV8 A;  2GA1 A;  3F8M A;  4MEY F;  3IC7 A;  5D5X B;  2VON A;  3QPT A;  3F8N A;  3ZMT A;  2CQK A;  4LMY A;  1J0R A;  3QAH A;  4M73 A;  3WTS C;  3G3Z A;  4UXN A;  4A2U A;  2OZ6 A;  4L5J A;  2ESH A;  1D5V A;  4A5M A;  2XHK A;  2LKP A;  4EJU A;  2F5D A;  4RB1 A;  4JK1 X;  2MD5 A;  2X4H A;  4M9S A;  3JSP A;  1K6O A;  3I54 A;  4A6E A;  2O03 A;  2KIM A;  2KIF A;  2YX4 A;  4YFK F;  3QOP A;  1DP7 P;  2QZ8 A;  2QQ9 A;  1SD4 A;  5H6R A;  3HSE A;  1W4M A;  4OMY A;  3MFK A;  3QU6 A;  2E1N A;  2LDU A;  5FLX Z;  2RNJ A;  4R1H A;  1U8R A;  1TQI A;  3MEX A;  5CJ9 A;  1JE8 A;  2Z33 A;  5HS7 A;  1IXS B;  1UHW A;  2KRF A;  4EV0 A;  2ACJ A;  3QU3 A;  3CUO A;  3BZ6 A;  3N4M A;  1MGT A;  4WWC A;  2OBP A;  1FT9 A;  1T2K A;  4CXF A;  2MBF A;  2MH2 A;  2W85 A;  3DXJ F;  3IRQ A;  1BI1 A;  1HQC A;  2GA2 A;  4RGR A;  1G4D A;  4HQE A;  2W84 A;  1G3W A;  4R79 A;  2QWW A;  5LHG A;  2XGX A;  1PDN C;  3GX4 X;  3LA7 A;  5ICG A;  2QVO A;  2GZW A;  2ZBK A;  1DUX C;  1S6L A;  4ENM A;  4G6Q A;  4UV9 A;  1HW2 A;  3KZY A;  2OQR A;  3I59 B;  2UWM A;  5BPD A;  2A07 F;  3ECO A;  1QBJ A;  3ULQ B;  4L9J A;  1B59 A;  4KIG A;  1LDK B;  4LG0 B;  4Y17 A;  1ONV A;  2ZCW A;  4IRH A;  5CVV A;  1R23 A;  2Q2E A;  4ZZL A;  1GHC A;  5D8K B;  1FYL A;  3COA C;  1MZB A;  1JGS A;  2HKO A;  4HF2 A;  3LQR A;  4UVC A;  4WXH A;  5ERI A;  3JTH A;  3TO6 A;  5ED4 A;  1FBS A;  3S2W A;  1SFX A;  2ZKZ A;  2O61 A;  1H9G A;  1IXR C;  3FWE A;  3W6J B;  4OIQ F;  3F72 A;  4ZYG A;  1BIB A;  5JR3 A;  5DCM B;  2MA3 A;  3VFZ A;  3RYR A;  3BP8 A;  5L3E A;  3M9A A;  5TJJ A;  5AON A;  2MLG A;  2RV8 A;  4RS8 A;  4I7H A;  4KMF A;  2E7X A;  1D8K A;  4IHS A;  1AWC A;  4LFU A;  2TDX A;  4M72 A;  2PI0 A;  3N97 A;  5LLQ A;  1EH8 A;  3JAM K;  1IXC A;  1YS6 A;  1EV7 A;  1JHH A;  3K1M A;  2M5W A;  1YTY A;  4L5I A;  2ZFW A;  3MCZ A;  4MNU A;  4Q5S F;  3JW4 A;  4P9F A;  3R6S A;  3T1B A;  2OA4 A;  2G9W A;  4KDP A;  4O5V A;  1RUN A;  2QM3 A;  2V79 A;  1S7O A;  2D1V A;  3LST A;  4O3M A;  2K86 A;  4HQM A;  1TW3 A;  5J8C A;  2DU9 A;  2RQP A;  4EM2 A;  2WWY A;  2XVC A;  3FHZ A;  2DTR A;  2EFN A;  2R3S A;  5E17 F;  3DPL C;  2CO5 A;  5FGM A;  1K79 A;  5IT9 Z;  3PFI A;  3ZMS A;  2ZNY A;  1V4R A;  4EM1 A;  2K02 A;  4E70 A;  3R0J A;  3FMR A;  2HOE A;  1TTY A;  1TBX A;  2VT2 A;  1I1S A;  2M87 A;  2XV4 S;  1Z91 A;  2L54 A;  4GCV A;  1BJA A;  4IXA A;  4EVI A;  4RGS A;  3E5U A;  4BHP A;  2IA0 A;  3NRV A;  4JQF A;  2W57 A;  5CVI A;  3RI4 A;  2EV5 A;  3HRU A;  3GUD A;  5ILV A;  5H20 A;  3RKW A;  1V3F A;  1YO5 C;  3EQL F;  4GYI A;  3EYI A;  2QEN A;  3W6K B;  5ILU A;  1I6X A;  2A6E F;  1KGS A;  2QLZ A;  3F6O A;  2V9V A;  2HDC A;  4L0Z B;  3I0T A;  4PZJ A;  2UXN A;  4EQQ A;  1D8J A;  1QZY A;  1WRJ A;  2QBY B;  3KZZ A;  3MQ0 A;  5F6F A;  2ISY A;  4HX8 A;  1UHM A;  5DD8 A;  1YIO A;  3C7J A;  3GXO A;  4HV5 A;  5D5V B;  1UST A;  3CDH A;  1LQ1 A;  2Z5U A;  4M9Z A;  1I1G A;  3HSF A;  2ELH A;  2DI3 A;  1J7K A;  3RJP A;  3H3Z A;  1WI9 A;  4QLC U;  3I71 A;  4EJW A;  4WK8 F;  5E18 F;  1H0M A;  2FE3 A;  3HTS B;  3QPH A;  2VE9 A;  1QZZ A;  4KT5 C;  5FFZ A;  3E6D A;  3RKY A;  1ZRC A;  4HDU A;  4ENN A;  5A2Q Z;  2Z9O A;  2DK8 A;  5E1W A;  1RNL A;  3GEZ A;  1T38 A;  3C1D A;  4BHC A;  1F1Z A;  1T39 A;  1ZLK A;  1BOA A;  3HUG A;  2IP2 A;  5EEG A;  1K78 A;  2HQR A;  5BPI A;  2GXB A;  1USS A;  2EFQ A;  3Q9V A;  2XAS A;  2FF4 A;  3BPX A;  4GYG A;  5AIQ A;  1Z1D A;  5BOX A;  1GXP A;  4L0Y B;  2EFW A;  1QGP A;  2ZME B;  4N9H A;  2FBK A;  3DP7 A;  4Y13 A;  4PDK A;  2HGC A;  1XDS A;  1P92 A;  4BAY A;  4N0B A;  1RI7 A;  5L3G A;  3ZN1 A;  2OQG A;  1MD0 A;  4BYY A;  2HZT A;  4Z2Y A;  3K0L A;  5F1R A;  1IRF A;  4MEX F;  2FRH A;  1TNS A;  1FWZ A;  2F2E A;  3I4P A;  4XSX F;  1ZAR A;  3I64 A;  2IJL A;  3ZMD A;  3BJA A;  4HZF A;  4P9U A;  1FC3 A;  5D5W B;  1STZ A;  1XDU A;  4YG2 F;  2J5O A;  4H0E A;  4G7H F;  3MZH A;  3KCC A;  1HKT A;  5H6Q A;  1KU7 A;  1PP8 F;  1U6G A;  1EH6 A;  1Z7U A;  5CLS A;  5CYV A;  4OMZ A;  5K5Q A;  3P9K A;  1IN8 A;  3WE3 A;  2VXZ A;  2ZJ2 A;  2Z3Y A;  1YW7 A;  4HLY A;  1S7A A;  4RAZ A;  4EGZ A;  1Z9C A;  3REO A;  3ABU A;  4LD5 A;  3SXY A;  4G9Y A;  3SHF A;  3WU0 A;  1DPU A;  3RPU A;  4P55 A;  1FPQ A;  2M30 A;  2PG4 A;  3FM5 A;  4CZZ A;  3ECH A;  4G7O F;  3J81 Z;  4I01 A;  2FNA A;  1P2F A;  2CYY A;  5J6X A;  3ABT A;  2P5L C;  1U2W A;  1FOK A;  2EWN A;  1FP1 D;  1E2X A;  2M8E A;  3O3K A;  5J8F A;  5LEJ A;  1QNT A;  5HLI A;  5DCF A;  2MH9 A;  3WTX C;  2CFX A;  2JZY A;  2LSO A;  4YIF A;  1ON2 A;  3U1D A;  2V1U A;  2A61 A;  1X3U A;  1ZG1 A;  4KYW A;  1TW2 A;  3L09 A;  1W7P D;  3E97 A;  4OIP F;  4U7B A;  1P4A A;  1O57 A;  1R1T A;  4IF4 A;  1HKS A;  3NEU A;  4MQ9 F;  5AIP A;  3E6C C;  1QPM A;  2GXG A;  2IPQ X;  4L9T A;  1MKM A;  2JT1 A;  2BV6 A;  1WWX A;  5DUI A;  1L0O C;  4A0Z A;  3ZMV A;  3T0Y A;  1UB9 A;  3HOS A;  4M74 A;  3ELK A;  2P7C B;  4OIR F;  1ODD A;  3GF2 A;  1HBX G;  3CUQ C;  4XBF A;  2CWE A;  2PMH A;  3F21 A;  3DQV C;  4U88 A;  3ERE D;  1XGM A;  2VBX A;  4KNY A;  2LF8 A;  2HEO A;  3TOA A;  3MAJ A;  4HV6 A;  3DKW A;  3V4G A;  1ZLJ A;  2RC4 A;  1G3Y A;  3T8R A;  4WX9 A;  4TV7 A;  4NB5 A;  4HLX A;  3WU1 B;  2D2W A;  3WTY C;  4LB5 A;  1BI2 A;  2M45 A;  2XAG A;  2EJR A;  3RTR A;  1RZ4 A;  3GFI A;  5CVJ A;  4L9V A;  1MJA A;  4KN7 X;  1BI3 A;  4G94 A;  1ZH5 A;  3HRS A;  4IVN A;  2NNY A;  4AD9 A;  3HRM A;  3EYY A;  4XSZ F;  3HYI A;  1W7P B;  1L3L A;  2Y75 A;  1BIA A;  1U78 A;  2YPR A;  3WTW C;  1DDN A;  2RN7 A;  3TQN A;  2C6Y A;  4RGX A;  3K1N A;  3WOD F;  1UCR A;  5HOO A;  4LLL A;  1C0W A;  2FML A;  3I5U A;  1XGO A;  4HA8 A;  1SMY F;  2VC1 A;  4MGR A;  1Z05 A;  4KIF A;  4S04 A;  2FQ3 A;  6PAX A;  4IHT A;  4GO1 A;  1WKM A;  4DNC A;  1TNT A;  4RB0 A;  2EFP A;  2STW A;  2KJC A;  2ZNZ A;  4HF0 A;  2K27 A;  5D4S A;  1IRG A;  3D5L A;  4M9X A;  1ZHF A;  2R7D A;  1KQ8 A;  2JPB A;  3C3W A;  4D0P A; 
#chains in the Genus database with same CATH topology
