1J6OA

Crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
260
structure length
260
Chain Sequence
HHHHMVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGVNLEDSKKSLDLSKTSDRIFCSVGVHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEAYEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGGPVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEPKYLKYVVETISQVLGVPEAKVDEATTENARRIFLEVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TatD-related deoxyribonuclease (TM0667) from Thermotoga maritima at 1.8 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords TatD-related deoxyribonuclease
total genus 103
structure length 260
sequence length 260
ec nomenclature ec 3.1.21.-:
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1j6oA00
3OU8A 2DVXA 1UBPC 1FWHC 4PBFA 2Z26A 3B0YA 3LU2A 5HMEA 1A4MA 1FWDC 4HA0A 3K2GA 4WVXA 2Q01A 1I0DA 2P50A 4H9VA 3ISIX 4WGXA 1EJVC 3IRSA 2BGNE 1BF6A 2O4QA 3MKVA 1V7AA 4I6KA 3RHGA 3WZ0E 4CEXC 4KQNA 3MJMA 4R85A 5FSEC 4L9XA 3OVGA 1XWYA 1M7JA 4LFYA 3NQBA 4F0LA 3OOQA 3LGGA 2D2HA 1FKXA 1RA0A 2I9UA 3E0LA 3SFWA 2HQAA 3LY0A 3EWDA 4C60A 1A4LA 5LXXA 3QGKC 2WJDA 1A5LC 4H9MA 2DVUA 4OFCA 4GY1A 3UF9A 3LS9A 4PCNA 4BKNA 4CEUC 3S2NA 2FVKA 3PAOA 3T81A 1ONWA 2GWGA 4NI8A 1RJRA 2DVTA 4C5ZA 2VR2A 3O0FA 4CQDA 2OGJA 1A5NC 3V7PA 4NP7A 4RE0A 4C6EA 4IFRA 2AQOA 4KF1A 3IJ6A 3DC8A 1FWJC 3TNBA 2HPIA 3JZEA 3S2LA 2OOFA 4BJHA 1NFGA 4C6CA 4DI8A 4PBEA 3IPWA 4C6DA 4LH8A 4H9UA 4GYFA 2Z29A 1ZZMA 3GTFA 4GOAA 3GG7A 3URAA 2XIOA 2QT3A 4H9XA 1O12A 3HPAA 4KEVA 4XD5A 4P5UA 5G4HC 1ITQA 4WHBA 4CNTA 4LCQA 1PB0A 4EP8C 2YZ5A 3IV8A 4F0RA 1K6WA 3LSBA 2VUNA 3IGHX 4IH3A 4H01A 1P1MA 4IG2A 2Z4GA 3O7UA 3GUWA 3SO7A 2WJEA 3GTHA 1RAKA 3DCPA 3AU2A 1K70A 4INFA 4ZSTA 4IGMA 1J6OA 1A5MC 2WM1A 4C6IA 2E1WA 3FEQA 1YIXA 4HK5A 2EG6A 1KRCC 3TN4A 2FTWA 1XRTA 4C6PA 3CS2A 4H9ZA 5CH9A 4XAZA 4KEUA 3E3HA 3MSRA 3PANA 4KERA 2PUZA 1HZYA 3TN5A 2GOKA 4CQCA 2ADAA 3GU9A 1GKPA 4HK7A 4GX8A 4IFOA 1P6BA 4LEFA 3GU1A 1XRFA 3ITCA 4R88A 1V51A 4PCPA 1V4YA 1J79A 1UMLA 5HMFA 1W1IE 4F0SA 4D8LA 3E38A 1EJXC 3S2JA 4B3ZA 1XGEA 3AU6A 1PTAA 4C6QA 2CZVA 2Z2AA 4PE8A 4XD3A 2VM8A 2D2JA 2GWNA 2D2GA 1KRAC 4AC7C 2FVMA 1NDYA 2QVNA 1FWBC 4IF2A 2PGRA 4NG3A 3HTWA 3MPGA 3EWCA 2IMRA 4LCRA 2VC7A 1EJUC 3MDUA 1GKQA 2P53A 4C6KA 4C6JA 1R9XA 1RJPA 4ERIA 3GTXA 1POJA 4KETA 3QY6A 1POKA 2F6KA 4G7EB 4EPKA 4AQLA 4TQTA 1EYWA 3TN3A 4B92A 1FWCC 2Z27A 2Z2BA 4CNUA 4YIWA 3GIPA 3PBMA 1ADDA 1K1DA 4B91A 1FWEC 1KRMA 4DO7A 2Q09A 3KM8A 3OODA 3UR5A 1EJRC 2R1KA 4BY3A 2HBXA 3WYZA 3F4CA 2OQLA 3LNPA 1J6PA 3R0DA 3PNZA 2ICSA 3S2MA 2KAUC 3DUGA 2VC5A 4G2DA 1EF2A 3G77A 4GC3A 3HM7A 1YMYA 4QROA 4LAOA 1EJTC 3GTIA 3E2VA 2W9MA 4Z42C 1V79A 3A4JA 3UR2A 3RCMA 2E25A 3ICJA 4DLMA 1O5RA 4DZHA 3FDKA 3PNUA 4IG2B 4GZ7A 4C6OA 3GRIA 2PLMA 3MVIA 2R1LA 1VFLA 3LSCA 3MTWA 3GU2A 2QPXA 2UZ9A 4C5YA 4IQJA 3RN6A 1ONXA 4E3TA 1YRRA 4DYKA 4GY7A 3NURA 4QSFA 4J5NA 2PGFA 4CQBA 2O4MA 1RA5A 2Z24A 4GBDA 1M68A 4XD6A 4GK8A 3CJPA 4UB9A 2YB1A 1KRBC 4C65A 3RYSA 3OJGA 1S3TC 2Y1HA 1PSCA 1E9ZB 1I0BA 4C6BA 4RDZA 4V1XA 1UIOA 4XAFA 2YB4A 3LGDA 4L6DA 2R1MA 4G7EA 1YBQA 3ID7A 3F2BA 1A5OC 1UIPA 3F2DA 1M65A 4R7WA 4IFKB 1E9YB 2Z00A 4DZIA 4LCSA 3A3XA 3D6NA 2WJFA 3E74A 4DLFA 3MVTA 2BB0A 4XAGA 2GZXA 4V1YA 2PAJA 1YNYA 1JGMA 2OB3A 5E5CA 2AQVA 5HMDA 4B90A 3EGJA 4H9YA 4KIRA 4QTGA 3F2CA 1FWIC 4RDVA 3A3WA 4DIAA 3LA4A 4EPEC 2OODA 3UPMA 4ERAA 1NDZA 2I5GA 2GSEA 3C86A 4M51A 3IACA 1NDVA 2ANUA 4DNMA 2FFIA 4C6FA 4H9TA 4ICMA 1EJWC 2VHLA 1QXLA 2A3LA 1FWFC 2Z25A 2EG7A 4C6MA 3F4DA 2R1PA 4LAMA 2QS8A 4GX9A 4IFKA 3N2CA 4J2MA 2YXOA 3QGAC 3URNA 4QS6A 3OQEA 1NDWA 3WMLA 3QY7A 4UBPC 1RK5A 1YBQB 1EZ2A 1A5KC 1FKWA 2HPMA 3MDWA 3FDGA 3QY8A 4XAYA 2ZC1A 1PO9A 4LALA 4H00A 3K5XA 3UBPC 3TN6A 2Z28A 4XD4A 1V77A 4C6NA 3B0XA 3NEHA 3AUOA 1EJSC 3URBA 4QS5A 4MUPA 2G3FA 2HBVA 5FSDC 1DPMA 1R9YA 4KESA 4C6LA 3BE7A 2RAGA 3B40A 3T1GA 1R9ZA 1J5SA 4JOMA 1IE7C 2HNHA 4HJWA 4RDYA 3K4WA 4J35A 3ORWA 1GKRA 4ZSUA 5A6TC 2AMXA 1P6CA 3E0FA 4KEZA 4CNSA 4EPDC 3GIQA 4ERGA 4DI9A 4IGNA 1RK6A 4I6VA 1RJQA 5AKQA 1FWGC 1QW7A 2UBPC 1WXZA 2FTYA 4LAKA 2EG8A 4HK6A 3URQA 2R1NA 3S4TA 1FWAC 1WXYA 4GXWA 3T8LA 4LANA 4EPBC 3IARA 2Z7GA 4RZBA 1ITUA 4GY0A 4RDWA 3CAKA 1KCXA 4QRNA
