1J5YA

Crystal structure of transcriptional regulator (tm1602) from thermotoga maritima at 2.3 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGGKSGVSRLVAVKHAPEEIKEELLCVVRNGGRIVDVIVEHPVYGEIRGIIDVSSEEEVLKFVNLMEMAKTEPLLTLSGGVHLHTIEAPDEETMERIMRELKKKGFLIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, BIOTIN REPRESSOR FAMILY
publication title Crystal structure of a transcription regulator (TM1602) from Thermotoga maritima at 2.3 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 51
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02829 3H 3H domain
A PF08279 HTH_11 HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j5yA01
3.30.1340.20 Alpha Beta 2-Layer Sandwich Histidine-containing Protein; Chain: A; 3H domain 1j5yA02
1SD6A 2F5DA 1SFUA 2XGXA 1WWXA 1Y0UA 4WWCA 1CF7B 4EJWA 4G9YA 1W4MA 1H0MA 1U78A 1REPC 1R1UA 4ZZDA 2CO5A 4GXOA 5F64A 3K1PA 2HKOA 3F6OA 2Z99A 3WTYC 2OBPA 4HV6A 1TTYA 2MD5A 3RKWA 2ZJ2A 4CDGA 1B1BA 1ZGAA 5K1YA 3MZHA 4WXHA 2ESHA 3TO7A 1RIOH 3I58A 2OU2A 2YR2A 1HW1A 3E6MA 5JR3A 3VFZA 3G3ZA 1S7OA 1SD7A 4I98B 5E8IA 3IHUA 1IN5A 1RNLA 3HHHA 4HX7A 3W6JB 3BROA 2DT5A 2F5CA 4BHPA 4IVNA 4U7DA 3L00A 1LQ1A 5ILUA 1JHFA 4EJVA 2KIMA 5D8KB 4LJZF 3K1MA 3H3ZA 3QU3A 1QZYA 4Q4ZF 1ZHFA 3KP7A 2HEOA 5H6RA 2FA5A 3KFWX 2DPUA 1W7PA 2Z9OA 3BP8A 4MEYF 1ZG3A 1SD5A 4R8HA 1U2WA 5L3FA 1P4XA 3RKXA 1P4WA 1R5HA 5D4RA 3F21A 4JK1X 1WQ2A 4B8XA 1UCRA 3GVAA 2ZCWA 1MJBA 5K5RA 3T8TA 2M30A 2DLLA 1LEBA 1TW3A 3I59B 1FYLA 3MEXA 2HR3A 3KEOA 3SHFA 5A2QK 2QQ9A 5BOXA 3HRUA 4QWQA 2XVCA 4I01A 1SFEA 2JPCA 2VODA 2A07F 3K0LA 3P9KA 2W85A 4KIGA 3QP6A 2CYYA 1T2KA 3HOSA 3K9TA 3DV8A 4GGGA 3RIRA 3K69A 4ASNA 2P5VA 3F6VA 2HQNA 2XAGA 1FSHA 2F5FA 3WGGA 1RUNA 1U5TB 2B0LA 3P9IA 1YS7A 4IRGA 5CJ9A 5HDGA 2KIFA 5BQTA 4CXFA 2QWWA 4UVBA 2QQBA 4KN4X 5E1ZB 5H20A 2OD5A 3WGIA 2FSWA 1DPUA 1LNWA 2DK5A 2WTEA 5LHIA 3LA2A 3MQ0A 4OOIA 3KETA 1K78B 2NNYA 2CFXA 4TV7A 2UZKA 2GXGA 1WI9A 1P92A 1IN6A 2MA3A 3ECOA 4BHBA 1JE8A 1B59A 4RGXA 4HDVA 2A6HF 3V8JA 3ZP5A 2ISZA 2HKXA 3MCZA 2XKPA 4AIJA 3I71A 3CTAA 2KJBA 4P9FA 4U88A 2MC3A 3BJOA 4S05A 2H27A 3DP7A 1K7AA 1O3QA 3GZ6A 3C1DA 1ZREA 2W57A 5HVQC 1SMYF 3GFLA 1WKMA 2DBBA 2IA2A 2KIUA 2YSRA 2HGCA 2XKOA 1MD0A 1TBXA 4HLYA 1YS6A 3WG9A 3KZZA 2UWMA 3FXUA 1YO5C 1QPMA 2OZ6A 4LD5A 4RS8A 2G9WA 1FT9A 1S8NA 4CICA 1RUOA 2E7XA 2OZUA 4RB2C 1W7PB 3BZ6A 2CGPA 1VTNC 4L0YB 4CZZA 2P7VB 5CVVA 2QLZA 2VT3A 4UHTA 2EK5A 2VBXA 3BJ6A 4R79A 5DD8A 2EWNA 5E18F 1O3RA 3K1NA 1G3SA 4HLXA 2AXLA 2V1XA 3J7AO 3HTUA 5HLIA 3DPTA 3C7JA 1BBYA 2IVMA 4Y13A 5KVRA 5CVUA 1STZA 2EB7A 2COMA 4RB1A 4NB5A 4KIFA 3HOTA 4BYYA 5ILVA 2PMHA 5D8LB 4M6XA 3E6CC 4U0VA 4BHCA 4U0WA 3S2WA 3IKTA 1XCVA 1ULYA 3JAMK 4A6EA 3GEZA 3F8CA 1BC8C 4XSXF 4P9UA 3E6DA 1ZLKA 3PQJA 2UXXA 1S29A 2FOKA 5IT9K 3TO6A 4IF4A 2EFOA 1T98A 2IA0A 3GZ5A 2VE9A 4A5NA 1W5TA 4LK1F 4P5OA 3ULQB 1ZARA 3SQNA 1FBUA 4D0PA 3EYYA 1UHWA 1QQIA 1V3FA 2K4BA 4MGRA 2JRTA 1XN7A 2MLKA 1FZPB 3LA7A 4A0ZA 1XSVA 2DQLA 3R0JA 1O7FA 5F1RA 1XCBA 1DP7P 3FXRA 4WCGA 3HRMA 4AWXB 4FT8A 1BOAA 4UV8A 3KE2A 3CJNA 2HTJA 1ZRFA 2M45A 2MBFA 3KZYA 4BQAA 3J80Z 3F8BA 4A0YA 4HQEA 5AONA 3WU1B 5K5QA 2XASA 2VT2A 2EFNA 1FWZA 1OYIA 1DUXC 2VC0A 1HKSA 2Z33A 1T38A 3T5XA 3IWFA 3SXYA 4KNYA 2G7UA 3HIFA 3E3VA 4ZYHA 2RVCA 2GQQA 3V7RA 2RN7A 1OKRA 2PLYA 4HZFA 1J75A 2E1CA 2VBZA 3QOPA 1MGTA 4EM2A 3GW2A 3C18A 1U5TC 1MZBA 1R5GA 1QO0D 3ML6A 3WTUC 1JHHA 2ZNZA 1R1TA 5HLGA 2EA4A 2W25A 4AIKA 2VC1A 4GYGA 3I4PA 5FFXA 4LB5A 1Z7UA 1S7AA 4A12A 1P6RA 3TOAA 3VODA 3O6BB 4UVAA 1Z05A 3G73A 4NQWA 2FMYA 4PCQA 4KMFA 5DCMB 4MTDA 1YFHA 1HKQA 2HQRA 3DFGA 3R60A 4ZYGA 5LLQA 1BI3A 4PDKA 2YX7A 1LEAA 5LGUA 2WV0A 3F23A 2O03A 5A2QZ 3VB2A 3RJPA 3M7GA 3L7WA 5D4SA 1IXCA 1UHMA 3CO7C 3ZMTA 2FQ3A 1F9NA 1S6LA 1ON2A 1R7JA 2XV4S 5FD5A 3K2ZA 4LMYA 1OPCA 1BI1A 3DQVC 2O6GE 2RV8A 1FBSA 3Q9SA 3N97A 2QUFA 1Z9CA 2DW4A 2ESNA 3RI4A 1DDNA 2F2EA 4ESBA 1B9NA 4M9ZA 3ZQ7A 3DKWA 3EDPA 4BAYA 5DDGA 3GFJA 3D5LA 5L3GA 3WODF 1EH7A 1I1SA 1XSXA 1MKMA 2K27A 3R0AA 1U8RA 1YW7A 1YYVA 4XSZF 2PMUA 3KCCA 5DCFA 1XD7A 4I0BA 1G3YA 1L0OC 4RAYA 1IUYA 2GIVA 1BN5A 1ZLJA 1QZZA 2M1BA 2L01A 2CW0F 3MZYA 3J81K 2NRAC 4LG0A 2P4WA 3WTZA 2STTA 1GVJA 4LLGF 3IRQA 1S3JA 1HW5A 2H94A 5E1WA 1B4AA 4EJOA 1HKTA 3M9AA 5L3DA 1XGMA 4N9HA 2L3DA 2RQPA 2ACJA 1TQPA 1XMKA 2ADUA 3NRVA 2QVOA 4EM0B 1W7PD 5HLHA 4HW0A 4OIQF 1Z6TA 3L9FA 3KLNA 3IWZA 4M73A 4KA4A 4ZYEA 4GO1A 5JVTA 3M8FA 3TDUC 5IT3A 5CVRA 2ZBKA 3V7SA 4GCVA 2JT1A 3OV8A 3LQQA 3GYHX 1J59A 1J5YA 2O3FA 4I09A 5E20A 3B02A 4BH9A 2FXAA 2ZFWA 2FNAA 5L3BA 1FPQA 2FBKA 3I54A 1UFMA 2RC4A 2Z5UA 2K02A 3LSTA 1K79A 1TW2A 5L3EA 2IJLA 5L3CA 5FD6A 3SZPA 3V8KA 4U0YA 3F3XA 4UVCA 2NAZA 1J0RA 2FBIA 2JZYA 1TQIA 5FO5A 2PFBA 3ISPA 4LB6B 2QBYA 1A04A 2EA2A 4KT5C 2IP2A 2OQGA 1R00A 5H6QA 5D6FA 4I2OA 2H09A 5CVJA 1R23A 2QENA 5JI6A 2K4JA 3B73A 3GXOA 2L4AA 4MEXF 2P5LC 2XAFA 1SAXA 3BWGA 4EM1A 3M1EA 4YFXF 1P4AA 3RDIA 3WU0A 2FBHA 1YQAA 4EJUA 3MAJA 4WF2A 3JAMZ 3U9GA 3EYIA 1D8JA 1R36A 5ICEA 1D5VA 4WXCA 1F5TA 3GFMA 3ZMSA 2VONA 1C0WA 2J5OA 3HRSA 1PP8F 4L9TA 1IRGA 1I5ZA 2DK8A 4YIFA 1ZN2A 2DI3A 1EV7A 1LB2A 4Q5SF 5BPIA 4G8XA 3O3KA 2DO7A 2LSOA 2GXBA 1Z91A 3JSOA 3QRFF 4RB0A 3FZVA 4IJAA 3R6SA 2OA4A 2L02A 3HTSB 1KU3A 1FYMA 2VOOA 4ZZLA 1IZ1A 4UV9A 4IXAA 3BJAA 2MLGA 4PGGA 4CYDA 2V9VA 3IC7A 2YX4A 5DUKA 1FSEA 4Y17A 2D45A 1FYKA 1NHAA 1KQ8A 2EFPA 1XGOA 1D3YA 2BYVE 3PQKA 5FB2A 4FX0A 3TOBA 2KKOA 1SD4A 1T0FA 1GXQA 3PFIA 1Z1DA 4I0AA 3E5QA 4IHSA 3F8MA 3GLXA 2O0YA 4LG0B 5LGNA 4M9XA 5D5VB 1W5SA 3I53A 4A0XA 2LDUA 4HF2A 1XB4A 1AWCA 3IKVA 4Q48A 4KFCA 5FFZA 1BM9A 1I1GA 2Y48A 1T6SA 1FP1D 1MDMA 2GA1A 2MH9A 3F8NA 2F5EA 3IL2A 2FU4A 4L9VA 3P7NA 1CGPA 4Q47A 5KK1A 3DPLC 4A6DA 1AOYA 2R7FA 3CUQA 1HW2A 4XRFA 2YU3A 3ABTA 3ZPLA 2G7HA 3TGNA 2ZO4A 1YW9A 4P55A 1PUEE 1XSDA 1IW7F 2TDXA 3E5UA 5EEHA 2R3SA 1T39A 5CLSA 1D8KA 3QP5A 4KIBA 1LJ9A 4E70A 2EV5A 4S04A 1IXRC 5DYMA 3FMQA 4G7ZF 3EQLF 2QBYB 4EMSA 3V7CA 2STWA 1LDDA 3E5XA 4A2UA 3SZTA 4M72A 4GYIA 4EV0A 2V6CA 2V79A 3U2RA 4AVPA 2ETHA 2LF8A 2W84A 2GA2A 2FNPA 2K7LA 2QM3A 3COAC 2DU9A 1YG2A 2LF7A 3KEQA 4B09A 4YIIA 1OYWA 2A5YB 4LGWA 4BNCA 2EFWA 3CUOA 4WX9A 1BC7C 5LEKA 3LA3A 2IW5A 3LFKA 3LWFA 4HA8A 4AD9A 4ENKA 2EFQA 4ENJA 2DFIA 3ELKA 3HSRA 5TRDA 2V1UA 4HBLA 1BJAA 1K6OA 4K2EA 2JPBA 1X3UA 2ZKZA 5JHUA 4G7HF 4UUVA 2PQ8A 4M9SA 3JTGA 2H6BA 1LDKB 2PBIA 1FBQA 5FLXK 2PJPA 5LGTA 1FX7A 2RKHA 4KMUX 1KYZA 1BI0A 5D5UB 5AIQA 4JQFA 3WGHA 2L4MA 4CO8A 1G3WA 4HQMA 3RTRA 3AAFA 3QPTA 1IN7A 4LK0F 1QGPA 2DQRA 1YTYA 2XHKA 4OIRF 4ENNA 1LDJA 2XAHA 2NS0A 2OAZA 5ICCA 3F8FA 1FC3A 4F7ZA 4IPAA 4RB3C 5LRRA 3NEUA 3GO5A 1PP7U 2GAUA 2E7WA 4AIHA 5ED4A 4H0EA 2XROA 4L9JA 1HSTA 5BS6A 4PGHA 2HZTA 5HDKA 1HQCA 4L5IA 3REOA 2PI0A 2O61A 2JTVA 2FRHA 2M5WA 4P96A 2W24A 4WK8F 3ERED 1MDMB 3WTTC 3GF2A 2A68F 3R4KA 2HTSA 3JTHA 5D5WB 3GX4X 4EVIA 2P6SA 1K78A 1JXSA 1ZAOA 2VBWA 1ZRDA 3J80K 4N0BA 3WE2A 1PDNC 3CUQB 3JSPA 4O5VA 1U6GA 3FXQA 3U1DA 4ZH4F 1KGSA 4HF1A 2VN2A 2AS5F 4ENMA 2V1DA 4RAZA 4MTEA 4LFUA 4DNCA 3KLOA 2M87A 3BDDA 2X4HA 4HYEA 3IRRA 2D1VA 1R58A 2P5KA 2CG4A 3QPHA 4YFKF 3HHGA 2Y0MA 3ZN1A 2ISYA 3TDZC 2HOEA 3FM5A 2QZ8A 4O3MA 4RGSA 1BI2A 2BGCA 3VOEA 1OMIA 4YFNF 1HBXG 3QAHA 4L9NA 5CYVA 1KU9A 1XGNA 4MQVA 1J2XA 2EV6A 1G3TA 1KQ9A 2CSOA 4WXDA 2HDCA 1WRJA 1ZH5A 1IAWA 3FHZA 3CLOA 3QU6A 3W6KB 1USTA 1YW8A 3T1BA 3CO6C 3C3WA 4CHUA 3BPVA 4G6DA 5J8CA 4M74A 1FNNA 3Q9VA 3LQRA 4PZJA 4M6YA 5DV5A 4CGZA 2GZWA 4U7BA 2A6EF 5BPDA 1V4RA 2XAJA 2NYXA 3T0YA 5TJJA 3FX3A 3HYIA 5AIPA 1ZGJA 1P2FA 5ICFA 3ZMUA 1I27A 3N4MA 3H3UA 2H6CA 3L2CA 4HDUA 2FEZA 5J6XA 3NQOA 2D1HA 4BXUA 2NNNA 2OQRA 2XAQA 1U3EM 3ROUA 1HSJA 2D2WA 2FF4A 1OR7A 1O7LA 1O3SA 5HOOA 3HSEA 1JGSA 3FM3A 5E1XA 3DF8A 1SFXA 2VE8A 5ICGA 2E1NA 1R1VA 3ZN0A 2PN6A 2BEOA 5K5OA 1ZRCA 2O8XA 5J8FA 5HS7A 4RGUA 4G7OF 3WTXC 3F22A 4OMZA 3JW4A 2X0LA 3TQNA 2Q0OA 4KN7X 5ILSA 3V4GA 2FE3A 2DAOA 4LLLA 4L0ZB 3EUHA 2M8EA 3BPXA 4JBAA 3VEPA 1J7KA 3Q5FA 4OIPF 2ZMEA 4Y15A 1H9TA 2Y75A 2IPQX 4HF0A 5D5XB 2P6TA 4A5MA 5IT9Z 5HS9A 1J9IA 2RDPA 4M71A 2R7DA 1FLIA 2ZXJA 1IRFA 1KU2A 3O2PE 1H9GA 4ESJA 4ETSA 1ZYRF 1Z6RA 3M8EA 3RYRA 3KP2A 1TNTA 2PG4A 2IRFG 1WSUA 4ON0A 4OIOF 3E6BA 4KICA 3KP3A 2J5PA 4NHJA 1GHCA 1DPRA 2C6YA 3RPUA 3OOPA 3BOQA 1O57A 1KQ0A 3E97A 4ZYDA 3T8RA 1FP2A 4FX4A 1O3TA 1ON1A 2XIGA 1EH6A 5D6EA 2HYGD 3ZMDA 3R61A 3ABUA 4Z2YA 2VOPA 4EGYA 1BIBA 3RYPA 3WTVC 4EJTA 5FGMA 2RNJA 3WE3A 2P7CB 3L09A 4MNUA 3DEUA 4OINF 2P8TA 4G6QA 3KP5A 4HX4A 1YIOA 3CUQC 1RI7A 2L54A 4HOBA 5DUIA 1XGSA 1F4KA 3ZMVA 3FF5A 2RGVA 2LKPA 1MJAA 3F72A 2JSCA 1TQMA 2K86A 2HWVA 3MFKA 5DCMA 4MQ9F 3SFZA 4EGZA 3KP6A 1YLFA 5FLXZ 1E2XA 2HYFA 4HV5A 2MH2A 5HDNA 5LHGA 1ZG1A 1EH8A 4L18B 4MHGA 1CF7A 3TO9A 4XLNF 1B9MA 1G6NA 2HS5A 5DEQA 4HAMA 4RGRA 4KDPA 1QNTA 3EETA 3HSFA 3BY6A 1IN8A 2GWRA 1GXPA 2QQAA 2A61A 4N9IA 5LRSA 1L3LA 1FOKA 1XDUA 5LEJA 2BBYA 2HFHA 4UXNA 1MJ9A 1IF1A 1BIAA 3HRTA 4IHTA 3FWEA 4XLPF 5LHHA 5DD4A 4I7HA 3DXJF 3TKYA 4L5JA 5ERIA 2QYOA 4YG2F 2WWYA 4KUMA 2A69F 4O6JA 3KP4A 2KRFA 1LVAA 1SMTA 3HUGA 1IXSB 2XUBA 5E8GA 1E17A 1G4DA 3GWZA 3ECHA 3H92A 4ESFA 3D0SA 5HS8A 1XDSA 1F1ZA 1OYYA 2Q8KA 2PEXA 1UB9A 5CVIA 3P9CA 2EJRA 4HX8A 1FY7A 1KYWA 3WTSC 2ZMEB 2DTRA 2CQKA 1ZG5A 1TNSA 1HXDA 3CDHA 3GUDA 6PAXA 3FMRA 2IA1A 1B6AA 3RPQA 1I6XA 1KA8A 3WTWC 1Q1HA 2FMLA 3LAJA 5LBQA 3MWMA 4QLCU 3FMSA 1TLHB 1USSA 3ZMZA 2BE5F 2ZNYA 2YPRA 3I0TA 3I59A 2Z3YA 2LNBA 1ONVA 4EQQA 4OU0A 2CWEA 2VXZA 1ODDA 5BMZA 1XMAA 4G94A 2DPDA 3LAPA 4XBFA 5E17F 5JFRA 4IRIA 2XRNA 5EEGA 2IT0A 2EV0A 1IN4A 3GFIA 4R1HA 1R22A 3I5UA 1RZ4A 4UNOA 3RKYA 2UXNA 4I02A 2A3SA 3J81Z 2BV6A 1U5TA 5F6FA 2KJCA 4FHTA 3I64A 4LLNA 4IRHA 2ELHA 4KYWA 4DQ2A 2WC2A 3V8LA 4OMYA 1QBJA 2VBYA 2Q2EA 1KU7A
chains in the Genus database with same CATH superfamily
1SD6A 2LH9A 2F5DA 1QRYA 4BY7J 1ZGWA 2DFHA 3SEZA 4RAGA 4GDFA 1SFUA 3K7AJ 5DM7F 4E7KA 3I3LA 4FTHA 2XGXA 1WWXA 1Y0UA 3FBNB 2JK3A 4WWCA 1CF7B 4ZJZA 4EJWA 2DN0A 4G9YA 3SDBA 4NUBA 2M4KA 1W4MA 4KT6A 2DOAA 1Y39A 3W2WA 2PJRB 2L7MP 1H0MA 1E3PA 4HSTA 1U78A 1REPC 1R1UA 4ZZDA 5HNFA 2CO5A 2K85A 4GXOA 3CC2I 5F64A 3DU5A 1AKHA 3K1PA 2HKOA 3OS1A 3ASNH 4XLEA 2ECCA 4HPQA 3F6OA 2GXAA 2Z99A 3WTYC 2ID6A 2OBPA 4HV6A 4M6VA 1TTYA 2MD5A 4BY1J 3RKWA 2ZJ2A 3WHBA 3MMYB 4XLHA 3CQZJ 1VQPI 5IYDJ 4BJTA 4CDGA 1B1BA 1X2MA 1ZGAA 4PK4A 5K1YA 4FE7A 3MZHA 4WXHA 2ESHA 2OJED 5F0CA 3TO7A 3U21A 1RIOH 2CUZA 3LSHA 4Y3OA 3FHNA 3I58A 4N4OB 3MKZA 4UUSA 2KRHA 2OU2A 2YR2A 4V2FA 1HW1A 3E6MA 4RAFA 3OYKA 3CCVI 3S15J 5JR3A 3VFZA 1ZVVJ 3G3ZA 1S7OA 2O7OA 2XPWA 5M5WJ 3BR5A 1SD7A 3BG7A 4I98B 2DA3A 1YHQI 5E8IA 5HLTA 2LC2A 4MO7A 3IHUA 4PJNA 1IN5A 3J7YJ 1IDYA 1JTYA 1RNLA 2VPLA 1ETYA 3C2BA 3HHHA 2ICWG 3IH2A 4HX7A 4MFEA 3W6JB 3BROA 2DT5A 1MIJA 2F5CA 4RM2A 1X3WB 4BHPA 4A3DJ 4IVNA 1WJBA 3ZRGA 3Q0VA 4XOTA 4U7DA 5GAHJ 3L00A 1LQ1A 5ILUA 1JHFA 3BCBA 4EJVA 2KIMA 1V55H 5D8KB 1D1AA 3K1MA 4LJZF 4PJMA 2HIDA 1PFHA 3H3ZA 2MYSA 3QU3A 1QZYA 1ETQA 2V4JC 4Q4ZF 1N78A 1ZHFA 3OYHA 3KP7A 3EZEB 2HEOA 2HI3A 5H6RA 2FA5A 2HOAA 3KFWX 1T8IA 2DPUA 2E2JJ 1M1EB 2X51A 4E7LA 1W7PA 4UY8I 2Z9OA 3BP8A 4MEYF 3LSGA 1ZG3A 3OWTA 2LREA 1FTTA 2VQHA 2XGDA 1SD5A 4R8HA 3BT9A 1U2WA 3OIOA 5GAGJ 5L3FA 1P4XA 4B3AA 3G71I 3RKXA 1R5HA 1P4WA 1YRNB 2QSFX 5D4RA 1FOWA 3F21A 1B8IA 4JK1X 3H0GJ 2JA7J 1WQ2A 4XK4A 4B8XA 1KZHA 1UCRA 3GVAA 3ZQFA 1PVEA 2ZCWA 2QSHX 2RLZA 1MJBA 5K5RA 3T8TA 2CQXA 2M30A 4XORA 2DLLA 2GLOA 3A1YA 5LD2C 1LEBA 1TW3A 4QSHA 4MFDA 3I59B 1U9NA 2TRTA 1NG6A 1FYLA 4XKWA 3MEXA 4M3GA 3JREA 2CUFA 1OR7C 2HR3A 3KEOA 3SHFA 5FRMA 3BR6A 1OCZH 4PSXA 3ZQLA 5A2QK 2ME6A 2QQ9A 5BOXA 3HRUA 2JQ7A 4CYCB 3LE5A 2CW8A 4QWQA 3HGYA 2XVCA 4I01A 1SFEA 1Y51A 1RKTA 2JPCA 2VODA 2A07F 4XKBA 1CQTA 3K0LA 2E1OA 3P9KA 1KKMH 2W85A 3TP0A 4KIGA 4QPOA 3QP6A 1X19A 3F0CA 2CYYA 3OSFA 1T2KA 3HOSA 3K9TA 3DV8A 4GGGA 3RIRA 3K69A 4ASNA 2P5VA 3F6VA 