 2VKE A;  4HX7 A;  3RQI A;  1HW1 A;  3OS0 A;  2EB7 A;  2WTE A;  2KKO A;  1YJ9 I;  1P6R A;  2IAI A;  1JI8 A;  5TIS C;  5L3C A;  5HLG A;  1VQ7 I;  1BBY A;  2O0Y A;  4NC6 A;  2X0L A;  3IWZ A;  5ILS A;  3V8L A;  2E2J J;  1QU3 A;  2V7F A;  2F48 A;  3FMQ A;  2ISZ A;  3WGH A;  1VQ4 I;  4RMN A;  4WXC A;  1CF7 A;  1JTX A;  4MFE A;  1SD5 A;  2ZJP F;  1DGW Y;  4NQW B;  2LR8 A;  2F4O B;  3EPZ A;  1R5H A;  3JRF A;  1QZE A;  4EGY A;  2L7F P;  3I4M J;  5F04 A;  2HXO A;  2XSJ C;  5LGU A;  3KP2 A;  1U5T A;  2KRC A;  4M3F A;  5B5E C;  5EGO A;  1FP2 A;  5K5R A;  3CJN A;  2K3F A;  1SFE A;  3H36 A;  4BNC A;  3BTI A;  2WAQ N;  3DFG A;  3HRT A;  1YJN I;  2DTZ A;  2EA2 A;  3M8E A;  2RNG A;  1KZH A;  3C2H A;  4FHT A;  2R5Y A;  2X6W A;  2BXZ A;  1FYK A;  5FLV A;  1PP7 U;  1S29 A;  1P4X A;  3GZ6 A;  3BQY A;  3ML6 A;  1Y8Q B;  4PJ0 C;  3VB2 A;  2OEN L;  3G1M A;  3K4K A;  3GBG A;  1QQI A;  3QOE A;  3K2A A;  4ESJ A;  3JRA A;  4IHX A;  1JJ6 C;  2M0M A;  1CGP A;  4PGH A;  1G59 A;  1K1C A;  3ISP A;  3DWL E;  2H8R A;  1R1U A;  5CVR A;  4FAS D;  5IP9 J;  2LP0 A;  2LVS A;  5JVT A;  1OMI A;  1K78 B;  3CC4 I;  5M5Y J;  2M3A A;  1DPR A;  4L9N A;  1XN7 A;  4IRG A;  3GME A;  1WFX A;  3LSM A;  3NQO A;  3ONQ A;  4BDY A;  1O3S A;  3EET A;  1K83 J;  4DZJ A;  1YFH A;  1OCC H;  2E1O A;  2P5K A;  2PQ8 A;  1SAX A;  1RIO H;  4UHT A;  2BGC A;  4XLN F;  4ESB A;  1IV6 A;  5JLX A;  1Q1H A;  1X3W B;  2OUM A;  5E20 A;  3ABM H;  1BA5 A;  4LG0 A;  1XSX A;  2XSD C;  4X1E A;  2QQB A;  1ZGA A;  4W97 A;  1WPK A;  1VQM I;  2H1K A;  4MTE A;  3OYG A;  2EFO A;  3G2B A;  2MYS A;  4RLQ A;  1ZAO A;  5CVU A;  2WBM A;  1IN7 A;  4P1W A;  4AVP A;  4A0X A;  5GTH C;  3G73 A;  1Y50 A;  3ZQC A;  1NG6 A;  2ELJ A;  2IGO A;  3TED A;  4NDL A;  2HPR A;  1S5L C;  2DDA A;  1Z0X A;  2R5Z B;  3Q0V A;  5HDK A;  1SD7 A;  4FET A;  3ZOB A;  1E0E A;  1NG7 A;  2FMY A;  3JRC A;  4RGU A;  3CUQ A;  5ICE A;  2ZJR F;  3LAJ A;  2P5V A;  2HI3 A;  4M6X A;  4RAY A;  2CG4 A;  3SDG A;  3FHN A;  5FB2 A;  4XLF A;  2OPT A;  4CGZ A;  1LE8 B;  2P6T A;  3VOE A;  5FJ8 J;  2MGQ A;  2OU2 A;  2QSH X;  4BH9 A;  4XLP F;  1YW9 A;  4XLH A;  4CCN A;  4C2U A;  1JXS A;  5H2F C;  2NZU L;  3U9G A;  1CM2 A;  3SZP A;  1N77 A;  2NVY J;  3VWB A;  3ZQ7 A;  2A69 F;  3FM3 A;  4XRF A;  4CYC B;  1TWF J;  1KU3 A;  3FXJ A;  2VN2 A;  4OIO F;  2JEL P;  3FZV A;  4I09 A;  4B8X A;  3LNQ A;  2H09 A;  2H6B A;  2IA2 A;  4YIR X;  1VQO I;  4IPA A;  2HPM A;  4IHW A;  3C18 A;  4GXO A;  1YQA A;  3BR6 A;  3HM5 A;  3ZN0 A;  1OLT A;  1FEX A;  5D5U B;  2LYC A;  2L01 A;  3F9K A;  2J5P A;  3PSF A;  4F3Q A;  1V54 H;  2VQH A;  4LLN A;  1FOX A;  2VKH A;  3RKX A;  1MDM B;  4EJT A;  2HQN A;  4LB6 B;  2CV1 A;  1LDD A;  5DEQ A;  5JI6 A;  1OCP A;  3E7L A;  3TO9 A;  2AQF A;  1FY7 A;  1KKM H;  2DLL A;  3IV5 A;  4CIC A;  5TRD A;  2KHM A;  2ADU A;  4E7L A;  2F6C A;  2GIV A;  1ULY A;  2VOP A;  2K5C A;  3TL4 X;  1I5Z A;  3LE5 A;  5LGN A;  3L00 A;  2K3P A;  1ZG3 A;  1RUO A;  3K1P A;  4I98 B;  3HOZ J;  2L9S A;  4A3D J;  5C4X J;  1X19 A;  1HXD A;  2CU7 A;  2Y0S A;  3OYF A;  2QQA A;  1ETX A;  5FLX K;  1BW6 A;  4PGG A;  1FNN A;  3OR1 C;  4N9I A;  3FXL A;  3TKY A;  2IS1 A;  1VQP I;  2HYG D;  1SFU A;  1J2X A;  2KFD A;  4ETS A;  1R22 A;  3VSK A;  1Z6R A;  3M7G A;  4CA0 A;  3UKG A;  3BCB A;  4HDV A;  1VI0 A;  2DMQ A;  2XAQ A;  1OR7 A;  2OJE D;  3ZMZ A;  3OR2 C;  2MG4 A;  9ANT A;  3KET A;  3FX3 A;  3MMY B;  1V5F A;  3KLO A;  1AHD P;  4Y4R A;  1HA8 A;  2ME0 A;  3KEO A;  2KJB A;  4RAF A;  4A3M J;  3SZT A;  3Q5F A;  5DV5 A;  5T17 A;  1MMA A;  4D9J A;  2XGD A;  2AXT C;  2JRT A;  4ASN A;  5K5O A;  1KYZ A;  1AOY A;  2NS0 A;  2IVM A;  3HTU A;  1N75 A;  2HKX A;  3KP4 A;  1G3S A;  4FE7 A;  1VQK I;  3LA2 A;  5LHI A;  1OQY A;  2YU3 A;  2FXA A;  4IQ4 A;  3KEQ A;  2R7Z J;  2KZG A;  1ETO A;  2ZO4 A;  2OZU A;  3VOD A;  1GDT A;  4NHJ A;  3ZGK A;  3VEP A;  1OJL A;  3F22 A;  2PLY A;  1QO0 D;  3GWZ A;  3DEU A;  4P5O A;  1VQ5 I;  1KYW A;  3PQJ A;  3TDZ C;  3DPT A;  3GTM J;  3ABL H;  5FKO A;  2ZME A;  3BRO A;  5FO5 A;  1R7J A;  1GXQ A;  1OR7 C;  2I8D A;  3FMS A;  1DU0 A;  2HYF A;  3GTO J;  4LGW A;  3U2R A;  2HDD A;  3HOY J;  1MMN A;  5DYM A;  3V7C A;  2Z16 A;  3VDX A;  1U3E M;  1DP3 A;  1U9N A;  1LB2 A;  1M1E B;  5E8G A;  2FJ1 A;  4UV8 A;  3JAM Z;  1O3T A;  1JUS A;  2IXS A;  4D5F A;  1SEU A;  4XID A;  3TW7 A;  1J09 A;  4KN4 X;  3S14 J;  4LLG F;  1HST A;  3WTZ A;  3QP6 A;  2X1C A;  4UUT A;  3J81 K;  4BBS J;  3J7Z I;  5IP7 J;  2DQL A;  3BPV A;  4LK1 F;  1CM3 A;  1SVM A;  1XC5 A;  2LKS A;  4WXD A;  3WTT C;  1XSD A;  2GXA A;  4L5E A;  3U1K A;  2XUB A;  3HC7 A;  2D45 A;  1ACI A;  4PCQ A;  2FOK A;  1TT5 B;  2LD5 A;  2E1M C;  2XRO A;  2EV0 A;  4I2O A;  4QTR A;  4HNT A;  4U0V A;  2H6C A;  1IRZ A;  3OQM D;  2WAE A;  5L3B A;  2PFB A;  3ROU A;  5LRS A;  2BBY A;  4CHU A;  2NRA C;  4XK4 A;  5DCM A;  4V19 K;  1I3A A;  4UVA A;  2EA4 A;  3CUQ B;  5FD5 A;  3Q9S A;  2B0L A;  2VJJ A;  2P8T A;  5E1X A;  2BEO A;  2K7L A;  3PO3 J;  1P4W A;  1HSJ A;  3H9G A;  2CW0 F;  1WH5 A;  3CCL I;  4HF1 A;  2FSW A;  1ZN2 A;  4Y3O A;  2PJP A;  1LVK A;  2HOT A;  3B6A A;  2JSC A;  4A69 C;  2XKP A;  3NAR A;  2V9P A;  1FJL A;  3R61 A;  2E71 A;  2NYX A;  3W2A A;  3T8T A;  4RM2 A;  1VQN I;  4BXF A;  1KKL H;  2BY3 A;  1E17 A;  2DK5 A;  1X3Z B;  1YRN A;  2UZK A;  1UZC A;  2IT0 A;  4CUG A;  1TL8 A;  5ICC A;  2PMZ N;  2O3F A;  2NNN A;  3TDU C;  3M1C A;  3OYL A;  1WZ2 A;  2X1E A;  3NAU A;  5EDN A;  3OOU A;  3GFL A;  3PNV A;  5F27 A;  5F64 A;  2HZD A;  2CGP A;  1J75 A;  4E6K G;  1I3Q J;  3JR9 A;  3H92 A;  1MDM A;  3WHB A;  2NVQ J;  1ORK A;  3AAF A;  2LNB A;  5L3F A;  1ZKG A;  3DTK A;  2VE8 A;  1JT6 A;  3WTU C;  2WY7 Q;  3CTA A;  5F1J A;  5DDG A;  2R92 J;  2ZXH A;  2AQE A;  3GVA A;  2TCT A;  1YIT I;  4UB8 C;  2CQ7 A;  4UVB A;  1KA8 A;  3V7S A;  3DV8 A;  1O3Q A;  2W24 A;  1OPC A;  3K4N A;  1BC7 C;  1S8N A;  2PBI A;  3KX2 A;  2KIQ A;  4BEH B;  1JGG A;  1IZ1 A;  3EUH A;  3RDI A;  4DQ2 A;  3CCD A;  2COM A;  2NOJ B;  4KUM A;  5IPA A;  2EZK A;  5HLH A;  1T8I A;  5K7F A;  2ID3 A;  2ZXI A;  3FXQ A;  2DQR A;  4I6Z A;  1JHF A;  1YW8 A;  2RGV A;  1B9M A;  3CD6 I;  1Y0N A;  1S72 I;  4YFN F;  3F0C A;  1FBQ A;  4CCK A;  2Y0M A;  2LTP A;  4DGW B;  4MQV A;  4HW0 A;  4BHB A;  1XGS A;  4B4C A;  3I3L A;  3J7A O;  5E8I A;  2P81 A;  1FMV A;  2F4M B;  4M71 A;  4BL0 B;  4IKF A;  1X58 A;  3S15 J;  2EPF A;  4FTH A;  2JA2 A;  2FEP S;  1IUY A;  3K4L A;  2Z99 A;  3FXU A;  3A03 A;  1YHQ I;  1T0F A;  3OYH A;  3E5Q A;  1W1W E;  2PMU A;  2Z2S B;  1WSU A;  1R1V A;  5JFR A;  5DS9 A;  4RAG A;  1KQ9 A;  3TO7 A;  2DXI A;  4N4N B;  4Q4Z F;  2BE5 F;  2R7O A;  3DU6 A;  2DPD A;  2VKD A;  1BI0 A;  3HHG A;  2GWR A;  5IY5 H;  1ZRE A;  2DFI A;  1FBU A;  5KK1 A;  4EAT A;  3ZQI A;  2Y69 H;  2H1L A;  2E1C A;  3QYB A;  3BTC A;  4RB3 C;  5F0H A;  3IH4 A;  4XKC A;  3P9C A;  3DF8 A;  3WE2 A;  3C2B A;  1B4A A;  4NQW A;  4HBL A;  3KLN A;  5KAI C;  2E34 A;  2LF7 A;  4KIC A;  2COB A;  2WC2 A;  4AYB A;  1GV2 A;  3E6M A;  5JHU A;  1XCV A;  4Y33 A;  2GLO A;  1LFB A;  2P0W A;  4EJV A;  3J7Y J;  1NHA A;  1OIS A;  2PN6 A;  3BDD A;  3BWG A;  1E3H A;  1ETQ A;  3MKL A;  3CCJ I;  1FZP B;  2JMW A;  2DCE A;  2RAE A;  2XKO A;  4MO7 A;  2MD0 A;  2KP6 A;  4F93 B;  3R60 A;  1X1C A;  4XR6 A;  3QYE A;  4ZYD A;  4UNO A;  5K1Y A;  2ZSH B;  2LBF B;  1N25 A;  2IA1 A;  3J80 Z;  2DO7 A;  3LSR A;  2EIN H;  5EG0 B;  1IF1 A;  2WAQ A;  1VQ9 I;  2IEK A;  2DAO A;  2OTJ I;  1XCB A;  2XB0 X;  3MWM A;  3OYK A;  3A02 A;  1UEL B;  2DOA A;  3BT9 A;  2DT7 B;  1LEA A;  2LK2 A;  1OYI A;  3BR3 A;  3ABK H;  1HF0 A;  3TBI A;  3QRF F;  1XMX A;  3QYF A;  3ZP5 A;  2G7U A;  4LJZ F;  4B3A A;  2VBW A;  1SFO J;  2I10 A;  4AIJ A;  1KQ0 A;  5BMZ A;  1HDN A;  3S1N J;  2EH3 A;  4Y15 A;  2FEZ A;  2F5C A;  3K4J A;  4XLE A;  1O4X A;  2RQQ A;  5M5W J;  3F3X A;  3CF2 A;  2HR3 A;  3LA3 A;  3JRG A;  3HHH A;  2GOX B;  2W7N A;  2XAF A;  2VOD A;  1ON1 A;  1NK3 P;  4C2T A;  3FXR A;  1XB4 A;  5FKM A;  2DA4 A;  5EEA A;  1O7F A;  1FIA A;  4F91 B;  2LRK D;  2R7W A;  1YJW I;  1RZR L;  1YLF A;  2BW3 A;  4IZZ A;  3LE1 A;  1XGN A;  4XL9 A;  2HWV A;  3CMM A;  4G12 A;  3IHU A;  1ZGJ A;  2JTV A;  3JRI A;  3OYN A;  2FU4 A;  2VT3 A;  3H3U A;  1LJ9 A;  3M1E A;  5KVR A;  3TMO A;  4E7Z A;  4FX4 A;  2ID6 A;  3WG9 A;  1R58 A;  3OYI A;  1I50 J;  1LDJ A;  2VB6 A;  2NVT J;  1XMA A;  4XON A;  2Q1Z B;  1ZG5 A;  3H9Q A;  5KCM A;  2NOG A;  1FX7 A;  5IYC J;  4ENJ A;  3O6B B;  2L3D A;  1J9I A;  2DPU A;  3L9F A;  1Y51 A;  1SMT A;  5GP9 A;  3HBL A;  5LHH A;  3E5X A;  3CCE I;  5D6F A;  2UXX A;  4FX0 A;  4NUB A;  1Z21 A;  2FA5 A;  3IHS A;  2LC2 A;  3IAM 2;  4ITV A;  4C3I J;  1OYW A;  3HSR A;  1F4K A;  4ZYH A;  2LKX A;  3VYU B;  3L2W A;  2QUF A;  3WGI A;  2STT A;  3IL2 A;  4O6J A;  1YG2 A;  4JX5 A;  1IDY A;  1GLN A;  2ZFU A;  1B9N A;  3FBN B;  1H89 C;  3UNG C;  2HOA A;  3F8B A;  3DPU A;  3JRB A;  5HDN A;  2R5Z A;  4E7I A;  4BJT A;  2DMN A;  3A2K A;  3PL8 A;  4KIS A;  3QQA A;  4M3E A;  2I5U A;  3OL4 A;  2XPW A;  3OWT A;  3IWF A;  3K9T A;  4EJO A;  4CYD A;  4ENK A;  3H1C A;  5IP6 A;  4J19 A;  2V1D A;  4IJA A;  3G6E I;  3CCS I;  3LAP A;  5LRR A;  2DFF A;  2L7K A;  1OYY A;  1WQ2 A;  3BG7 A;  1FSE A;  1EKE A;  2XIG A;  5E1Z B;  3CCQ I;  3OIO A;  4A3G J;  1HCR A;  2EBI A;  2XB5 A;  3MZY A;  5FFX A;  3D0S A;  3LFK A;  2Y9Z A;  1OCO H;  4UB6 C;  4MIM A;  1I39 A;  5FKK A;  1XD7 A;  3JRD A;  1SFK A;  3K4C A;  4OU0 A;  2XDV A;  1P7J A;  4RLF A;  4QIW N;  2A6H F;  5GAH J;  1ZRF A;  3SDB A;  2K9Q A;  4AC0 A;  5J4Y A;  2IW5 A;  2CSO A;  2DYR H;  1IAW A;  1JKP C;  1T6S A;  1WGX A;  1YE9 A;  2KL4 A;  2K4B A;  2Y48 A;  5GAD J;  3CCU I;  2MC3 A;  2DA3 A;  2V6C A;  3FF5 A;  1D5Y A;  5DD4 A;  3RZO J;  2FNP A;  2L9V A;  1XX5 A;  4U0Y A;  2AK7 A;  5DUK A;  3MN2 A;  2P7V B;  4EMS A;  4ESF A;  2WV0 A;  3GLX A;  4I0A A;  4U7D A;  1U5T C;  3BR2 A;  1AU7 A;  1Y0U A;  2E60 A;  3KP7 A;  4OIN F;  2FBH A;  2MSY A;  3E6B A;  4LIU A;  4L18 B;  3WG7 H;  3SFZ A;  3LWF A;  3JTG A;  5J1U A;  2F5E A;  1O3R A;  1LNW A;  1D0Z A;  1CQT A;  3BR0 A;  5FLM J;  2EIJ H;  1N78 A;  2QYO A;  3F8C A;  4HX4 A;  4A3E J;  2P4W A;  5HS9 A;  3F6V A;  3DEW A;  1H88 C;  3SQN A;  1VZ0 A;  5D6E A;  2HTJ A;  1U5T B;  4RM3 A;  2A3S A;  4KFC A;  2GIZ A;  4KA4 A;  2RDP A;  4BQN A;  5JLW A;  3IKT A;  1X1D A;  2QCO A;  1T98 A;  5FRO A;  3BOQ A;  5HLT A;  1T95 A;  1FLI A;  1LUJ B;  2XAH A;  5BS6 A;  1YYV A;  3O8G A;  4IOA F;  2VOO A;  2XRL A;  1LEB A;  3H35 A;  1I27 A;  2ESN A;  3HGG A;  2ZXJ A;  3RQ4 A;  3RPQ A;  3GYH X;  2YSR A;  3S3M A;  3V7R A;  2AS5 F;  2HU9 A;  1FTZ A;  2FOW A;  2QGU A;  3FIS A;  1J5Y A;  2MC4 A;  3DCF A;  1FSH A;  2HS5 A;  3NWT A;  3A01 A;  3B6C A;  3F8F A;  3IP4 B;  3T5X A;  1X4O A;  3K10 A;  3CZ6 A;  2QA4 I;  4E4H A;  2LRE A;  3EZA B;  5IT3 A;  3BJO A;  4Y52 J;  2GBY A;  4ZH4 F;  5D4R A;  2DW4 A;  1G6N A;  2NAZ A;  2XPV A;  3H5A A;  2PEX A;  3A1Y A;  2VXD A;  4G7Z F;  1H9T A;  3E1S A;  2A5Y B;  4JX6 A;  1J59 A;  2Q0O A;  1S3J A;  3RIR A;  2H27 A;  5HNF A;  3I59 A;  2DJI A;  2CUZ A;  1ZYR F;  2XAJ A;  4GGG A;  2NVX J;  5J1R A;  2GQQ A;  1V5G A;  4LK0 F;  1NTC A;  3O2P E;  1O7L A;  2XF7 A;  4P96 A;  5HNH A;  3ZMU A;  3OOP A;  4FT8 A;  1MNE A;  3ESW B;  2DYS H;  4QPQ A;  3KFW X;  2A68 F;  5J40 A;  3EDP A;  2RVC A;  4K2E A;  2VBZ A;  2M0C A;  3A4C A;  3M8F A;  3WTV C;  1ZGW A;  5IT9 K;  3E3V A;  2JK3 A;  4Q47 A;  1REP C;  2HID A;  1VFC A;  4KMU X;  3GO5 A;  4PSX A;  5A2Q K;  3F23 A;  2EK5 A;  4YII A;  2XDF C;  3AG4 H;  1UHS A;  4GFB A;  3GFJ A;  1FYM A;  1Z6T A;  1IRX A;  2G7H A;  2QSF X;  2R7T A;  1SVL A;  1AKH B;  2BVM A;  2A6T A;  4V2G A;  4IX7 A;  1IGN A;  3HOU J;  3S2D J;  1YS7 A;  3RKQ A;  3V8K A;  2QBY A;  1W36 C;  2LG4 A;  3R4K A;  1KU2 A;  3JSO A;  3GZ5 A;  4Y7N J;  2BHZ A;  3I58 A;  1BM9 A;  2RKH A;  3DLL F;  3BJ6 A;  1Y8R B;  2L02 A;  5HVQ C;  2ZJQ F;  1QRY A;  1UG0 A;  1TQM A;  1W5T A;  3I53 A;  2V9K A;  3M8J A;  3CP8 A;  3AG2 H;  