chains in the Genus database with same CATH superfamily
4PBFA 3TTSA 4H41A 3ARYA 2IQTA 4OVXA 1BWKA 5U7SA 2OQHA 4GO8A 1Z69A 5HDRA 4ZO8A 3SB0A 1ZJBA 1UMYA 1PIIA 4QG9A 2RKXA 2WWDA 3OZYA 4UR8A 3PWIA 1SO6A 1QW8A 4EX4A 4X2PA 1ISYA 3S2CA 3E0LA 4NJIA 3IJQA 4TTGA 5C2GA 2WCSA 2ESCA 3G1YA 4B5WA 4PCNA 2QQ6A 3S2NA 3PAOA 2VWTA 3B0VC 2DVTA 1H7OA 4WR3A 1XBXA 1XYMA 3AZTA 2J75A 4WOQA 3V7PA 1ZJAA 1VFOA 3EX3A 3G3DA 4HN4A 2AQOA 2F7FA 4UZSA 3E6EA 1N82A 4KF1A 3DBNA 4WGHA 2ZWYA 2OOFA 3PWGA 1SJDA 3DX5A 3ZM8A 1ISVA 3NQCA 4EWND 4HCHA 1DIEA 1RALA 3TEVA 3N14A 1E1FA 1TWIA 3QLDA 4WHBA 2GJNA 2YZ5A 4JFVA 1UJQA 2YCLB 4HHMA 4RXFA 3ARRA 1VR6A 2VUNA 4Q33A 3R89A 2WVVB 3GNNA 3OW1A 3W74A 3VGBA 4IIBA 3ZWTA 5J5DA 1I2QA 1QATA 2FDSA 4C6IA 4G8TA 2CERA 5HNTA 4GRSA 3NXLA 2A5HA 2NT1A 3XIMA 5KZMA 5DLCA 2A3CA 1NWUA 2ZX5A 4KERA 1OX4B 3BW3A 5JH1A 4LVBA 1KFJA 5AHFA 1PTDA 1G7VA 1AH4A 1SJBA 4HNLA 1XRFA 2GDQA 3B8UA 2C3ZA 3VDAA 4O4VA 3WDJA 3TA6A 5DO8A 1BKSA 3FNDA 4O28A 4FXSA 2CW6A 3ITVA 1J9YA 3VNJA 4RNFA 1E51A 2POZA 3SN1A 4LUSA 2UY3A 4Y9AA 3PJWA 1NDYA 1JRCA 3H26A 5I03A 1E6RA 1GUVA 5D2VA 4IF2A 2ZRXA 2WKJA 3R8HA 2VC7A 3MDUA 3OIHA 1EXBA 3TYAA 1YDOA 3DKJA 1JDCA 5ABFB 3AS2A 4H6QA 4IJRA 4RZ5A 3TYBA 4EPKA 1B9ZA 1KTCA 1BXCA 1NF7A 3C61A 1K1DA 2YBVA 2PDNA 4B91A 3FYPA 3VD4A 1XD0A 4Y9MA 2XVPA 4Z1YA 1WOBA 3CO8A 4O16A 4WDXA 1W5MA 2HBXA 2HTMA 3SGZA 4ADTA 2QULA 3F4NA 3OG2A 2XN1A 4FO4A 1XS2A 2W4XA 1GWJA 2BGQA 3G77A 1NU5A 3HM7A 1UWSA 3O9NA 3W02A 5A8MA 5C7VA 1EYEA 2E25A 1UR0A 1Q65A 1ZCOA 5FF7A 4PUDA 3REQA 1XF0A 3TA9A 4CQ9A 1M3UA 5I2UA 2C1GA 1YRRA 5LIKX 2QPUA 3QFWA 2D20A 1US2A 3EDEA 4KFPA 2Y89A 1JZ3A 4UFHA 2VT0A 2CLIA 1VBGA 1JCLA 3FCPA 3P8JA 5H1WA 4A3HA 1ZBKA 1LTDA 3GIYA 4U3AA 4PL2A 1OT2A 4D6IA 1OD8A 1LZOA 4H6KA 3OZPA 4LJ3A 3W87A 4FA3A 1LWHA 1LYXA 1EC7A 1QOQA 1H0IA 2QW5A 3LRLA 3TZNA 3GVQA 1S38A 4WUIA 5K9CA 4TO8A 1JCYA 2OR2A 4AHQA 1VLIA 3KBJA 3VGEA 1YADA 1UPMB 1JIBA 4DO4A 3SIMA 2AKZA 4XAGA 3QMTA 2YKKA 1YNYA 3A4AA 1BAGA 3XINA 4NUWA 5KITA 3GH5A 3FA5A 2ZRZA 1E6ZA 5E9AA 4QTGA 4YLWA 1QMLA 4RDVA 1BVZA 2J8FA 3TTOA 1CXFA 2E6FA 6XIAA 3BSGA 1FWWA 4YVXA 4JIIX 2XH0A 3IGUA 1OGSA 3EXSA 4GCXA 3BMVA 1KKRA 4H9TA 1SVDA 1BTCA 2JF6A 3N29A 1GJPA 4C6MA 5HR6A 2E28A 2ATMA 2OYKA 1REQA 3WNNA 1QHPA 2FB3A 3NDZA 4P8WA 1BYBA 1B3WA 2Y7GA 1Z44A 5I78A 4O15A 3CMFA 5FEWA 3PPFA 3VX0A 1O95A 2Z28A 3KL5A 5H6HA 3BANA 1H09A 3B06A 3SSJA 3RDKA 3WH7A 2ZZ7A 4RPQA 1WB0A 2DSUA 2QXWA 1K4HA 1WKDA 2O0TA 4LQ1A 1QAPA 1E6NA 4S38A 4Z1BA 3TWBA 1H50A 1R9ZA 3I3BA 1Q7QA 4XUGA 1E1CB 4IJBA 9CGTA 1DIDA 3K4WA 2C19A 1GTHA 1XCWA 2XWDA 3ORWA 4EXAA 2WLYA 3WLOA 2LLEA 2R91A 1C9WA 3WLLA 3KUMA 3KHDA 2V81A 4FR1A 4ERGA 1TJ2A 3ZSSA 3Q94A 3L5MA 2ZUNA 2CKRA 4XZIA 2Y6ZA 5CZKA 1TTPA 1HP4A 4UTMA 1E0UA 4JIPA 1FWAC 5DCDA 1YEYA 4WKHA 3AXHA 2QGHA 4HPNA 3W9ZA 1FWDC 1EQPA 3B0YA 2FTPA 1UD6A 4TMCA 2VZVA 1A4MA 1QNPA 4IP7A 3OVQA 1O66A 3HOJA 2DFAA 3CTTA 4AIBA 1BF6A 3SIZA 3EDFA 1EH9A 3AIQA 1VJZA 1ZJHA 3EX2A 1CGYA 3Q67A 2WSQA 1OK4A 3KDOA 1TIWA 1AW5A 1VFUA 5DMLA 1C8VA 1OF8A 1P0KA 4TVDA 1E40A 1DHPA 1WZKA 1TPDA 4DJEC 1LP6A 3A3HA 4H9MA 4XZNX 4MKSA 2B7PA 4JEQA 3QTGA 3H55A 3BCJA 2GWGA 4LRSA 2BHYA 3EX4A 3WQCA 1HT6A 3BZGA 1G1YA 1KV8A 2WC4A 1KTBA 6REQA 1YKWA 3PULA 3UYIA 3BAKA 1JZ8A 4PA8A 2E09A 1AH0A 1H63A 2W6RA 3M43A 5DEZA 4MPKA 1EHNA 1FCUA 1IZKA 2PZ0A 3HO8A 1NFGA 1GQJA 3GTFA 4FNRA 4PUJA 1IZJA 2QT3A 4AWUA 1E15A 3GKFA 4FR6A 3QOKA 1GVYA 3GXFA 3S6OA 1T41A 4GIAA 2OCZA 3WH6A 2NUXA 1L6WA 3RITA 1PX8A 1R3SA 3MUIA 2QDDA 3DCPA 4IUOA 3GE7A 4CNOA 4IGHA 3SZ8A 4NHVA 1FA2A 4AZHA 4FF7A 3L21A 3IWPA 4B5NA 3FW6A 2V9DA 7TAAA 1AD1A 1OIMA 1WDDA 4PL1A 1G5AA 1U1JA 4MY9A 2J7BA 3SM0A 5REQB 1UP2A 3N2XA 2RGMA 5HMSA 4ORIA 4MNMA 5U4NA 3RO6A 1P1XA 3LZ5A 1P6BA 3F5LA 1TMLA 3DFHA 1VRXA 4JTAA 3VNYA 3E38A 5DRIA 3WLPA 4HOXA 4NILA 4EACA 3MO7A 3W27A 4KRUA 1GYMA 1IZCA 3WLJA 3KOYA 4OWGA 3DHFA 4C6QA 3SW6A 2CZVA 1O1ZA 3G1AA 4U31A 3SQLA 3VYLA 4RK8A 4O19A 2JF7A 2OGYA 5T26A 2QV4A 4R7OA 4ZQRA 2P53A 3JU2A 3CV2A 3ERPA 3IK4A 2HXTA 4C6JA 4M1RA 1JULA 4NNCA 1YYAA 4N4PA 4ZB0A 3HG3A 4P7NA 3PBVA 5D33A 1ISWA 3D3AA 3AS1A 3VKCA 1DJZA 3PBMA 3RMEA 1Z89A 5K9XA 3LHTA 3UETA 1HKJA 3CUIA 1FCVA 1Z7AA 3W0KA 2QZRA 1WDSA 2D73A 4GKLA 4N6EA 2BODX 1BYAA 1LORA 4QDMA 1J6PA 3WD3A 1E0VA 4JTIA 3WEZA 1XHGA 2EPOA 3V0TA 1BG9A 2Z1SA 1MUMA 2PEVA 3TC7A 2WZHA 4GVGA 4UZUA 4RW3A 5E6ZA 3PAJA 3T0BA 1MQPA 1O60A 3WQPA 2P8BA 1R3RA 4W5UA 1OCQA 4AZ7A 1VH7A 1GORA 1R3YA 3BAWA 5G2IA 2XFFA 3HQPA 3VIPA 1HJUA 3CPRA 3OB8A 1AJ2A 1PS9A 3M0LA 2ZZ1A 2PC8A 4OZOA 4CGTA 1DYSA 1UD3A 1VAHA 3QRHA 4XD6A 1EDTA 4XWUA 3ABQA 5J8LA 4EE9A 3H21A 5CC5A 5ECVA 1OT1A 3VD7A 3ZOAA 3TTEA 3ARXA 4FMVA 2CKSA 2BWGA 1PE1A 2GJPA 1AFSA 5AZ1A 2NXHA 3RPTA 4NVTA 2V6AA 3QHNA 4G7EA 3UERA 3BARA 3BLIA 3NSNA 1A5OC 1TWDA 2E9LA 2ZIDA 3EXRA 4JXCA 3CWNA 3AHYA 4L65A 3RU8X 3MB9A 1SUXA 3CH9A 3OLGA 4CD6A 3IIZA 4AF0B 1E0WA 3C2RA 1E6PA 1OX5A 3KBVA 1EO5A 3WMBA 4H9YA 1GW1A 2AGKA 1PVNA 4Y2WA 4LOCA 4JHMA 4XVDA 5E70A 5D2XA 3RCNA 3S47A 3XISA 4JIQA 4F2UA 2V3EA 1PBGA 2Z1XA 1CCWB 3P2VA 2A3LA 4PEKA 4IPLA 3EKZA 5AHLA 4ORMA 3W1AA 2WHKA 4GUJA 1U5VA 2YA2A 3N9KA 1GOOA 3WJYA 3VIIA 2KZHA 5FJIA 3QY8A 4PMRA 4ICCX 3I6TA 3HV9A 3FAWA 5FIPA 3TN6A 2C15A 2B0MA 4JEJA 1V6WA 2ZXBA 2B7OA 3M5XA 2BVDA 3UZ5A 3N12A 5I77A 3CZKA 2QCLA 1KC7A 3VIGA 1DVJA 2VKZG 3DU0A 4GUHA 1QBBA 2GLKA 4NRSA 2X16A 1VENA 3GW3A 3I6RA 4J40A 5I3DA 4GE8A 4H2CA 4WLCA 1LQ2A 2QAFA 1XLLA 2P76A 1PL9A 4I6VA 2O56A 1XICA 5A1AA 3K8LA 2FTYA 4UOQA 2QNEA 5IFPA 2INZA 1MFVA 3HURA 4DM2A 4YWSA 1DIOA 1IXNA 2FJKA 1B1YA 3U5UA 3B9AA 2HE5A 1ZQ5A 1UR9A 4UQCA 2Z26A 4PULA 3WBAA 1VFSA 2G5WA 2VOTA 2RDUA 4H9VA 3UFYA 1CGVA 1Q7MA 1PIFA 4P8UA 2QLYA 4I6KA 4LYPA 1W2VA 2G3MA 1LUCA 2R82A 2ZVRA 4MB3A 4JQ1A 2PA6A 2PD5A 3OVGA 4KPLA 5JMUA 1CGTA 4F0LA 3HBLA 2D2HA 2E77A 3UGVA 2HQAA 3LY0A 4U3CA 1VF8A 4IL2A 1CXKA 1CXHA 4PMQA 3U8GA 3LYEA 3WLQA 3K8KA 2J88A 1AQFA 1PIGA 3O8AA 3MYPA 4A3UA 1W3HA 3M9YA 3O0FA 1A5NC 4AD0A 4PUEA 2DZXA 3GAYA 4Z08A 3J7HA 4HCDA 4JKLA 2WZMA 2D24A 3MI3A 3OVPA 3HMJG 4PCSA 4KGLA 2NUYA 2QPSA 3TNBA 1HO4A 1ZL1A 1UOZA 2DH2A 4PBEA 3W7OA 2CZEA 1EA9C 2OOGA 4JBRA 3M0KA 2PS2A 1NAL1 2EQDA 3PBGA 5FEZA 4PEEA 5AYYA 5FF4A 1O12A 2R8WA 4DY1A 1DTNA 1KFWA 2C6QA 4MJ2A 4ZB5A 2JK2A 2XSAA 3IGHX 3FX4A 4FS9A 4FX8A 4IG2A 3LCIA 3EDKA 3F7JA 1Y5XA 1Q66A 3M5YA 1KB3A 1LCOA 1QK2A 1KRCC 1XM3A 1GZJA 1FH7A 4K7YA 2NLYA 4N9BA 1OC5A 4H83A 2PUZA 1IEQA 3DHPA 2QCFA 3VO0A 5K3VA 3CLMA 1KBIA 4UMBA 1F5ZA 4GX8A 5C5YA 2G0WA 4IFOA 3L2IA 3ITCA 3LGEA 3TXVA 4IOTA 3ABXA 3TYUA 2DUZA 1FP8A 1WXJA 4K6AA 2X41A 1QO2A 5LXEA 1SZNA 2YXGA 4ZOBA 1IXOA 1ZTVA 4GIEA 5I3HA 4HB7A 2PWVA 2GWNA 4AC7C 1KFCA 3U2OA 4NZJA 1Q6GA 4CD4A 5BNKA 3S42A 5CG0A 1T99A 4JYFA 1X1OA 4IWWA 3UA4A 2ZX7A 3JW7A 2DIJA 4YWIA 3H2FA 4JDBA 4DXKA 4BQ5A 2OYLA 2BGSA 2D3NA 3P82A 3GTXA 4K36A 3VOFA 1PDYA 5DX7A 2D0GA 3IV3A 3M44A 2VEPA 4I8DA 4KWSA 4M6UA 1YTDA 1AG1O 4V15A 1P5BA 4X2RA 4D1IA 4YHEA 1GONA 4Z1CA 3RRXA 1GVSA 4NJJA 4DO7A 3CZGA 2ZUVA 3OODA 3VDCA 3G22A 3NZ1A 5I3GA 1GVRA 3F4CA 1E72M 3UCDA 4H3DA 2CLPA 3OYXA 2GDUA 3DOPA 3AS3A 2G50A 3B3DA 3UXIA 1JF5A 4YHGA 5KEZA 3VKJA 2WLZA 4AD1A 2ZX6A 1ZJIA 3UQNA 3MC5A 3D46A 3FDKA 3L65A 