3HXLA 1G2HA 5C4XJ 1PUFB 2HQNA 2XAGA 4CCJA 2IAIA 1APLC 3L2UA 1FSHA 3BG9A 5H2FC 3IH4A 1N75A 2HQAA 2F5FA 3WGGA 1ZR4A 1RUNA 1T95A 4KITB 4A93J 2XAUA 1U5TB 2B0LA 3P9IA 1YS7A 3ABKH 4E4HA 4IRGA 1OFCX 1MBGA 3LSJA 5CJ9A 2F4OB 5HDGA 3A0BC 3CMYA 2KIFA 3EUHC 4BEHB 5BQTA 3HJEA 2HXOA 5F0FA 1D5YA 1R5ID 4CXFA 1HDDC 2QWWA 4UVBA 1X3ZB 3J7ZI 2QQBA 2ZMEC 4KN4X 5E1ZB 5H20A 2OD5A 3S1RJ 2LVSA 3WGIA 2FSWA 2DCEA 2Q2EB 5C4JJ 1LNWA 2DK5A 1DPUA 2KHMA 3G1OA 4XKVA 3PIPF 3OL4A 2WTEA 5LHIA 3RSNA 3LA2A 3MQ0A 2ZXHA 4OOIA 3KETA 3EPZA 2N8GA 3QOEA 5FJ8J 1K78B 2NNYA 2KFDA 4J01A 2DDAA 2CFXA 4TV7A 2UZKA 2GXGA 1WI9A 3JRFA 1P92A 1IN6A 2MA3A 3ECOA 3ASOH 4BHBA 1JE8A 5M3MJ 1B59A 1HCRA 4RGXA 2AHQA 1SC7A 4HDVA 4IHYA 2K9NA 4IQ4A 2A6HF 3V8JA 1PJRA 3X2QH 3ZP5A 1MNDA 1VQ6I 4FQGA 1NH3A 4BE2A 2DT6A 3OL3A 5IP6A 2ISZA 1TWHJ 2OENL 1AKHB 4LG3A 1GUUA 1VI0A 3ZQGA 2HKXA 2BHZA 2EIKH 2IGOA 3MCZA 2XKPA 5BNGA 1CM3A 5CQEA 4AIJA 3I71A 3CTAA 4F55A 4HSRA 1U0JA 2E5ZA 2KJBA 4P9FA 4ANJA 3JRBA 4U88A 4BACA 2R7XA 4DZJA 2MC3A 3BJOA 4UB6C 4S05A 3TW7A 1DGRM 2H27A 4XNFA 2XSDC 4BQNA 3FDYA 3DP7A 4G12A 3L2RA 1ERDA 2XB5A 1K7AA 3I55I 1O3QA 3K4MA 3GZ6A 3C1DA 4P1WA 5J1UA 1ZREA 2W57A 5HVQC 3LNWA 1SMYF 3GFLA 4H4KC 1WKMA 3OYGA 2DBBA 3HGGA 2IA2A 2KIUA 2YSRA 2KISA 2JELP 1VQ8I 2HGCA 1Z77A 2FOWA 3VYSB 4CUGA 2XKOA 1BL0A 1MD0A 3L2WA 2R5YA 4ZTJA 3AKZA 1TBXA 2CRGA 4HLYA 1YS6A 3ZQCA 4BJ5C 3WG9A 2EZKA 3KZZA 2UWMA 1UZCA 3OYDA 3FKJA 3FXUA 4E7HA 1YO5C 4DW6A 1QPMA 4CSWA 2CFOA 2OZ6A 3KPHA 4LD5A 2HVRA 4RS8A 2G9WA 5EEAA 5F1JA 1FT9A 1S8NA 4CICA 1RUOA 2E7XA 1I3QJ 2OZUA 2ZFUA 2FJ1A 3M4OJ 4RB2C 1W7PB 3BZ6A 2CGPA 1FIPA 1OLTA 1VTNC 3FKIJ 4AU7A 2EH3A 4L0YB 2HYJA 4CZZA 2P7VB 2R7TA 1BR1A 5CVVA 1MMNA 5FKOA 3GTKJ 2XPUA 3MD2A 2HDDA 2QLZA 2VT3A 4UHTA 2DA6A 2EK5A 5IOYA 2M0CA 2VBXA 2W00A 2R7UA 3CCSI 3BJ6A 4R79A 2KRCA 2OTLI 5GAEJ 3RPUD 1QU3A 1XC5A 5T17A 1N25A 5DD8A 4D7NA 2EWNA 5E18F 1O3RA 1E0EA 3K1NA 1G3SA 4HLXA 2HPMA 2AXLA 2V1XA 2E2IJ 3J7AO 2VXDA 3HTUA 4IQJA 1BR4A 5HLIA 3DPTA 5B5EC 3C7JA 2V6EA 1BBYA 2IVMA 2M2EA 2KP6A 3LSMA 4Y13A 3ZR8X 3BR2A 5KVRA 3OYFA 2X6XA 2IS1A 5E3MA 5CVUA 1STZA 2EB7A 3SJMA 2COMA 4RB1A 4NB5A 4KIFA 3VYRB 1VQLI 2QKMB 3HOTA 4BYYA 5ILVA 1OCTC 2HXIA 3NWSA 2Y69H 2PMHA 2VJIA 5D8LB 4M6XA 3DWLE 1GV5A 4U0VA 4ABZA 5F0HA 4CCNA 3E6CC 1VQMI 4BHCA 4U0WA 3S2WA 3IKTA 2CMPA 1XCVA 1ULYA 3DBRB 2ZSHB 3JAMK 4A6EA 5EZGA 3GEZA 3F8CA 3GLLA 1BC8C 4XSXF 4P9UA 2KZGA 3E6DA 2F4MB 1ZLKA 4IHVA 3FISA 4NC8A 1MBHA 3PQJA 2LFBA 4AC0A 2UXXA 1S29A 2FOKA 5IT9K 1DU6A 4NBQA 1SAUA 4C3IJ 3TO6A 1I6HJ 4IF4A 2LBFA 1Z67A 2EFOA 1T98A 2IA0A 2DFFA 3GZ5A 2XGCA 2VE9A 2E2HJ 4A5NA 1W5TA 4LK1F 5GPAA 2OF7A 4A3LJ 3S1NJ 4P5OA 3TBIA 3ULQB 1ZARA 3DTEA 2VKVA 1UMQA 4XLCA 1FBUA 2VQGA 3EYYA 2E71A 2NS7A 3SQNA 4D0PA 1UHWA 1QQIA 1V3FA 2K4BA 4MGRA 3ZCOA 3S1QJ 2IXSA 2JRTA 4HNTA 1XN7A 2LKSA 2MLKA 1FZPB 3CP8A 3LA7A 4A0ZA 4D9JA 1XSVA 4ZDPA 5EDNA 2DQLA 3R0JA 1O7FA 4W97A 5F1RA 1HLVA 5F04A 1XCBA 1DP7P 3FXRA 3CCLI 3TEDA 4N4NB 1T08B 1WHUA 1YITI 2KMUA 4XLAA 4WCGA 2M7AA 2WADA 4JX5A 4CA0A 3HRMA 4AWXB 4FT8A 1BOAA 2M3AA 4UV8A 3KE2A 3FXOA 3W6VA 3CJNA 3BR0A 5FKNA 2HTJA 3AG2H 4LOCA 3SZGA 1ZRFA 1B72A 2YU9J 3AL0B 2OPTA 2JSPA 2M45A 2MBFA 3KZYA 4BQAA 3VYTB 2R93J 3J80Z 4UUTA 3F8BA 3GTOJ 4A0YA 4HQEA 5AONA 1IRXA 2COBA 1WGXA 3EZBB 3WU1B 3Q0UA 2R0QC 5B1BH 4B1RA 3K4KA 1YE9A 5K5QA 3OY9A 3HOXJ 5CKTA 1BOBA 2XASA 2VIXA 2VT2A 4RBOA 2EFNA 1FWZA 1K4TA 1OYIA 1DUXC 3JRHA 4A3BJ 1ZQ3P 3BR1A 1Z7LA 2VC0A 2WA0A 1HKSA 1A6IA 2Z33A 1T38A 3T5XA 3IWFA 2NZUL 3SXYA 4KNYA 1FMWA 2G7UA 5F08A 3HIFA 3E3VA 4ZYHA 2RVCA 2BW3A 2GQQA 2CU7A 3IAS2 3VSKA 1D1BA 3V7RA 4FISA 2RN7A 4CCKA 1IUFA 2WAEA 1OKRA 1SVMA 2DXIA 1A35A 2PLYA 4HZFA 1J75A 1W0UA 1GDTA 2E1CA 2VBZA 4M3EA 3QOPA 1Y50A 4C2MJ 2IS6A 1MGTA 4EM2A 3GW2A 3TP3A 3CCMI 3C18A 1U5TC 4XICA 5IP9J 2R5YB 1V54H 1MZBA 3K10A 4DYCA 5TGTA 2PX9A 1R5GA 1QO0D 5FRNA 3KYDB 4CCMA 3ML6A 5E3OA 3WTUC 1N77A 1JHHA 2R7WA 3S8PA 2ZNZA 2OTJI 2X6YA 2DA1A 2E5NA 1R1TA 5HLGA 2EA4A 2DJIA 1QFRA 5J1RA 1MSEC 2W25A 1JGGA 1E3OC 4AIKA 2VC1A 4GYGA 1H89C 2EIJH 3I4PA 1WCMJ 2AO9A 1FOYA 5FFXA 4LB5A 1MMSA 1Z7UA 1S7AA 1Y6IA 4BJ6C 4PUSA 4A12A 2H1LA 4IZZA 4F93B 3CF5F 3OYAA 1R49A 1P6RA 2YUSA 2CQQA 1TT5B 3TOAA 3VODA 4M3BA 2M0MA 1IG7A 1VQNI 3O6BB 4UB8C 1ENHA 3QYFA 2ZJQF 4UVAA 2ECBA 1Z05A 3G73A 4NQWA 4XONA 4DOZA 2FMYA 4PSWA 3M07A 4PCQA 4KMFA 1S5LC 2MG4A 3ZGKA 2VJ5A 2ZJPF 1IDZA 3FXLA 5DCMB 2QF7A 4MTDA 4ZDOA 2RQQA 4IO9F 1YFHA 1HKQA 3RZDJ 3E1SA 1JEMA 1MNEA 2HQRA 3DFGA 2E60A 3R60A 4BDZA 1K6YA 4ZYGA 4HG2A 5LLQA 3CMEI 1BI3A 2M7BA 2YX7A 1LEAA 2CH0A 4PDKA 5LGUA 2WV0A 3F23A 2O03A 3A03A 2OC6A 3CP2A 4BL0B 5GADJ 5A2QZ 3VB2A 3RJPA 3M7GA 4JOMA 3L7WA 1Z3YA 5D4SA 3UNGC 2LY9A 3BCAA 1UG0A 1IXCA 1UHMA 4BQOA 3CO7C 3ZMTA 2FQ3A 1F9NA 1MBJA 1S6LA 1ON2A 2AQEA 2LRKD 1R7JA 3ZQQA 3DEEA 1D0YA 1FMVA 2XV4S 1VNDA 5FD5A 3K2ZA 4E7IA 3G2BA 4DBQA 2X1EA 1TC3C 5M5YJ 4LMYA 2QGUA 1Z21A 3OQOD 2X1DA 3OYLA 1OPCA 1MH4A 1BI1A 3DQVC 1H8AC 1Y8QB 2E1MB 2O6GE 3GMEA 1LPQA 1MBKA 2RV8A 4QIWN 1FBSA 4HNUA 1POHA 3Q9SA 2KL4A 1WH7A 3J7AY 1P7JA 3MN2A 5J1YA 3N97A 1YJNI 2LBFB 2QUFA 1Z9CA 2DW4A 2ESNA 3OQND 3HZJA 1XX5A 3RI4A 4NC6A 4BBRJ 2KDZA 1DDNA 2F2EA 4ESBA 1B9NA 4M9ZA 3ZQ7A 2XPVA 3M1CA 5J47A 3DKWA 3EDPA 3WU2C 4BAYA 5DDGA 3GFJA 4II2A 3FXJA 1POGA 2K9SA 2LY2A 3D5LA 5L3GA 3WODF 1EH7A 5HODA 4BU2A 1HA8A 1W36D 1I1SA 2JA6J 1QR5A 1XSXA 1MKMA 5M3FJ 2K27A 3R0AA 1YIJI 5IYBJ 1HF0A 1U8RA 1YW7A 3HUGB 3HEFA 1YYVA 4XSZF 2PMUA 3D5SC 1VQ5I 3K2AA 3KCCA 4F92B 5DCFA 2NXNB 4A3KJ 1IO2A 1XD7A 3OYMA 2CV1A 4I0BA 1B72B 3BR3A 1G3YA 1L0OC 4RAYA 3LL7A 1MO1A 1IUYA 2GIVA 1YI2I 1VFCA 1SVLA 1BN5A 4C9YA 3CCQI 2LD5A 1FEXA 1ZLJA 2DMPA 4EATA 1QZZA 3IP4B 4FE4A 1X58A 1GVDA 1K83J 2M1BA 4FCYA 3BZKA 2L01A 2CW0F 5DS9A 1X1BA 5IOZA 3WG7H 3MZYA 3J81K 3RZOJ 3RQIA 2NRAC 5E3NA 2BY3A 4LG0A 2P4WA 3CLQA 3WTZA 5GPCA 2P0WA 2STTA 1GVJA 2X85A 1MH3A 4LLGF 3IRQA 3OS0A 1IC8A 4RLFA 3GTLJ 1S3JA 2WY8Q 1HW5A 2H94A 2LOOA 5E1WA 1B4AA 4EJOA 1HKTA 3M9AA 2HQ5A 2WV1A 5L3DA 1XGMA 4N9HA 3G6EI 4B47A 2L3DA 5J40A 4A3MJ 2RQPA 2ACJA 1TQPA 2DMUA 1XMKA 2ADUA 4D7MA 4OAYA 1TWFJ 3NRVA 2QVOA 4PFPA 4EM0B 1UHSA 1W7PD 5HLHA 1ETKA 4HW0A 2JUCA 3CESA 4OWRB 2WAQN 1JUMA 2CV2A 4OIQF 1DGWY 1Z6TA 3L9FA 2CUEA 2OCEA 1IGNA 3JCUC 4IHWA 3KLNA 1EF4A 3IWZA 4B3XA 4M73A 4KA4A 4ZYEA 1SEUA 3K4NA 5LFAA 4GO1A 2DA4A 5JVTA 1TL8A 3M8FA 1MBFA 4A3EJ 3TDUC 5EG0A 5HNHA 5IT3A 2K9LA 5CVRA 2ZBKA 3V7SA 1AHDP 4GCVA 2XF5A 2R7SA 1RETA 3O8HA 2JT1A 2F48A 3OV8A 3KZIC 3LQQA 3GYHX 1J59A 1J5YA 3QYEA 2O3FA 4I09A 5E20A 3B02A 3IH3A 4BH9A 4XRMA 1DP3A 2EZIA 2XC7A 2FXAA 3W3CA 2ZFWA 2FNAA 5L3BA 1FPQA 2FBKA 3I54A 1UFMA 2RC4A 2Z5UA 2K02A 3LSTA 4LIUA 2VQLA 1JJ6C 1K79A 1TW2A 3H9GA 2R7VA 5L3EA 1JKPC 1V5GA 2IJLA 5L3CA 1WI3A 2ZSIB 2M4GA 5FD6A 3PSIA 1K61A 2EZHA 3AL0C 3PNTA 3SZPA 5IY5H 3V8KA 5B66C 3CD6I 4M3FA 4U0YA 3F3XA 4UVCA 2BZTA 2K9QA 3QQAA 2NAZA 1J0RA 2FBIA 2JZYA 1TQIA 5FO5A 2PFBA 3ISPA 4LB6B 2CW7A 2QBYA 3ZQHA 2IGKA 5DTDA 4NQWB 1PTFA 5T1OA 2HVSA 2IGMA 1WJ5A 1A04A 3OR1C 2BY2A 2EA2A 4KT5C 2IP2A 4IOCF 2OQGA 1R00A 3CMMA 4CZCA 3GTJJ 5H6QA 2K3FA 5D6FA 1JKQC 4I2OA 3AFHA 2H09A 3GTMJ 2PMZA 5CVJA 1R23A 2R4GA 2QENA 2OV7A 1JI8A 5JI6A 2K4JA 2Y9ZA 3B73A 1MSFC 2QEXI 3GXOA 3PL8A 3PO2J 2L4AA 1S7EA 4X1EA 4MEXF 2P5LC 2XAFA 1SAXA 1QHGA 3BWGA 1CM2A 4EM1A 1Z3XA 3M1EA 4DBRA 5K7ZA 2CJJA 4Y4RA 2XF6A 4YFXF 1P4AA 1D0XA 1W5CC 3RDIA 3WU0A 4FASD 1JKRC 3BTJA 3E7LA 2FBHA 3DTKA 1YQAA 4XOPA 3MAJA 4EJUA 5FKMA 4WF2A 3JAMZ 5EZHA 3U9GA 3K4BA 3EYIA 1R36A 1D8JA 2P81A 5ICEA 1D5VA 3PSFA 4C30A 1YJWI 3PUFA 2W82A 4WXCA 3PNYA 5TISC 5JHFA 1F5TA 3GFMA 1X2NA 3ZOBA 3ZMSA 4UUSB 2VONA 1C0WA 1U8BA 2J5OA 3HRSA 2DOEA 4JX6A 2R5ZA 3GTQJ 1PP8F 4L9TA 1IRGA 1LFBA 1I5ZA 3EUKL 2I10A 3M8JA 2V9PA 2DK8A 4X6AJ 4YIFA 1WVRA 1NTCA 3LSIA 3OR2C 1ZN2A 2DI3A 3UR3C 1EV7A 2VJJA 1ETVA 3DTIA 4B4CA 1LB2A 2D5VA 4Q5SF 4RMNA 5BPIA 1LKXA 4G8XA 3O3KA 2FQ4A 2DO7A 2LSOA 2GXBA 2EQRA 2Z16A 3GTPJ 1WZ2A 1Z91A 1MMAA 3JSOA 1J09A 4RB0A 3QRFF 1Y4YA 3FZVA 1ETWA 2A5WA 2I8DA 2MSYA 2OA4A 3DKXA 1TT0A 4IJAA 2L02A 3R6SA 3VSLA 3HTSB 1KU3A 4E6KG 1FYMA 2VOOA 2JRMA 2LRDA 4ZZLA 3CC7I 1IZ1A 4UV9A 4IXAA 2W48A 2MLGA 3BJAA 4PGGA 2V9VA 1V5EA 2NS8A 4XN0A 4CYDA 1RPWA 3IC7A 3ESWB 2AK7A 2YX4A 3H9QA 3SEQA 5DUKA 4X0GA 3KIOA 1FSEA 2HOTA 2E19A 2DA7A 4Y17A 2D45A 1FYKA 1NHAA 3Q0WA 4XM3A 2W4SA 1KQ8A 2EFPA 3CF2A 4B44A 4CCLA 4YELA 1XGOA 4U87A 4DJAA 1D3YA 5DM6F 2BYVE 3PQKA 5FB2A 3OOUA 2DMTA 1IJWC 4FX0A 3TOBA 4QTRA 2UUZA 1UELB 2KKOA 4PFOA 1Y1WJ 1SD4A 4Y52J 4ZDLA 1T0FA 1GXQA 3PFIA 2FD5A 1Z1DA 4I0AA 3E5QA 2VJ4A 4IHSA 2X9DA 3VDXA 3F8MA 1B8IB 3GLXA 1JUPA 2O0YA 3P5JA 1VQ7I 4LG0B 5LGNA 4M9XA 2FUG2 5D5VB 5FLMJ 1W5SA 3OYEA 3I53A 2E34A 3CZ6A 4A0XA 2LDUA 4HF2A 1XB4A 1AWCA 1HDPA 3IKVA 4Q48A 1K4SA 4KFCA 5FFZA 2LTPA 1ORKA 4BE1A 2B9SA 2I5UA 1BM9A 1I1GA 2Y48A 5C3EJ 1T6SA 1FP1D 5FKLA 2MFZA 2JA5J 1MDMA 4A3JJ 2GA1A 2MH9A 4YIRX 4NC7A 3F8NA 1NK2P 2F5EA 3CC4I 1NK3P 3BC8A 2QQ8A 3IL2A 2FU4A 4L9VA 3P7NA 1Y8RB 5T1NA 2IBDA 1CGPA 4Q47A 3D5RC 3MVPA 3RCOA 3DPLC 5KK1A 3A2KA 4A6DA 2XDFC 3DU6A 3H3VK 1AOYA 2LMDA 1SANA 2R7FA 2DMNA 3HOZJ 3B6AA 3CUQA 3PFYA 2B63J 3FBIB 1HW2A 3RKQA 3QPSA 4XRFA 2L0KA 2YU3A 3ABTA 3S3MA 3ZPLA 2G7HA 2OUMA 3TGNA 2ZO4A 3C2GA 3CCJI 1YW9A 2WB1A 1WFXA 3TW6A 4P55A 3UKGA 4RM3A 3G1MA 1BW5A 1BW6A 1BJZA 3BQYA 3OMYA 1PUEE 3W2AA 2BHYA 5KAFC 1XSDA 1IW7F 3S3NA 3CMAI 2TDXA 4RDUA 3E5UA 5EEHA 2R3SA 1T39A 2XB0X 5CLSA 1D8KA 4PJLA 1QVTA 5KNLA 1H88C 3QP5A 1AU7A 4KIBA 3LSPA 1LJ9A 4E70A 3SDGA 1I39A 2EV5A 1GT0C 1FTZA 4S04A 4L5EA 2WAQA 1IXRC 5DYMA 3FMQA 4G7ZF 3AG3H 3EQLF 2HNHA 4B48A 2QBYB 2L9NA 2RNGA 3HB9A 4EMSA 2BXZA 1EKEA 3V7CA 2STWA 3DCFA 1LDDA 4BDYA 3E5XA 3SYTA 3ZXSA 3GCMA 1OCRH 1UG2A 1D1CA 4A2UA 4II3A 3SZTA 4M72A 4GYIA 4EV0A 2G0EA 2V6CA 2V79A 3U2RA 3DBHB 3OYBA 2K5CA 4AVPA 5F27A 1FIAA 2ETHA 1D0ZA 3B6CA 2LF8A 2W84A 2BY0A 3KYCB 4XRSA 2GA2A 2FNPA 2BVLA 3S93A 1RRJA 1S72I 2DA2A 2K7LA 3DBLB 2QM3A 2A05A 1SFKA 3COAC 1A5JA 2DU9A 3PO3J 1YG2A 2B7EA 2LF7A 3KEQA 3IAM2 4YIIA 4AIDA 4B09A 2KQRA 1RR8C 1OYWA 5IP7J 3DLLF 1JUSA 1WJCA 2A5YB 2HPRA 4LGWA 2HOSA 1YX5A 3L2QA 2EFWA 4BNCA 1FOXA 1R4NB 2JJ7A 1ZR2A 3CUOA 4WX9A 1BC7C 5LEKA 4MIMA 3LA3A 1QA6A 3HOWJ 2Y31A 2IW5A 5GTIC 3NARA 4M3DA 3LFKA 5CQGA 1HDNA 1W0TA 2ZXIA 3LWFA 4HA8A 4AD9A 4ENKA 2EFQA 2LG4A 4ENJA 2DFIA 1TWGJ 3JRIA 3ELKA 3HSRA 5TRDA 2V1UA 4HBLA 1BJAA 1K6OA 4K2EA 2JPBA 1ETXA 1X3UA 2ZKZA 1YRNA 2R5ZB 2MABA 5JHUA 4G7HF 1VQOI 5C44J 4UUVA 2PQ8A 4BXXJ 2GOXB 4M9SA 3JTGA 1S9HA 2H6BA 1LDKB 2PBIA 1LFPA 1FBQA 5FLXK 2PJPA 3HG9A 2VL8A 3CCYA 5LGTA 1FX7A 2RKHA 4KMUX 5KAIC 3JR9A 2V9KA 1KYZA 1BI0A 3FK6A 2EILH 5D5UB 5AIQA 4JQFA 3G4SI 3WGHA 4E7JA 2L4MA 4W1UA 4CO8A 3BTCA 2PMZN 1G3WA 2VPRA 1VF9A 4HQMA 1YJ9I 3RTRA 4XWJB 3AAFA 1P7IA 3QPTA 4V2GA 1IN7A 5B1AH 4LK0F 1QGPA 2DQRA 3ONQA 4KJZA 2JN6A 2XHKA 1YTYA 4OIRF 2M9HA 4JP0A 3HL2A 1HC8A 4ENNA 2LP0A 2BY1A 1LDJA 2E35A 2XAHA 1WJAA 2NS0A 2OAZA 5ICCA 3F8FA 1FC3A 1KONA 4F7ZA 5JLXA 3DLAA 4IPAA 5LRRA 4RB3C 1QZEA 3GO5A 3NEUA 1PP7U 1TWAJ 2Y9YA 2Q1ZB 2GAUA 2E7WA 1PUFA 4AIHA 5ED4A 4H0EA 2XROA 4XN3A 3HPGA 4L9JA 1HSTA 5K7FA 5BS6A 1EJ9A 3LE1A 4PGHA 2HZTA 5HDKA 2CUJA 3L2VA 2KT0A 2GIZA 1HQCA 4F3QA 3EUAA 4V19K 1BR2A 2KPMA 1W36C 4L5IA 3REOA 1SPHA 4OAZA 3MKWB 2PI0A 3OYJA 4GFBA 4HRIA 2O61A 3DEWA 2JTVA 2FRHA 4AYBA 2M5WA 4P96A 4NDLA 1KKLH 2W24A 2HU9A 3V42A 4WK8F 3ERED 1P9QC 1RESA 1MDMB 3CJTB 3KX2A 3WTTC 3GF2A 2L9VA 2A68F 2IS4A 3BZCA 3R4KA 5KHDA 2HTSA 3JTHA 5D5WB 3GX4X 4EVIA 2P6SA 1R9TJ 1J6TB 1K78A 2EPFA 1JXSA 1ZAOA 3F9KA 2VBWA 2X48A 1ETOA 2KLOA 3CJRB 1ZRDA 4XRSG 3J80K 4N0BA 3WE2A 4ZTFA 1PDNC 1MBEA 2H1KA 3CUQB 3QYBA 3JSPA 4O5VA 1U6GA 1X1DA 3FXQA 2DYSH 3U1DA 4ZH4F 3LFGA 1KGSA 1ZK8A 4HF1A 1WJDA 1TZLA 2HPIA 2VN2A 3G1LA 1Z0XA 2AS5F 1U9OA 1RKWA 2HVQA 1ITYA 2KDOA 3ABLH 4ITVA 1XMXA 4E7SA 2V1DA 4ENMA 4RAZA 4PJ0C 3BG5A 4MTEA 2K3PA 3LMMA 2L7ZA 5EF6A 3H5RA 2F5VA 