3DU5 A;  2DA6 A;  1VQ6 I;  4M3D A;  2Q2E B;  4E7K A;  3SEQ A;  2IS4 A;  1OCR H;  5EEH A;  4DJA A;  1R36 A;  1A04 A;  1X1B A;  1RC9 A;  2H94 A;  2K9N A;  1Y4Y A;  4BXU A;  3IKV A;  4XRS A;  4G6D A;  2VI6 A;  1OKR A;  2W82 A;  5GPA A;  2DA5 A;  2BYV E;  1WHU A;  3GFM A;  4HPQ A;  2V1X A;  3CCV I;  2QKL B;  3LOC A;  1XSV A;  2VBY A;  3ZXS A;  4A3I J;  2O6G E;  4CZC A;  1JT0 A;  4B3X A;  1FOY A;  2ZXW H;  3ZCO A;  1KU9 A;  3GW2 A;  4D7N A;  4S05 A;  1U0J A;  1UG2 A;  2E36 A;  1R00 A;  3P9I A;  2CQX A;  4BKX A;  3BY6 A;  4A5N A;  2DT5 A;  3B73 A;  5GPC A;  1JJ8 C;  2RRE A;  3CO6 C;  1ZVV J;  2B7E A;  4B09 A;  2CJJ A;  4HAM A;  2AXL A;  4YEL A;  4J01 A;  4U87 A;  1W5S A;  2CUE A;  4HYE A;  3CJT B;  4J00 A;  3HG9 A;  3EZE B;  2M2E A;  3BZK A;  3HKZ A;  2V1N A;  2A05 A;  1MND A;  2BOL A;  3TGN A;  1X1A A;  3CO7 C;  2VC0 A;  3CQZ J;  1QPI A;  5M3F J;  4GDF A;  1D1B A;  2E5Z A;  1MBE A;  2XRN A;  4LOC A;  2YX7 A;  2E7W A;  3B02 A;  4XKB A;  1BC8 C;  1CF7 B;  2R93 J;  3CDI A;  4A12 A;  1W7P A;  1WJA A;  2F4I A;  4CYC A;  3QP5 A;  2O8X A;  5ICF A;  3HOT A;  3KP6 A;  1LE8 A;  2W25 A;  3IRR A;  1XMK A;  4MHG A;  2OV7 A;  3KP5 A;  2UUZ A;  2V6E A;  4CO8 A;  4YFX F;  2B9S A;  1IC8 A;  2K85 A;  3CLO A;  4MLO A;  1VRC C;  1TQP A;  2M1B A;  2ZC2 A;  3OYJ A;  3MVP A;  1POG A;  4WF2 A;  1WJB A;  3UR3 C;  5LEK A;  2KLO A;  1G3T A;  2GAU A;  1R49 A;  2QF7 A;  4IRI A;  2F5F A;  4ZZD A;  4I0B A;  1MJ9 A;  3BLY A;  1D3Y A;  2VQC A;  2KIU A;  1ZRD A;  4C3J J;  1G8X A;  5D8L B;  4XIC A;  3K4B A;  2EV6 A;  3J80 K;  2KDO A;  1UMQ A;  2FBI A;  3RCO A;  1JKR C;  3R0A A;  3HIF A;  1IO2 A;  4CSW A;  2M34 A;  4GRI A;  2DBB A;  1HW5 A;  2HTS A;  1MSF C;  3PQK A;  3D5R C;  1SD6 A;  5BNG A;  3L2C A;  2O5R A;  4M6Y A;  4Q48 A;  1F5T A;  3IAS 2;  3KE2 A;  4ZYE A;  4A0Y A;  1VQ8 I;  1GVJ A;  4BQA A;  3KIO A;  3K2Z A;  4W1U A;  3ZPL A;  3A0B C;  3KPH A;  1Z3Y A;  2K4J A;  4H4K C;  5C4J J;  3RYP A;  3S3N A;  1EH7 A;  5BQT A;  5LBQ A;  4CCO A;  2OCE A;  3EZB B;  5HS8 A;  4A3C J;  3CES A;  5C44 J;  5L3D A;  1MJB A;  4A6D A;  2KT0 A;  2XGE A;  1IN5 A;  2P6S A;  4IEJ A;  1B6A A;  1ENH A;  2IBD A;  2QKM B;  4CCL A;  2HQ5 A;  1RR8 C;  2R7F A;  5DM7 F;  2OD5 A;  2ETH A;  4I99 C;  4WCG A;  3L2V A;  1BN5 A;  1B1B A;  3K69 A;  2R7S A;  4I02 A;  1ZTR A;  1DGR M;  3BQZ A;  4B44 A;  4G8X A;  1ZEL A;  1VQL I;  1MIJ A;  5E3O A;  2IRF G;  1JKO C;  4F7Z A;  3L7W A;  4AUX A;  1MBK A;  3L1P A;  3LNW A;  4UY8 I;  3TOB A;  4U0W A;  4HG2 A;  1FOW A;  2O7O A;  4XKW A;  1F9N A;  4JBA A;  4HOB A;  5LGT A;  2JJ7 A;  2L4A A;  2JPC A;  2CUF A;  2LMD A;  5FD6 A;  3TP3 A;  4D5C A;  1R5G A;  4ON0 A;  3P7N A;  2YR2 A;  5IYD J;  1LVA A;  4UUV A;  3LQQ A;  1T56 A;  3GLL A;  1WJC A;  2DMP A;  2WAD A;  1W0T A;  3GCM A;  5HDG A;  3LL7 A;  2MLK A;  4AIH A;  4BQQ A;  4AIK A;  1MU4 A;  1UFM A;  5EF6 A;  5EG0 A;  4IHV A;  2D1H A;  4F92 B;  2QSG X;  2XC7 A;  4CDG A;  2D5V A;  4PK4 A;  1AKH A;  4MTD A;  2HFH A;  3OIP A;  4AWX B;  3BR5 A;  1KA5 A;  3K4M A;  1IN6 A;  1A6Q A;  2Q8K A;  3WGG A;  4ZC3 A;  4QWQ A;  1ETV A;  3CF5 F;  3KP3 A;  1B8I B;  3GTG J;  1TLH B;  4KIB A;  4FIS A;  1VTN C;  1BR1 A;  1PVE A;  1HKQ A;  1IN4 A;  3JCU C;  4EM0 B;  2L4M A;  4R8H A;  3NWS A;  2DOE A;  4OOI A;  3PNY A;  1IW7 F;  1TWG J;  2OAZ A;  3V8J A;  1YRN B;  5M3M J;  1PUE E;  4RB2 C;  1K7A A;  3OV8 A;  3HXL A;  3OS2 A;  3ZQF A;  3PSI A;  2JA7 J;  5DTD A;  2JVG A;  2GA1 A;  3F8M A;  3OSG A;  4MEY F;  4Z6Y A;  3IC7 A;  4LIT A;  5D5X B;  2VON A;  3S17 J;  3QPT A;  3DTI A;  3F8N A;  4BJ5 C;  1PUF B;  3ZMT A;  2KDZ A;  3BZC A;  2CQK A;  2K9M A;  5E3N A;  4PJN A;  4LMY A;  3D5S C;  1J0R A;  2JSP A;  2DA2 A;  2EIM H;  4I76 A;  1VND A;  3QAH A;  4FE4 A;  4M73 A;  3WTS C;  3G3Z A;  4UXN A;  2JRM A;  4XOP A;  2EZI A;  4A2U A;  3IH2 A;  2OZ6 A;  2NS8 A;  4L5J A;  1TWA J;  2M9H A;  2CUJ A;  2ESH A;  3K6G A;  4A3J J;  2YUS A;  3ASO H;  2Y0S N;  2JA8 J;  4XOR A;  4A5M A;  1SAN A;  1D5V A;  5IOY A;  1WJ5 A;  2XHK A;  2ECB A;  2F5V A;  3DLA A;  5E3L A;  5T1O A;  1D0Y A;  2LKP A;  2LRD A;  4EJU A;  2F5D A;  4D1Q A;  3OYC A;  3LMM A;  4RB1 A;  2XGC A;  1GVD A;  3U21 A;  3N05 A;  3PFY A;  1WI3 A;  2MD5 A;  2X4H A;  4JK1 X;  4M9S A;  3JSP A;  5HOD A;  2PJR B;  1SAU A;  1PYV A;  1YX3 A;  1K6O A;  3I54 A;  4PJL A;  4A6E A;  2O03 A;  5J47 A;  3VPR A;  1XPX A;  2Y30 A;  3H3V K;  2K40 A;  2KIM A;  5E79 C;  4HRI A;  1IDZ A;  3HOV J;  2KIF A;  2YX4 A;  4YFK F;  2OTL I;  2VJ5 A;  3QOP A;  1Q1V A;  4C2M J;  3JRE A;  2R7R A;  4DYQ A;  1B72 B;  1DP7 P;  1DU6 A;  2QZ8 A;  3BTJ A;  3HOW J;  1Y6I A;  2QQ9 A;  1SD4 A;  5H6R A;  3AL0 C;  2Y31 A;  1QVT A;  3HSE A;  1W4M A;  1F36 A;  5EZH A;  3H9J A;  5J3L A;  5GAE J;  4OMY A;  5CQE A;  2X6X A;  2HNH A;  3MFK A;  1R6R A;  2VL8 A;  3FK7 A;  3QU6 A;  2E1N A;  2M4K A;  4NBQ A;  1RKT A;  2LDU A;  3S1M J;  1WJE A;  3BG5 A;  5FLX Z;  2RNJ A;  1E3P A;  3CCM I;  4R1H A;  2R7V A;  1U8R A;  3QPL A;  3LSH A;  1TQI A;  3OMY A;  5FKL A;  3MEX A;  5CJ9 A;  1JE8 A;  1A35 A;  2Z33 A;  4XLA A;  5HS7 A;  3OQN D;  2VPL A;  2X51 A;  1TC3 C;  2LFB A;  1JTY A;  1IXS B;  1UHW A;  2KRF A;  3PUB A;  4HSR A;  4EV0 A;  2X6Y A;  2JUG A;  1EJ9 A;  1MW7 A;  2L2O A;  2ACJ A;  3HJE A;  3QU3 A;  2ZB9 A;  1A36 A;  3CUO A;  1UAA A;  3BZ6 A;  1HDP A;  3CJQ B;  3N4M A;  4JYK A;  1MGT A;  3GTK J;  3AL0 B;  4AID A;  4HNV A;  5KAF C;  4WWC A;  3GTJ J;  2OBP A;  1FT9 A;  3MKW B;  2CW7 A;  1T2K A;  4CXF A;  2L0K A;  3X2Q H;  2MBF A;  2MH2 A;  2W85 A;  3OYA A;  3D1N I;  3MKY B;  3DXJ F;  3IRQ A;  3CCR I;  5E3M A;  3CME I;  1BI1 A;  1HQC A;  2GA2 A;  4RGR A;  1G4D A;  4HQE A;  2W84 A;  3K7A J;  1G3W A;  4R79 A;  2QWW A;  5LHG A;  1HC8 A;  2O8K A;  2HXI A;  3DBH B;  3G1L A;  2EIK H;  3GZN B;  3W2W A;  5K7Z A;  2XGX A;  4ZTF A;  3GX4 X;  1PDN C;  3LA7 A;  4QSH A;  5EZG A;  1IJW C;  4BUP A;  3BG9 A;  1P7I A;  3M4O J;  1ERD A;  3LE3 A;  5ICG A;  2QVO A;  3S32 A;  2GZW A;  3O8H A;  2ZBK