2Z1KA 3LI0A 5I3FA 2V30A 3AIWA 5FJTA 4QQ3A 2VFFA 5DFAA 1VKFA 5AECA 5F2IA 3SURA 4BI6A 3NQEA 1VC4A 3JRKA 1CLXA 1SPQA 3VGFA 3VVGA 4IZGA 2YBUA 3T55A 3OBKA 1KRBC 4QG6A 3QM3A 3GDMA 3W38A 1Z42A 4JTDA 1MMFA 1OFRA 2WC7A 1IEVA 1UA3A 1PZ2A 1FCQA 3PZ9A 2WPGA 1PYFA 3W7IA 1ME7A 1KQYA 3VI2A 1T96A 4AG0A 4LVFA 4J3VA 4RW5A 1MXGA 2OZTA 3D0CA 5CPLA 5IHSA 2G41A 1GQIA 2PE4A 2NQHA 1QI5A 3L23A 4HNNA 3APTA 4JQ3A 1H7XA 3DDMA 3C2EA 4HNVA 1YNPA 2OG9A 3NPXA 2BVWA 4M82A 3R58A 4M80A 4JCLA 4UTTC 5AHNA 2ZTKA 1TV4A 4JTLA 4Q8TA 1AQ0A 3TNOA 1NDVA 4WRHA 3I7QA 1AW1A 3VNDA 4RE3A 5A95A 4KCUA 5CGMA 1DJIA 4DWSC 1ZALA 3GO2A 1XR2A 3GTNA 2QHAA 1SR9A 3R8RA 5C8BB 4LVAA 4QS6A 3EB4A 3WMLA 4O4WA 3LTPA 4W8BA 3L2MA 2BY0A 2J27A 4LUTA 2HPMA 3PG9A 3MDWA 4HKPA 5EMLA 4HTYA 1QR7A 2H90A 4ZBCA 2E7FA 2PP0A 2VRQA 3E2SA 5HA7A 5F2GA 4AX6A 1N55A 5D37A 3DENA 4S39A 2PDBA 4NNBA 4KESA 3DXIA 3DESA 1JNDA 3HFYA 3BMXA 2PWDA 2XHYA 2A6NA 2QMJA 3WSUA 1KBBA 5JXQA 4HJWA 4TIMA 1YLVA 2J6VA 4QE1A 3EOLA 4JTCA 4AZBA 4KEZA 3NYDA 1R87A 2OEKA 4HZ7A 5C6MA 1TB3A 4H6RA 5FJRA 1FWGC 2UBPC 1VFFA 2GOUA 3BLLA 3N3TA 1LT7A 3ZR6A 4DWSA 4Z2IA 3KCLA 1V02E 2JIWA 1W3JA 4M56A 2FZDA 1E70M 4H7ZA 1KM3A 1RV8A 3W7LA 4OKDA 1ODUA 5TD4A 9XIAA 3ARTA 4HTBA 3QBUA 3C2OA 1IEIA 1QFEA 4M6QA 4J3XA 1JF6A 4Y90A 5C9XA 3TLLA 4JX5A 2WSKA 1TPC1 4MHBA 2PP3A 1X97A 4FLRA 4UR7A 3QJAA 2BOGX 3BJSA 3VMOA 2FZNA 2I9UA 1FVPA 3DYMA 3CPUA 3FK4A 1UKPA 4UNKA 2PDLA 5IOBA 1K03A 1MXSA 4MB5A 1PUDA 1A5LC 1UPPA 5EB8A 5JBFA 3GSMA 2QCDB 4L1GA 2YOCA 1YDYA 1OY0A 3IJ8A 3MP4A 3V0SA 3GHRA 2Y85A 3VGGA 4X63A 1OYAA 1LUCB 4FIRA 3BCDA 2G3NA 2EEXA 3PF3A 3OBAA 2HPIA 5CSRA 2TPSA 3ALFA 3H4XA 3MHFA 3RX3A 1E73M 4GOAA 1A49A 4DNHA 3BQ6A 5IDIA 2XIOA 3VILA 4GXMA 5A8GA 4P5UA 1ITQA 2J25A 2QV5A 1PKNA 4V2XA 4MLJA 1SZEA 4RNIA 3CHFA 4HPGA 3EWBX 3SO7A 5G4EA 3LTSA 4ZENA 1OF6A 1DBTA 2WM1A 4B5SA 4KKXA 1XRTA 3TJIA 3H7UA 4JS3A 1DHKA 2F38A 3PANA 5K7JA 2VFDA 3VCRA 3ZLHA 3TN5A 2GJXA 2NX1A 2TAAA 2EGZA 4J9JA 1QNSA 1V51A 5EY5A 2VO5A 1KBLA 3W82A 4REQA 2ZX9A 2OZ8A 4JNYA 1AH3A 1FFQA 4DO6A 4L61A 2CBVA 2DU2A 3SI9A 3N9RA 3VOJA 3PUDA 3SDOA 3W3OA 5KINA 5EFFA 3R94A 4O53A 1R3VA 5I5RA 3MV11 1F3EA 3DYPA 3H2NA 1OCNA 3BGJA 3TC3A 2G96A 3VNZA 3EWCA 3W7DA 3W76A 2OWCA 3NTYA 1POJA 1UBSA 1WO2A 3GXDA 4U5IA 1EYWA 3RM8A 1J4EA 3T0CA 3HGSA 2PF8A 3W28A 4N7QA 2FPTA 4RZ6A 3V1HA 2BS9A 4MAZA 5LIYX 4I7UA 3BVJA 1KFLA 4L4MA 3W1LA 2DSVA 1G01A 3ITTA 2A7PA 1VS1A 3S0CA 2VX7A 3KVKA 3ITOA 3RX2A 4PSPA 4F0MA 4TXEA 1OG6A 3M0VA 4K8EA 1Q5MA 1UH2A 2VELA 4O0QA 5HUPA 1E4LA 1L9WA 1WAWA 4NJGA 3B8WA 6XIMA 4LF2A 4I90A 4AYSA 2WWCA 4YS1A 1K8CA 3RRAA 3KBWA 3G0XA 3N25A 3TROA 3RAOA 1GEHA 1LBLA 5AB3A 1ZP4A 3E5PA 4UNLA 1R86A 2ZYFA 2QPXA 3RN6A 3SAZA 3EX1A 3NO1A 3V5CA 5HPCA 2ZFAA 2IXUA 2VGBA 3WX7A 1THFD 1M68A 2DT2A 1AMYA 2JKAA 3EA1A 1TREA 3U48A 3I6EA 3VTRA 5I24A 2YB1A 4ENLA 4FP1A 3CQ0A 4DZ5A 4W84A 4WKFA 4KW2A 2E6YA 1M5WA 4QXIA 1FHDA 1G4TA 2Z2UA 1F05A 4C6BA 2XH2A 3LGDA 3RO8A 3ANVA 5C7HA 3F5KA 1YBQA 2DSZA 9RUBA 2PDYA 5CGTA 1BRLB 2CLFA 3NQFA 5JH2A 4GGHA 5DBTA 2Z00A 4NAEA 4ZGYA 2EHHA 1G7UA 4AZ6A 1C8QA 1A50A 4U10A 5BW6A 4WXYA 5DN1A 3SQMA 3CK5A 1H5YA 2ZRUA 4JTSA 2FH6A 4O1AA 1SR0A 4HIBA 1GYNA 4AZCB 1VYPX 2Q3OA 1Y0EA 1I1WA 1OVDA 2X1SA 1XBYA 3LLFA 3P7YA 4M6PA 4LF1A 5AVHA 4DNMA 4A8IA 1RCXB 1XINA 2TYSA 4DYEA 4R34A 1OX4A 2VD8A 3RPMA 2XYLA 3QY7A 3HJEA 3N15A 2Y5EA 3NSMA 6TAAA 4ROPA 4C1KA 3W2NA 4GZIA 4US6A 3BQ5A 3MMDA 3K5XA 1XYZA 3GZAA 4LB3A 2PB1A 3S1GA 5DT5A 5A8OA 4GACA 1R2SA 2HVMA 3ANUA 3CUGA 3PJUA 4GNKB 4UMAA 4DJDA 1F4HA 1DJYA 2GVGA 3TMLA 4DBDA 4MTVA 4DF1A 2OJPA 3U2EA 5T9CE 4J3ZA 3MA8A 1GKRA 2PWFA 2WXDM 4R27A 2GDVA 4CNSA 4EPDC 3MUXA 2OYMA 4IGNA 2XM2A 4E8DA 1XLCA 2QCMA 3LCXA 3IJIA 1H0GA 4Q7BA 2EG8A 4IMDA 3URQA 2YA0A 2O9PA 4UFLA 2J77A 2OLSA 1XCXA 1EUNA 3OU8A 2V5CA 1EX1A 