4LFUA 4DNCA 3K4LA 3KLOA 1OISA 3CCRI 1SFOJ 2VUMJ 2M87A 2DT7B 5M5XJ 3BDDA 3S17J 2X4HA 3GZNB 4HYEA 2Z2SB 3IRRA 4AVZA 2D1VA 1R58A 2P5KA 4EEFG 2IS2A 2CG4A 3KEYA 5JVGF 1FU0A 4BUPA 3QPHA 2LRLD 1XTAA 4YFKF 2MC4A 3HHGA 2Y0MA 3ZN1A 3CDIA 2ISYA 3H5AA 2O9LA 4C2UA 2R7OA 3TDZC 1VRCC 2HOEA 5IPAA 3FM5A 2QZ8A 3IUOA 4I6ZA 3JRGA 3H9JA 3Q3SA 3D1NI 3HDDA 2QKLB 4O3MA 4ZC3A 4XLFA 4IEJA 4RGSA 1BI2A 2BGCA 4LIVA 3VOEA 2DODA 3HBLA 4HNVA 4Y33A 1Y1VJ 5EYRA 2R7ZJ 5FLVA 2VI6A 1K1CA 1OMIA 4YFNF 1HBXG 2Y30A 3QAHA 1T56A 4XKCA 4L9NA 4PJJA 4BE0A 2Y2ZA 3OYCA 5CYVA 5J3LA 1KU9A 1XGNA 4MQVA 1MMDA 1J2XA 2WB1N 2EV6A 1G3TA 1KQ9A 2CSOA 4WXDA 2HDCA 1WRJA 1A6QA 1ZH5A 3IHSA 1Y56A 4JYKA 1IAWA 3K6GA 4Z6YA 3BTLA 2EBIA 2WBMA 3FHZA 3K70C 3CLOA 3QU6A 3W6KB 3I56I 4AM3A 1R6RA 1F43A 1IRZA 3S2HJ 1E3HA 1USTA 3I9V2 1XG1A 4QPQA 1YW8A 3T1BA 2JVHA 5J4YA 3DKYA 3CO6C 1IV6A 3C3WA 4CHUA 3BPVA 4G6DA 4XR6A 2BW3B 4M74A 5J8CA 1FNNA 3Q9VA 4KISA 3LQRA 4XL9A 3BG3A 2M34A 4PZJA 3OS2A 4M6YA 5DV5A 4CGZA 3GTGJ 2GZWA 4U7BA 2VKHA 3CCDA 1NG7A 2A6EF 1V4RA 2XAJA 2W1OA 5BPDA 2LY1A 3QODA 4LITA 2NYXA 3T0YA 4XIDA 3VYUB 3LOCA 5TJJA 3FX3A 2NOJB 5J4VA 4XMYA 3HYIA 5E3LA 2VKEA 5AIPA 3CCEI 1ZGJA 1P2FA 2V7FA 1VQ9I 5EGOA 5ICFA 3ZMUA 1I27A 3N4MA 3H3UA 2V1NA 1WJFA 3FK7A 3H0DA 2H6CA 3L2CA 2LR8A 2FEZA 3H5NA 5J6XA 4HDUA 5GTHC 3NQOA 2D1HA 4BXUA 2NNNA 2Z1DA 2OQRA 2XAQA 1U3EM 3ROUA 1HSJA 3W2VA 2D2WA 2FF4A 1PYVA 1OR7A 1O7LA 1O3SA 5HOOA 3HSEA 2VB6A 1FJLA 1JGSA 3FM3A 3HKZN 5E1XA 3BQZA 5FKKA 3DF8A 1SFXA 3HOVJ 2AQFA 2DFEA 2VE8A 2TCTA 4BS9A 4JX4A 2O5RA 5ICGA 3K70D 2RREA 2E1NA 1R1VA 3ZN0A 4DZPA 2PN6A 2BEOA 4AUXA 5K5OA 4A3GJ 1WJEA 5GP9A 3KYLA 4BXFA 1ZRCA 2O8XA 3QWLA 2MD0A 2R92J 1AA7A 3OSGA 2R7RA 1I50J 5J8FA 4I76A 5HS7A 4ZYAA 3VPRA 4RGUA 1OPDA 3TL4X 4G7OF 1WPKA 3WTXC 1ACIA 2DYRH 3F22A 4OMZA 3S32A 2RAEA 3JW4A 2X0LA 3TQNA 2ZJRF 3ERMA 2Q0OA 1ZELA 4A3CJ 2ID3A 1LUJB 1EA3A 4KN7X 3NWTA 3S3OA 3HC7A 2UV1A 1LE8A 5ILSA 2F4IA 2K40A 3V4GA 1DQUA 2FE3A 2DAOA 4BQQA 4LLLA 4BKXA 4L0ZB 3EUHA 2M8EA 3BPXA 4JBAA 3VEPA 1J7KA 3Q5FA 4OIPF 3U1KA 2F6CA 2ZMEA 4Y15A 1H9TA 2NVTJ 2LYCA 3LSKA 4IOAF 2Y75A 2JVGA 1SVOA 2IPQX 1W1WE 3C2HA 4HF0A 1Y0NA 2GBYA 2P6TA 5D5XB 4A5MA 5IT9Z 2FX0A 2L5QA 3JRCA 3I4MJ 1OCPA 2Y0SN 1DU0A 4DIQA 3FIWA 5HS9A 2GM4A 1LVKA 1X1PA 4IKFA 1Q1VA 1J9IA 2RDPA 2DMQA 4M71A 3OYNA 2JA8J 2H8RA 2R7DA 2JUGA 1FLIA 1GLNA 4C3HJ 2ZXJA 1IRFA 1KU2A 1LFUP 1JT6A 3O2PE 1H9GA 1YOVB 1XPXA 4ESJA 4AYBN 1TWCJ 1ZYRF 2ZB9A 1T0FC 4ETSA 2ELJA 3H1CA 1Z6RA 3M8EA 2WY7Q 3RYRA 3KP2A 3FXKA 1TNTA 2PG4A 2IRFG 3S14J 1WSUA 4ON0A 4OIOF 3E6BA 4KICA 1ZTRA 2J5PA 1JTXA 3KP3A 4NHJA 1GHCA 1DPRA 3LFUA 1QPIA 1WH5A 3A01A 3RPUA 2C6YA 2QCOA 1BA5A 3OOPA 3IV5A 3BOQA 1O57A 1KQ0A 2A6TA 3E97A 4ZYDA 1MO1B 3T8RA 1FP2A 4FX4A 1X4OA 4DGWB 1O3TA 1ON1A 2VLAA 2XIGA 1EH6A 5D6EA 2HYGD 3ZMDA 5FROA 2M8GX 2JA2A 4J00A 3R61A 3ABUA 4Z2YA 2VOPA 4I99C 2W7NA 3RQ4A 4YEJA 2L7FP 4EGYA 1BIBA 3OYIA 1MW7A 2O8KA 3RYPA 4C3JJ 3WTVC 4EJTA 5FGMA 2X1CA 4E7ZA 4RLQA 2L9RA 2RNJA 3WE3A 2L7KA 1X1CA 3OIPA 2P7CB 3L09A 1VQKI 2XGEA 4MNUA 3DEUA 4OINF 1R4MB 2P8TA 2FEPS 4G6QA 3KP5A 4HX4A 1YIOA 3CUQC 4HEA2 1RI7A 2L54A 3H35A 2NVQJ 4HOBA 5DUIA 2BXYA 1XGSA 2ME0A 1F4KA 3ZMVA 3FF5A 2K9MA 2RGVA 2LKPA 1MJAA 5E79C 2E1MC 2JSCA 3F72A 4IL6C 1TQMA 2K86A 2HWVA 3L1PA 3MFKA 1TP4A 3ZQIA 5DCMA 4MQ9F 3SFZA 2NOGA 4EGZA 3LE3A 3S1MJ 2EINH 1YLFA 3KP6A 5FLXZ 1E2XA 2HYFA 4HV5A 1JT0A 2MH2A 5HDNA 2R7QA 5LHGA 1ZG1A 1EH8A 2HDWA 3AG4H 1RZRL 1OJLA 4L18B 3K4CA 4MHGA 1CF7A 5EG0B 4CCOA 5K7HA 3TO9A 4XLNF 1G8XA 1MMGA 1UJ8A 1B9MA 2PJRA 1MNMC 5EGOB 1G6NA 2HS5A 2L9SA 1VQ4I 5DEQA 4HAMA 4RGRA 4DYQA 1X4PA 4KDPA 3A4CA 1QNTA 3EETA 2EIMH 3JRAA 3HSFA 3BY6A 1IN8A 2KIQA 2GWRA 4A3IJ 1GXPA 1R71A 2QQAA 2A61A 2DTZA 4N9IA 2JWTA 2ELKA 3FXMA 3HM5A 5LRSA 1X1AA 4GRIA 1L3LA 2NVUB 1FOKA 1I3AA 3BLYA 4MLOA 1XDUA 5IYCJ 2QA4I 4B43A 5LEJA 2AXTC 4D5FA 2BBYA 1JJ8C 2HFHA 4UXNA 1MJ9A 1IF1A 3S2DJ 1OCOH 1BIAA 3QPLA 3HRTA 1UAAA 2YS9A 4IHTA 3FWEA 4XLPF 1QHHD 5LHHA 2HZDA 5DD4A 4DYRA 1ZKGA 2ZXWH 4I7HA 3GBGA 3DXJF 3I4NJ 1G59A 3OQMD 2NVYJ 3TKYA 4L5JA 5ERIA 3MKLA 3PIOF 2QYOA 4YG2F 2DJNA 2X6WA 2XSJC 2WWYA 4KUMA 3HPHA 2A69F 3CCUI 2LKXA 1O4XA 1T33A 4O6JA 4XQFA 2XF7A 3KP4A 2E36A 2KRFA 1LVAA 2ZC2A 1A36A 3N05A 1F36A 1SMTA 3ABMH 3HUGA 1IXSB 4F91B 1MU4A 3S16J 2XUBA 5E8GA 2QSGX 4IHXA 1KA5A 1E17A 3O8GA 1G4DA 3GWZA 4C2TA 3ECHA 3H92A 4ESFA 3D0SA 2VKDA 5EJCA 5CPRB 4A3FJ 3VWBA 2BOLA 5HS8A 1LE8B 1XDSA 2BVMA 3CDLA 5B3SH 1F1ZA 3A02A 4CH7A 1OYYA 2CS3A 2MGQA 2Q8KA 3CJQB 2PEXA 1UB9A 5CVIA 4YRVA 2IGNA 3H36A 1GV2A 3P9CA 2EJRA 3HKZA 4HX8A 1FY7A 1KYWA 3E0JB 1RC9A 4D5CA 3WTSC 2ZMEB 2DTRA 4J19A 3HOYJ 2CQKA 2MW8A 4F52A 2XDVA 1ZG5A 1TNSA 1HXDA 3CDHA 2WAFA 3GUDA 1XS9A 6PAXA 3FMRA 2CQ7A 2IA1A 1B6AA 3RPQA 1I6XA 1KA8A 3WTWC 1Q1HA 2FMLA 3K4JA 3LAJA 5LBQA 3MWMA 4Y7NJ 4QLCU 3NAUA 1RR7A 3FMSA 2NVXJ 3MZ8A 1TLHB 4BBSJ 1USSA 5KCMA 3ZMZA 1V5FA 2LLKA 2BE5F 2ZNYA 2YPRA 3I0TA 3DPUA 3I59A 2Z3YA 2LNBA 9ANTA 2XRLA 3AG1H 2CV0A 3MKYB 1JKOC 1ONVA 2KZVA 4EQQA 1GGRB 2DOFA 3BTIA 3BG6A 4G6TB 4CYCA 4OU0A 2VASA 4RA2A 3TMOA 2CWEA 2VXZA 4BGDA 2EZLA 5JLWA 3PM1A 3A01B 1ODDA 5BMZA 1XMAA 4G94A 2DPDA 2CQNA 3A0HC 3M3YJ 3LAPA 4XBFA 5E17F 1TXEA 5JFRA 2L2OA 4IX7A 1YX3A 3PJRA 4IRIA 3OIQA 1VZ0A 2XRNA 4FETA 5EEGA 2IT0A 2EV0A 1IN4A 4S0HB 3LSRA 3GFIA 4R1HA 1R22A 2Y0SA 1RZ4A 3I5UA 4UNOA 4D1QA 2GOMA 2IEKA 3RKYA 1OQYA 2UXNA 4I02A 1PCHA 2V26A 2OCCH 2A3SA 2NZVL 3SFIA 3J81Z 3EZAB 2BV6A 1U5TA 5F6FA 2KJCA 4FHTA 3I64A 4LLNA 1HOMA 4IRHA 2ELHA 4KYWA 3PNVA 1QVUA 4BEHA 4DQ2A 2WC2A 3WHCA 4A69C 1A31A 4NNJA 3V8LA 4OMYA 2DA5A 1QBJA 2VBYA 3LNQA 2LK2A 2VQCA 1IV8A 2JMWA 2H8WA 3PUBA 1OCCH 2X6OA 3JRDA 3HOUJ 2DDBA 2Q2EA 1KU7A
chains in the Genus database with same CATH topology
1SD6A 2F5DA 1SFUA 2XGXA 1WWXA 1Y0UA 4WWCA 1CF7B 4EJWA 4G9YA 1W4MA 1H0MA 1U78A 1REPC 1R1UA 4ZZDA 2CO5A 4GXOA 5F64A 3K1PA 2HKOA 3F6OA 2Z99A 3WTYC 2OBPA 4HV6A 1TTYA 2MD5A 3RKWA 2ZJ2A 4CDGA 1B1BA 1ZGAA 5K1YA 3MZHA 4WXHA 2ESHA 3TO7A 1RIOH 3I58A 2OU2A 2YR2A 1HW1A 3E6MA 5JR3A 3VFZA 3G3ZA 1S7OA 1SD7A 4I98B 5E8IA 3IHUA 1IN5A 1RNLA 3HHHA 4HX7A 3W6JB 3BROA 2DT5A 2F5CA 4BHPA 4IVNA 4U7DA 3L00A 1LQ1A 5ILUA 1JHFA 4EJVA 2KIMA 5D8KB 4LJZF 3K1MA 3H3ZA 3QU3A 1QZYA 4Q4ZF 1ZHFA 3KP7A 2HEOA 5H6RA 2FA5A 3KFWX 2DPUA 1W7PA 2Z9OA 3BP8A 4MEYF 1ZG3A 1SD5A 4R8HA 1U2WA 5L3FA 1P4XA 3RKXA 1P4WA 1R5HA 5D4RA 3F21A 4JK1X 1WQ2A 4B8XA 1UCRA 3GVAA 2ZCWA 1MJBA 5K5RA 3T8TA 2M30A 2DLLA 1LEBA 1TW3A 3I59B 1FYLA 3MEXA 2HR3A 3KEOA 3SHFA 5A2QK 2QQ9A 5BOXA 3HRUA 4QWQA 2XVCA 4I01A 1SFEA 2JPCA 2VODA 2A07F 3K0LA 3P9KA 2W85A 4KIGA 3QP6A 2CYYA 1T2KA 3HOSA 3K9TA 3DV8A 4GGGA 3RIRA 3K69A 4ASNA 2P5VA 3F6VA 2HQNA 2XAGA 1FSHA 2F5FA 3WGGA 1RUNA 1U5TB 2B0LA 3P9IA 1YS7A 4IRGA 5CJ9A 5HDGA 2KIFA 5BQTA 4CXFA 2QWWA 4UVBA 2QQBA 4KN4X 5E1ZB 5H20A 2OD5A 3WGIA 2FSWA 1DPUA 1LNWA 2DK5A 2WTEA 5LHIA 3LA2A 3MQ0A 4OOIA 3KETA 1K78B 2NNYA 2CFXA 4TV7A 2UZKA 2GXGA 1WI9A 1P92A 1IN6A 2MA3A 3ECOA 4BHBA 1JE8A 1B59A 4RGXA 4HDVA 2A6HF 3V8JA 3ZP5A 2ISZA 2HKXA 3MCZA 2XKPA 4AIJA 3I71A 3CTAA 2KJBA 4P9FA 4U88A 2MC3A 3BJOA 4S05A 2H27A 3DP7A 1K7AA 1O3QA 3GZ6A 3C1DA 1ZREA 2W57A 5HVQC 1SMYF 3GFLA 1WKMA 2DBBA 2IA2A 2KIUA 2YSRA 2HGCA 2XKOA 1MD0A 1TBXA 4HLYA 1YS6A 3WG9A 3KZZA 2UWMA 3FXUA 1YO5C 1QPMA 2OZ6A 4LD5A 4RS8A 2G9WA 1FT9A 1S8NA 4CICA 1RUOA 2E7XA 2OZUA 4RB2C 1W7PB 3BZ6A 2CGPA 1VTNC 4L0YB 4CZZA 2P7VB 5CVVA 2QLZA 2VT3A 4UHTA 2EK5A 2VBXA 3BJ6A 4R79A 5DD8A 2EWNA 5E18F 1O3RA 3K1NA 1G3SA 4HLXA 2AXLA 2V1XA 3J7AO 3HTUA 5HLIA 3DPTA 3C7JA 1BBYA 2IVMA 4Y13A 5KVRA 5CVUA 1STZA 2EB7A 2COMA 4RB1A 4NB5A 4KIFA 3HOTA 4BYYA 5ILVA 2PMHA 5D8LB 4M6XA 3E6CC 4U0VA 4BHCA 4U0WA 3S2WA 3IKTA 1XCVA 1ULYA 3JAMK 4A6EA 3GEZA 3F8CA 1BC8C 4XSXF 4P9UA 3E6DA 1ZLKA 3PQJA 2UXXA 1S29A 2FOKA 5IT9K 3TO6A 4IF4A 2EFOA 1T98A 2IA0A 3GZ5A 2VE9A 4A5NA 1W5TA 4LK1F 4P5OA 3ULQB 1ZARA 3SQNA 1FBUA 4D0PA 3EYYA 1UHWA 1QQIA 1V3FA 2K4BA 4MGRA 2JRTA 1XN7A 2MLKA 1FZPB 3LA7A 4A0ZA 1XSVA 2DQLA 3R0JA 1O7FA 5F1RA 1XCBA 1DP7P 3FXRA 4WCGA 3HRMA 4AWXB 4FT8A 1BOAA 4UV8A 3KE2A 3CJNA 2HTJA 1ZRFA 2M45A 2MBFA 3KZYA 4BQAA 3J80Z 3F8BA 4A0YA 4HQEA 5AONA 3WU1B 5K5QA 2XASA 2VT2A 2EFNA 1FWZA 1OYIA 1DUXC 2VC0A 1HKSA 2Z33A 1T38A 3T5XA 3IWFA 3SXYA 4KNYA 2G7UA 3HIFA 3E3VA 4ZYHA 2RVCA 2GQQA 3V7RA 2RN7A 1OKRA 2PLYA 4HZFA 1J75A 2E1CA 2VBZA 3QOPA 1MGTA 4EM2A 3GW2A 3C18A 1U5TC 1MZBA 1R5GA 1QO0D 3ML6A 3WTUC 1JHHA 2ZNZA 1R1TA 5HLGA 2EA4A 2W25A 4AIKA 2VC1A 4GYGA 3I4PA 5FFXA 4LB5A 1Z7UA 1S7AA 4A12A 1P6RA 3TOAA 3VODA 3O6BB 4UVAA 1Z05A 3G73A 4NQWA 2FMYA 4PCQA 4KMFA 5DCMB 4MTDA 1YFHA 1HKQA 2HQRA 3DFGA 3R60A 4ZYGA 5LLQA 1BI3A 4PDKA 2YX7A 1LEAA 5LGUA 2WV0A 3F23A 2O03A 5A2QZ 3VB2A 3RJPA 3M7GA 3L7WA 5D4SA 1IXCA 1UHMA 3CO7C 3ZMTA 2FQ3A 1F9NA 1S6LA 1ON2A 1R7JA 2XV4S 5FD5A 3K2ZA 4LMYA 1OPCA 1BI1A 3DQVC 2O6GE 2RV8A 1FBSA 3Q9SA 3N97A 2QUFA 1Z9CA 2DW4A 2ESNA 3RI4A 1DDNA 2F2EA 4ESBA 1B9NA 4M9ZA 3ZQ7A 3DKWA 3EDPA 4BAYA 5DDGA 3GFJA 3D5LA 5L3GA 3WODF 1EH7A 1I1SA 1XSXA 1MKMA 2K27A 3R0AA 1U8RA 1YW7A 1YYVA 4XSZF 2PMUA 3KCCA 5DCFA 1XD7A 4I0BA 1G3YA 1L0OC 4RAYA 1IUYA 2GIVA 1BN5A 1ZLJA 1QZZA 2M1BA 2L01A 2CW0F 3MZYA 3J81K 2NRAC 4LG0A 2P4WA 3WTZA 2STTA 1GVJA 4LLGF 3IRQA 1S3JA 1HW5A 2H94A 5E1WA 1B4AA 4EJOA 1HKTA 3M9AA 5L3DA 1XGMA 4N9HA 2L3DA 2RQPA 2ACJA 1TQPA 1XMKA 2ADUA 3NRVA 2QVOA 4EM0B 1W7PD 5HLHA 4HW0A 4OIQF 1Z6TA 3L9FA 3KLNA 3IWZA 4M73A 4KA4A 4ZYEA 4GO1A 5JVTA 3M8FA 3TDUC 5IT3A 5CVRA 2ZBKA 3V7SA 4GCVA 2JT1A 3OV8A 3LQQA 3GYHX 1J59A 1J5YA 2O3FA 4I09A 5E20A 3B02A 4BH9A 2FXAA 2ZFWA 2FNAA 5L3BA 1FPQA 2FBKA 3I54A 1UFMA 2RC4A 2Z5UA 2K02A 3LSTA 1K79A 1TW2A 5L3EA 2IJLA 5L3CA 5FD6A 3SZPA 3V8KA 4U0YA 3F3XA 4UVCA 2NAZA 1J0RA 2FBIA 2JZYA 1TQIA 5FO5A 2PFBA 3ISPA 4LB6B 2QBYA 1A04A 2EA2A 4KT5C 2IP2A 2OQGA 1R00A 5H6QA 5D6FA 4I2OA 2H09A 5CVJA 1R23A 2QENA 5JI6A 2K4JA 3B73A 3GXOA 2L4AA 4MEXF 2P5LC 2XAFA 1SAXA 3BWGA 4EM1A 3M1EA 4YFXF 1P4AA 3RDIA 3WU0A 2FBHA 1YQAA 4EJUA 3MAJA 4WF2A 3JAMZ 3U9GA 3EYIA 1D8JA 1R36A 5ICEA 1D5VA 4WXCA 1F5TA 3GFMA 3ZMSA 2VONA 1C0WA 2J5OA 3HRSA 1PP8F 4L9TA 1IRGA 1I5ZA 2DK8A 4YIFA 1ZN2A 2DI3A 1EV7A 1LB2A 4Q5SF 5BPIA 4G8XA 3O3KA 2DO7A 2LSOA 2GXBA 1Z91A 3JSOA 3QRFF 4RB0A 3FZVA 4IJAA 3R6SA 2OA4A 2L02A 3HTSB 1KU3A 1FYMA 2VOOA 4ZZLA 1IZ1A 4UV9A 4IXAA 3BJAA 2MLGA 4PGGA 4CYDA 2V9VA 3IC7A 2YX4A 5DUKA 1FSEA 4Y17A 2D45A 1FYKA 1NHAA 1KQ8A 2EFPA 1XGOA 1D3YA 2BYVE 3PQKA 5FB2A 4FX0A 3TOBA 2KKOA 1SD4A 1T0FA 1GXQA 3PFIA 1Z1DA 4I0AA 3E5QA 4IHSA 3F8MA 3GLXA 2O0YA 4LG0B 5LGNA 4M9XA 5D5VB 1W5SA 3I53A 4A0XA 2LDUA 4HF2A 1XB4A 1AWCA 3IKVA 4Q48A 4KFCA 5FFZA 1BM9A 1I1GA 2Y48A 1T6SA 1FP1D 1MDMA 2GA1A 2MH9A 3F8NA 2F5EA 3IL2A 2FU4A 4L9VA 3P7NA 1CGPA 4Q47A 5KK1A 3DPLC 4A6DA 1AOYA 2R7FA 3CUQA 1HW2A 4XRFA 2YU3A 3ABTA 3ZPLA 2G7HA 3TGNA 2ZO4A 1YW9A 4P55A 1PUEE 1XSDA 1IW7F 2TDXA 3E5UA 5EEHA 2R3SA 1T39A 5CLSA 1D8KA 3QP5A 4KIBA 1LJ9A 4E70A 2EV5A 4S04A 1IXRC 5DYMA 3FMQA 4G7ZF 3EQLF 2QBYB 4EMSA 3V7CA 2STWA 1LDDA 3E5XA 4A2UA 3SZTA 4M72A 4GYIA 4EV0A 2V6CA 2V79A 3U2RA 4AVPA 2ETHA 2LF8A 2W84A 2GA2A 2FNPA 2K7LA 2QM3A 3COAC 2DU9A 1YG2A 2LF7A 3KEQA 4B09A 4YIIA 1OYWA 2A5YB 4LGWA 4BNCA 2EFWA 3CUOA 4WX9A 1BC7C 5LEKA 3LA3A 2IW5A 3LFKA 3LWFA 4HA8A 4AD9A 4ENKA 2EFQA 4ENJA 2DFIA 3ELKA 3HSRA 5TRDA 2V1UA 4HBLA 1BJAA 1K6OA 4K2EA 2JPBA 1X3UA 2ZKZA 5JHUA 4G7HF 4UUVA 2PQ8A 4M9SA 3JTGA 2H6BA 1LDKB 2PBIA 1FBQA 5FLXK 2PJPA 5LGTA 1FX7A 2RKHA 4KMUX 1KYZA 1BI0A 5D5UB 5AIQA 4JQFA 3WGHA 2L4MA 4CO8A 1G3WA 4HQMA 3RTRA 3AAFA 3QPTA 1IN7A 4LK0F 1QGPA 2DQRA 1YTYA 2XHKA 4OIRF 4ENNA 1LDJA 2XAHA 2NS0A 2OAZA 5ICCA 3F8FA 1FC3A 4F7ZA 4IPAA 4RB3C 5LRRA 3NEUA 3GO5A 1PP7U 2GAUA 2E7WA 4AIHA 5ED4A 4H0EA 2XROA 4L9JA 1HSTA 5BS6A 4PGHA 2HZTA 5HDKA 1HQCA 4L5IA 3REOA 2PI0A 2O61A 2JTVA 2FRHA 2M5WA 4P96A 2W24A 4WK8F 3ERED 1MDMB 3WTTC 3GF2A 2A68F 3R4KA 2HTSA 3JTHA 5D5WB 3GX4X 4EVIA 2P6SA 1K78A 1JXSA 1ZAOA 2VBWA 