A;  1DUX C;  1S6L A;  1R4M B;  4ENM A;  4G6Q A;  2V4J C;  3OYM A;  3CMY A;  2JWT A;  4LG3 A;  4UV9 A;  2OC6 A;  1APL C;  1E3O C;  3KZY A;  1HW2 A;  2OQR A;  2XPU A;  3LSI A;  3I59 B;  2UWM A;  3LSK A;  3E0J B;  2AO9 A;  5BPD A;  1JKQ C;  2A07 F;  2R7U A;  2G0E A;  3ECO A;  1QBJ A;  2VPR A;  2NVU B;  4L9J A;  2PX9 A;  3ULQ B;  4RDU A;  5JVG F;  1B59 A;  4KIG A;  2CQN A;  4BE2 A;  2E1M B;  1LDK B;  4LG0 B;  4Y17 A;  5TGT A;  1ONV A;  2ZCW A;  4IQJ A;  4IRH A;  5CVV A;  4C3H J;  1BL0 A;  1WJF A;  1BJZ A;  2LLK A;  1R23 A;  2Q2E A;  3VYR B;  4ZZL A;  1GHC A;  2DA7 A;  3ERM A;  1U9O A;  5D8K B;  1FYL A;  3S2H J;  3G1O A;  3COA C;  1MZB A;  1TWC J;  1JGS A;  2HKO A;  4HF2 A;  3LQR A;  4UVC A;  4WXH A;  5ERI A;  3JTH A;  3TO6 A;  5ED4 A;  1FBS A;  4ZDO A;  3S2W A;  1SFX A;  2ZKZ A;  2O61 A;  3QOD A;  2CQQ A;  3CC2 I;  1H9G A;  1IXR C;  3FWE A;  3S1R J;  2YS9 A;  3W6J B;  4OIQ F;  5EGO B;  3F72 A;  4ZYG A;  1BIB A;  4DBQ A;  5JR3 A;  5DCM B;  2MA3 A;  3VFZ A;  3RYR A;  4XRS G;  3BP8 A;  3CDL A;  2LBF A;  1PFH A;  5L3E A;  1JEM A;  2LY9 A;  1FIP A;  5KHD A;  2DDB A;  3OYB A;  3CLQ A;  3M9A A;  5TJJ A;  3VYS B;  5AON A;  1LKX A;  2MLG A;  2E2H J;  2RV8 A;  4RS8 A;  4I7H A;  2AHQ A;  4KMF A;  2E7X A;  1PUF A;  5EYR A;  1D8K A;  4ZDP A;  3L2U A;  3KEY A;  4IHS A;  1BW5 A;  4XKV A;  1JUM A;  1D1A A;  4LFU A;  3LSP A;  1AWC A;  2K9S A;  2BXY A;  2WA0 A;  4A93 J;  2TDX A;  4M72 A;  4X6A J;  2E35 A;  1LFU P;  1A31 A;  1BR4 A;  4OAY A;  2PI0 A;  1K6Y A;  3N97 A;  5LLQ A;  1W0U A;  1EH8 A;  3JAM K;  4AM3 A;  1TZL A;  1IXC A;  1YS6 A;  1EV7 A;  3PO2 J;  1JHH A;  3K1M A;  2M5W A;  3K70 C;  1YTY A;  1S9H A;  4AVZ A;  2XF6 A;  4L5I A;  2ZFW A;  1TWH J;  4DW6 A;  3MCZ A;  4MNU A;  4A3B J;  4Q5S F;  3V42 A;  2VUM J;  4JP0 A;  4XOT A;  3JW4 A;  4P9F A;  3OSF A;  3R6S A;  3IUO A;  3T1B A;  1SC7 A;  2OA4 A;  2G9W A;  4KDP A;  4UUS B;  3LFU A;  4AU7 A;  4O5V A;  1RUN A;  2QM3 A;  2NS7 A;  1S7O A;  2D1V A;  2V79 A;  3LST A;  4O3M A;  2K86 A;  1GGR B;  4HQM A;  1XTA A;  1LPQ A;  1TW3 A;  5J8C A;  4XN0 A;  4KIT B;  1RRJ A;  4B1R A;  4ZTJ A;  2FUG 2;  1S7E A;  2DFE A;  2DU9 A;  3OYD A;  1MBJ A;  1FTT A;  5F08 A;  4CCJ A;  3RZD J;  2RQP A;  1FMW A;  2KIS A;  1B8I A;  2FQ4 A;  3HUG B;  2BVL A;  4F55 A;  1X2M A;  5B66 C;  4EM2 A;  3PJR A;  2WWY A;  2M8G X;  1PJR A;  2XVC A;  3FHZ A;  4EEF G;  4UUS A;  2DTR A;  3AG3 H;  2EFN A;  2R3S A;  5E17 F;  3DPL C;  2CO5 A;  4YRV A;  2WB1 N;  5M5X J;  1T33 A;  2X1D A;  1W36 D;  4C9Y A;  3OL3 A;  3LSJ A;  2DOD A;  5FGM A;  2OCC H;  1K79 A;  1QA6 A;  5IT9 Z;  4HST A;  4FCY A;  4C30 A;  3JRH A;  3PFI A;  4BS9 A;  3ZMS A;  2ZNY A;  4ZDL A;  2E2I J;  4XWJ B;  3PUF A;  3CJR B;  1V4R A;  4EM1 A;  2K02 A;  2A5W A;  4E70 A;  3R0J A;  2YU9 J;  4ANJ A;  2L7M P;  3FMR A;  2CH0 A;  2HOE A;  2L5Q A;  2LY1 A;  1X2N A;  4BGD A;  4BE1 A;  3W6V A;  1TTY A;  3OYE A;  2ICW G;  2WB1 A;  2BW3 B;  1TBX A;  2VT2 A;  1I1S A;  2M87 A;  3CP2 A;  2XV4 S;  2DOF A;  1TXE A;  1RPW A;  1Z91 A;  2L54 A;  4GCV A;  1BJA A;  4IXA A;  1MO1 A;  1MMG A;  4EVI A;  1YX5 A;  4RGS A;  1MSE C;  1YI2 I;  3E5U A;  4PFP A;  4ABZ A;  4BHP A;  4E7H A;  2IA0 A;  3NRV A;  2VAS A;  4JQF A;  2W57 A;  5CVI A;  3RI4 A;  2EV5 A;  5IOZ A;  3WU2 C;  3GTQ J;  3HRU A;  3EUA A;  2VJ4 A;  1A6I A;  3GUD A;  5ILV A;  5H20 A;  3RKW A;  1V3F A;  2KZV A;  1YO5 C;  5FRN A;  3EQL F;  2XAU A;  3I56 I;  4G6T B;  4GYI A;  2OF7 A;  3Q3S A;  3EYI A;  2QEN A;  2X48 A;  3ZQH A;  3W6K B;  5ILU A;  1I6X A;  2A6E F;  3LFG A;  2W48 A;  1KGS A;  3MKZ A;  2QLZ A;  3F6O A;  2O9L A;  2V9V A;  2R7X A;  2HDC A;  4DOZ A;  4L0Z B;  1Z3X A;  3PM1 A;  3I0T A;  4JOM A;  5CPR B;  4F52 A;  3L2R A;  1MBG A;  4PZJ A;  1R71 A;  2UXN A;  4EQQ A;  1D8J A;  1OCZ H;  1QZY A;  3I55 I;  1WRJ A;  2QBY B;  3KZZ A;  4IL6 C;  2ELK A;  2CW8 A;  4B48 A;  2CV2 A;  3FDY A;  1R5I D;  3FXK A;  3MQ0 A;  5LFA A;  2PJR A;  5F6F A;  5FRM A;  2ISY A;  2DA1 A;  2HYJ A;  4HX8 A;  1YIJ I;  4X0G A;  1UHM A;  3ASN H;  2WAF A;  1J6T B;  1R4N B;  2MAB A;  5DD8 A;  1YIO A;  2M7A A;  3OQO D;  3C7J A;  3KYC B;  3GXO A;  4HV5 A;  5D5V B;  1UST A;  4B43 A;  3CDH A;  1JUP A;  2HQA A;  3FBI B;  1K61 A;  4PJJ A;  1LQ1 A;  2VJI A;  3BR1 A;  2Z5U A;  3BG6 A;  4M9Z A;  3GTP J;  2QEX I;  2NXN B;  2CS3 A;  1I1G A;  3HPH A;  2WY8 Q;  3HSF A;  2ELH A;  2HVS A;  2DI3 A;  3SFI A;  1J7K A;  3DBR B;  4PJM A;  2VIX A;  1SVO A;  2VQL A;  3DEE A;  3RJP A;  3H3Z A;  1WI9 A;  2CFO A;  4HNU A;  4QLC U;  1MH4 A;  3I71 A;  4EJW A;  4WK8 F;  3A0H C;  2N8G A;  5E18 F;  4XMY A;  2FE3 A;  1H0M A;  3HTS B;  1T08 B;  3QPS A;  2VQG A;  3QPH A;  2VE9 A;  1QZZ A;  3WHC A;  4KT5 C;  5FFZ A;  3E6D A;  3RKY A;  4LIV A;  4JX4 A;  4HDU A;  1ZRC A;  4BJ6 C;  4ENN A;  3PNT A;  5A2Q Z;  4XLC A;  2Z9O A;  2DK8 A;  4M3B A;  1QFR A;  5E1W A;  1RNL A;  3TW6 A;  3GEZ A;  4M3G A;  4XN3 A;  1OCT C;  2HDW A;  1T38 A;  3C1D A;  4BHC A;  1F1Z A;  1T39 A;  1ZLK A;  1BOA A;  2V26 A;  3QWL A;  3HUG A;  1TT0 A;  3DBL B;  2IP2 A;  3ZRG A;  4AYB N;  5EEG A;  2X9D A;  2BY1 A;  4DZP A;  1K78 A;  1WH7 A;  2HQR A;  3OIQ A;  5BPI A;  4XRM A;  2GXB A;  1USS A;  2EFQ A;  3Q9V A;  3VYT B;  2TRT A;  4XM3 A;  1Y1W J;  1F43 A;  4BEH A;  2XAS A;  2CV0 A;  2FF4 A;  2X6O A;  1X1P A;  3BPX A;  1ZR2 A;  2E5N A;  3AG1 H;  3BCA A;  5KNL A;  2ZME C;  2DN0 A;  4GYG A;  5AIQ A;  3AFH A;  4IOC F;  3LSG A;  1Z1D A;  3KYD B;  5BOX A;  1GXP A;  4L0Y B;  3S93 A;  1SPH A;  2DMT A;  4CH7 A;  2IGK A;  3PIO F;  1P9Q C;  4A3F J;  2EFW A;  5FKN A;  2FD5 A;  2KPM A;  4BAC A;  1QGP A;  5CQG A;  2ZME B;  4N9H A;  2FBK A;  3DP7 A;  4Y13 A;  4PDK A;  3J7A Y;  1Z77 A;  2JA6 J;  1QR5 A;  2KMU A;  2HGC A;  2Y2Z A;  1XDS A;  1Y39 A;  2JN6 A;  1NH3 A;  4NC8 A;  1P92 A;  4BAY A;  4N0B A;  1RI7 A;  1V55 H;  5LD2 C;  5L3G A;  3ZN1 A;  4E7J A;  2OQG A;  1MD0 A;  2HZT A;  4BYY A;  3BC8 A;  2L9N A;  4BY7 J;  2R4G A;  4Z2Y A;  2BHY A;  3K0L A;  5F1R A;  1IRF A;  5GAG