1XSKA 5HMEA 4GJJA 3CAVA 4WVXA 5CEWA 3DHDA 4LNYA 5E0KA 2BXYA 2FHCA 3UCCA 6A3HA 3WZ0E 4DF2A 4FAMA 5BYWA 1W91A 2XZ7A 1WDWA 1TELA 4TOQA 2XH7A 3T4CA 1LF1A 2PDFA 4PTXA 1TV3A 4LFYA 3Q2DA 1WX0A 1EBHA 4Y7EA 3WL1A 5LGXA 2C8NA 1OGBA 5MKGA 1A4LA 1CX9A 2CNCA 2DDXA 4K68A 4G1NA 1PZ0A 4AFYA 4I3GA 2GPTA 2FFCA 4N9DA 4HPXA 1A3HA 3PTQA 5D30A 5ABGA 3IIVA 4C5ZA 5HQMA 2A6LA 4ZCWA 3M5ZA 3WF2A 3WLNA 3TLQA 4PMVA 4ZQMA 4WEVX 3DC8A 2ZRVA 4IQLA 4K39A 2D69A 2PTZA 4BJHA 2YA1A 4CQ8A 3I3EA 2VCCA 4E2BA 1C8XA 1UUOA 3KFTA 3FAXA 1MZRA 3CV1A 3R6IA 3B0PA 4N42A 3PBWA 4ZODA 5EPDA 3PBUA 4KCWA 3RR4A 2WMIA 2Y7DA 1TSIA 1WPCA 1W1ZA 1XL9A 3QQ0A 4ADSA 1OD0A 1XDMA 4IH3A 3PN8A 2Y8VA 1SO5A 2A2IA 5FF2A 3JVAA 3ABZA 1GOXA 1YDVA 1QK0A 1V8EA 4ACYA 3F03K 3RCYA 4PTNA 1C29A 1JZ7A 3LCGA 3LMYA 5JIWA 2ZXDA 5CH9A 3V35A 4KH2A 3PTDA 4P8VA 5FESA 1ICSA 1LRQA 1QNVA 5CSSA 8TIMA 5AC6A 1XCFA 1QRQA 5DQPA 1DXEA 1HX0A 3FEMA 1CXIA 3DI1A 4GYKA 4HK7A 1OGGA 3DG6A 3QR1A 5M3WA 1R85A 1W1IE 4F0SA 4D8LA 1V3IA 3AISA 2A3BA 3UWQA 1TUXA 5EMYA 3NZQA 1J0KA 2WKLA 2QUMA 1E43A 3KRBA 4GO9A 4XD3A 5F4SA 3WG6A 1JPHA 1E5NA 2QCDA 2QVNA 2OO0A 3QW4B 2I14A 4HYVA 5E9XA 2BOEX 2WCGA 1K9DA 2Q8ZA 3S1XA 1KCKA 2RDTA 3O06A 2FPVA 4HHLA 1Y5VA 4MWAA 3AHXA 4R5EA 5BCAA 1OHLA 1R3WA 4JNZA 3VD9A 4PTVA 3W1UA 3BICA 2VDHA 4JHOA 1TKKA 3UJFA 4QJ3B 4CLMA 2J66A 1RBLA 1DWFM 1J0HA 3S5ZA 3V3WA 4D1JA 2ODOA 2WZEA 3KM8A 3QYQA 1LRNA 1W9BM 1QVBA 3T2PA 3H2EA 1KNWA 5C71A 4PMXA 3LNPA 1VRDA 5CLWA 3HF3A 1QI0A 3S2MA 2KAUC 4Z2GA 5DXYA 5BMXA 2CETA 3PZUA 3WEOA 2RUSA 3MUY1 1V6XA 5HK4A 3IVUA 1H61A 3II1A 3QF0A 2ABAA 2RDXA 1QNQA 1LM1A 4I8YA 3LRKA 1MO0A 1ONEA 3BC9A 4AYGA 4YTTA 2E9MA 3GH4A 4JZ5A 1VFLA 3W6LA 2PGEA 2OLHA 1G67A 2QJNA 3BAYA 1R2RA 1VHNA 3H24A 3W1QA 4LPCA 4L56A 1TTJA 3V75A 4JN6A 4GISA 4KWOA 1ZLPA 3MI6A 2W0UA 3MWCA 1F8IA 3C2FA 5DRCA 5DMNA 3KOZA 2ACSA 3OJGA 4E3VA 3UPWA 1YQ2A 3R12A 4N9CA 1D9EA 3THDA 2Q71A 1TWZA 4AMAA 1CGUA 3VE7A 5CQ1A 4W7VA 4UTIA 1U30A 3F5JA 4CUCA 4LYQA 1OFBA 1QI3A 3QC0A 4HOWA 4YCOA 1GZGA 1LG1A 1UZDA 1FWTA 5CAHA 1KR0A 4F2BA 4MDOA 2AQVA 5A69A 1SQ7A 1FRBA 3UG8A 2RDWA 1FWIC 3IAPA 2J7FA 2HJPA 5EA9A 2YL8A 3LG3A 2OODA 4YVPA 3EWUA 3GR7A 2OPJA 4REQB 3PZNA 4MJ4A 1HL8A 1IWAA 1X1ZA 3VD5A 2PURA 2CLKA 1E0TA 5G2HA 3T0TA 3LTYA 7CGTA 4YXGA 4GVIA 5HBFA 2WKGA 2PCEA 3GD6A 1E55A 3R4IA 4TX6A 5GJNA 2J7EA 3DFTA 4LVGA 4Q8NA 4Q8OA 1HP5A 4AIEA 3WK2A 4GFIA 2HCVA 4HYRA 1M7OA 4LGXA 1F3TA 1UZHA 1EEXA 5I7GA 4D6EA 2GSJA 3LPPA 4O10A 1MEHA 4DWSD 3N6HA 2W63A 2PP1A 3EB2A 7REQA 3WFZA 1CGWA 2HBVA 3GHSA 3N1AA 4OU1A 3TCSA 3TJ4A 1J0YA 4LBUA 5CC6A 2PU1A 2YCKX 4C6LA 3QZEA 5I06A 2ASHA 1FWSA 3W7HA 4ALDA 4LC8A 3VC5A 2VFHA 4FI4A 3G1VA 1ZAHA 4S2BA 3T2QA 1W3NA 1Z9AA 3QPEA 2OSWA 4JQ4A 4Q8UA 3VIFA 4BI7A 2A21A 4B5TA 2BG5A 1SFLA 2CWXA 1WXZA 3ZT5A 5C54A 4I9TA 2R1NA 4QJ4B 3SUVA 1XLMA 1AVAA 1TJPA 4HU8A 3T42A 4RDZA 4A8RA 1XGZA 3THCA 3H4WA 1HJXA 2RJHA 3BLFA 3LU2A 1VP5A 2WSPA 4MYAA 1LDCA 3WDIA 3TSDA 4X61A 5AC5A 3IIOA 3QPZA 3U4FA 4P7RA 3B8TA 5F1VA 2W67A 5HQLA 3G1DA 4DJDD 2O9OA 4BQ4A 3AMCA 2ACQA 1I2RA 4MGGA 1J12A 3V0UA 1LJYA 3WUBA 4OQVA 3MCMA 1JCTA 1RA0A 4E4PA 1ECQA 4HSNA 2ZQ0A 3W23A 3WH8A 1FXQA 3MMTA 4IQDA 5H91A 3HV8A 2WJDA 1J8VA 2DVUA 4NX5A 3HPSA 4V33A 4IM4A 3R2GA 5MKGB 1RJRA 4X0VA 2YL6A 1F6PA 4X60A 2VR2A 5SWUA 3AIEA 5BROA 2WV8A 2NQZA 4R9XA 1HL9A 4Y9OA 1TVPA 4L80A 3BO9A 1FWJC 2V3FA 2BDQA 4GJ1A 1GHRA 3QV9A 4KBXA 1M03A 2INFA 4C6DA 3GM8A 4H9UA 4GYFA 1XH2A 1N8FA 2VX5A 1Y65A 2Z29A 2WK2A 4W85A 3GG7A 4Q8WA 2NV1A 5DXXA 2VWSA 1X6NA 3HPAA 5D9OA 2QIWA 4CNTA 5IXEA 4KWWA 3SJ3A 1QI2A 1WZLA 1XSIA 5M17A 2ATSA 4ZR8A 3VE9A 2DY3A 3MO4A 1ENUA 5KZDA 3FJNA 3MY9A 4ECLA 1XPGA 5FKYA 2QIIA 2GVJA 5AHMA 5D2WA 1SFTA 1AA1B 3TN4A 4YU1A 2YCEA 1OQFA 1Q6DA 3C0SA 5A3HA 4XAZA 4M0XA 5CCZA 3ARZA 3GAKA 3RLVA 4ZO6A 4L9YA 1UD5A 3OHIA 