1ZRDA 3J80K 4N0BA 3WE2A 1PDNC 3CUQB 3JSPA 4O5VA 1U6GA 3FXQA 3U1DA 4ZH4F 1KGSA 4HF1A 2VN2A 2AS5F 4ENMA 2V1DA 4RAZA 4MTEA 4LFUA 4DNCA 3KLOA 2M87A 3BDDA 2X4HA 4HYEA 3IRRA 2D1VA 1R58A 2P5KA 2CG4A 3QPHA 4YFKF 3HHGA 2Y0MA 3ZN1A 2ISYA 3TDZC 2HOEA 3FM5A 2QZ8A 4O3MA 4RGSA 1BI2A 2BGCA 3VOEA 1OMIA 4YFNF 1HBXG 3QAHA 4L9NA 5CYVA 1KU9A 1XGNA 4MQVA 1J2XA 2EV6A 1G3TA 1KQ9A 2CSOA 4WXDA 2HDCA 1WRJA 1ZH5A 1IAWA 3FHZA 3CLOA 3QU6A 3W6KB 1USTA 1YW8A 3T1BA 3CO6C 3C3WA 4CHUA 3BPVA 4G6DA 5J8CA 4M74A 1FNNA 3Q9VA 3LQRA 4PZJA 4M6YA 5DV5A 4CGZA 2GZWA 4U7BA 2A6EF 5BPDA 1V4RA 2XAJA 2NYXA 3T0YA 5TJJA 3FX3A 3HYIA 5AIPA 1ZGJA 1P2FA 5ICFA 3ZMUA 1I27A 3N4MA 3H3UA 2H6CA 3L2CA 4HDUA 2FEZA 5J6XA 3NQOA 2D1HA 4BXUA 2NNNA 2OQRA 2XAQA 1U3EM 3ROUA 1HSJA 2D2WA 2FF4A 1OR7A 1O7LA 1O3SA 5HOOA 3HSEA 1JGSA 3FM3A 5E1XA 3DF8A 1SFXA 2VE8A 5ICGA 2E1NA 1R1VA 3ZN0A 2PN6A 2BEOA 5K5OA 1ZRCA 2O8XA 5J8FA 5HS7A 4RGUA 4G7OF 3WTXC 3F22A 4OMZA 3JW4A 2X0LA 3TQNA 2Q0OA 4KN7X 5ILSA 3V4GA 2FE3A 2DAOA 4LLLA 4L0ZB 3EUHA 2M8EA 3BPXA 4JBAA 3VEPA 1J7KA 3Q5FA 4OIPF 2ZMEA 4Y15A 1H9TA 2Y75A 2IPQX 4HF0A 5D5XB 2P6TA 4A5MA 5IT9Z 5HS9A 1J9IA 2RDPA 4M71A 2R7DA 1FLIA 2ZXJA 1IRFA 1KU2A 3O2PE 1H9GA 4ESJA 4ETSA 1ZYRF 1Z6RA 3M8EA 3RYRA 3KP2A 1TNTA 2PG4A 2IRFG 1WSUA 4ON0A 4OIOF 3E6BA 4KICA 3KP3A 2J5PA 4NHJA 1GHCA 1DPRA 2C6YA 3RPUA 3OOPA 3BOQA 1O57A 1KQ0A 3E97A 4ZYDA 3T8RA 1FP2A 4FX4A 1O3TA 1ON1A 2XIGA 1EH6A 5D6EA 2HYGD 3ZMDA 3R61A 3ABUA 4Z2YA 2VOPA 4EGYA 1BIBA 3RYPA 3WTVC 4EJTA 5FGMA 2RNJA 3WE3A 2P7CB 3L09A 4MNUA 3DEUA 4OINF 2P8TA 4G6QA 3KP5A 4HX4A 1YIOA 3CUQC 1RI7A 2L54A 4HOBA 5DUIA 1XGSA 1F4KA 3ZMVA 3FF5A 2RGVA 2LKPA 1MJAA 3F72A 2JSCA 1TQMA 2K86A 2HWVA 3MFKA 5DCMA 4MQ9F 3SFZA 4EGZA 3KP6A 1YLFA 5FLXZ 1E2XA 2HYFA 4HV5A 2MH2A 5HDNA 5LHGA 1ZG1A 1EH8A 4L18B 4MHGA 1CF7A 3TO9A 4XLNF 1B9MA 1G6NA 2HS5A 5DEQA 4HAMA 4RGRA 4KDPA 1QNTA 3EETA 3HSFA 3BY6A 1IN8A 2GWRA 1GXPA 2QQAA 2A61A 4N9IA 5LRSA 1L3LA 1FOKA 1XDUA 5LEJA 2BBYA 2HFHA 4UXNA 1MJ9A 1IF1A 1BIAA 3HRTA 4IHTA 3FWEA 4XLPF 5LHHA 5DD4A 4I7HA 3DXJF 3TKYA 4L5JA 5ERIA 2QYOA 4YG2F 2WWYA 4KUMA 2A69F 4O6JA 3KP4A 2KRFA 1LVAA 1SMTA 3HUGA 1IXSB 2XUBA 5E8GA 1E17A 1G4DA 3GWZA 3ECHA 3H92A 4ESFA 3D0SA 5HS8A 1XDSA 1F1ZA 1OYYA 2Q8KA 2PEXA 1UB9A 5CVIA 3P9CA 2EJRA 4HX8A 1FY7A 1KYWA 3WTSC 2ZMEB 2DTRA 2CQKA 1ZG5A 1TNSA 1HXDA 3CDHA 3GUDA 6PAXA 3FMRA 2IA1A 1B6AA 3RPQA 1I6XA 1KA8A 3WTWC 1Q1HA 2FMLA 3LAJA 5LBQA 3MWMA 4QLCU 3FMSA 1TLHB 1USSA 3ZMZA 2BE5F 2ZNYA 2YPRA 3I0TA 3I59A 2Z3YA 2LNBA 1ONVA 4EQQA 4OU0A 2CWEA 2VXZA 1ODDA 5BMZA 1XMAA 4G94A 2DPDA 3LAPA 4XBFA 5E17F 5JFRA 4IRIA 2XRNA 5EEGA 2IT0A 2EV0A 1IN4A 3GFIA 4R1HA 1R22A 3I5UA 1RZ4A 4UNOA 3RKYA 2UXNA 4I02A 2A3SA 3J81Z 2BV6A 1U5TA 5F6FA 2KJCA 4FHTA 3I64A 4LLNA 4IRHA 2ELHA 4KYWA 4DQ2A 2WC2A 3V8LA 4OMYA 1QBJA 2VBYA 2Q2EA 1KU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SD6 A;  2F5D A;  1SFU A;  2XGX A;  1WWX A;  1Y0U A;  4WWC A;  1CF7 B;  4EJW A;  4G9Y A;  1W4M A;  1H0M A;  1U78 A;  1REP C;  1R1U A;  4ZZD A;  2CO5 A;  4GXO A;  5F64 A;  3K1P A;  2HKO A;  3F6O A;  2Z99 A;  3WTY C;  2OBP A;  4HV6 A;  1TTY A;  2MD5 A;  3RKW A;  2ZJ2 A;  4CDG A;  1B1B A;  1ZGA A;  5K1Y A;  3MZH A;  4WXH A;  2ESH A;  3TO7 A;  1RIO H;  3I58 A;  2OU2 A;  2YR2 A;  1HW1 A;  3E6M A;  5JR3 A;  3VFZ A;  3G3Z A;  1S7O A;  1SD7 A;  4I98 B;  5E8I A;  3IHU A;  1IN5 A;  1RNL A;  3HHH A;  4HX7 A;  3W6J B;  3BRO A;  2DT5 A;  2F5C A;  4BHP A;  4IVN A;  4U7D A;  3L00 A;  1LQ1 A;  5ILU A;  1JHF A;  4EJV A;  2KIM A;  5D8K B;  4LJZ F;  3K1M A;  3H3Z A;  3QU3 A;  1QZY A;  4Q4Z F;  1ZHF A;  3KP7 A;  2HEO A;  5H6R A;  2FA5 A;  3KFW X;  2DPU A;  1W7P A;  2Z9O A;  3BP8 A;  4MEY F;  1ZG3 A;  1SD5 A;  4R8H A;  1U2W A;  5L3F A;  1P4X A;  3RKX A;  1P4W A;  1R5H A;  5D4R A;  3F21 A;  4JK1 X;  1WQ2 A;  4B8X A;  1UCR A;  3GVA A;  2ZCW A;  1MJB A;  5K5R A;  3T8T A;  2M30 A;  2DLL A;  1LEB A;  1TW3 A;  3I59 B;  1FYL A;  3MEX A;  2HR3 A;  3KEO A;  3SHF A;  5A2Q K;  2QQ9 A;  5BOX A;  3HRU A;  4QWQ A;  2XVC A;  4I01 A;  1SFE A;  2JPC A;  2VOD A;  2A07 F;  3K0L A;  3P9K A;  2W85 A;  4KIG A;  3QP6 A;  2CYY A;  1T2K A;  3HOS A;  3K9T A;  3DV8 A;  4GGG A;  3RIR A;  3K69 A;  4ASN A;  2P5V A;  3F6V A;  2HQN A;  2XAG A;  1FSH A;  2F5F A;  3WGG A;  1RUN A;  1U5T B;  2B0L A;  3P9I A;  1YS7 A;  4IRG A;  5CJ9 A;  5HDG A;  2KIF A;  5BQT A;  4CXF A;  2QWW A;  4UVB A;  2QQB A;  4KN4 X;  5E1Z B;  5H20 A;  2OD5 A;  3WGI A;  2FSW A;  1DPU A;  1LNW A;  2DK5 A;  2WTE A;  5LHI A;  3LA2 A;  3MQ0 A;  4OOI A;  3KET A;  1K78 B;  2NNY A;  2CFX A;  4TV7 A;  2UZK A;  2GXG A;  1WI9 A;  1P92 A;  1IN6 A;  2MA3 A;  3ECO A;  4BHB A;  1JE8 A;  1B59 A;  4RGX A;  4HDV A;  2A6H F;  3V8J A;  3ZP5 A;  2ISZ A;  2HKX A;  3MCZ A;  2XKP A;  4AIJ A;  3I71 A;  3CTA A;  2KJB A;  4P9F A;  4U88 A;  2MC3 A;  3BJO A;  4S05 A;  2H27 A;  3DP7 A;  1K7A A;  1O3Q A;  3GZ6 A;  3C1D A;  1ZRE A;  2W57 A;  5HVQ C;  1SMY F;  3GFL A;  1WKM A;  2DBB A;  2IA2 A;  2KIU A;  2YSR A;  2HGC A;  2XKO A;  1MD0 A;  1TBX A;  4HLY A;  1YS6 A;  3WG9 A;  3KZZ A;  2UWM A;  3FXU A;  1YO5 C;  1QPM A;  2OZ6 A;  4LD5 A;  4RS8 A;  2G9W A;  1FT9 A;  1S8N A;  4CIC A;  1RUO A;  2E7X A;  2OZU A;  4RB2 C;  1W7P B;  3BZ6 A;  2CGP A;  1VTN C;  4L0Y B;  4CZZ A;  2P7V B;  5CVV A;  2QLZ A;  2VT3 A;  4UHT A;  2EK5 A;  2VBX A;  3BJ6 A;  4R79 A;  5DD8 A;  2EWN A;  5E18 F;  1O3R A;  3K1N A;  1G3S A;  4HLX A;  2AXL A;  2V1X A;  3J7A O;  3HTU A;  5HLI A;  3DPT A;  3C7J A;  1BBY A;  2IVM A;  4Y13 A;  5KVR A;  5CVU A;  1STZ A;  2EB7 A;  2COM A;  4RB1 A;  4NB5 A;  4KIF A;  3HOT A;  4BYY A;  5ILV A;  2PMH A;  5D8L B;  4M6X A;  3E6C C;  4U0V A;  4BHC A;  4U0W A;  3S2W A;  3IKT A;  1XCV A;  1ULY A;  3JAM K;  4A6E A;  3GEZ A;  3F8C A;  1BC8 C;  4XSX F;  4P9U A;  3E6D A;  1ZLK A;  3PQJ A;  2UXX A;  1S29 A;  2FOK A;  5IT9 K;  3TO6 A;  4IF4 A;  2EFO A;  1T98 A;  2IA0 A;  3GZ5 A;  2VE9 A;  4A5N A;  1W5T A;  4LK1 F;  4P5O A;  3ULQ B;  1ZAR A;  3SQN A;  1FBU A;  4D0P A;  3EYY A;  1UHW A;  1QQI A;  1V3F A;  2K4B A;  4MGR A;  2JRT A;  1XN7 A;  2MLK A;  1FZP B;  3LA7 A;  4A0Z A;  1XSV A;  2DQL A;  3R0J A;  1O7F A;  5F1R A;  1XCB A;  1DP7 P;  3FXR A;  4WCG A;  3HRM A;  4AWX B;  4FT8 A;  1BOA A;  4UV8 A;  3KE2 A;  3CJN A;  2HTJ A;  1ZRF A;  2M45 A;  2MBF A;  3KZY A;  4BQA A;  3J80 Z;  3F8B A;  4A0Y A;  4HQE A;  5AON A;  3WU1 B;  5K5Q A;  2XAS A;  2VT2 A;  2EFN A;  1FWZ A;  1OYI A;  1DUX C;  2VC0 A;  1HKS A;  2Z33 A;  1T38 A;  3T5X A;  3IWF A;  3SXY A;  4KNY A;  2G7U A;  3HIF A;  3E3V A;  4ZYH A;  2RVC A;  2GQQ A;  3V7R A;  2RN7 A;  1OKR A;  2PLY A;  4HZF A;  1J75 A;  2E1C A;  2VBZ A;  3QOP A;  1MGT A;  4EM2 A;  3GW2 A;  3C18 A;  1U5T C;  1MZB A;  1R5G A;  1QO0 D;  3ML6 A;  3WTU C;  1JHH A;  2ZNZ A;  1R1T A;  5HLG A;  2EA4 A;  2W25 A;  4AIK A;  2VC1 A;  4GYG A;  3I4P A;  5FFX A;  4LB5 A;  1Z7U A;  1S7A A;  4A12 A;  1P6R A;  3TOA A;  3VOD A;  3O6B B;  4UVA A;  1Z05 A;  3G73 A;  4NQW A;  2FMY A;  4PCQ A;  4KMF A;  5DCM B;  4MTD A;  1YFH A;  1HKQ A;  2HQR A;  3DFG A;  3R60 A;  4ZYG A;  5LLQ A;  1BI3 A;  4PDK A;  2YX7 A;  1LEA A;  5LGU A;  2WV0 A;  3F23 A;  2O03 A;  5A2Q Z;  3VB2 A;  3RJP A;  3M7G A;  3L7W A;  5D4S A;  1IXC A;  1UHM A;  3CO7 C;  3ZMT A;  2FQ3 A;  1F9N A;  1S6L A;  1ON2 A;  1R7J A;  2XV4 S;  5FD5 A;  3K2Z A;  4LMY A;  1OPC A;  1BI1 A;  3DQV C;  2O6G E;  2RV8 A;  1FBS A;  3Q9S A;  3N97 A;  2QUF A;  1Z9C A;  2DW4 A;  2ESN A;  3RI4 A;  1DDN A;  2F2E A;  4ESB A;  1B9N A;  4M9Z A;  3ZQ7 A;  3DKW A;  3EDP A;  4BAY A;  5DDG A;  3GFJ A;  3D5L A;  5L3G A;  3WOD F;  1EH7 A;  1I1S A;  1XSX A;  1MKM A;  2K27 A;  3R0A A;  1U8R A;  1YW7 A;  1YYV A;  4XSZ F;  2PMU A;  3KCC A;  5DCF A;  1XD7 A;  4I0B A;  1G3Y A;  1L0O C;  4RAY A;  1IUY A;  2GIV A;  1BN5 A;  1ZLJ A;  1QZZ A;  2M1B A;  2L01 A;  2CW0 F;  3MZY A;  3J81 K;  2NRA C;  4LG0 A;  2P4W A;  3WTZ A;  2STT A;  1GVJ A;  4LLG F;  3IRQ A;  1S3J A;  1HW5 A;  2H94 A;  5E1W A;  1B4A A;  4EJO A;  1HKT A;  3M9A A;  5L3D A;  1XGM A;  4N9H A;  2L3D A;  2RQP A;  2ACJ A;  1TQP A;  1XMK A;  2ADU A;  3NRV A;  2QVO A;  4EM0 B;  1W7P D;  5HLH A;  4HW0 A;  4OIQ F;  1Z6T A;  3L9F A;  3KLN A;  3IWZ A;  4M73 A;  4KA4 A;  4ZYE A;  4GO1 A;  5JVT A;  3M8F A;  3TDU C;  5IT3 A;  5CVR A;  2ZBK A;  3V7S A;  4GCV A;  2JT1 A;  3OV8 A;  3LQQ A;  3GYH X;  1J59 A;  1J5Y A;  2O3F A;  4I09 A;  5E20 A;  3B02 A;  4BH9 A;  2FXA A;  2ZFW A;  2FNA A;  5L3B A;  1FPQ A;  2FBK A;  3I54 A;  1UFM A;  2RC4 A;  2Z5U A;  2K02 A;  3LST A;  1K79 A;  1TW2 A;  5L3E A;  2IJL A;  5L3C A;  5FD6 A;  3SZP A;  3V8K A;  4U0Y A;  3F3X A;  4UVC A;  2NAZ A;  1J0R A;  2FBI A;  2JZY A;  1TQI A;  5FO5 A;  2PFB A;  3ISP A;  4LB6 B;  2QBY A;  1A04 A;  2EA2 A;  4KT5 C;  2IP2 A;  2OQG A;  1R00 A;  5H6Q A;  5D6F A;  4I2O A;  2H09 A;  5CVJ A;  1R23 A;  2QEN A;  5JI6 A;  2K4J A;  3B73 A;  3GXO A;  2L4A A;  4MEX F;  2P5L C;  2XAF A;  1SAX A;  3BWG A;  4EM1 A;  3M1E A;  4YFX F;  1P4A A;  3RDI A;  3WU0 A;  2FBH A;  1YQA A;  4EJU A;  3MAJ A;  4WF2 A;  3JAM Z;  3U9G A;  3EYI A;  1D8J A;  1R36 A;  5ICE A;  1D5V A;  4WXC A;  1F5T A;  3GFM A;  3ZMS A;  2VON A;  1C0W A;  2J5O A;  3HRS A;  1PP8 F;  4L9T A;  1IRG A;  1I5Z A;  2DK8 A;  4YIF A;  1ZN2 A;  2DI3 A;  1EV7 A;  1LB2 A;  4Q5S F;  5BPI A;  4G8X A;  3O3K A;  2DO7 A;  2LSO A;  2GXB A;  1Z91 A;  3JSO A;  3QRF F;  4RB0 A;  3FZV A;  4IJA A;  3R6S A;  2OA4 A;  2L02 A;  3HTS B;  1KU3 A;  1FYM A;  2VOO A;  4ZZL A;  1IZ1 A;  4UV9 A;  4IXA A;  3BJA A;  2MLG A;  4PGG A;  4CYD A;  2V9V A;  3IC7 A;  2YX4 A;  5DUK A;  1FSE A;  4Y17 A;  2D45 A;  1FYK A;  1NHA A;  1KQ8 A;  2EFP A;  1XGO A;  1D3Y A;  2BYV E;  3PQK A;  5FB2 A;  4FX0 A;  3TOB A;  2KKO A;  1SD4 A;  1T0F A;  1GXQ A;  3PFI A;  1Z1D A;  4I0A A;  3E5Q A;  4IHS A;  3F8M A;  3GLX A;  2O0Y A;  4LG0 B;  5LGN A;  4M9X A;  5D5V B;  1W5S A;  3I53 A;  4A0X A;  2LDU A;  4HF2 A;  1XB4 A;  1AWC A;  3IKV A;  4Q48 A;  4KFC A;  5FFZ A;  1BM9 A;  1I1G A;  2Y48 A;  1T6S A;  1FP1 D;  1MDM A;  2GA1 A;  2MH9 A;  3F8N A;  2F5E A;  3IL2 A;  2FU4 A;  4L9V A;  3P7N A;  1CGP A;  4Q47 A;  5KK1 A;  3DPL C;  4A6D A;  1AOY A;  2R7F A;  3CUQ A;  1HW2 A;  4XRF A;  2YU3 A;  3ABT A;  3ZPL A;  2G7H A;  3TGN A;  2ZO4 A;  1YW9 A;  4P55 A;  1PUE E;  1XSD A;  1IW7 F;  2TDX A;  3E5U A;  5EEH A;  2R3S A;  1T39 A;  5CLS A;  1D8K A;  3QP5 A;  4KIB A;  1LJ9 A;  4E70 A;  2EV5 A;  4S04 A;  1IXR C;  5DYM A;  3FMQ A;  4G7Z F;  3EQL F;  2QBY B;  4EMS A;  3V7C A;  2STW A;  1LDD A;  3E5X A;  4A2U A;  3SZT A;  4M72 A;  4GYI A;  4EV0 A;  2V6C A;  2V79 A;  3U2R A;  4AVP A;  2ETH A;  2LF8 A;  2W84 A;  2GA2 A;  2FNP A;  2K7L A;  2QM3 A;  3COA C;  2DU9 A;  1YG2 A;  2LF7 A;  3KEQ A;  4B09 A;  4YII A;  1OYW A;  2A5Y B;  4LGW A;  4BNC A;  2EFW A;  3CUO A;  4WX9 A;  1BC7 C;  5LEK A;  3LA3 A;  2IW5 A;  3LFK A;  3LWF A;  4HA8 A;  4AD9 A;  4ENK A;  2EFQ A;  4ENJ A;  2DFI A;  3ELK A;  3HSR A;  5TRD A;  2V1U A;  4HBL A;  1BJA A;  1K6O A;  4K2E A;  2JPB A;  1X3U A;  2ZKZ A;  5JHU A;  4G7H F;  4UUV A;  2PQ8 A;  4M9S A;  3JTG A;  2H6B A;  1LDK B;  2PBI A;  1FBQ A;  5FLX K;  2PJP A;  5LGT A;  1FX7 A;  2RKH A;  4KMU X;  1KYZ A;  1BI0 A;  5D5U B;  5AIQ A;  4JQF A;  3WGH A;  2L4M A;  4CO8 A;  1G3W A;  4HQM A;  3RTR A;  3AAF A;  3QPT A;  1IN7 A;  4LK0 F;  1QGP A;  2DQR A;  1YTY A;  2XHK A;  4OIR F;  4ENN A;  1LDJ A;  2XAH A;  2NS0 A;  2OAZ A;  5ICC A;  3F8F A;  1FC3 A;  4F7Z A;  4IPA A;  4RB3 C;  5LRR A;  3NEU A;  3GO5 A;  1PP7 U;  2GAU A;  2E7W A;  4AIH A;  5ED4 A;  4H0E A;  2XRO A;  4L9J A;  1HST A;  5BS6 A;  4PGH A;  2HZT A;  5HDK A;  1HQC A;  4L5I A;  3REO A;  2PI0 A;  2O61 A;  2JTV A;  2FRH A;  