J;  3I4N J;  4MEX F;  4MFD A;  2JQ7 A;  3H0D A;  2FRH A;  3K70 D;  1TNS A;  1FWZ A;  2F2E A;  1BR2 A;  3I4P A;  3M07 A;  4XSX F;  4RA2 A;  1ZAR A;  3I64 A;  2H8W A;  2IJL A;  3ZMD A;  3BJA A;  4HZF A;  2JVH A;  4P9U A;  3Q0W A;  1FC3 A;  1WCM J;  5D5W B;  1STZ A;  1XDU A;  2BY2 A;  4YG2 F;  1HDD C;  2HOS A;  2J5O A;  5B3S H;  4H0E A;  1R9T J;  4G7H F;  2IS2 A;  2M7B A;  3MZH A;  2QQ8 A;  3KCC A;  2CRG A;  1HKT A;  1Y56 A;  3HDD A;  2MW8 A;  5H6Q A;  2DJN A;  1KU7 A;  1OFC X;  1PP8 F;  1U6G A;  2XF5 A;  1EH6 A;  1Z7U A;  5CLS A;  1MMS A;  5CYV A;  4OMZ A;  5K5Q A;  3VSL A;  1G2H A;  3P9K A;  3HOX J;  1IN8 A;  3SJM A;  3WE3 A;  1UJ8 A;  2VXZ A;  2ZJ2 A;  2Y9Y A;  2Z3Y A;  5JHF A;  1QHH D;  1YW7 A;  2X85 A;  4HLY A;  1ITY A;  1S7A A;  4RAZ A;  4EGZ A;  1Z9C A;  3REO A;  3ABU A;  4LD5 A;  1MNM C;  4BE0 A;  2DT6 A;  3RSN A;  3SXY A;  4G9Y A;  3SHF A;  1GV5 A;  3DTE A;  3WU0 A;  1DPU A;  1A5J A;  3RPU A;  4P55 A;  3HZJ A;  1ETY A;  3ZQQ A;  1FPQ A;  2M30 A;  2PG4 A;  3FM5 A;  4CZZ A;  3ECH A;  5B1A H;  3H5N A;  4G7O F;  2PMZ A;  3J81 Z;  2UV1 A;  4CCM A;  4I01 A;  2FNA A;  1GT0 C;  1EF4 A;  1D0X A;  5F0F A;  1P2F A;  2CYY A;  1EA3 A;  1GUU A;  5J6X A;  3HB9 A;  3ABT A;  3SYT A;  1XG1 A;  2P5L C;  4KT6 A;  3TP0 A;  1U2W A;  1FOK A;  2IS6 A;  2EWN A;  1FP1 D;  3FXM A;  1E2X A;  2DMU A;  1QVU A;  2M8E A;  3O3K A;  5T1N A;  1XS9 A;  1DQU A;  5J8F A;  5LEJ A;  1I6H J;  1QNT A;  5HLI A;  5DCF A;  2MH9 A;  1X4P A;  3EUH C;  3WTX C;  2CFX A;  1MBF A;  2JZY A;  4NC7 A;  2LSO A;  4E7S A;  2R0Q C;  1K4T A;  4YIF A;  1ON2 A;  3U1D A;  4DIQ A;  3EUK L;  2V1U A;  1MO1 B;  2A61 A;  3HPG A;  1ETW A;  2VKV A;  1X3U A;  1ZG1 A;  4KYW A;  1TW2 A;  3L09 A;  1W7P D;  3E97 A;  4OIP F;  2RLZ A;  4U7B A;  1NK2 P;  1PTF A;  3HKZ N;  1P4A A;  1O57 A;  1IG7 A;  1R1T A;  1FU0 A;  4IF4 A;  4BY1 J;  3SZG A;  1HKS A;  3NEU A;  4MQ9 F;  5AIP A;  3E6C C;  3SEZ A;  1KON A;  1QPM A;  2GXG A;  2IPQ X;  1T0F C;  1Z67 A;  4L9T A;  3FKI J;  1MKM A;  2HVQ A;  2JT1 A;  2BV6 A;  2MFZ A;  1WWX A;  4XNF A;  3HEF A;  2R5Y B;  4D7M A;  5DUI A;  1RR7 A;  1L0O C;  2EZH A;  2R7Q A;  4A0Z A;  3ZMV A;  3Q0U A;  3S16 J;  3FIW A;  4BBR J;  3T0Y A;  5CKT A;  2IGM A;  2JA5 J;  2ZSI B;  2W00 A;  1UB9 A;  3W2V A;  4BU2 A;  3HOS A;  4M74 A;  3ELK A;  2P7C B;  4OIR F;  1D1C A;  4BXX J;  4FQG A;  1ODD A;  4IHY A;  3GF2 A;  3M3Y J;  1HBX G;  3CUQ C;  4XBF A;  2CWE A;  2PMH A;  3CMA I;  4PUS A;  3F21 A;  3G71 I;  3DQV C;  3H0G J;  3KZI C;  1VF9 A;  4OAZ A;  4S0H B;  4U88 A;  1H8A C;  3ERE D;  1XGM A;  4HEA 2;  3CCY A;  3S8P A;  4DBR A;  2E19 A;  1MH3 A;  4RBO A;  2VBX A;  2WV1 A;  3P5J A;  4KNY A;  1Y1V J;  5J1Y A;  2LF8 A;  2HEO A;  3DKY A;  3L2Q A;  4II2 A;  3TOA A;  3MAJ A;  4HV6 A;  3DKW A;  3V4G A;  1ZLJ A;  2RC4 A;  3H5R A;  5GTI C;  1K4S A;  1G3Y A;  1YOV B;  3IH3 A;  3T8R A;  4WX9 A;  4TV7 A;  4NB5 A;  1OPD A;  3ZR8 X;  2LY2 A;  4HLX A;  3WU1 B;  4M6V A;  1WVR A;  5K7H A;  3CC7 I;  2D2W A;  5J4V A;  3BTL A;  2EIL H;  3WTY C;  2GOM A;  4LB5 A;  3MZ8 A;  2KQR A;  1BI2 A;  2M45 A;  2LRL D;  3PIP F;  4BQO A;  2XAG A;  2DFH A;  4DYR A;  4A3L J;  2BZT A;  3OS1 A;  2EJR A;  3S3O A;  3RTR A;  1RZ4 A;  1ZR4 A;  3GFI A;  1HOM A;  5CVJ A;  4KJZ A;  2K9L A;  2L9R A;  4L9V A;  3G4S I;  1MJA A;  4KN7 X;  1POH A;  3C2G A;  1BI3 A;  1V5E A;  2NZV L;  1AA7 A;  2KRH A;  3AKZ A;  3HL2 A;  1U8B A;  4G94 A;  1WJD A;  1ZK8 A;  2VLA A;  1TP4 A;  1ZH5 A;  3HRS A;  3KYL A;  2ECC A;  3ZQG A;  4IVN A;  2NNY A;  4AD9 A;  4B47 A;  3HRM A;  2HVR A;  2LOO A;  3FK6 A;  3EYY A;  3FKJ A;  5EJC A;  1MMD A;  4XSZ F;  3HYI A;  3W3C A;  1W7P B;  1L3L A;  1HLV A;  2Y75 A;  1BIA A;  2LH9 A;  2JUC A;  4PFO A;  1U78 A;  3DKX A;  2YPR A;  3WTW C;  1W5C C;  2B63 J;  1ETK A;  3S1Q J;  1ZQ3 P;  3RPU D;  2FX0 A;  1DDN A;  2RN7 A;  5B1B H;  2EZL A;  3MD2 A;  3ZQL A;  4ZYA A;  3TQN A;  2C6Y A;  4RGX A;  2Z1D A;  3I9V 2;  1BOB A;  4PSW A;  4NNJ A;  3K1N A;  3WOD F;  1UCR A;  5HOO A;  2CMP A;  2W1O A;  3GTL J;  1PCH A;  4LLL A;  1QHG A;  4A3K J;  1C0W A;  2FML A;  3I5U A;  1XGO A;  4HA8 A;  1RKW A;  1SMY F;  4N4O B;  2VC1 A;  4YEJ A;  4MGR A;  1Z05 A;  4KIF A;  4S04 A;  4BDZ A;  2FQ3 A;  2ME6 A;  4IHT A;  6PAX A;  4ZJZ A;  1RES A;  1IUF A;  1Z7L A;  4GO1 A;  1B72 A;  2BY0 A;  1LFP A;  1WKM A;  3BG3 A;  4DNC A;  1TNT A;  5IYB J;  4RB0 A;  5C3E J;  2HPI A;  2EFP A;  5F0C A;  2M4G A;  4V2F A;  2STW A;  2KJC A;  2ZNZ A;  4HF0 A;  4QPO A;  3HGY A;  1MBH A;  4II3 A;  2K27 A;  2GM4 A;  1RET A;  1IV8 A;  3A01 B;  5D4S A;  1IRG A;  3D5L A;  4M9X A;  2EQR A;  4OWR B;  2W4S A;  4XQF A;  3OY9 A;  4DYC A;  1ZHF A;  2R7D A;  4IO9 F;  1KQ8 A;  5DM6 F;  2JPB A;  3FXO A;  2L7Z A;  3C3W A;  2IGN A;  4D0P A; 
#chains in the Genus database with same CATH homology
 4HX7 A;  1HW1 A;  2EB7 A;  2WTE A;  2KKO A;  1P6R A;  5L3C A;  5HLG A;  1BBY A;  2O0Y A;  2X0L A;  3IWZ A;  5ILS A;  3V8L A;  3FMQ A;  2ISZ A;  3WGH A;  4WXC A;  1CF7 A;  1SD5 A;  1R5H A;  4EGY A;  5LGU A;  3KP2 A;  1U5T A;  1FP2 A;  5K5R A;  3CJN A;  1SFE A;  4BNC A;  3DFG A;  3HRT A;  2EA2 A;  3M8E A;  4FHT A;  1FYK A;  1PP7 U;  1S29 A;  1P4X A;  3GZ6 A;  3ML6 A;  3VB2 A;  1QQI A;  4ESJ A;  1CGP A;  4PGH A;  3ISP A;  1R1U A;  5CVR A;  5JVT A;  1OMI A;  1K78 B;  1DPR A;  4L9N A;  1XN7 A;  4IRG A;  3NQO A;  1O3S A;  3EET A;  1YFH A;  2P5K A;  2PQ8 A;  1SAX A;  1RIO H;  4UHT A;  2BGC A;  4XLN F;  4ESB A;  1Q1H A;  5E20 A;  4LG0 A;  1XSX A;  2QQB A;  1ZGA A;  4MTE A;  2EFO A;  1ZAO A;  5CVU A;  1IN7 A;  4AVP A;  3G73 A;  4A0X A;  5HDK A;  1SD7 A;  2FMY A;  4RGU A;  3CUQ A;  5ICE A;  3LAJ A;  2P5V A;  4M6X A;  4RAY A;  2CG4 A;  5FB2 A;  4CGZ A;  2P6T A;  3VOE A;  2OU2 A;  4BH9 A;  4XLP F;  1YW9 A;  1JXS A;  3U9G A;  3SZP A;  3ZQ7 A;  2A69 F;  3FM3 A;  4XRF A;  1KU3 A;  2VN2 A;  4OIO F;  3FZV A;  4I09 A;  4B8X A;  2H09 A;  2H6B A;  2IA2 A;  4IPA A;  3C18 A;  4GXO A;  1YQA A;  3ZN0 A;  5D5U B;  2L01 A;  2J5P A;  4LLN A;  