2V38A 2XIBA 3NVDA 2ZUTA 4GWEA 3UZWA 5C9WA 4POCA 3N19B 1EHAA 3AWOA 1XLAA 3K30A 1E1EA 3DFQA 1XLEA 3IJ9A 1LOSA 3DECA 1J96A 1XD1A 2BVYA 4IGSA 1A5CA 3S5SA 3WDQA 3F4WA 3L0GA 1OFAA 2PGRA 3VKKA 1X7FA 2IMRA 4I7WA 1UW9A 3P93A 4DUXA 1NJJA 4KETA 2DZWA 3STPA 2ZBTA 4TQTA 2Z27A 1KKOA 2W66A 5F7UA 1IEXA 1U1UA 1GQKA 3PZVA 3B8DA 4RPPA 2HMCA 3TJXA 1MDLA 3VA8A 2ONEA 3R8GA 4US5A 1XPYA 4NU7A 3BTNA 1UP3A 2PDHA 3DUGA 3QSRA 1ZNNA 1EF2A 1ZFJA 2DZUA 3PBYA 1XBVA 5XINA 2X40A 4GA8A 2VGGA 5CZTA 4HCLA 4DZHA 1DOSA 3WQEA 1CWYA 3MTWA 3GU2A 2YCLA 1V5XA 1KCZA 5CBJA 3LZ3A 1KXTA 2F9RA 1K9FA 1JPDX 1DXFA 3CZ8A 1FDJA 5C2CA 1XKJA 4O14A 2CXGA 2O7QA 3RX4A 3PP7A 1F2JA 4NX0A 4GQQA 1BQCA 2FB2A 1Z3NA 5I3KA 1E9ZB 1K02A 1K7EA 4RV8A 3U2CA 3GG1A 4LV9A 2PLJA 2IUZA 3GR4A 4MYXA 2G4FA 1NOFA 1M65A 4IHCA 8XIMA 2X0YA 3W01A 2WCAA 2ZE0A 2PPGA 3MVTA 2O55A 4PCTA 1M1BA 2P3ZA 4B90A 2PDQA 3KE0A 4J3SA 2PLKA 2GVEA 2GYIA 1JZ6A 1GNXA 3CZEA 1W1TA 3T40A 3L4ZA 1EC9A 4OGZA 3FLUA 5K9DA 3HG4A 4LW7A 1OWQA 3ARPA 1TIMA 4UFMA 1EJWC 1R47A 2OZ3A 1Q6QA 1FWFC 1U22A 3N2CA 4AD3A 5ECUA 3FN9A 3URNA 5FEXA 1OJXA 3UZZA 1BVWA 1OCJA 1RK5A 3B9EA 3LLXA 4DBEA 3QHOA 1FCBA 3CV6A 4LALA 3NPUA 3HMCA 4ML9A 1W8GA 4H2HA 3GVVA 4I5XA 1P7TB 4BK9A 1FX6A 2RAGA 4A22A 1Y7VA 2GJRA 3QQ1A 1OINA 4O50A 2J4GA 1RQEA 3RXZA 1EGMA 3BL3A 1NWRA 1IXQA 3HB9A 1VEMA 1MEIA 3WY1A 3FKKA 4UQDA 1TCMA 4K1WA 2IKGA 3E0FA 2PBGA 1M6JA 2ZVIA 2V67A 2V69A 1SSDA 2NX9A 1FH9A 1XX1A 3A9IA 1X38A 4O1CA 2HVNA 4GXWA 4KFOA 4H8NA 1C93A 3VC6A 3CAKA 3I4EA 1GJUA 3GHUA 1N8WA 4HA0A 3CUJA 2V68A 3WQVA 4JD4A 3W07A 3ISIX 3D47A 3AMGA 2BGNE 1PKMA 2BMBA 1U2YA 3NOEA 3PJTA 3UT0A 1ICQA 3I68A 2HSAA 3OLDA 1KFEA 4XKYA 5CPTA 2AAAA 3ZJKA 1RPKA 1E3XA 2Y88A 1R0MA 2A79A 4GUIA 3NGJA 1A5BA 4FF5A 3L68A 4PSRA 1TV2A 1XRVA 4GUFA 3UY7A 3CASA 3CAWA 3AHTA 5BOFA 5RUBA 4DBUA 1DIKA 4NASA 3ZWSA 4HZ6A 2DV0A 3EZ4A 3SCSA 3UA3A 1DE5A 2AKMA 4IMGA 7PTDA 2ZUSA 2AL2B 2V2CA 4RUBA 2FH8A 2WVTA 3SFKA 2PBOA 3S9ZA 2XN2A 4M5PA 3P0XA 2GJLA 3WK1A 3PWAA 3DEQA 1GOQA 1DP0A 1IIHA 3EWWA 3HQOA 3TTYA 1Q6RA 3L2LA 1B30A 4JFUA 4FNTA 3M0HA 5FL1A 1ME8A 1SMDA 2VVNA 4DWSB 4UFIA 3QKEA 4ACZB 1S5NA 2V5KA 1P7TA 3IEBA 3JS3A 1KM0A 2G3JA 4XZHA 5D4YA 2QEZA 1ZHAA 4BS0A 2PDUA 2HE8A 4E4FA 3FEQA 1ITCA 3I3DA 4HK5A 3E2RA 1V08A 3NPVA 3V36A 2CBJA 4GABA 4HPJA 5A5WA 4UTKA 1TRDA 2EPKX 4HD5A 4DHGA 3O6AA 4HU3A 1F3XA 2BX7A 4F0KA 4IPIA 1BTMA 1UMLA 3UEQA 1NOWA 1P0BA 3RJXA 4HJFA 2H3BA 1VFTA 3RNDA 5AOUA 3THAA 5KTLA 1TPEA 1UOKA 6REQB 1VCVA 3K1DA 3BAJA 4F9DA 1J5TA 4C1LA 1PXGA 4PH6A 4GG9A 4XZWA 3P6LA 1JD9A 3TSBA 6PTDA 4DX3A 3GKAA 2PODA 3ZT7A 1VBRA 2V3DA 1H62A 5E93A 3W29A 4LCRA 3SECA 1DJXA 3VDHA 1FWRA 4O1DA 3UJRA 4OV9A 2HNEA 4ERIA 5F2LA 3VPLA 3W1MA 1MYRA 2IQ0A 1LWJA 4G7EB 4MSSA 1HKKA 1B90A 2AL1A 3GIPA 4NL1A 4O0ZA 3LQLA 3TVAA 2P1FA 1AD4A 1IIGA 1LG2A 4W9TA 4L4LA 4NQ1A 1R30A 3VKDA 1A47A 4C90A 4NZ4A 2ZRWA 1S5MA 3SBFA 3WJZA 4L7ZA 5HJYA 1H5VA 2VCAA 3QPYA 3GXNA 1H7PA 4G2DA 4Z2HA 3UVIA 2QJIA 1AODA 4NAFA 1I6NA 4ES4A 3GTIA 3ITYA 3O3RA 1VIWA 1V79A 4Z42C 5K2ZA 3N73A 3EDJA 3DKLA 4D72A 1UUQA 4MPQA 3FKRA 4DBWA 3H8AA 4IQEA 5AFDA 6ENLA 1MFUA 3GNPA 3LSCA 3EAUA 4E3TA 1GOIA 3FA3A 2VENA 4L1WA 2WPBA 4CQBA 3N2TA 1RA5A 2GGIA 3I65A 4DB7A 2QJHA 4LU0A 4GK8A 5BMWA 4CD7A 3OEXA 5H2ZA 3RLHA 1KTNA 4U4MA 3EKLA 4DJFC 3GG8A 2V5LA 1JRBA 4Y8EA 1ZBVA 3UZJA 3S46A 2YB4A 3I7RA 3WQOA 2E8YA 1XIDA 4DAFA 3UJEA 4KT2A 4GINA 3OIXA 1O1HA 3M07A 3GDLA 1XYFA 3EMCA 4JX4A 1I60A 2CWNA 3WK3A 2VZTA 1VPXA 1Q85A 4ZQOA 3TYZA 3GVGA 1OFDA 4RNHA 1EF3A 3QMRA 1NVMA 3OQ8A 2QCGA 2DZVA 2OB3A 2BNJA 1PCWA 4NXSA 2C1IA 5LGZA 4HZMA 3OG3A 2TSYA 2QF7A 3B9OA 4JQAA 2UWFA 4PMYA 2OSYA 1GVFA 5AHEA 3S5YA 3T2OA 1TJ1A 3MS8A 3TKFA 1EA0A 1QHOA 4EOUA 2ISWA 3A24A 2WAGA 3BPWA 4B9ZA 4DRSA 4ZXLA 2Z25A 2IW0A 3WMCA 4N0RA 5JVLA 3ZYZA 4H8HA 3TW7A 