2M5W A;  4P96 A;  2W24 A;  4WK8 F;  3ERE D;  1MDM B;  3WTT C;  3GF2 A;  2A68 F;  3R4K A;  2HTS A;  3JTH A;  5D5W B;  3GX4 X;  4EVI A;  2P6S A;  1K78 A;  1JXS A;  1ZAO A;  2VBW A;  1ZRD A;  3J80 K;  4N0B A;  3WE2 A;  1PDN C;  3CUQ B;  3JSP A;  4O5V A;  1U6G A;  3FXQ A;  3U1D A;  4ZH4 F;  1KGS A;  4HF1 A;  2VN2 A;  2AS5 F;  4ENM A;  2V1D A;  4RAZ A;  4MTE A;  4LFU A;  4DNC A;  3KLO A;  2M87 A;  3BDD A;  2X4H A;  4HYE A;  3IRR A;  2D1V A;  1R58 A;  2P5K A;  2CG4 A;  3QPH A;  4YFK F;  3HHG A;  2Y0M A;  3ZN1 A;  2ISY A;  3TDZ C;  2HOE A;  3FM5 A;  2QZ8 A;  4O3M A;  4RGS A;  1BI2 A;  2BGC A;  3VOE A;  1OMI A;  4YFN F;  1HBX G;  3QAH A;  4L9N A;  5CYV A;  1KU9 A;  1XGN A;  4MQV A;  1J2X A;  2EV6 A;  1G3T A;  1KQ9 A;  2CSO A;  4WXD A;  2HDC A;  1WRJ A;  1ZH5 A;  1IAW A;  3FHZ A;  3CLO A;  3QU6 A;  3W6K B;  1UST A;  1YW8 A;  3T1B A;  3CO6 C;  3C3W A;  4CHU A;  3BPV A;  4G6D A;  5J8C A;  4M74 A;  1FNN A;  3Q9V A;  3LQR A;  4PZJ A;  4M6Y A;  5DV5 A;  4CGZ A;  2GZW A;  4U7B A;  2A6E F;  5BPD A;  1V4R A;  2XAJ A;  2NYX A;  3T0Y A;  5TJJ A;  3FX3 A;  3HYI A;  5AIP A;  1ZGJ A;  1P2F A;  5ICF A;  3ZMU A;  1I27 A;  3N4M A;  3H3U A;  2H6C A;  3L2C A;  4HDU A;  2FEZ A;  5J6X A;  3NQO A;  2D1H A;  4BXU A;  2NNN A;  2OQR A;  2XAQ A;  1U3E M;  3ROU A;  1HSJ A;  2D2W A;  2FF4 A;  1OR7 A;  1O7L A;  1O3S A;  5HOO A;  3HSE A;  1JGS A;  3FM3 A;  5E1X A;  3DF8 A;  1SFX A;  2VE8 A;  5ICG A;  2E1N A;  1R1V A;  3ZN0 A;  2PN6 A;  2BEO A;  5K5O A;  1ZRC A;  2O8X A;  5J8F A;  5HS7 A;  4RGU A;  4G7O F;  3WTX C;  3F22 A;  4OMZ A;  3JW4 A;  2X0L A;  3TQN A;  2Q0O A;  4KN7 X;  5ILS A;  3V4G A;  2FE3 A;  2DAO A;  4LLL A;  4L0Z B;  3EUH A;  2M8E A;  3BPX A;  4JBA A;  3VEP A;  1J7K A;  3Q5F A;  4OIP F;  2ZME A;  4Y15 A;  1H9T A;  2Y75 A;  2IPQ X;  4HF0 A;  5D5X B;  2P6T A;  4A5M A;  5IT9 Z;  5HS9 A;  1J9I A;  2RDP A;  4M71 A;  2R7D A;  1FLI A;  2ZXJ A;  1IRF A;  1KU2 A;  3O2P E;  1H9G A;  4ESJ A;  4ETS A;  1ZYR F;  1Z6R A;  3M8E A;  3RYR A;  3KP2 A;  1TNT A;  2PG4 A;  2IRF G;  1WSU A;  4ON0 A;  4OIO F;  3E6B A;  4KIC A;  3KP3 A;  2J5P A;  4NHJ A;  1GHC A;  1DPR A;  2C6Y A;  3RPU A;  3OOP A;  3BOQ A;  1O57 A;  1KQ0 A;  3E97 A;  4ZYD A;  3T8R A;  1FP2 A;  4FX4 A;  1O3T A;  1ON1 A;  2XIG A;  1EH6 A;  5D6E A;  2HYG D;  3ZMD A;  3R61 A;  3ABU A;  4Z2Y A;  2VOP A;  4EGY A;  1BIB A;  3RYP A;  3WTV C;  4EJT A;  5FGM A;  2RNJ A;  3WE3 A;  2P7C B;  3L09 A;  4MNU A;  3DEU A;  4OIN F;  2P8T A;  4G6Q A;  3KP5 A;  4HX4 A;  1YIO A;  3CUQ C;  1RI7 A;  2L54 A;  4HOB A;  5DUI A;  1XGS A;  1F4K A;  3ZMV A;  3FF5 A;  2RGV A;  2LKP A;  1MJA A;  3F72 A;  2JSC A;  1TQM A;  2K86 A;  2HWV A;  3MFK A;  5DCM A;  4MQ9 F;  3SFZ A;  4EGZ A;  3KP6 A;  1YLF A;  5FLX Z;  1E2X A;  2HYF A;  4HV5 A;  2MH2 A;  5HDN A;  5LHG A;  1ZG1 A;  1EH8 A;  4L18 B;  4MHG A;  1CF7 A;  3TO9 A;  4XLN F;  1B9M A;  1G6N A;  2HS5 A;  5DEQ A;  4HAM A;  4RGR A;  4KDP A;  1QNT A;  3EET A;  3HSF A;  3BY6 A;  1IN8 A;  2GWR A;  1GXP A;  2QQA A;  2A61 A;  4N9I A;  5LRS A;  1L3L A;  1FOK A;  1XDU A;  5LEJ A;  2BBY A;  2HFH A;  4UXN A;  1MJ9 A;  1IF1 A;  1BIA A;  3HRT A;  4IHT A;  3FWE A;  4XLP F;  5LHH A;  5DD4 A;  4I7H A;  3DXJ F;  3TKY A;  4L5J A;  5ERI A;  2QYO A;  4YG2 F;  2WWY A;  4KUM A;  2A69 F;  4O6J A;  3KP4 A;  2KRF A;  1LVA A;  1SMT A;  3HUG A;  1IXS B;  2XUB A;  5E8G A;  1E17 A;  1G4D A;  3GWZ A;  3ECH A;  3H92 A;  4ESF A;  3D0S A;  5HS8 A;  1XDS A;  1F1Z A;  1OYY A;  2Q8K A;  2PEX A;  1UB9 A;  5CVI A;  3P9C A;  2EJR A;  4HX8 A;  1FY7 A;  1KYW A;  3WTS C;  2ZME B;  2DTR A;  2CQK A;  1ZG5 A;  1TNS A;  1HXD A;  3CDH A;  3GUD A;  6PAX A;  3FMR A;  2IA1 A;  1B6A A;  3RPQ A;  1I6X A;  1KA8 A;  3WTW C;  1Q1H A;  2FML A;  3LAJ A;  5LBQ A;  3MWM A;  4QLC U;  3FMS A;  1TLH B;  1USS A;  3ZMZ A;  2BE5 F;  2ZNY A;  2YPR A;  3I0T A;  3I59 A;  2Z3Y A;  2LNB A;  1ONV A;  4EQQ A;  4OU0 A;  2CWE A;  2VXZ A;  1ODD A;  5BMZ A;  1XMA A;  4G94 A;  2DPD A;  3LAP A;  4XBF A;  5E17 F;  5JFR A;  4IRI A;  2XRN A;  5EEG A;  2IT0 A;  2EV0 A;  1IN4 A;  3GFI A;  4R1H A;  1R22 A;  3I5U A;  1RZ4 A;  4UNO A;  3RKY A;  2UXN A;  4I02 A;  2A3S A;  3J81 Z;  2BV6 A;  1U5T A;  5F6F A;  2KJC A;  4FHT A;  3I64 A;  4LLN A;  4IRH A;  2ELH A;  4KYW A;  4DQ2 A;  2WC2 A;  3V8L A;  4OMY A;  1QBJ A;  2VBY A;  2Q2E A;  1KU7 A; 
#chains in the Genus database with same CATH topology
 1SD6 A;  2LH9 A;  2F5D A;  1QRY A;  4BY7 J;  1ZGW A;  2DFH A;  3SEZ A;  4RAG A;  4GDF A;  1SFU A;  3K7A J;  5DM7 F;  4E7K A;  3I3L A;  4FTH A;  2XGX A;  1WWX A;  1Y0U A;  3FBN B;  2JK3 A;  4WWC A;  1CF7 B;  4ZJZ A;  4EJW A;  2DN0 A;  4G9Y A;  3SDB A;  4NUB A;  2M4K A;  1W4M A;  4KT6 A;  2DOA A;  1Y39 A;  3W2W A;  2PJR B;  2L7M P;  1H0M A;  1E3P A;  4HST A;  1U78 A;  1REP C;  1R1U A;  4ZZD A;  5HNF A;  2CO5 A;  2K85 A;  4GXO A;  3CC2 I;  5F64 A;  3DU5 A;  1AKH A;  3K1P A;  2HKO A;  3OS1 A;  3ASN H;  4XLE A;  2ECC A;  4HPQ A;  3F6O A;  2GXA A;  2Z99 A;  3WTY C;  2ID6 A;  2OBP A;  4HV6 A;  4M6V A;  1TTY A;  2MD5 A;  4BY1 J;  3RKW A;  2ZJ2 A;  3WHB A;  3MMY B;  4XLH A;  3CQZ J;  1VQP I;  5IYD J;  4BJT A;  4CDG A;  1B1B A;  1X2M A;  1ZGA A;  4PK4 A;  5K1Y A;  4FE7 A;  3MZH A;  4WXH A;  2ESH A;  2OJE D;  5F0C A;  3TO7 A;  3U21 A;  1RIO H;  2CUZ A;  3LSH A;  4Y3O A;  3FHN A;  3I58 A;  4N4O B;  3MKZ A;  4UUS A;  2KRH A;  2OU2 A;  2YR2 A;  4V2F A;  1HW1 A;  3E6M A;  4RAF A;  3OYK A;  3CCV I;  3S15 J;  5JR3 A;  3VFZ A;  1ZVV J;  3G3Z A;  1S7O A;  2O7O A;  2XPW A;  5M5W J;  3BR5 A;  1SD7 A;  3BG7 A;  4I98 B;  2DA3 A;  1YHQ I;  5E8I A;  5HLT A;  2LC2 A;  4MO7 A;  3IHU A;  4PJN A;  1IN5 A;  3J7Y J;  1IDY A;  1JTY A;  1RNL A;  2VPL A;  1ETY A;  3C2B A;  3HHH A;  2ICW G;  3IH2 A;  4HX7 A;  4MFE A;  3W6J B;  3BRO A;  2DT5 A;  1MIJ A;  2F5C A;  4RM2 A;  1X3W B;  4BHP A;  4A3D J;  4IVN A;  1WJB A;  3ZRG A;  3Q0V A;  4XOT A;  4U7D A;  5GAH J;  3L00 A;  1LQ1 A;  5ILU A;  1JHF A;  3BCB A;  4EJV A;  2KIM A;  1V55 H;  5D8K B;  1D1A A;  3K1M A;  4LJZ F;  4PJM A;  2HID A;  1PFH A;  3H3Z A;  2MYS A;  3QU3 A;  1QZY A;  1ETQ A;  2V4J C;  4Q4Z F;  1N78 A;  1ZHF A;  3OYH A;  3KP7 A;  3EZE B;  2HEO A;  2HI3 A;  5H6R A;  2FA5 A;  2HOA A;  3KFW X;  1T8I A;  2DPU A;  2E2J J;  1M1E B;  2X51 A;  4E7L A;  1W7P A;  4UY8 I;  2Z9O A;  3BP8 A;  4MEY F;  3LSG A;  1ZG3 A;  3OWT A;  2LRE A;  1FTT A;  2VQH A;  2XGD A;  1SD5 A;  4R8H A;  3BT9 A;  1U2W A;  3OIO A;  5GAG J;  5L3F A;  1P4X A;  4B3A A;  3G71 I;  3RKX A;  1R5H A;  1P4W A;  1YRN B;  2QSF X;  5D4R A;  1FOW A;  3F21 A;  1B8I A;  4JK1 X;  3H0G J;  2JA7 J;  1WQ2 A;  4XK4 A;  4B8X A;  1KZH A;  1UCR A;  3GVA A;  3ZQF A;  1PVE A;  2ZCW A;  2QSH X;  2RLZ A;  1MJB A;  5K5R A;  3T8T A;  2CQX A;  2M30 A;  4XOR A;  2DLL A;  2GLO A;  3A1Y A;  5LD2 C;  1LEB A;  1TW3 A;  4QSH A;  4MFD A;  3I59 B;  1U9N A;  2TRT A;  1NG6 A;  1FYL A;  4XKW A;  3MEX A;  4M3G A;  3JRE A;  2CUF A;  1OR7 C;  2HR3 A;  3KEO A;  3SHF A;  5FRM A;  3BR6 A;  1OCZ H;  4PSX A;  3ZQL A;  5A2Q K;  2ME6 A;  2QQ9 A;  5BOX A;  3HRU A;  2JQ7 A;  4CYC B;  3LE5 A;  2CW8 A;  4QWQ A;  3HGY A;  2XVC A;  4I01 A;  1SFE A;  1Y51 A;  1RKT A;  2JPC A;  2VOD A;  2A07 F;  4XKB A;  1CQT A;  3K0L A;  2E1O A;  3P9K A;  1KKM H;  2W85 A;  3TP0 A;  4KIG A;  4QPO A;  3QP6 A;  1X19 A;  3F0C A;  2CYY A;  3OSF A;  1T2K A;  3HOS A;  3K9T A;  3DV8 A;  4GGG A;  3RIR A;  3K69 A;  4ASN A;  2P5V A;  3F6V A;  3HXL A;  1G2H A;  5C4X J;  1PUF B;  2HQN A;  2XAG A;  4CCJ A;  2IAI A;  1APL C;  3L2U A;  1FSH A;  3BG9 A;  5H2F C;  3IH4 A;  1N75 A;  2HQA A;  2F5F A;  3WGG A;  1ZR4 A;  1RUN A;  1T95 A;  4KIT B;  4A93 J;  2XAU A;  1U5T B;  2B0L A;  3P9I A;  1YS7 A;  3ABK H;  4E4H A;  4IRG A;  1OFC X;  1MBG A;  3LSJ A;  5CJ9 A;  2F4O B;  5HDG A;  3A0B C;  3CMY A;  2KIF A;  3EUH C;  4BEH B;  5BQT A;  3HJE A;  2HXO A;  5F0F A;  1D5Y A;  1R5I D;  4CXF A;  1HDD C;  2QWW A;  4UVB A;  1X3Z B;  3J7Z I;  2QQB A;  2ZME C;  4KN4 X;  5E1Z B;  5H20 A;  2OD5 A;  3S1R J;  2LVS A;  3WGI A;  2FSW A;  2DCE A;  2Q2E B;  5C4J J;  1LNW A;  2DK5 A;  1DPU A;  2KHM A;  3G1O A;  4XKV A;  3PIP F;  3OL4 A;  2WTE A;  5LHI A;  3RSN A;  3LA2 A;  3MQ0 A;  2ZXH A;  4OOI A;  3KET A;  3EPZ A;  2N8G A;  3QOE A;  5FJ8 J;  1K78 B;  2NNY A;  2KFD A;  4J01 A;  2DDA A;  2CFX A;  4TV7 A;  2UZK A;  2GXG A;  1WI9 A;  3JRF A;  1P92 A;  1IN6 A;  2MA3 A;  3ECO A;  3ASO H;  4BHB A;  1JE8 A;  5M3M J;  1B59 A;  1HCR A;  4RGX A;  2AHQ A;  1SC7 A;  4HDV A;  4IHY A;  2K9N A;  4IQ4 A;  2A6H F;  3V8J A;  1PJR A;  3X2Q H;  3ZP5 A;  1MND A;  1VQ6 I;  4FQG A;  1NH3 A;  4BE2 A;  2DT6 A;  3OL3 A;  5IP6 A;  2ISZ A;  1TWH J;  2OEN L;  1AKH B;  4LG3 A;  1GUU A;  1VI0 A;  3ZQG A;  2HKX A;  2BHZ A;  2EIK H;  2IGO A;  3MCZ A;  2XKP A;  5BNG A;  1CM3 A;  5CQE A;  4AIJ A;  3I71 A;  3CTA A;  4F55 A;  4HSR A;  1U0J A;  2E5Z A;  2KJB A;  4P9F A;  4ANJ A;  3JRB A;  4U88 A;  4BAC A;  2R7X A;  4DZJ A;  2MC3 A;  3BJO A;  4UB6 C;  4S05 A;  3TW7 A;  1DGR M;  2H27 A;  4XNF A;  2XSD C;  4BQN A;  3FDY A;  3DP7 A;  4G12 A;  3L2R A;  1ERD A;  2XB5 A;  1K7A A;  3I55 I;  1O3Q A;  3K4M A;  3GZ6 A;  3C1D A;  4P1W A;  5J1U A;  1ZRE A;  2W57 A;  5HVQ C;  3LNW A;  1SMY F;  3GFL A;  4H4K C;  1WKM A;  3OYG A;  2DBB A;  3HGG A;  2IA2 A;  2KIU A;  2YSR A;  2KIS A;  2JEL P;  1VQ8 I;  2HGC A;  1Z77 A;  2FOW A;  3VYS B;  4CUG A;  2XKO A;  1BL0 A;  1MD0 A;  3L2W A;  2R5Y A;  4ZTJ A;  3AKZ A;  1TBX A;  2CRG A;  4HLY A;  1YS6 A;  3ZQC A;  4BJ5 C;  3WG9 A;  2EZK A;  3KZZ A;  2UWM A;  1UZC A;  3OYD A;  3FKJ A;  3FXU A;  4E7H A;  1YO5 C;  4DW6 A;  1QPM A;  4CSW A;  2CFO A;  2OZ6 A;  3KPH A;  4LD5 A;  2HVR A;  4RS8 A;  2G9W A;  5EEA A;  5F1J A;  1FT9 A;  1S8N A;  4CIC A;  1RUO A;  2E7X A;  1I3Q J;  2OZU A;  2ZFU A;  2FJ1 A;  3M4O J;  4RB2 C;  1W7P B;  3BZ6 A;  2CGP A;  1FIP A;  1OLT A;  1VTN C;  3FKI J;  4AU7 A;  2EH3 A;  4L0Y B;  2HYJ A;  4CZZ A;  2P7V B;  2R7T A;  1BR1 A;  5CVV A;  1MMN A;  5FKO A;  3GTK J;  2XPU A;  3MD2 A;  2HDD A;  2QLZ A;  2VT3 A;  4UHT A;  2DA6 A;  2EK5 A;  5IOY A;  2M0C A;  2VBX A;  2W00 A;  2R7U A;  3CCS I;  3BJ6 A;  4R79 A;  2KRC A;  2OTL I;  5GAE J;  3RPU D;  1QU3 A;  1XC5 A;  5T17 A;  1N25 A;  5DD8 A;  4D7N A;  2EWN A;  5E18 F;  1O3R A;  1E0E A;  3K1N A;  1G3S A;  4HLX A;  2HPM A;  2AXL A;  2V1X A;  2E2I J;  3J7A O;  2VXD A;  3HTU A;  4IQJ A;  1BR4 A;  5HLI A;  3DPT A;  5B5E C;  3C7J A;  2V6E A;  1BBY A;  2IVM A;  2M2E A;  2KP6 A;  3LSM A;  4Y13 A;  3ZR8 X;  3BR2 A;  5KVR A;  3OYF A;  2X6X A;  2IS1 A;  5E3M A;  5CVU A;  1STZ A;  2EB7 A;  3SJM A;  2COM A;  4RB1 A;  4NB5 A;  4KIF A;  3VYR B;  1VQL I;  2QKM B;  3HOT A;  4BYY A;  5ILV A;  1OCT C;  2HXI A;  3NWS A;  2Y69 H;  2PMH A;  2VJI A;  5D8L B;  4M6X A;  3DWL E;  1GV5 A;  4U0V A;  4ABZ A;  5F0H A;  4CCN A;  3E6C C;  1VQM I;  4BHC A;  4U0W A;  3S2W A;  3IKT A;  2CMP A;  1XCV A;  1ULY A;  3DBR B;  2ZSH B;  3JAM K;  4A6E A;  5EZG A;  3GEZ A;  3F8C A;  3GLL A;  1BC8 C;  4XSX F;  4P9U A;  2KZG A;  3E6D A;  2F4M B;  1ZLK A;  4IHV A;  3FIS A;  4NC8 A;  1MBH A;  3PQJ A;  2LFB A;  4AC0 A;  2UXX A;  1S29 A;  2FOK A;  5IT9 K;  1DU6 A;  4NBQ A;  1SAU A;  4C3I J;  3TO6 A;  1I6H J;  4IF4 A;  2LBF A;  1Z67 A;  2EFO A;  1T98 A;  2IA0 A;  2DFF A;  3GZ5 A;  2XGC A;  2VE9 A;  2E2H J;  4A5N A;  1W5T A;  4LK1 F;  5GPA A;  2OF7 A;  4A3L J;  3S1N J;  4P5O A;  3TBI A;  3ULQ B;  1ZAR A;  3DTE A;  2VKV A;  1UMQ A;  4XLC A;  1FBU A;  2VQG A;  3EYY A;  2E71 A;  2NS7 A;  3SQN A;  4D0P A;  1UHW A;  1QQI A;  1V3F A;  2K4B A;  4MGR A;  3ZCO A;  3S1Q J;  2IXS A;  2JRT A;  4HNT A;  1XN7 A;  2LKS A;  2MLK