3RKX A;  1MDM B;  4EJT A;  2HQN A;  4LB6 B;  1LDD A;  5DEQ A;  5JI6 A;  3TO9 A;  1FY7 A;  2DLL A;  4CIC A;  5TRD A;  2ADU A;  2GIV A;  1ULY A;  2VOP A;  1I5Z A;  5LGN A;  3L00 A;  1ZG3 A;  1RUO A;  3K1P A;  4I98 B;  1HXD A;  2QQA A;  5FLX K;  4PGG A;  1FNN A;  4N9I A;  3TKY A;  2HYG D;  1SFU A;  1J2X A;  4ETS A;  1R22 A;  1Z6R A;  3M7G A;  4HDV A;  2XAQ A;  1OR7 A;  3ZMZ A;  3KET A;  3FX3 A;  3KLO A;  3KEO A;  2KJB A;  3SZT A;  3Q5F A;  5DV5 A;  2JRT A;  4ASN A;  5K5O A;  1KYZ A;  1AOY A;  2NS0 A;  2IVM A;  3HTU A;  3KP4 A;  2HKX A;  1G3S A;  3LA2 A;  5LHI A;  2YU3 A;  2FXA A;  3KEQ A;  2ZO4 A;  2OZU A;  3VOD A;  4NHJ A;  3VEP A;  2PLY A;  3F22 A;  1QO0 D;  3GWZ A;  3DEU A;  4P5O A;  1KYW A;  3PQJ A;  3TDZ C;  3DPT A;  2ZME A;  3BRO A;  5FO5 A;  1R7J A;  1GXQ A;  3FMS A;  2HYF A;  4LGW A;  3U2R A;  5DYM A;  3V7C A;  1U3E M;  1LB2 A;  5E8G A;  3JAM Z;  4UV8 A;  1O3T A;  4KN4 X;  4LLG F;  1HST A;  3WTZ A;  3QP6 A;  3J81 K;  2DQL A;  3BPV A;  4LK1 F;  3WTT C;  1XSD A;  4WXD A;  2XUB A;  2D45 A;  4PCQ A;  2FOK A;  2XRO A;  2EV0 A;  4I2O A;  4U0V A;  2H6C A;  5L3B A;  2PFB A;  3ROU A;  5LRS A;  2BBY A;  4CHU A;  2NRA C;  5DCM A;  4UVA A;  2EA4 A;  3CUQ B;  5FD5 A;  3Q9S A;  2B0L A;  2P8T A;  5E1X A;  2BEO A;  2K7L A;  1P4W A;  1HSJ A;  2CW0 F;  2FSW A;  1ZN2 A;  2PJP A;  2JSC A;  2XKP A;  3R61 A;  2NYX A;  3T8T A;  1E17 A;  2DK5 A;  2UZK A;  2IT0 A;  5ICC A;  2O3F A;  2NNN A;  3TDU C;  3GFL A;  5F64 A;  2CGP A;  1J75 A;  3H92 A;  1MDM A;  3AAF A;  2LNB A;  5L3F A;  2VE8 A;  3WTU C;  3CTA A;  5DDG A;  3GVA A;  1O3Q A;  4UVB A;  3V7S A;  1BC7 C;  1KA8 A;  3DV8 A;  2W24 A;  1OPC A;  1S8N A;  2PBI A;  1IZ1 A;  3EUH A;  3RDI A;  4DQ2 A;  2COM A;  4KUM A;  5HLH A;  3FXQ A;  2DQR A;  1JHF A;  1YW8 A;  2RGV A;  1B9M A;  4YFN F;  1FBQ A;  2Y0M A;  4MQV A;  4HW0 A;  4BHB A;  1XGS A;  3J7A O;  5E8I A;  4M71 A;  1IUY A;  2Z99 A;  3FXU A;  1T0F A;  3E5Q A;  1WSU A;  2PMU A;  1R1V A;  5JFR A;  1KQ9 A;  3TO7 A;  4Q4Z F;  2BE5 F;  2DPD A;  1BI0 A;  3HHG A;  2GWR A;  1ZRE A;  2DFI A;  1FBU A;  5KK1 A;  2E1C A;  4RB3 C;  3P9C A;  3DF8 A;  3WE2 A;  1B4A A;  4NQW A;  4HBL A;  3KLN A;  4KIC A;  2LF7 A;  2WC2 A;  3E6M A;  5JHU A;  1XCV A;  4EJV A;  1NHA A;  2PN6 A;  3BDD A;  3BWG A;  1FZP B;  2XKO A;  3R60 A;  4ZYD A;  4UNO A;  5K1Y A;  2IA1 A;  3J80 Z;  2DO7 A;  1IF1 A;  2DAO A;  1XCB A;  3MWM A;  1LEA A;  1OYI A;  3QRF F;  3ZP5 A;  2G7U A;  4LJZ F;  2VBW A;  4AIJ A;  1KQ0 A;  5BMZ A;  4Y15 A;  2FEZ A;  2F5C A;  3F3X A;  2HR3 A;  3LA3 A;  3HHH A;  2XAF A;  2VOD A;  1ON1 A;  3FXR A;  1XB4 A;  1O7F A;  1YLF A;  1XGN A;  2HWV A;  3IHU A;  1ZGJ A;  2JTV A;  2FU4 A;  2VT3 A;  3H3U A;  1LJ9 A;  3M1E A;  5KVR A;  4FX4 A;  3WG9 A;  1R58 A;  1LDJ A;  1XMA A;  1ZG5 A;  1FX7 A;  4ENJ A;  3O6B B;  2L3D A;  1J9I A;  2DPU A;  3L9F A;  1SMT A;  5LHH A;  3E5X A;  5D6F A;  2UXX A;  4FX0 A;  2FA5 A;  1OYW A;  3HSR A;  1F4K A;  4ZYH A;  2QUF A;  3WGI A;  2STT A;  3IL2 A;  4O6J A;  1YG2 A;  1B9N A;  3F8B A;  5HDN A;  3IWF A;  3K9T A;  4EJO A;  4CYD A;  4ENK A;  2V1D A;  4IJA A;  3LAP A;  5LRR A;  1OYY A;  1WQ2 A;  1FSE A;  2XIG A;  5E1Z B;  3MZY A;  5FFX A;  3D0S A;  3LFK A;  1XD7 A;  4HF1 A;  4OU0 A;  2A6H F;  1ZRF A;  2IW5 A;  2CSO A;  1IAW A;  1T6S A;  2K4B A;  2Y48 A;  2MC3 A;  2V6C A;  3FF5 A;  5DD4 A;  2FNP A;  4U0Y A;  5DUK A;  2P7V B;  4EMS A;  4ESF A;  2WV0 A;  3GLX A;  4I0A A;  4U7D A;  1U5T C;  1Y0U A;  3KP7 A;  4OIN F;  2FBH A;  3E6B A;  4L18 B;  3SFZ A;  3LWF A;  3JTG A;  2F5E A;  1O3R A;  1LNW A;  2QYO A;  3F8C A;  4HX4 A;  2P4W A;  5HS9 A;  3F6V A;  3SQN A;  5D6E A;  2HTJ A;  1U5T B;  2A3S A;  4KFC A;  4KA4 A;  2RDP A;  3IKT A;  1T98 A;  3BOQ A;  1FLI A;  2XAH A;  5BS6 A;  1YYV A;  2VOO A;  1LEB A;  1I27 A;  2ESN A;  2ZXJ A;  3RPQ A;  3GYH X;  2YSR A;  3V7R A;  2AS5 F;  1J5Y A;  1FSH A;  2HS5 A;  3F8F A;  3T5X A;  5IT3 A;  3BJO A;  4ZH4 F;  5D4R A;  2DW4 A;  1G6N A;  2NAZ A;  2PEX A;  4G7Z F;  1H9T A;  2A5Y B;  1J59 A;  2Q0O A;  1S3J A;  3RIR A;  2H27 A;  3I59 A;  1ZYR F;  2XAJ A;  4GGG A;  2GQQ A;  4LK0 F;  3O2P E;  1O7L A;  4P96 A;  3ZMU A;  3OOP A;  4FT8 A;  3KFW X;  2A68 F;  3EDP A;  2RVC A;  4K2E A;  2VBZ A;  3M8F A;  3WTV C;  5IT9 K;  3E3V A;  4Q47 A;  1REP C;  4KMU X;  3GO5 A;  5A2Q K;  3F23 A;  2EK5 A;  4YII A;  3GFJ A;  1FYM A;  1Z6T A;  2G7H A;  1YS7 A;  3V8K A;  2QBY A;  3R4K A;  1KU2 A;  3JSO A;  3GZ5 A;  3I58 A;  1BM9 A;  2RKH A;  3BJ6 A;  2L02 A;  5HVQ C;  1TQM A;  1W5T A;  3I53 A;  5EEH A;  1R36 A;  1A04 A;  2H94 A;  4BXU A;  3IKV A;  4G6D A;  1OKR A;  2BYV E;  3GFM A;  2V1X A;  2O6G E;  1XSV A;  2VBY A;  1KU9 A;  3GW2 A;  4S05 A;  1R00 A;  3P9I A;  3BY6 A;  4A5N A;  2DT5 A;  3B73 A;  3CO6 C;  4B09 A;  4HAM A;  2AXL A;  1W5S A;  4HYE A;  3TGN A;  3CO7 C;  2VC0 A;  2XRN A;  1CF7 B;  2YX7 A;  2E7W A;  3B02 A;  1BC8 C;  4A12 A;  1W7P A;  3QP5 A;  2O8X A;  5ICF A;  3HOT A;  3KP6 A;  2W25 A;  3IRR A;  1XMK A;  4MHG A;  3KP5 A;  4CO8 A;  4YFX F;  3CLO A;  1TQP A;  2M1B A;  4WF2 A;  5LEK A;  1G3T A;  2GAU A;  4IRI A;  2F5F A;  4ZZD A;  4I0B A;  1MJ9 A;  1D3Y A;  2KIU A;  1ZRD A;  5D8L B;  2EV6 A;  3J80 K;  2FBI A;  3R0A A;  3HIF A;  2DBB A;  1HW5 A;  2HTS A;  3PQK A;  1SD6 A;  3L2C A;  4M6Y A;  4Q48 A;  1F5T A;  3KE2 A;  4ZYE A;  4A0Y A;  1GVJ A;  4BQA A;  3K2Z A;  3ZPL A;  2K4J A;  3RYP A;  1EH7 A;  5BQT A;  5LBQ A;  5HS8 A;  5L3D A;  1MJB A;  4A6D A;  1IN5 A;  2P6S A;  1B6A A;  2R7F A;  2OD5 A;  2ETH A;  4WCG A;  1BN5 A;  1B1B A;  3K69 A;  4I02 A;  4G8X A;  2IRF G;  4F7Z A;  3L7W A;  3TOB A;  4U0W A;  1F9N A;  4JBA A;  4HOB A;  5LGT A;  2L4A A;  2JPC A;  5FD6 A;  1R5G A;  4ON0 A;  3P7N A;  2YR2 A;  1LVA A;  4UUV A;  3LQQ A;  5HDG A;  2MLK A;  4AIH A;  4AIK A;  1UFM A;  2D1H A;  4CDG A;  4MTD A;  2HFH A;  4AWX B;  1IN6 A;  2Q8K A;  3WGG A;  4QWQ A;  3KP3 A;  1TLH B;  4KIB A;  1VTN C;  1HKQ A;  1IN4 A;  4EM0 B;  2L4M A;  4R8H A;  4OOI A;  1IW7 F;  2OAZ A;  3V8J A;  