4J2MA 1IGWA 2Y5SA 2VI0A 1AQHA 2YDQA 1W5QA 6TIMA 2VP8A 1WUFA 2G8ZA 1GJWA 4RXGA 4IISA 3LHVA 3NA8A 3JR2A 4JTFA 2PLCA 1DJWA 5G2WA 2WHJA 4Q4OA 4E8GA 1XFCA 1SJCA 2ZZ6A 5FSDC 1KBKA 1R9YA 5I79A 3TV8A 4XISA 1V93A 1EDQA 3A23A 2WNQA 1LT8A 2IXVA 1L6YA 4RR4A 1Q2RA 1JR1A 4L6OA 2HISA 1K9TA 2VZSA 1P6CA 1UG6A 2FZBA 3KXQA 1TA3A 1QBAA 1JAEA 1AQMA 3T9PA 5JIPA 4HNCA 3PZMA 4ZFMA 1UH3A 2ZTJA 3EWYA 3A64A 4Z1DA 3CB8A 3WELA 1FUYA 1JYXA 3OLIA 2NWRA 4JICA 1N8IA 2P10A 3O15A 3GUGA 4J2PA 1M9HA 2P8CA 2FPYA 4FZIA 2AMGA 1OFPA 3EA3A 1HFBA 1ZAJA 3AHVA 3AROA 4L5ZA 2WZTA 1V02A 1M41A 4X9YA 3EXTA 4E38A 4G6CA 2E6DA 4Q7IA 1RBAA 4L9XA 1GHSA 1M7JA 1CENA 4M29A 1EKOA 4S3KA 3SGUA 3WDHA 3U4AA 4XB3A 4HNUA 4C60A 2R14A 3QGKC 4ICNA 2DSKA 4BHYA 1EPVA 2Z7KA 1IXPA 3H2MA 2I9EA 2VOMA 2WANA 4DQWA 2DQWA 2EF9A 3NAVA 4NZCA 4IJCA 1XGDA 2G3IA 4LYRA 5BRQA 1LBFA 4UUIA 3LQGA 1R38A 2VVSA 1VYRA 2WZIA 1RUSA 4M81A 4IICA 4JFWA 2NV2A 1E6XM 1TG7A 3UYCA 1O4UA 3VFLA 2ZA3A 4O8RA 3W1NA 1PPIA 2CLLA 5K4XA 3MMUA 3SJNA 4GH3A 4UC5A 4NJKA 1RD5A 2V0TA 3QW3A 1OFEA 1HF6A 4JQ2A 2C16A 3LHUA 4UTTA 4HP5A 1CEOA 3O7UA 1W32A 1TVLA 3GTHA 3L4XA 2EJ1A 1KO0A 1TWWA 1TQXA 4OV4A 4PR4A 3TIMA 1BKHA 3N2BA 5IDZA 4EXQA 3GH7A 2DH3A 3JZUA 4S2CA 3WNLA 1VYSX 3T8QA 3ZIZA 4JL1A 4JCMA 4WDWA 4K7VA 5TQLA 2VRJA 4IPJA 1V4YA 3E9AA 4H8VA 5E09A 4MKNA 1ZBCA 2H8XA 5DANA 1FHLA 4AMCA 2HEJA 5IBXA 2F61A 3PVFA 3N2MA 3M5VA 1Q6OA 2VM8A 2D2JA 1MNZA 2XVLA 4E2OA 3GVWA 4JX6A 2VEMA 3NQ6A 3D3FA 1MRAA 4A8NA 2QCCA 2B31A 2X1TA 3OYZA 3ABOA 4ZMGA 3KRSA 3W1PA 3E1F1 2UY2A 1HJQA 1MW0A 4GQBA 3L12A 1JFHA 4GNJA 2FHBA 1R9XA 1RJPA 1RBOB 5LKYA 2F6KA 2DZPA 2R24A 2C7FA 5F1UA 3C0LA 4A3QA 3WD0A 1WKYA 4XTDA 4YIWA 1X39A 1J11A 1S5WA 2QJMA 4DPPA 1XUZA 2V5JA 2FKPA 1KLZA 2R6OA 2YCIX 4KEMA 1M7PA 5BWAA 3W7NA 3ZVIA 4XZBA 4DYJA 2HWGA 4JIHA 4EWJA 2NSOA 5CSUA 3KRZA 2D22A 4Q4KA 1TPUA 4RE4A 3LD5A 3CYVA 2VC5A 1CI1A 3GXTA 3VKBA 4DUWA 1V3JA 1D3GA 2CEQA 1OC7A 1ZRQA 3BLOA 3RIKA 2DGAA 3RCMA 3RR1A 3REQB 3NG3A 3C52A 3P80A 2REQA 3OBEA 2R1LA 3C2VA 4ACZA 4FALA 1WZAA 1Y8BA 4PB3A 4A2RA 5A6AA 1JZ2A 1XI3A 3QR0A 4NZ3A 4PRWA 3WFLA 2PTDA 3ONBA 5I07A 5CPOA 3KP0A 3M0ZA 2DQXA 2A3AA 3GFXA 3VM7A 3L4TA 3PJXA 3GDKA 4IT1A 1G4PA 1XIJA 1JI1A 4MNKA 2R1MA 2V5BA 1E6SM 1OM0A 3MI2A 4RE2A 3ID7A 2GK1A 3DFSA 4XZMX 3OA5A 5LHEA 3Q37A 1WBHA 4K8GA 4A6GA 4L64A 3CPGA 2QCNA 2VC6A 4DZIA 1EGZA 3W75A 2XSXA 5LSMA 3LV5A 3KTSA 3R25A 2OX1A 2VTFA 4ZO9A 5I09A 3GC4A 5D8WA 1NARA 2R94A 4HHHA 3G8RA 4XBSA 5HINA 3H4GA 1QOXA 4EF8A 5FJJA 3CT2A 2E67A 4Z2LA 3CT7A 4DIAA 3LA4A 4RKAA 4FOUA 5HATA 1NDZA 4PTDA 1TV5A 1F4AA 4M51A 4K1GA 1XLJA 4N2YA 1XLGA 3E02A 4D2JA 5LIWX 5D03A 3H2OA 1GOMA 1JAKA 3HN3A 2QS8A 4QHRA 4AWTA 3WFAA 3A5FA 3BV7A 4B2DD 4M24A 2QJJA 4GIRA 3QZAA 1Z8AA 3VIJA 7XIMA 3B0XA 1G0CA 2VDIA 3AUOA 3SCRA 4PFHA 1WV2A 4W86A 5PTDA 4LVDA 4DXVA 2XGIA 3H7RA 1NFPA 4I7VA 4JIRA 3AXMA 1UD4A 3DH7A 3B40A 1OC6A 3GS6A 1Z6KA 4C7FA 3STGA 2HNHA 1YTKA 1VPYA 1Q3NA 3QLLA 4MKVA 3DG7A 4ZSUA 1JXKA 1DWIM 1CZ1A 4GUGA 1RJQA 1W56A 2WMJA 1QW7A 1EBGA 3K4DA 4LAKA 1KXHA 1R2TA 3B8SA 3KVJA 3SY8A 3S4TA 4UMCA 2XG9A 1HJVA 1XYAA 2V82A 3G0SA 1FFRA 4RDWA 4HBKA 2I57A 1PAMA 3EDDA 3FSTA 1LQ0A 1KM6A 1LOLA 1QOPA 4HYWA 3MHUA 1V03A 4P7LA 1QWGA 2JKPA 2CBUA 4AZIA 2ZC8A 3RHGA 3RGTA 3G1SA 1SW3A 3L5LA 2OWWA 2W91A 3EOEA 1XC4A 4Q8MA 3RUBL 2C71A 3SFWA 1GG0A 1J2WA 1MVYA 3M0JA 2AAMA 4GQGA 4AF0A 5LA1A 1CLKA 1WA3A 1BEUA 4TTUA 3UWEA 1W1A1 3VCCA 1H49A 5KZ6A 1Z41A 2BY3A 1EDGA 3KOXA 4BKNA 2POTA 1TWSA 3P67A 4QJ1A 4PC8A 3T44A 3DFNA 2WMKA 1ONWA 5HWMA 1TR9A 4FXFA 1V7YA 3MJYA 1G69A 4LEQA 3PUOA 2VR5A 3V5FA 2J8GA 4UTWC 3HFTA 4LTSA 4ADUA 2I5QA 4KCTA 1GEQA 5T9BG 5E0FA 3NZGA 1VHCA 3NL3A 3MQTA 3MZNA 4MDPA 3MBFA 1E4NA 1AMKA 2A3HA 2WYSA 4C6CA 1I2PA 2AGTA 4GYJA 1V3HA 3E49A 4H8UA 1T6MA 4BQ2A 1IT0A 2WSRA 4XIMA 1LQAA 