A;  1FZP B;  3CP8 A;  3LA7 A;  4A0Z A;  4D9J A;  1XSV A;  4ZDP A;  5EDN A;  2DQL A;  3R0J A;  1O7F A;  4W97 A;  5F1R A;  1HLV A;  5F04 A;  1XCB A;  1DP7 P;  3FXR A;  3CCL I;  3TED A;  4N4N B;  1T08 B;  1WHU A;  1YIT I;  2KMU A;  4XLA A;  4WCG A;  2M7A A;  2WAD A;  4JX5 A;  4CA0 A;  3HRM A;  4AWX B;  4FT8 A;  1BOA A;  2M3A A;  4UV8 A;  3KE2 A;  3FXO A;  3W6V A;  3CJN A;  3BR0 A;  5FKN A;  2HTJ A;  3AG2 H;  4LOC A;  3SZG A;  1ZRF A;  1B72 A;  2YU9 J;  3AL0 B;  2OPT A;  2JSP A;  2M45 A;  2MBF A;  3KZY A;  4BQA A;  3VYT B;  2R93 J;  3J80 Z;  4UUT A;  3F8B A;  3GTO J;  4A0Y A;  4HQE A;  5AON A;  1IRX A;  2COB A;  1WGX A;  3EZB B;  3WU1 B;  3Q0U A;  2R0Q C;  5B1B H;  4B1R A;  3K4K A;  1YE9 A;  5K5Q A;  3OY9 A;  3HOX J;  5CKT A;  1BOB A;  2XAS A;  2VIX A;  2VT2 A;  4RBO A;  2EFN A;  1FWZ A;  1K4T A;  1OYI A;  1DUX C;  3JRH A;  4A3B J;  1ZQ3 P;  3BR1 A;  1Z7L A;  2VC0 A;  2WA0 A;  1HKS A;  1A6I A;  2Z33 A;  1T38 A;  3T5X A;  3IWF A;  2NZU L;  3SXY A;  4KNY A;  1FMW A;  2G7U A;  5F08 A;  3HIF A;  3E3V A;  4ZYH A;  2RVC A;  2BW3 A;  2GQQ A;  2CU7 A;  3IAS 2;  3VSK A;  1D1B A;  3V7R A;  4FIS A;  2RN7 A;  4CCK A;  1IUF A;  2WAE A;  1OKR A;  1SVM A;  2DXI A;  1A35 A;  2PLY A;  4HZF A;  1J75 A;  1W0U A;  1GDT A;  2E1C A;  2VBZ A;  4M3E A;  3QOP A;  1Y50 A;  4C2M J;  2IS6 A;  1MGT A;  4EM2 A;  3GW2 A;  3TP3 A;  3CCM I;  3C18 A;  1U5T C;  4XIC A;  5IP9 J;  2R5Y B;  1V54 H;  1MZB A;  3K10 A;  4DYC A;  5TGT A;  2PX9 A;  1R5G A;  1QO0 D;  5FRN A;  3KYD B;  4CCM A;  3ML6 A;  5E3O A;  3WTU C;  1N77 A;  1JHH A;  2R7W A;  3S8P A;  2ZNZ A;  2OTJ I;  2X6Y A;  2DA1 A;  2E5N A;  1R1T A;  5HLG A;  2EA4 A;  2DJI A;  1QFR A;  5J1R A;  1MSE C;  2W25 A;  1JGG A;  1E3O C;  4AIK A;  2VC1 A;  4GYG A;  1H89 C;  2EIJ H;  3I4P A;  1WCM J;  2AO9 A;  1FOY A;  5FFX A;  4LB5 A;  1MMS A;  1Z7U A;  1S7A A;  1Y6I A;  4BJ6 C;  4PUS A;  4A12 A;  2H1L A;  4IZZ A;  4F93 B;  3CF5 F;  3OYA A;  1R49 A;  1P6R A;  2YUS A;  2CQQ A;  1TT5 B;  3TOA A;  3VOD A;  4M3B A;  2M0M A;  1IG7 A;  1VQN I;  3O6B B;  4UB8 C;  1ENH A;  3QYF A;  2ZJQ F;  4UVA A;  2ECB A;  1Z05 A;  3G73 A;  4NQW A;  4XON A;  4DOZ A;  2FMY A;  4PSW A;  3M07 A;  4PCQ A;  4KMF A;  1S5L C;  2MG4 A;  3ZGK A;  2VJ5 A;  2ZJP F;  1IDZ A;  3FXL A;  5DCM B;  2QF7 A;  4MTD A;  4ZDO A;  2RQQ A;  4IO9 F;  1YFH A;  1HKQ A;  3RZD J;  3E1S A;  1JEM A;  1MNE A;  2HQR A;  3DFG A;  2E60 A;  3R60 A;  4BDZ A;  1K6Y A;  4ZYG A;  4HG2 A;  5LLQ A;  3CME I;  1BI3 A;  2M7B A;  2YX7 A;  1LEA A;  2CH0 A;  4PDK A;  5LGU A;  2WV0 A;  3F23 A;  2O03 A;  3A03 A;  2OC6 A;  3CP2 A;  4BL0 B;  5GAD J;  5A2Q Z;  3VB2 A;  3RJP A;  3M7G A;  4JOM A;  3L7W A;  1Z3Y A;  5D4S A;  3UNG C;  2LY9 A;  3BCA A;  1UG0 A;  1IXC A;  1UHM A;  4BQO A;  3CO7 C;  3ZMT A;  2FQ3 A;  1F9N A;  1MBJ A;  1S6L A;  1ON2 A;  2AQE A;  2LRK D;  1R7J A;  3ZQQ A;  3DEE A;  1D0Y A;  1FMV A;  2XV4 S;  1VND A;  5FD5 A;  3K2Z A;  4E7I A;  3G2B A;  4DBQ A;  2X1E A;  1TC3 C;  5M5Y J;  4LMY A;  2QGU A;  1Z21 A;  3OQO D;  2X1D A;  3OYL A;  1OPC A;  1MH4 A;  1BI1 A;  3DQV C;  1H8A C;  1Y8Q B;  2E1M B;  2O6G E;  3GME A;  1LPQ A;  1MBK A;  2RV8 A;  4QIW N;  1FBS A;  4HNU A;  1POH A;  3Q9S A;  2KL4 A;  1WH7 A;  3J7A Y;  1P7J A;  3MN2 A;  5J1Y A;  3N97 A;  1YJN I;  2LBF B;  2QUF A;  1Z9C A;  2DW4 A;  2ESN A;  3OQN D;  3HZJ A;  1XX5 A;  3RI4 A;  4NC6 A;  4BBR J;  2KDZ A;  1DDN A;  2F2E A;  4ESB A;  1B9N A;  4M9Z A;  3ZQ7 A;  2XPV A;  3M1C A;  5J47 A;  3DKW A;  3EDP A;  3WU2 C;  4BAY A;  5DDG A;  3GFJ A;  4II2 A;  3FXJ A;  1POG A;  2K9S A;  2LY2 A;  3D5L A;  5L3G A;  3WOD F;  1EH7 A;  5HOD A;  4BU2 A;  1HA8 A;  1W36 D;  1I1S A;  2JA6 J;  1QR5 A;  1XSX A;  1MKM A;  5M3F J;  2K27 A;  3R0A A;  1YIJ I;  5IYB J;  1HF0 A;  1U8R A;  1YW7 A;  3HUG B;  3HEF A;  1YYV A;  4XSZ F;  2PMU A;  3D5S C;  1VQ5 I;  3K2A A;  3KCC A;  4F92 B;  5DCF A;  2NXN B;  4A3K J;  1IO2 A;  1XD7 A;  3OYM A;  2CV1 A;  4I0B A;  1B72 B;  3BR3 A;  1G3Y A;  1L0O C;  4RAY A;  3LL7 A;  1MO1 A;  1IUY A;  2GIV A;  1YI2 I;  1VFC A;  1SVL A;  1BN5 A;  4C9Y A;  3CCQ I;  2LD5 A;  1FEX A;  1ZLJ A;  2DMP A;  4EAT A;  1QZZ A;  3IP4 B;  4FE4 A;  1X58 A;  1GVD A;  1K83 J;  2M1B A;  4FCY A;  3BZK A;  2L01 A;  2CW0 F;  5DS9 A;  1X1B A;  5IOZ A;  3WG7 H;  3MZY A;  3J81 K;  3RZO J;  3RQI A;  2NRA C;  5E3N A;  2BY3 A;  4LG0 A;  2P4W A;  3CLQ A;  3WTZ A;  5GPC A;  2P0W A;  2STT A;  1GVJ A;  2X85 A;  1MH3 A;  4LLG F;  3IRQ A;  3OS0 A;  1IC8 A;  4RLF A;  3GTL J;  1S3J A;  2WY8 Q;  1HW5 A;  2H94 A;  2LOO A;  5E1W A;  1B4A A;  4EJO A;  1HKT A;  3M9A A;  2HQ5 A;  2WV1 A;  5L3D A;  1XGM A;  4N9H A;  3G6E I;  4B47 A;  2L3D A;  5J40 A;  4A3M J;  2RQP A;  2ACJ A;  1TQP A;  2DMU A;  1XMK A;  2ADU A;  4D7M A;  4OAY A;  1TWF J;  3NRV A;  2QVO A;  4PFP A;  4EM0 B;  1UHS A;  1W7P D;  5HLH A;  1ETK A;  4HW0 A;  2JUC A;  3CES A;  4OWR B;  2WAQ N;  1JUM A;  2CV2 A;  4OIQ F;  1DGW Y;  1Z6T A;  3L9F A;  2CUE A;  2OCE A;  1IGN A;  3JCU C;  4IHW A;  3KLN A;  1EF4 A;  3IWZ A;  4B3X A;  4M73 A;  4KA4 A;  4ZYE A;  1SEU A;  3K4N A;  5LFA A;  4GO1 A;  2DA4 A;  5JVT A;  1TL8 A;  3M8F A;  1MBF A;  4A3E J;  3TDU C;  5EG0 A;  5HNH A;  5IT3 A;  2K9L A;  5CVR A;  2ZBK A;  3V7S A;  1AHD P;  4GCV A;  2XF5 A;  2R7S A;  1RET A;  3O8H A;  2JT1 A;  2F48 A;  3OV8 A;  3KZI C;  3LQQ A;  3GYH X;  1J59 A;  1J5Y A;  3QYE A;  2O3F A;  4I09 A;  5E20 A;  3B02 A;  3IH3 A;  4BH9 A;  4XRM A;  1DP3 A;  2EZI A;  2XC7 A;  2FXA A;  3W3C A;  2ZFW A;  2FNA A;  5L3B A;  1FPQ A;  2FBK A;  3I54 A;  1UFM A;  2RC4 A;  2Z5U A;  2K02 A;  3LST A;  4LIU A;  2VQL A;  1JJ6 C;  1K79 A;  1TW2 A;  3H9G A;  2R7V A;  5L3E A;  1JKP C;  1V5G A;  2IJL A;  5L3C A;  1WI3 A;  2ZSI B;  2M4G A;  5FD6 A;  3PSI A;  1K61 A;  2EZH A;  3AL0 C;  3PNT A;  3SZP A;  5IY5 H;  3V8K A;  5B66 C;  3CD6 I;  4M3F A;  4U0Y A;  3F3X A;  4UVC A;  2BZT A;  2K9Q A;  3QQA A;  2NAZ A;  1J0R A;  2FBI A;  2JZY A;  1TQI A;  5FO5 A;  2PFB A;  3ISP A;  4LB6 B;  2CW7 A;  2QBY A;  3ZQH A;  2IGK A;  5DTD A;  4NQW B;  1PTF A;  5T1O A;  2HVS A;  2IGM A;  1WJ5 A;  1A04 A;  3OR1 C;  2BY2 A;  2EA2 A;  4KT5 C;  2IP2 A;  4IOC F;  2OQG A;  1R00 A;  3CMM A;  4CZC A;  3GTJ J;  5H6Q A;  2K3F A;  5D6F A;  1JKQ C;  4I2O A;  3AFH A;  2H09 A;  3GTM J;  2PMZ A;  5CVJ A;  1R23 A;  2R4G A;  2QEN A;  2OV7 A;  1JI8 A;  5JI6 A;  2K4J A;  2Y9Z A;  3B73 A;  1MSF C;  2QEX I;  3GXO A;  3PL8 A;  3PO2 J;  2L4A A;  1S7E A;  4X1E A;  4MEX F;  2P5L C;  2XAF A;  1SAX A;  1QHG A;  3BWG A;  1CM2 A;  4EM1 A;  1Z3X A;  3M1E A;  4DBR A;  5K7Z A;  2CJJ A;  4Y4R A;  2XF6 A;  4YFX F;  1P4A A;  1D0X A;  1W5C C;  3RDI A;  3WU0 A;  4FAS D;  1JKR C;  3BTJ A;  3E7L A;  2FBH A;  3DTK A;  1YQA A;  4XOP A;  3MAJ A;  4EJU A;  5FKM A;  4WF2 A;  3JAM Z;  5EZH A;  3U9G A;  3K4B A;  3EYI A;  1R36 A;  1D8J A;  2P81 A;  5ICE A;  1D5V A;  3PSF A;  4C30 A;  1YJW I;  3PUF A;  2W82 A;  4WXC A;  3PNY A;  5TIS C;  5JHF A;  1F5T A;  3GFM A;  1X2N A;  3ZOB A;  3ZMS A;  4UUS B;  2VON A;  1C0W A;  1U8B A;  2J5O A;  3HRS A;  2DOE A;  4JX6 A;  2R5Z A;  3GTQ J;  1PP8 F;  4L9T A;  1IRG A;  1LFB A;  1I5Z A;  3EUK L;  2I10 A;  3M8J A;  2V9P A;  2DK8 A;  4X6A J;  4YIF A;  1WVR A;  1NTC A;  3LSI A;  3OR2 C;  1ZN2 A;  2DI3 A;  3UR3 C;  1EV7 A;  2VJJ A;  1ETV A;  3DTI A;  4B4C A;  1LB2 A;  2D5V A;  4Q5S F;  4RMN A;  5BPI A;  1LKX A;  4G8X A;  3O3K A;  2FQ4 A;  2DO7 A;  2LSO A;  2GXB A;  2EQR A;  2Z16 A;  3GTP J;  1WZ2 A;  1Z91 A;  1MMA A;  3JSO A;  1J09 A;  4RB0 A;  3QRF F;  1Y4Y A;  3FZV A;  1ETW A;  2A5W A;  2I8D A;  2MSY A;  2OA4 A;  3DKX A;  1TT0 A;  4IJA A;  2L02 A;  3R6S A;  3VSL A;  3HTS B;  1KU3 A;  4E6K G;  1FYM A;  2VOO A;  2JRM A;  2LRD A;  4ZZL A;  3CC7 I;  1IZ1 A;  4UV9 A;  4IXA A;  2W48 A;  2MLG A;  3BJA A;  4PGG A;  2V9V A;  1V5E A;  2NS8 A;  4XN0 A;  4CYD A;  1RPW A;  3IC7 A;  3ESW B;  2AK7 A;  2YX4 A;  3H9Q A;  3SEQ A;  5DUK A;  4X0G A;  3KIO A;  1FSE A;  2HOT A;  2E19 A;  2DA7 A;  4Y17 A;  2D45 A;  1FYK A;  1NHA A;  3Q0W A;  4XM3 A;  2W4S A;  1KQ8 A;  2EFP A;  3CF2 A;  4B44 A;  4CCL A;  4YEL A;  1XGO A;  4U87 A;  4DJA A;  1D3Y A;  5DM6 F;  2BYV E;  3PQK A;  5FB2 A;  3OOU A;  2DMT A;  1IJW C;  4FX0 A;  3TOB A;  4QTR A;  2UUZ A;  1UEL B;  2KKO A;  4PFO A;  1Y1W J;  1SD4 A;  4Y52 J;  4ZDL A;  1T0F A;  1GXQ A;  3PFI A;  2FD5 A;  1Z1D A;  4I0A A;  3E5Q A;  2VJ4 A;  4IHS A;  2X9D A;  3VDX A;  3F8M A;  1B8I B;  3GLX A;  1JUP A;  2O0Y A;  3P5J A;  1VQ7 I;  4LG0 B;  5LGN A;  4M9X A;  2FUG 2;  5D5V B;  5FLM J;  1W5S A;  3OYE A;  3I53 A;  2E34 A;  3CZ6 A;  4A0X A;  2LDU A;  4HF2 A;  1XB4 A;  1AWC A;  1HDP A;  3IKV A;  4Q48 A;  1K4S A;  4KFC A;  5FFZ A;  2LTP A;  1ORK A;  4BE1 A;  2B9S A;  2I5U A;  1BM9 A;  1I1G A;  2Y48 A;  5C3E J;  1T6S A;  1FP1 D;  5FKL A;  2MFZ A;  2JA5 J;  1MDM A;  4A3J J;  2GA1 A;  2MH9 A;  4YIR X;  4NC7 A;  3F8N A;  1NK2 P;  2F5E A;  3CC4 I;  1NK3 P;  3BC8 A;  2QQ8 A;  3IL2 A;  2FU4 A;  4L9V A;  3P7N A;  1Y8R B;  5T1N A;  2IBD A;  1CGP A;  4Q47 A;  3D5R C;  3MVP A;  3RCO A;  3DPL C;  5KK1 A;  3A2K A;  4A6D A;  2XDF C;  3DU6 A;  3H3V K;  1AOY A;  2LMD A;  1SAN A;  2R7F A;  2DMN A;  3HOZ J;  3B6A A;  3CUQ A;  3PFY A;  2B63 J;  3FBI B;  1HW2 A;  3RKQ A;  3QPS A;  4XRF A;  2L0K A;  2YU3 A;  3ABT A;  3S3M A;  3ZPL A;  2G7H A;  2OUM A;  3TGN A;  2ZO4 A;  3C2G A;  3CCJ I;  1YW9 A;  2WB1 A;  1WFX A;  3TW6 A;  4P55 A;  3UKG A;  4RM3 A;  3G1M A;  1BW5 A;  1BW6 A;  1BJZ A;  3BQY A;  3OMY A;  1PUE E;  3W2A A;  2BHY A;  5KAF C;  1XSD A;  1IW7 F;  3S3N A;  3CMA I;  2TDX A;  4RDU A;  3E5U A;  5EEH A;  2R3S A;  1T39 A;  2XB0 X;  5CLS A;  1D8K A;  4PJL A;  1QVT A;  5KNL A;  1H88 C;  3QP5 A;  1AU7 A;  4KIB A;  3LSP A;  1LJ9 A;  4E70 A;  3SDG A;  1I39 A;  2EV5 A;  1GT0 C;  1FTZ A;  4S04 A;  4L5E A;  2WAQ A;  1IXR C;  5DYM A;  3FMQ A;  4G7Z F;  3AG3 H;  3EQL F;  2HNH A;  4B48 A;  2QBY B;  2L9N A;  2RNG A;  3HB9 A;  4EMS A;  2BXZ A;  1EKE A;  3V7C A;  2STW A;  3DCF A;  1LDD A;  4BDY A;  3E5X A;  3SYT A;  3ZXS A;  3GCM A;  1OCR H;  1UG2 A;  1D1C A;  4A2U A;  4II3 A;  3SZT A;  4M72 A;  4GYI A;  4EV0 A;  2G0E A;  2V6C A;  2V79 A;  3U2R A;  3DBH B;  3OYB A;  2K5C A;  4AVP A;  5F27 A;  1FIA A;  2ETH A;  1D0Z A;  3B6C A;  2LF8 A;  2W84 A;  2BY0 A;  3KYC B;  4XRS A;  2GA2 A;  2FNP A;  2BVL A;  3S93 A;  1RRJ A;  1S72 I;  2DA2 A;  2K7L A;  3DBL B;  2QM3 A;  2A05 A;  1SFK A;  3COA C;  1A5J A;  2DU9 A;  3PO3 J;  1YG2 A;  2B7E A;  2LF7 A;  3KEQ A;  3IAM 2;  4YII A;  4AID A;  4B09 A;  2KQR A;  1RR8 C;  1OYW A;  5IP7 J;  3DLL F;  1JUS A;  1WJC A;  2A5Y B;  2HPR A;  4LGW A;  2HOS A;  1YX5 A;  3L2Q A;  2EFW A;  4BNC A;  1FOX A;  1R4N B;  2JJ7 A;  1ZR2 A;  3CUO A;  4WX9 A;  1BC7 C;  5LEK A;  4MIM A;  3LA3 A;  1QA6 A;  3HOW J;  2Y31 A;  2IW5 A;  5GTI C;  3NAR A;  4M3D A;  3LFK A;  5CQG A;  1HDN A;  1W0T A;  2ZXI A;  3LWF A;  4HA8 A;  4AD9 A;  4ENK A;  2EFQ A;  2LG4 A;  4ENJ A;  2DFI A;  1TWG J;  3JRI A;  3ELK A;  3HSR A;  5TRD A;  2V1U A;  4HBL A;  1BJA A;  1K6O A;  4K2E A;  2JPB A;  1ETX A;  1X3U A;  2ZKZ A;  1YRN A;  2R5Z B;  2MAB A;  5JHU A;  4G7H F;  1VQO I;  5C44 J;  4UUV A;  2PQ8 A;  4BXX J;  2GOX B;  4M9S A;  3JTG A;  1S9H A;  2H6B A;  1LDK B;  2PBI A;  1LFP A;  1FBQ A;  5FLX K;  2PJP A;  3HG9 A;  2VL8 A;  3CCY A;  5LGT A;  1FX7 A;  2RKH A;  4KMU X;  5KAI C;  3JR9 A;  2V9K A;  1KYZ A;  1BI0 A;  3FK6 A;  2EIL H;  5D5U B;  5AIQ A;  4JQF A;  3G4S I;  3WGH A;  4E7J A;  2L4M A;  4W1U A;  4CO8 A;  3BTC A;  2PMZ N;  1G3W A;  2VPR A;  1VF9 A;  4HQM A;  1YJ9 I;  3RTR A;  4XWJ B;  3AAF A;  1P7I A;  3QPT A;  4V2G A;  1IN7 A;  5B1A H;  4LK0 