1PUE E;  4RB2 C;  1K7A A;  3OV8 A;  2GA1 A;  3F8M A;  4MEY F;  3IC7 A;  5D5X B;  2VON A;  3QPT A;  3F8N A;  3ZMT A;  2CQK A;  4LMY A;  1J0R A;  3QAH A;  4M73 A;  3WTS C;  3G3Z A;  4UXN A;  4A2U A;  2OZ6 A;  4L5J A;  2ESH A;  1D5V A;  4A5M A;  2XHK A;  2LKP A;  4EJU A;  2F5D A;  4RB1 A;  4JK1 X;  2MD5 A;  2X4H A;  4M9S A;  3JSP A;  1K6O A;  3I54 A;  4A6E A;  2O03 A;  2KIM A;  2KIF A;  2YX4 A;  4YFK F;  3QOP A;  1DP7 P;  2QZ8 A;  2QQ9 A;  1SD4 A;  5H6R A;  3HSE A;  1W4M A;  4OMY A;  3MFK A;  3QU6 A;  2E1N A;  2LDU A;  5FLX Z;  2RNJ A;  4R1H A;  1U8R A;  1TQI A;  3MEX A;  5CJ9 A;  1JE8 A;  2Z33 A;  5HS7 A;  1IXS B;  1UHW A;  2KRF A;  4EV0 A;  2ACJ A;  3QU3 A;  3CUO A;  3BZ6 A;  3N4M A;  1MGT A;  4WWC A;  2OBP A;  1FT9 A;  1T2K A;  4CXF A;  2MBF A;  2MH2 A;  2W85 A;  3DXJ F;  3IRQ A;  1BI1 A;  1HQC A;  2GA2 A;  4RGR A;  1G4D A;  4HQE A;  2W84 A;  1G3W A;  4R79 A;  2QWW A;  5LHG A;  2XGX A;  1PDN C;  3GX4 X;  3LA7 A;  5ICG A;  2QVO A;  2GZW A;  2ZBK A;  1DUX C;  1S6L A;  4ENM A;  4G6Q A;  4UV9 A;  1HW2 A;  3KZY A;  2OQR A;  3I59 B;  2UWM A;  5BPD A;  2A07 F;  3ECO A;  1QBJ A;  3ULQ B;  4L9J A;  1B59 A;  4KIG A;  1LDK B;  4LG0 B;  4Y17 A;  1ONV A;  2ZCW A;  4IRH A;  5CVV A;  1R23 A;  2Q2E A;  4ZZL A;  1GHC A;  5D8K B;  1FYL A;  3COA C;  1MZB A;  1JGS A;  2HKO A;  4HF2 A;  3LQR A;  4UVC A;  4WXH A;  5ERI A;  3JTH A;  3TO6 A;  5ED4 A;  1FBS A;  3S2W A;  1SFX A;  2ZKZ A;  2O61 A;  1H9G A;  1IXR C;  3FWE A;  3W6J B;  4OIQ F;  3F72 A;  4ZYG A;  1BIB A;  5JR3 A;  5DCM B;  2MA3 A;  3VFZ A;  3RYR A;  3BP8 A;  5L3E A;  3M9A A;  5TJJ A;  5AON A;  2MLG A;  2RV8 A;  4RS8 A;  4I7H A;  4KMF A;  2E7X A;  1D8K A;  4IHS A;  1AWC A;  4LFU A;  2TDX A;  4M72 A;  2PI0 A;  3N97 A;  5LLQ A;  1EH8 A;  3JAM K;  1IXC A;  1YS6 A;  1EV7 A;  1JHH A;  3K1M A;  2M5W A;  1YTY A;  4L5I A;  2ZFW A;  3MCZ A;  4MNU A;  4Q5S F;  3JW4 A;  4P9F A;  3R6S A;  3T1B A;  2OA4 A;  2G9W A;  4KDP A;  4O5V A;  1RUN A;  2QM3 A;  2V79 A;  1S7O A;  2D1V A;  3LST A;  4O3M A;  2K86 A;  4HQM A;  1TW3 A;  5J8C A;  2DU9 A;  2RQP A;  4EM2 A;  2WWY A;  2XVC A;  3FHZ A;  2DTR A;  2EFN A;  2R3S A;  5E17 F;  3DPL C;  2CO5 A;  5FGM A;  1K79 A;  5IT9 Z;  3PFI A;  3ZMS A;  2ZNY A;  1V4R A;  4EM1 A;  2K02 A;  4E70 A;  3R0J A;  3FMR A;  2HOE A;  1TTY A;  1TBX A;  2VT2 A;  1I1S A;  2M87 A;  2XV4 S;  1Z91 A;  2L54 A;  4GCV A;  1BJA A;  4IXA A;  4EVI A;  4RGS A;  3E5U A;  4BHP A;  2IA0 A;  3NRV A;  4JQF A;  2W57 A;  5CVI A;  3RI4 A;  2EV5 A;  3HRU A;  3GUD A;  5ILV A;  5H20 A;  3RKW A;  1V3F A;  1YO5 C;  3EQL F;  4GYI A;  3EYI A;  2QEN A;  3W6K B;  5ILU A;  1I6X A;  2A6E F;  1KGS A;  2QLZ A;  3F6O A;  2V9V A;  2HDC A;  4L0Z B;  3I0T A;  4PZJ A;  2UXN A;  4EQQ A;  1D8J A;  1QZY A;  1WRJ A;  2QBY B;  3KZZ A;  3MQ0 A;  5F6F A;  2ISY A;  4HX8 A;  1UHM A;  5DD8 A;  1YIO A;  3C7J A;  3GXO A;  4HV5 A;  5D5V B;  1UST A;  3CDH A;  1LQ1 A;  2Z5U A;  4M9Z A;  1I1G A;  3HSF A;  2ELH A;  2DI3 A;  1J7K A;  3RJP A;  3H3Z A;  1WI9 A;  4QLC U;  3I71 A;  4EJW A;  4WK8 F;  5E18 F;  1H0M A;  2FE3 A;  3HTS B;  3QPH A;  2VE9 A;  1QZZ A;  4KT5 C;  5FFZ A;  3E6D A;  3RKY A;  1ZRC A;  4HDU A;  4ENN A;  5A2Q Z;  2Z9O A;  2DK8 A;  5E1W A;  1RNL A;  3GEZ A;  1T38 A;  3C1D A;  4BHC A;  1F1Z A;  1T39 A;  1ZLK A;  1BOA A;  3HUG A;  2IP2 A;  5EEG A;  1K78 A;  2HQR A;  5BPI A;  2GXB A;  1USS A;  2EFQ A;  3Q9V A;  2XAS A;  2FF4 A;  3BPX A;  4GYG A;  5AIQ A;  1Z1D A;  5BOX A;  1GXP A;  4L0Y B;  2EFW A;  1QGP A;  2ZME B;  4N9H A;  2FBK A;  3DP7 A;  4Y13 A;  4PDK A;  2HGC A;  1XDS A;  1P92 A;  4BAY A;  4N0B A;  1RI7 A;  5L3G A;  3ZN1 A;  2OQG A;  1MD0 A;  4BYY A;  2HZT A;  4Z2Y A;  3K0L A;  5F1R A;  1IRF A;  4MEX F;  2FRH A;  1TNS A;  1FWZ A;  2F2E A;  3I4P A;  4XSX F;  1ZAR A;  3I64 A;  2IJL A;  3ZMD A;  3BJA A;  4HZF A;  4P9U A;  1FC3 A;  5D5W B;  1STZ A;  1XDU A;  4YG2 F;  2J5O A;  4H0E A;  4G7H F;  3MZH A;  3KCC A;  1HKT A;  5H6Q A;  1KU7 A;  1PP8 F;  1U6G A;  1EH6 A;  1Z7U A;  5CLS A;  5CYV A;  4OMZ A;  5K5Q A;  3P9K A;  1IN8 A;  3WE3 A;  2VXZ A;  2ZJ2 A;  2Z3Y A;  1YW7 A;  4HLY A;  1S7A A;  4RAZ A;  4EGZ A;  1Z9C A;  3REO A;  3ABU A;  4LD5 A;  3SXY A;  4G9Y A;  3SHF A;  3WU0 A;  1DPU A;  3RPU A;  4P55 A;  1FPQ A;  2M30 A;  2PG4 A;  3FM5 A;  4CZZ A;  3ECH A;  4G7O F;  3J81 Z;  4I01 A;  2FNA A;  1P2F A;  2CYY A;  5J6X A;  3ABT A;  2P5L C;  1U2W A;  1FOK A;  2EWN A;  1FP1 D;  1E2X A;  2M8E A;  3O3K A;  5J8F A;  5LEJ A;  1QNT A;  5HLI A;  5DCF A;  2MH9 A;  3WTX C;  2CFX A;  2JZY A;  2LSO A;  4YIF A;  1ON2 A;  3U1D A;  2V1U A;  2A61 A;  1X3U A;  1ZG1 A;  4KYW A;  1TW2 A;  3L09 A;  1W7P D;  3E97 A;  4OIP F;  4U7B A;  1P4A A;  1O57 A;  1R1T A;  4IF4 A;  1HKS A;  3NEU A;  4MQ9 F;  5AIP A;  3E6C C;  1QPM A;  2GXG A;  2IPQ X;  4L9T A;  1MKM A;  2JT1 A;  2BV6 A;  1WWX A;  5DUI A;  1L0O C;  4A0Z A;  3ZMV A;  3T0Y A;  1UB9 A;  3HOS A;  4M74 A;  3ELK A;  2P7C B;  4OIR F;  1ODD A;  3GF2 A;  1HBX G;  3CUQ C;  4XBF A;  2CWE A;  2PMH A;  3F21 A;  3DQV C;  4U88 A;  3ERE D;  1XGM A;  2VBX A;  4KNY A;  2LF8 A;  2HEO A;  3TOA A;  3MAJ A;  4HV6 A;  3DKW A;  3V4G A;  1ZLJ A;  2RC4 A;  1G3Y A;  3T8R A;  4WX9 A;  4TV7 A;  4NB5 A;  4HLX A;  3WU1 B;  2D2W A;  3WTY C;  4LB5 A;  1BI2 A;  2M45 A;  2XAG A;  2EJR A;  3RTR A;  1RZ4 A;  3GFI A;  5CVJ A;  4L9V A;  1MJA A;  4KN7 X;  1BI3 A;  4G94 A;  1ZH5 A;  3HRS A;  4IVN A;  2NNY A;  4AD9 A;  3HRM A;  3EYY A;  4XSZ F;  3HYI A;  1W7P B;  1L3L A;  2Y75 A;  1BIA A;  1U78 A;  2YPR A;  3WTW C;  1DDN A;  2RN7 A;  3TQN A;  2C6Y A;  4RGX A;  3K1N A;  3WOD F;  1UCR A;  5HOO A;  4LLL A;  1C0W A;  2FML A;  3I5U A;  1XGO A;  4HA8 A;  1SMY F;  2VC1 A;  4MGR A;  1Z05 A;  4KIF A;  4S04 A;  2FQ3 A;  6PAX A;  4IHT A;  4GO1 A;  1WKM A;  4DNC A;  1TNT A;  4RB0 A;  2EFP A;  2STW A;  2KJC A;  2ZNZ A;  4HF0 A;  2K27 A;  5D4S A;  1IRG A;  3D5L A;  4M9X A;  1ZHF A;  2R7D A;  1KQ8 A;  2JPB A;  3C3W A;  4D0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...