F;  1QGP A;  2DQR A;  3ONQ A;  4KJZ A;  2JN6 A;  2XHK A;  1YTY A;  4OIR F;  2M9H A;  4JP0 A;  3HL2 A;  1HC8 A;  4ENN A;  2LP0 A;  2BY1 A;  1LDJ A;  2E35 A;  2XAH A;  1WJA A;  2NS0 A;  2OAZ A;  5ICC A;  3F8F A;  1FC3 A;  1KON A;  4F7Z A;  5JLX A;  3DLA A;  4IPA A;  5LRR A;  4RB3 C;  1QZE A;  3GO5 A;  3NEU A;  1PP7 U;  1TWA J;  2Y9Y A;  2Q1Z B;  2GAU A;  2E7W A;  1PUF A;  4AIH A;  5ED4 A;  4H0E A;  2XRO A;  4XN3 A;  3HPG A;  4L9J A;  1HST A;  5K7F A;  5BS6 A;  1EJ9 A;  3LE1 A;  4PGH A;  2HZT A;  5HDK A;  2CUJ A;  3L2V A;  2KT0 A;  2GIZ A;  1HQC A;  4F3Q A;  3EUA A;  4V19 K;  1BR2 A;  2KPM A;  1W36 C;  4L5I A;  3REO A;  1SPH A;  4OAZ A;  3MKW B;  2PI0 A;  3OYJ A;  4GFB A;  4HRI A;  2O61 A;  3DEW A;  2JTV A;  2FRH A;  4AYB A;  2M5W A;  4P96 A;  4NDL A;  1KKL H;  2W24 A;  2HU9 A;  3V42 A;  4WK8 F;  3ERE D;  1P9Q C;  1RES A;  1MDM B;  3CJT B;  3KX2 A;  3WTT C;  3GF2 A;  2L9V A;  2A68 F;  2IS4 A;  3BZC A;  3R4K A;  5KHD A;  2HTS A;  3JTH A;  5D5W B;  3GX4 X;  4EVI A;  2P6S A;  1R9T J;  1J6T B;  1K78 A;  2EPF A;  1JXS A;  1ZAO A;  3F9K A;  2VBW A;  2X48 A;  1ETO A;  2KLO A;  3CJR B;  1ZRD A;  4XRS G;  3J80 K;  4N0B A;  3WE2 A;  4ZTF A;  1PDN C;  1MBE A;  2H1K A;  3CUQ B;  3QYB A;  3JSP A;  4O5V A;  1U6G A;  1X1D A;  3FXQ A;  2DYS H;  3U1D A;  4ZH4 F;  3LFG A;  1KGS A;  1ZK8 A;  4HF1 A;  1WJD A;  1TZL A;  2HPI A;  2VN2 A;  3G1L A;  1Z0X A;  2AS5 F;  1U9O A;  1RKW A;  2HVQ A;  1ITY A;  2KDO A;  3ABL H;  4ITV A;  1XMX A;  4E7S A;  2V1D A;  4ENM A;  4RAZ A;  4PJ0 C;  3BG5 A;  4MTE A;  2K3P A;  3LMM A;  2L7Z A;  5EF6 A;  3H5R A;  2F5V A;  4LFU A;  4DNC A;  3K4L A;  3KLO A;  1OIS A;  3CCR I;  1SFO J;  2VUM J;  2M87 A;  2DT7 B;  5M5X J;  3BDD A;  3S17 J;  2X4H A;  3GZN B;  4HYE A;  2Z2S B;  3IRR A;  4AVZ A;  2D1V A;  1R58 A;  2P5K A;  4EEF G;  2IS2 A;  2CG4 A;  3KEY A;  5JVG F;  1FU0 A;  4BUP A;  3QPH A;  2LRL D;  1XTA A;  4YFK F;  2MC4 A;  3HHG A;  2Y0M A;  3ZN1 A;  3CDI A;  2ISY A;  3H5A A;  2O9L A;  4C2U A;  2R7O A;  3TDZ C;  1VRC C;  2HOE A;  5IPA A;  3FM5 A;  2QZ8 A;  3IUO A;  4I6Z A;  3JRG A;  3H9J A;  3Q3S A;  3D1N I;  3HDD A;  2QKL B;  4O3M A;  4ZC3 A;  4XLF A;  4IEJ A;  4RGS A;  1BI2 A;  2BGC A;  4LIV A;  3VOE A;  2DOD A;  3HBL A;  4HNV A;  4Y33 A;  1Y1V J;  5EYR A;  2R7Z J;  5FLV A;  2VI6 A;  1K1C A;  1OMI A;  4YFN F;  1HBX G;  2Y30 A;  3QAH A;  1T56 A;  4XKC A;  4L9N A;  4PJJ A;  4BE0 A;  2Y2Z A;  3OYC A;  5CYV A;  5J3L A;  1KU9 A;  1XGN A;  4MQV A;  1MMD A;  1J2X A;  2WB1 N;  2EV6 A;  1G3T A;  1KQ9 A;  2CSO A;  4WXD A;  2HDC A;  1WRJ A;  1A6Q A;  1ZH5 A;  3IHS A;  1Y56 A;  4JYK A;  1IAW A;  3K6G A;  4Z6Y A;  3BTL A;  2EBI A;  2WBM A;  3FHZ A;  3K70 C;  3CLO A;  3QU6 A;  3W6K B;  3I56 I;  4AM3 A;  1R6R A;  1F43 A;  1IRZ A;  3S2H J;  1E3H A;  1UST A;  3I9V 2;  1XG1 A;  4QPQ A;  1YW8 A;  3T1B A;  2JVH A;  5J4Y A;  3DKY A;  3CO6 C;  1IV6 A;  3C3W A;  4CHU A;  3BPV A;  4G6D A;  4XR6 A;  2BW3 B;  4M74 A;  5J8C A;  1FNN A;  3Q9V A;  4KIS A;  3LQR A;  4XL9 A;  3BG3 A;  2M34 A;  4PZJ A;  3OS2 A;  4M6Y A;  5DV5 A;  4CGZ A;  3GTG J;  2GZW A;  4U7B A;  2VKH A;  3CCD A;  1NG7 A;  2A6E F;  1V4R A;  2XAJ A;  2W1O A;  5BPD A;  2LY1 A;  3QOD A;  4LIT A;  2NYX A;  3T0Y A;  4XID A;  3VYU B;  3LOC A;  5TJJ A;  3FX3 A;  2NOJ B;  5J4V A;  4XMY A;  3HYI A;  5E3L A;  2VKE A;  5AIP A;  3CCE I;  1ZGJ A;  1P2F A;  2V7F A;  1VQ9 I;  5EGO A;  5ICF A;  3ZMU A;  1I27 A;  3N4M A;  3H3U A;  2V1N A;  1WJF A;  3FK7 A;  3H0D A;  2H6C A;  3L2C A;  2LR8 A;  2FEZ A;  3H5N A;  5J6X A;  4HDU A;  5GTH C;  3NQO A;  2D1H A;  4BXU A;  2NNN A;  2Z1D A;  2OQR A;  2XAQ A;  1U3E M;  3ROU A;  1HSJ A;  3W2V A;  2D2W A;  2FF4 A;  1PYV A;  1OR7 A;  1O7L A;  1O3S A;  5HOO A;  3HSE A;  2VB6 A;  1FJL A;  1JGS A;  3FM3 A;  3HKZ N;  5E1X A;  3BQZ A;  5FKK A;  3DF8 A;  1SFX A;  3HOV J;  2AQF A;  2DFE A;  2VE8 A;  2TCT A;  4BS9 A;  4JX4 A;  2O5R A;  5ICG A;  3K70 D;  2RRE A;  2E1N A;  1R1V A;  3ZN0 A;  4DZP A;  2PN6 A;  2BEO A;  4AUX A;  5K5O A;  4A3G J;  1WJE A;  5GP9 A;  3KYL A;  4BXF A;  1ZRC A;  2O8X A;  3QWL A;  2MD0 A;  2R92 J;  1AA7 A;  3OSG A;  2R7R A;  1I50 J;  5J8F A;  4I76 A;  5HS7 A;  4ZYA A;  3VPR A;  4RGU A;  1OPD A;  3TL4 X;  4G7O F;  1WPK A;  3WTX C;  1ACI A;  2DYR H;  3F22 A;  4OMZ A;  3S32 A;  2RAE A;  3JW4 A;  2X0L A;  3TQN A;  2ZJR F;  3ERM A;  2Q0O A;  1ZEL A;  4A3C J;  2ID3 A;  1LUJ B;  1EA3 A;  4KN7 X;  3NWT A;  3S3O A;  3HC7 A;  2UV1 A;  1LE8 A;  5ILS A;  2F4I A;  2K40 A;  3V4G A;  1DQU A;  2FE3 A;  2DAO A;  4BQQ A;  4LLL A;  4BKX A;  4L0Z B;  3EUH A;  2M8E A;  3BPX A;  4JBA A;  3VEP A;  1J7K A;  3Q5F A;  4OIP F;  3U1K A;  2F6C A;  2ZME A;  4Y15 A;  1H9T A;  2NVT J;  2LYC A;  3LSK A;  4IOA F;  2Y75 A;  2JVG A;  1SVO A;  2IPQ X;  1W1W E;  3C2H A;  4HF0 A;  1Y0N A;  2GBY A;  2P6T A;  5D5X B;  4A5M A;  5IT9 Z;  2FX0 A;  2L5Q A;  3JRC A;  3I4M J;  1OCP A;  2Y0S N;  1DU0 A;  4DIQ A;  3FIW A;  5HS9 A;  2GM4 A;  1LVK A;  1X1P A;  4IKF A;  1Q1V A;  1J9I A;  2RDP A;  2DMQ A;  4M71 A;  3OYN A;  2JA8 J;  2H8R A;  2R7D A;  2JUG A;  1FLI A;  1GLN A;  4C3H J;  2ZXJ A;  1IRF A;  1KU2 A;  1LFU P;  1JT6 A;  3O2P E;  1H9G A;  1YOV B;  1XPX A;  4ESJ A;  4AYB N;  1TWC J;  1ZYR F;  2ZB9 A;  1T0F C;  4ETS A;  2ELJ A;  3H1C A;  1Z6R A;  3M8E A;  2WY7 Q;  3RYR A;  3KP2 A;  3FXK A;  1TNT A;  2PG4 A;  2IRF G;  3S14 J;  1WSU A;  4ON0 A;  4OIO F;  3E6B A;  4KIC A;  1ZTR A;  2J5P A;  1JTX A;  3KP3 A;  4NHJ A;  1GHC A;  1DPR A;  3LFU A;  1QPI A;  1WH5 A;  3A01 A;  3RPU A;  2C6Y A;  2QCO A;  1BA5 A;  3OOP A;  3IV5 A;  3BOQ A;  1O57 A;  1KQ0 A;  2A6T A;  3E97 A;  4ZYD A;  1MO1 B;  3T8R A;  1FP2 A;  4FX4 A;  1X4O A;  4DGW B;  1O3T A;  1ON1 A;  2VLA A;  2XIG A;  1EH6 A;  5D6E A;  2HYG D;  3ZMD A;  5FRO A;  2M8G X;  2JA2 A;  4J00 A;  3R61 A;  3ABU A;  4Z2Y A;  2VOP A;  4I99 C;  2W7N A;  3RQ4 A;  4YEJ A;  2L7F P;  4EGY A;  1BIB A;  3OYI A;  1MW7 A;  2O8K A;  3RYP A;  4C3J J;  3WTV C;  4EJT A;  5FGM A;  2X1C A;  4E7Z A;  4RLQ A;  2L9R A;  2RNJ A;  3WE3 A;  2L7K A;  1X1C A;  3OIP A;  2P7C B;  3L09 A;  1VQK I;  2XGE A;  4MNU A;  3DEU A;  4OIN F;  1R4M B;  2P8T A;  2FEP S;  4G6Q A;  3KP5 A;  4HX4 A;  1YIO A;  3CUQ C;  4HEA 2;  1RI7 A;  2L54 A;  3H35 A;  2NVQ J;  4HOB A;  5DUI A;  2BXY A;  1XGS A;  2ME0 A;  1F4K A;  3ZMV A;  3FF5 A;  2K9M A;  2RGV A;  2LKP A;  1MJA A;  5E79 C;  2E1M C;  2JSC A;  3F72 A;  4IL6 C;  1TQM A;  2K86 A;  2HWV A;  3L1P A;  3MFK A;  1TP4 A;  3ZQI A;  5DCM A;  4MQ9 F;  3SFZ A;  2NOG A;  4EGZ A;  3LE3 A;  3S1M J;  2EIN H;  1YLF A;  3KP6 A;  5FLX Z;  1E2X A;  2HYF A;  4HV5 A;  1JT0 A;  2MH2 A;  5HDN A;  2R7Q A;  5LHG A;  1ZG1 A;  1EH8 A;  2HDW A;  3AG4 H;  1RZR L;  1OJL A;  4L18 B;  3K4C A;  4MHG A;  1CF7 A;  5EG0 B;  4CCO A;  5K7H A;  3TO9 A;  4XLN F;  1G8X A;  1MMG A;  1UJ8 A;  1B9M A;  2PJR A;  1MNM C;  5EGO B;  1G6N A;  2HS5 A;  2L9S A;  1VQ4 I;  5DEQ A;  4HAM A;  4RGR A;  4DYQ A;  1X4P A;  4KDP A;  3A4C A;  1QNT A;  3EET A;  2EIM H;  3JRA A;  3HSF A;  3BY6 A;  1IN8 A;  2KIQ A;  2GWR A;  4A3I J;  1GXP A;  1R71 A;  2QQA A;  2A61 A;  2DTZ A;  4N9I A;  2JWT A;  2ELK A;  3FXM A;  3HM5 A;  5LRS A;  1X1A A;  4GRI A;  1L3L A;  2NVU B;  1FOK A;  1I3A A;  3BLY A;  4MLO A;  1XDU A;  5IYC J;  2QA4 I;  4B43 A;  5LEJ A;  2AXT C;  4D5F A;  2BBY A;  1JJ8 C;  2HFH A;  4UXN A;  1MJ9 A;  1IF1 A;  3S2D J;  1OCO H;  1BIA A;  3QPL A;  3HRT A;  1UAA A;  2YS9 A;  4IHT A;  3FWE A;  4XLP F;  1QHH D;  5LHH A;  2HZD A;  5DD4 A;  4DYR A;  1ZKG A;  2ZXW H;  4I7H A;  3GBG A;  3DXJ F;  3I4N J;  1G59 A;  3OQM D;  2NVY J;  3TKY A;  4L5J A;  5ERI A;  3MKL A;  3PIO F;  2QYO A;  4YG2 F;  2DJN A;  2X6W A;  2XSJ C;  2WWY A;  4KUM A;  3HPH A;  2A69 F;  3CCU I;  2LKX A;  1O4X A;  1T33 A;  4O6J A;  4XQF A;  2XF7 A;  3KP4 A;  2E36 A;  2KRF A;  1LVA A;  2ZC2 A;  1A36 A;  3N05 A;  1F36 A;  1SMT A;  3ABM H;  3HUG A;  1IXS B;  4F91 B;  1MU4 A;  3S16 J;  2XUB A;  5E8G A;  2QSG X;  4IHX A;  1KA5 A;  1E17 A;  3O8G A;  1G4D A;  3GWZ A;  4C2T A;  3ECH A;  3H92 A;  4ESF A;  3D0S A;  2VKD A;  5EJC A;  5CPR B;  4A3F J;  3VWB A;  2BOL A;  5HS8 A;  1LE8 B;  1XDS A;  2BVM A;  3CDL A;  5B3S H;  1F1Z A;  3A02 A;  4CH7 A;  1OYY A;  2CS3 A;  2MGQ A;  2Q8K A;  3CJQ B;  2PEX A;  1UB9 A;  5CVI A;  4YRV A;  2IGN A;  3H36 A;  1GV2 A;  3P9C A;  2EJR A;  3HKZ A;  4HX8 A;  1FY7 A;  1KYW A;  3E0J B;  1RC9 A;  4D5C A;  3WTS C;  2ZME B;  2DTR A;  4J19 A;  3HOY J;  2CQK A;  2MW8 A;  4F52 A;  2XDV A;  1ZG5 A;  1TNS A;  1HXD A;  3CDH A;  2WAF A;  3GUD A;  1XS9 A;  6PAX A;  3FMR A;  2CQ7 A;  2IA1 A;  1B6A A;  3RPQ A;  1I6X A;  1KA8 A;  3WTW C;  1Q1H A;  2FML A;  3K4J A;  3LAJ A;  5LBQ A;  3MWM A;  4Y7N J;  4QLC U;  3NAU A;  1RR7 A;  3FMS A;  2NVX J;  3MZ8 A;  1TLH B;  4BBS J;  1USS A;  5KCM A;  3ZMZ A;  1V5F A;  2LLK A;  2BE5 F;  2ZNY A;  2YPR A;  3I0T A;  3DPU A;  3I59 A;  2Z3Y A;  2LNB A;  9ANT A;  2XRL A;  3AG1 H;  2CV0 A;  3MKY B;  1JKO C;  1ONV A;  2KZV A;  4EQQ A;  1GGR B;  2DOF A;  3BTI A;  3BG6 A;  4G6T B;  4CYC A;  4OU0 A;  2VAS A;  4RA2 A;  3TMO A;  2CWE A;  2VXZ A;  4BGD A;  2EZL A;  5JLW A;  3PM1 A;  3A01 B;  1ODD A;  5BMZ A;  1XMA A;  4G94 A;  2DPD A;  2CQN A;  3A0H C;  3M3Y J;  3LAP A;  4XBF A;  5E17 F;  1TXE A;  5JFR A;  2L2O A;  4IX7 A;  1YX3 A;  3PJR A;  4IRI A;  3OIQ A;  1VZ0 A;  2XRN A;  4FET A;  5EEG A;  2IT0 A;  2EV0 A;  1IN4 A;  4S0H B;  3LSR A;  3GFI A;  4R1H A;  1R22 A;  2Y0S A;  1RZ4 A;  3I5U A;  4UNO A;  4D1Q A;  2GOM A;  2IEK A;  3RKY A;  1OQY A;  2UXN A;  4I02 A;  1PCH A;  2V26 A;  2OCC H;  2A3S A;  2NZV L;  3SFI A;  3J81 Z;  3EZA B;  2BV6 A;  1U5T A;  5F6F A;  2KJC A;  4FHT A;  3I64 A;  4LLN A;  1HOM A;  4IRH A;  2ELH A;  4KYW A;  3PNV A;  1QVU A;  4BEH A;  4DQ2 A;  2WC2 A;  3WHC A;  4A69 C;  1A31 A;  4NNJ A;  3V8L A;  4OMY A;  2DA5 A;  1QBJ A;  2VBY A;  3LNQ A;  2LK2 A;  2VQC A;  1IV8 A;  2JMW A;  2H8W A;  3PUB A;  1OCC H;  2X6O A;  3JRD A;  3HOU J;  2DDB A;  2Q2E A;  1KU7 A; 
#chains in the Genus database with same CATH homology
 1SD6 A;  2F5D A;  1SFU A;  2XGX A;  1WWX A;  1Y0U A;  4WWC A;  1CF7 B;  4EJW A;  4G9Y A;  1W4M A;  1H0M A;  1U78 A;  1REP C;  1R1U A;  4ZZD A;  2CO5 A;  4GXO A;  5F64 A;  3K1P A;  2HKO A;  3F6O A;  2Z99 A;  3WTY C;  2OBP A;  4HV6 A;  1TTY A;  2MD5 A;  3RKW A;  2ZJ2 A;  4CDG A;  1B1B A;  1ZGA A;  5K1Y A;  3MZH A;  4WXH A;  2ESH A;  3TO7 A;  1RIO H;  3I58 A;  2OU2 A;  2YR2 A;  1HW1 A;  3E6M A;  5JR3 A;  3VFZ A;  3G3Z A;  1S7O A;  1SD7 A;  4I98 B;  5E8I A;  3IHU A;  1IN5 A;  1RNL A;  3HHH A;  4HX7 A;  3W6J B;  3BRO A;  2DT5 A;  2F5C A;  4BHP A;  4IVN A;  4U7D A;  3L00 A;  1LQ1 A;  5ILU A;  1JHF A;  4EJV A;  2KIM A;  5D8K B;  4LJZ F;  3K1M A;  3H3Z A;  3QU3 A;  1QZY A;  4Q4Z F;  1ZHF A;  3KP7 A;  2HEO A;  5H6R A;  2FA5 A;  3KFW X;  2DPU A;  1W7P A;  2Z9O A;  3BP8 A;  4MEY F;  1ZG3 A;  1SD5 A;  4R8H A;  1U2W A;  5L3F A;  1P4X A;  3RKX A;  1P4W A;  1R5H A;  5D4R A;  3F21 A;  4JK1 X;  1WQ2 A;  4B8X A;  1UCR A;  3GVA A;  2ZCW A;  1MJB A;  5K5R A;  3T8T A;  2M30 A;  2DLL A;  1LEB A;  1TW3 A;  3I59 B;  1FYL A;  3MEX A;  2HR3 A;  3KEO A;  3SHF A;  5A2Q K;  2QQ9 A;  5BOX A;  3HRU A;  4QWQ A;  2XVC A;  4I01 A;  1SFE A;  2JPC A;  2VOD A;  2A07 F;  3K0L A;  3P9K A;  2W85 A;  4KIG A;  3QP6 A;  2CYY A;  1T2K A;  3HOS A;  3K9T A;  3DV8 A;  4GGG A;  3RIR A;  3K69 A;  4ASN A;  2P5V A;  3F6V A;  2HQN A;  2XAG A;  1FSH A;  2F5F A;  3WGG A;  1RUN A;  1U5T B;  2B0L A;  3P9I A;  1YS7 A;  4IRG A;  5CJ9 A;  5HDG A;  2KIF A;  5BQT A;  4CXF A;  2QWW A;  4UVB A;  2QQB A;  4KN4 X;  5E1Z B;  5H20 A;  2OD5 A;  3WGI A;  2FSW A;  1DPU A;  1LNW A;  2DK5 A;  2WTE A;  5LHI A;  3LA2 A;  3MQ0 A;  4OOI A;  3KET A;  1K78 B;  2NNY A;  2CFX A;  4TV7 A;  2UZK A;  2GXG A;  1WI9 A;  1P92 A;  1IN6 A;  2MA3 A;  3ECO A;  4BHB A;  1JE8 A;  1B59 A;  4RGX A;  4HDV A;  2A6H F;  3V8J A;  3ZP5 A;  2ISZ A;  2HKX A;  3MCZ A;  2XKP A;  4AIJ A;  3I71 A;  3CTA A;  2KJB A;  4P9F A;  4U88 A;  2MC3 A;  3BJO A;  4S05 A;  2H27 A;  3DP7 A;  1K7A A;  1O3Q A;  3GZ6 A;  3C1D A;  1ZRE A;  2W57 A;  5HVQ C;  1SMY F;  3GFL A;  1WKM A;  2DBB A;  2IA2 A;  2KIU A;  2YSR A;  2HGC A;  2XKO A;  1MD0 A;  1TBX A;  4HLY A;  1YS6 A;  3WG9 A;  3KZZ A;  2UWM A;  3FXU A;  1YO5 C;  1QPM A;  2OZ6 A;  4LD5 A;  4RS8 A;  2G9W A;  1FT9 A;  1S8N A;  4CIC A;  1RUO A;  2E7X A;  2OZU A;  4RB2 C;  1W7P B;  3BZ6 A;  2CGP A;  1VTN C;  4L0Y B;  4CZZ A;  2P7V B;  5CVV A;  2QLZ A;  2VT3 A;  4UHT A;  2EK5 A;  2VBX A;  3BJ6 A;  4R79 A;  5DD8 A;  2EWN A;  5E18 F;  1O3R A;  3K1N A;  1G3S A;  4HLX A;  2AXL A;  2V1X A;  3J7A O;  3HTU A;  5HLI A;  3DPT A;  3C7J A;  1BBY A;  2IVM A;  4Y13 A;  5KVR A;  5CVU A;  1STZ A;  2EB7 A;  2COM A;  4RB1 A;  4NB5 A;  4KIF A;  3HOT A;  4BYY A;  5ILV A;  2PMH A;  5D8L B;  4M6X A;  3E6C C;  4U0V A;  4BHC A;  4U0W A;  3S2W A;  3IKT A;  1XCV A;  1ULY A;  3JAM K;  4A6E A;  3GEZ A;  3F8C A;  1BC8 C;  4XSX F;  4P9U A;  3E6D A;  1ZLK A;  3PQJ A;  2UXX A;  1S29 A;  2FOK A;  5IT9 K;  3TO6 A;  4IF4 A;  2EFO A;  1T98 A;  2IA0 A;  3GZ5 A;  2VE9 A;  4A5N A;  1W5T A;  4LK1 F;  4P5O A;  3ULQ B;  1ZAR A;  3SQN A;  1FBU A;  4D0P A;  3EYY A;  1UHW A;  1QQI A;  1V3F A;  2K4B A;  4MGR A;  2JRT A;  1XN7 A;  2MLK A;  1FZP B;  3LA7 A;  4A0Z A;  1XSV A;  2DQL A;  3R0J A;  1O7F A;  5F1R A;  1XCB A;  1DP7 P;  3FXR A;  4WCG A;  3HRM A;  4AWX B;  4FT8 A;  1BOA A;  4UV8 A;  3KE2 A;  3CJN A;  2HTJ A;  1ZRF A;  2M45 A;  2MBF A;  3KZY A;  4BQA A;  3J80 Z;  3F8B A;  4A0Y A;  4HQE A;  5AON A;  3WU1 B;  5K5Q A;  2XAS A;  2VT2 A;  2EFN A;  1FWZ A;  1OYI A;  1DUX C;  2VC0 A;  1HKS A;  2Z33 A;  1T38 A;  3T5X A;  3IWF A;  3SXY A;  4KNY A;  2G7U A;  3HIF A;  3E3V A;  4ZYH A;  2RVC A;  2GQQ A;  3V7R A;  2RN7 A;  1OKR A;  2PLY A;  4HZF A;  1J75 A;  2E1C A;  2VBZ A;  3QOP A;  1MGT A;  4EM2 A;  3GW2 A;  3C18 A;  1U5T C;  1MZB A;  1R5G A;  1QO0 D;  3ML6 A;  3WTU C;  1JHH A;  2ZNZ A;  1R1T A;  5HLG A;  2EA4 A;  2W25 A;  4AIK A;  2VC1 A;  4GYG A;  3I4P A;  5FFX A;  4LB5 A;  1Z7U A;  1S7A A;  4A12 A;  1P6R A;  3TOA A;  3VOD A;  3O6B B;  4UVA A;  1Z05 A;  3G73 A;  4NQW A;  2FMY A;  4PCQ A;  4KMF A;  5DCM B;  4MTD A;  1YFH A;  1HKQ A;  2HQR A;  3DFG A;  3R60 A;  4ZYG A;  5LLQ A;  1BI3 A;  4PDK A;  2YX7 A;  1LEA A;  5LGU A;  2WV0 A;  3F23 A;  2O03 A;  5A2Q Z;  3VB2 A;  3RJP A;  3M7G A;  3L7W A;  5D4S A;  1IXC A;  1UHM A;  3CO7 C;  3ZMT A;  2FQ3 A;  1F9N A;  1S6L A;  1ON2 A;  1R7J A;  2XV4 S;  5FD5 A;  3K2Z A;  4LMY A;  1OPC A;  1BI1 A;  3DQV C;  2O6G E;  2RV8 A;  1FBS A;  3Q9S A;  3N97 A;  2QUF A;  1Z9C A;  2DW4 A;  2ESN A;  3RI4 A;  1DDN A;  2F2E A;  4ESB A;  1B9N A;  4M9Z A;  3ZQ7 A;  3DKW A;  3EDP A;  4BAY A;  5DDG A;  3GFJ A;  3D5L A;  5L3G A;  3WOD F;  1EH7 A;  1I1S A;  1XSX A;  1MKM A;  2K27 A;  3R0A A;  1U8R A;  1YW7 A;  1YYV A;  4XSZ F;  2PMU A;  3KCC A;  5DCF A;  1XD7 A;  4I0B A;  1G3Y A;  1L0O C;  4RAY A;  1IUY A;  2GIV A;  1BN5 A;  1ZLJ A;  1QZZ A;  2M1B A;  2L01 A;  2CW0 F;  3MZY A;  3J81 K;  2NRA C;  4LG0 A;  2P4W A;  3WTZ A;  2STT A;  1GVJ A;  4LLG F;  3IRQ A;  1S3J A;  1HW5 A;  2H94 A;  5E1W A;  1B4A A;  4EJO A;  1HKT A;  3M9A A;  5L3D A;  1XGM A;  4N9H A;  2L3D A;  2RQP A;  2ACJ A;  1TQP A;  1XMK A;  2ADU A;  3NRV A;  2QVO A;  4EM0 B;  1W7P D;  5HLH A;  4HW0 A;  4OIQ F;  1Z6T A;  3L9F A;  3KLN A;  3IWZ A;  4M73 A;  4KA4 A;  4ZYE A;  4GO1 A;  5JVT A;  3M8F A;  3TDU C;  5IT3 A;  5CVR A;  2ZBK A;  3V7S A;  4GCV A;  2JT1 A;  3OV8 A;  3LQQ A;  3GYH X;  1J59 A;  1J5Y A;  2O3F A;  4I09 A;  5E20 A;  3B02 A;  4BH9 A;  2FXA A;  2ZFW A;  2FNA A;  5L3B A;  1FPQ A;  2FBK A;  3I54 A;  1UFM A;  2RC4 A;  2Z5U A;  2K02 A;  3LST A;  1K79 A;  1TW2 A;  5L3E A;  2IJL A;  5L3C A;  5FD6 A;  3SZP A;  3V8K A;  4U0Y A;  3F3X A;  4UVC A;  2NAZ A;  1J0R A;  2FBI A;  2JZY A;  1TQI A;  5FO5 A;  2PFB A;  3ISP A;  4LB6 B;  2QBY A;  1A04 A;  2EA2 A;  4KT5 C;  2IP2 A;  2OQG A;  1R00 A;  5H6Q A;  5D6F A;  4I2O A;  2H09 A;  5CVJ A;  1R23 A;  2QEN A;  5JI6 A;  2K4J A;  3B73 A;  3GXO A;  2L4A A;  4MEX F;  2P5L C;  2XAF A;  1SAX A;  3BWG A;  4EM1 A;  3M1E A;  4YFX F;  1P4A A;  3RDI A;  3WU0 A;  2FBH A;  1YQA A;  4EJU A;  3MAJ A;  4WF2 A;  3JAM Z;  3U9G A;  3EYI A;  1D8J A;  1R36 A;  5ICE A;  1D5V A;  4WXC A;  1F5T A;  3GFM A;  3ZMS A;  2VON A;  1C0W A;  2J5O A;  3HRS A;  1PP8 F;  4L9T A;  1IRG A;  1I5Z A;  2DK8 A;  4YIF A;  1ZN2 A;  2DI3 A;  1EV7 A;  1LB2 A;  4Q5S F;  5BPI A;  4G8X A;  3O3K A;  2DO7 A;  2LSO A;  2GXB A;  1Z91 A;  3JSO A;  3QRF F;  4RB0 A;  3FZV A;  4IJA A;  3R6S A;  2OA4 A;  2L02 A;  3HTS B;  1KU3 A;  1FYM A;  2VOO A;  4ZZL A;  1IZ1 A;  4UV9 A;  4IXA A;  3BJA A;  2MLG A;  4PGG A;  4CYD A;  2V9V A;  3IC7 A;  2YX4 A;  5DUK A;  1FSE A;  4Y17 A;  2D45 A;  1FYK A;  1NHA A;  1KQ8 A;  2EFP A;  1XGO A;  1D3Y A;  2BYV E;  3PQK A;  5FB2 A;  4FX0 A;  3TOB A;  2KKO A;  1SD4 A;  1T0F A;  1GXQ A;  3PFI A;  1Z1D A;  4I0A A;  3E5Q A;  4IHS A;  3F8M A;  3GLX A;  2O0Y A;  4LG0 B;  5LGN A;  4M9X A;  5D5V B;  1W5S A;  3I53 A;  4A0X A;  2LDU A;  4HF2 A;  1XB4 A;  1AWC A;  3IKV A;  4Q48 A;  4KFC A;  5FFZ A;  1BM9 A;  1I1G A;  2Y48 A;  1T6S A;  1FP1 D;  1MDM A;  2GA1 A;  2MH9 A;  3F8N A;  2F5E A;  3IL2 A;  2FU4 A;  4L9V A;  3P7N A;  1CGP A;  4Q47 A;  5KK1 A;  3DPL C;  4A6D A;  1AOY A;  2R7F A;  3CUQ A;  1HW2 A;  4XRF A;  2YU3 A;  3ABT A;  3ZPL A;  2G7H A;  3TGN A;  2ZO4 A;  1YW9 A;  4P55 A;  1PUE E;  1XSD A;  1IW7 F;  2TDX A;  3E5U A;  5EEH A;  2R3S A;  1T39 A;  5CLS A;  1D8K A;  3QP5 A;  4KIB A;  1LJ9 A;  4E70 A;  2EV5 A;  4S04 A;  1IXR C;  5DYM A;  3FMQ A;  4G7Z F;  3EQL F;  2QBY B;  4EMS A;  3V7C A;  2STW A;  1LDD A;  3E5X A;  4A2U A;  3SZT A;  4M72 A;  4GYI A;  4EV0 A;  2V6C A;  2V79 A;  3U2R A;  4AVP A;  2ETH A;  2LF8 A;  2W84 A;  2GA2 A;  2FNP A;  2K7L A;  2QM3 A;  3COA C;  2DU9 A;  1YG2 A;  2LF7 A;  3KEQ A;  4B09 A;  4YII A;  1OYW A;  2A5Y B;  4LGW A;  4BNC A;  2EFW A;  3CUO A;  4WX9 A;  1BC7 C;  5LEK A;  3LA3 A;  2IW5 A;  3LFK A;  3LWF A;  4HA8 A;  4AD9 A;  4ENK A;  2EFQ A;  4ENJ A;  2DFI A;  3ELK A;  3HSR A;  5TRD A;  2V1U A;  4HBL A;  1BJA A;  1K6O A;  4K2E A;  2JPB A;  1X3U A;  2ZKZ A;  5JHU A;  4G7H F;  4UUV A;  2PQ8 A;  4M9S A;  3JTG A;  2H6B A;  1LDK B;  2PBI A;  1FBQ A;  5FLX K;  2PJP A;  5LGT A;  1FX7 A;  2RKH A;  4KMU X;  1KYZ A;  1BI0 A;  5D5U B;  5AIQ A;  4JQF A;  3WGH A;  2L4M A;  4CO8 A;  1G3W A;  4HQM A;  3RTR A;  3AAF A;  3QPT A;  1IN7 A;  4LK0 F;  1QGP A;  2DQR A;  1YTY A;  2XHK A;  4OIR F;  4ENN A;  1LDJ A;  2XAH A;  2NS0 A;  2OAZ A;  5ICC A;  3F8F A;  1FC3 A;  4F7Z A;  4IPA A;  4RB3 C;  5LRR A;  3NEU A;  3GO5 A;  1PP7 U;  2GAU A;  2E7W A;  4AIH A;  5ED4 A;  4H0E A;  2XRO A;  4L9J A;  1HST A;  5BS6 A;  4PGH A;  2HZT A;  5HDK A;  1HQC A;  4L5I A;  3REO A;  2PI0 A;  2O61 A;  2JTV A;  2FRH A;  2M5W A;  4P96 A;  2W24 A;  4WK8 F;  3ERE D;  1MDM B;  3WTT C;  3GF2 A;  2A68 F;  3R4K A;  2HTS A;  3JTH A;  5D5W B;  3GX4 X;  4EVI A;  2P6S A;  1K78 A;  1JXS A;  1ZAO A;  2VBW A;  1ZRD A;  3J80 K;  4N0B A;  3WE2 A;  1PDN C;  3CUQ B;  3JSP A;  4O5V A;  1U6G A;  3FXQ A;  3U1D A;  4ZH4 F;  1KGS A;  4HF1 A;  2VN2 A;  2AS5 F;  4ENM A;  2V1D A;  4RAZ A;  4MTE A;  4LFU A;  4DNC A;  3KLO A;  2M87 A;  3BDD A;  2X4H A;  4HYE A;  3IRR A;  2D1V A;  1R58 A;  2P5K A;  2CG4 A;  3QPH A;  4YFK F;  3HHG A;  2Y0M A;  3ZN1 A;  2ISY A;  3TDZ C;  2HOE A;  3FM5 A;  2QZ8 A;  4O3M A;  4RGS A;  1BI2 A;  2BGC A;  3VOE A;  1OMI A;  4YFN F;  1HBX G;  3QAH A;  4L9N A;  5CYV A;  1KU9 A;  1XGN A;  4MQV A;  1J2X A;  2EV6 A;  1G3T A;  1KQ9 A;  2CSO A;  4WXD A;  2HDC A;  1WRJ A;  1ZH5 A;  1IAW A;  3FHZ A;  3CLO A;  3QU6 A;  3W6K B;  1UST A;  1YW8 A;  3T1B A;  3CO6 C;  3C3W A;  4CHU A;  3BPV A;  4G6D A;  5J8C A;  4M74 A;  1FNN A;  3Q9V A;  3LQR A;  4PZJ A;  4M6Y A;  5DV5 A;  4CGZ A;  2GZW A;  4U7B A;  2A6E F;  5BPD A;  1V4R A;  2XAJ A;  2NYX A;  3T0Y A;  5TJJ A;  3FX3 A;  3HYI A;  5AIP A;  1ZGJ A;  1P2F A;  5ICF A;  3ZMU A;  1I27 A;  3N4M A;  3H3U A;  2H6C A;  3L2C A;  4HDU A;  2FEZ A;  5J6X A;  3NQO A;  2D1H A;  4BXU A;  2NNN A;  2OQR A;  2XAQ A;  1U3E M;  3ROU A;  1HSJ A;  2D2W A;  2FF4 A;  1OR7 A;  1O7L A;  1O3S A;  5HOO A;  3HSE A;  1JGS A;  3FM3 A;  5E1X A;  3DF8 A;  1SFX A;  2VE8 A;  5ICG A;  2E1N A;  1R1V A;  3ZN0 A;  2PN6 A;  2BEO A;  5K5O A;  1ZRC A;  2O8X A;  5J8F A;  5HS7 A;  4RGU A;  4G7O F;  3WTX C;  3F22 A;  4OMZ A;  3JW4 A;  2X0L A;  3TQN A;  2Q0O A;  4KN7 X;  5ILS A;  3V4G A;  2FE3 A;  2DAO A;  4LLL A;  4L0Z B;  3EUH A;  2M8E A;  3BPX A;  4JBA A;  3VEP A;  1J7K A;  3Q5F A;  4OIP F;  2ZME A;  4Y15 A;  1H9T A;  2Y75 A;  2IPQ X;  4HF0 A;  5D5X B;  2P6T A;  4A5M A;  5IT9 Z;  5HS9 A;  1J9I A;  2RDP A;  4M71 A;  2R7D A;  1FLI A;  2ZXJ A;  1IRF A;  1KU2 A;  3O2P E;  1H9G A;  4ESJ A;  4ETS A;  1ZYR F;  1Z6R A;  3M8E A;  3RYR A;  3KP2 A;  1TNT A;  2PG4 A;  2IRF G;  1WSU A;  4ON0 A;  4OIO F;  3E6B A;  4KIC A;  3KP3 A;  2J5P A;  4NHJ A;  1GHC A;  1DPR A;  2C6Y A;  3RPU A;  3OOP A;  3BOQ A;  1O57 A;  1KQ0 A;  3E97 A;  4ZYD A;  3T8R A;  1FP2 A;  4FX4 A;  1O3T A;  1ON1 A;  2XIG A;  1EH6 A;  5D6E A;  2HYG D;  3ZMD A;  3R61 A;  3ABU A;  4Z2Y A;  2VOP A;  4EGY A;  1BIB A;  3RYP A;  3WTV C;  4EJT A;  5FGM A;  2RNJ A;  3WE3 A;  2P7C B;  3L09 A;  4MNU A;  3DEU A;  4OIN F;  2P8T A;  4G6Q A;  3KP5 A;  4HX4 A;  1YIO A;  3CUQ C;  1RI7 A;  2L54 A;  4HOB A;  5DUI A;  1XGS A;  1F4K A;  3ZMV A;  3FF5 A;  2RGV A;  2LKP A;  1MJA A;  3F72 A;  2JSC A;  1TQM A;  2K86 A;  2HWV A;  3MFK A;  5DCM A;  4MQ9 F;  3SFZ A;  4EGZ A;  3KP6 A;  1YLF A;  5FLX Z;  1E2X A;  2HYF A;  4HV5 A;  2MH2 A;  5HDN A;  5LHG A;  1ZG1 A;  1EH8 A;  4L18 B;  4MHG A;  1CF7 A;  3TO9 A;  4XLN F;  1B9M A;  1G6N A;  2HS5 A;  5DEQ A;  4HAM A;  4RGR A;  4KDP A;  1QNT A;  3EET A;  3HSF A;  3BY6 A;  1IN8 A;  2GWR A;  1GXP A;  2QQA A;  2A61 A;  4N9I A;  5LRS A;  1L3L A;  1FOK A;  1XDU A;  5LEJ A;  2BBY A;  2HFH A;  4UXN A;  1MJ9 A;  1IF1 A;  1BIA A;  3HRT A;  4IHT A;  3FWE A;  4XLP F;  5LHH A;  5DD4 A;  4I7H A;  3DXJ F;  3TKY A;  4L5J A;  5ERI A;  2QYO A;  4YG2 F;  2WWY A;  4KUM A;  2A69 F;  4O6J A;  3KP4 A;  2KRF A;  1LVA A;  1SMT A;  3HUG A;  1IXS B;  2XUB A;  5E8G A;  1E17 A;  1G4D A;  3GWZ A;  3ECH A;  3H92 A;  4ESF A;  3D0S A;  5HS8 A;  1XDS A;  1F1Z A;  1OYY A;  2Q8K A;  2PEX A;  1UB9 A;  5CVI A;  3P9C A;  2EJR A;  4HX8 A;  1FY7 A;  1KYW A;  3WTS C;  2ZME B;  2DTR A;  2CQK A;  1ZG5 A;  1TNS A;  1HXD A;  3CDH A;  3GUD A;  6PAX A;  3FMR A;  2IA1 A;  1B6A A;  3RPQ A;  1I6X A;  1KA8 A;  3WTW C;  1Q1H A;  2FML A;  3LAJ A;  5LBQ A;  3MWM A;  4QLC U;  3FMS A;  1TLH B;  1USS A;  3ZMZ A;  2BE5 F;  2ZNY A;  2YPR A;  3I0T A;  3I59 A;  2Z3Y A;  2LNB A;  1ONV A;  4EQQ A;  4OU0 A;  2CWE A;  2VXZ A;  1ODD A;  5BMZ A;  1XMA A;  4G94 A;  2DPD A;  3LAP A;  4XBF A;  5E17 F;  5JFR A;  4IRI A;  2XRN A;  5EEG A;  2IT0 A;  2EV0 A;  1IN4 A;  3GFI A;  4R1H A;  1R22 A;  3I5U A;  1RZ4 A;  4UNO A;  3RKY A;  2UXN A;  4I02 A;  2A3S A;  3J81 Z;  2BV6 A;  1U5T A;  5F6F A;  2KJC A;  4FHT A;  3I64 A;  4LLN A;  4IRH A;  2ELH A;  4KYW A;  4DQ2 A;  2WC2 A;  3V8L A;  4OMY A;  1QBJ A;  2VBY A;  2Q2E A;  1KU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...