2EPLX 5EGRA 5G4HC 3ONCA 2FGZA 3W26A 4UTFA 3CQIA 3PG8A 3DI0A 3VIKA 2PCQA 2GUYA 3IV8A 5K4ZA 3LSBA 3M7SA 2PU0A 4V27A 3WF1A 3QR3A 4PUKA 2ZZ5A 5I23A 1XSJA 2WJEA 3U3HA 4NYYA 1K70A 4MAVA 3WCZA 4NYUA 1V0KA 3I10A 4BQ3A 2C0HA 3W81A 3H54A 4C6PA 2YDAA 3T78A 3E3HA 5GQBA 1TZZA 4L9ZA 3ZR5A 2GOKA 1G6CA 4HNTA 1GKPA 4IL0A 2Y7FA 1V3MA 2HK1A 4B3KA 4M8UA 2PD9A 3IIXA 4J1OA 1XLKA 3BG5A 1VBHA 1JJKA 4KGJA 3W22A 3ZLFA 1QT1A 3W7EA 2HZGA 4E2DA 2YDSA 1ISXA 2GQ3A 3K1GA 4MY1A 3NCOA 2PZNA 1XDJA 1TJRA 2X1IA 3OZMA 1AK5A 3TR9A 2V63A 2ZWZA 3CGTA 4OIFA 4DELA 4Y9PA 3WLMA 1FWBC 1Q63A 3F1QA 1O5KA 3TU9A 2XZ9A 4WY0A 2XN0A 5D09A 4J28A 1DJHA 1TJ0A 2V2DA 1ZENA 2WHLA 3SUTA 1V6YA 3OGRA 4FSAA 2BXVA 4XO7A 5B7YA 1EOKA 4O1BA 4HQVA 5D8ZA 1GTEA 2Y61A 4QEEA 1SO3A 4QCEA 2DT1A 3SN4A 3WLSA 3CHDA 3UR5A 1E9LA 2HVOA 3CMJA 3BLPX 3WYZA 3B0UX 1TMQA 4NF7A 3THQA 5A6KA 1SMAA 1VEOA 5ABHA 2ICSA 3N9SA 3WBYA 4AISA 4B16A 1W37A 1VZWA 1WCGA 2ZA2A 3MP3A 1UP0A 1ALDA 1DJNA 3KZSA 1UROA 4GGBA 5T8GA 4W93A 3EX6A 2EPNA 3HG2A 4DAIA 2I16A 4ZQCA 4YNGA 3EMQA 2NV9A 4ZE5A 2O4MA 1P4CA 3W2LA 4FEZA 4UB9A 2YSWA 5I6SA 4CU6A 2CCRA 1J0JA 4Y8FA 4EXBA 2BASA 1WDQA 1EP3A 3GBEA 1ONRA 4PB5A 1ZUAX 1L6GA 1HUVA 4MLRA 1MXDA 5BXPA 3BUVA 4XSLA 7A3HA 4GI9A 3Q4DA 3GXMA 1RSCA 3ARSA 4LCSA 2Y5JA 3G2GA 3NQ2A 2WJFA 3LB0A 2BB0A 3KDNA 1B9BA 4JTKA 4BFAA 5FACA 4MNJA 2XFYA 3EGJA 4KIRA 3K4AA 4TVUA 3NOYA 1MRQA 1EX5A 3PZTA 1K7FA 4ERAA 2PDJA 1JYWA 4QDPA 3EWXA 1US3A 5A2CA 4CU7A 3GXIA 1GG1A 1PZ3A 1X8CA 4R7JA 4GX9A 2VUYA 3VDGA 1QPNA 3AZSA 1B31A 3ARQA 2PFHA 3BXWA 1Q8AA 3MUAA 1RCOB 2WBGA 1EZ2A 3MU7A 5EBUA 3G1RA 1JNEA 1QPQA 3RK8A 2ZC1A 2PTXA 4XD4A 5M1TA 3UJ2A 2B81A 4JN7A 5F4WA 2G3FA 3G1FA 3TW6A 1DJQA 1F6KA 1KM5A 4JL2A 5M2FX 4LUIA 2ZDSA 3QV8A 1I75A 4YPJA 1NWSA 2J79A 4JR5A 4AIUA 1RP8A 4J35A 1CECA 4D8AA 3EBVA 3W73A 1XH1A 4BI5A 3W25A 2NZLA 2DUAA 5DY3A 2C79A 3LX9A 2RJGA 2ABBA 2Y8UA 5CSYA 1G4SA 4HK6A 3RU6A 2WMIB 2GGHA 3CBWA 5D38A 4GY0A 3IRDA 2QUNA 4A35A 3U9IA 3N4FA 4XG1A 2VEKA 1Q4NX 3A9BA 2IPJA 3FYOA 2XM1A 4RV3A 1P0NA 5LNSA 4PUUA 1HNYA 4HU0A 3CZJA 1HG3A 2PWHA 4MIMA 1ESWA 2J7HA 4S1FA 2HXUA 3VUPA 2YLAA 5FJPA 3QVQA 3BSMA 2ZUWA 3VAVA 4CEXC 3G1HA 1SU5A 4KQNA 1H60A 3W4RA 1EFZA 3ZJ7A 3KOFA 1X98A 2XH4A 2E3ZA 4KRTA 3W2MA 1TV7A 4AH7A 1XQLA 4JTJA 4Q6JA 4D6GA 1CB7B 1XFBA 4HMDA 3LS9A 4S3CA 3T09A 5CJNA 3WUFA 1V6VA 3E2QA 3U2ZA 2QCEA 4H7VA 3MCNA 1LL4A 2OGJA 4AXNA 1ME9A 4IFRA 4BF5A 2FMOA 3MSGA 1HGYA 5HWJA 3IJ6A 3TAKA 3EOSA 4JFSA 3SCQA 2QYGA 5CZJA 3LLDA 1BXNA 7ENLA 3UXKA 2DJXA 3NQMA 1XRSA 3U7BA 4CVUA 4LC6A 3YPIA 1T8QA 4CN6A 1B4KA 3W7JA 4FIQA 3WDRA 3S9IA 3USZA 5BRBA 3GC5A 4WJXA 5CPQA 5EKYA 2J9XA 4B4FA 5HNRA 3DG3A 1UQZA 1B0IA 2X7VA 1CBGA 3AYRA 3OTRA 5LHFA 1XKYA 4QEHA 4C91A 3VGDA 1MI3A 1X6LA 3GUWA 4GKTA 3UZXA 1J10A 1JPIA 1PDZA 4W8LA 2GL5A 3UXAA 1OBAA 2X05A 1IF2A 1OG0A 4H9ZA 3V18A 1NOUA 3BZJA 4KEUA 2HS6A 1LBMA 1HZYA 3QFEA 3UWZA 2XSBA 3A4XA 3EOUA 4R88A 1DQUA 3LBCA 4IMAA 4UIOA 1B4EA 3FYYA 2IS7A 1XG4A 1TPFA 2OX4A 3M47A 5HANA 1CGXA 3CEUA 3M41A 4PE8A 1Q6LA 5JUVA 4Z1AA 2FGLA 2CLOA 1XLIA 3A5VA 3A4WA 3HGJA 4S3DA 3WQ6A 2DIEA 3FY1A 5AYXA 1JPKA 1EJUC 2OQYA 3L0KA 3E0VA 1V6UA 2X0HA 4E8CA 1G4EA 3PZIA 3VNKA 1VB9A 1D8CA 4B92A 1J0ZA 1W5PA 5CAKA 1ADDA 1KW1A 3DFPA 3O16A 1KRMA 1ODZA 5LZLA 4JKMA 2IPWA 5IFTA 1EJRC 2R1KA 4BY3A 3PY2A 2VZUA 3CLWA 1EUAA 2VCBA 2VYOA 4Z17A 4TU1A 1CPUA 1XXXA 4R9OA 1OZQA 4MADA 1C7SA 1X7IA 1YPIA 1RR2A 3E2VA 2F84A 3A4JA 1XIMA 2C14A 3PFRA 3MUCA 4DLMA 4WOZA 1OABA 4HSOA 4JTTA 3GRIA 1EIBA 2PLMA 1T7LA 3LCFA 4LRTA 4WDUA 1NWTA 1K3UA 2Y24A 4C5YA 1ONXA 1UR8A 3EKGA 4MY8A 4QISA 4QSFA 1RHCA 3AIUA 2PGFA 4WD0A 3WIJA 4RZ4A 1JQVA 2I5IA 5BOOA 4QE4A 2ZOXA 3S9YA 2REQB 1B3XA 4QFUA 1O68A 1P6WA 1JVNA 1UHVA 3GDTA 2Y1HA 3CB3A 3LM3A 3WLTA 2NX3A 4BR1A 3AYSA 3CQKA 3ES8A 1Q2SA 1ZU8A 3WKZA 1UIPA 1TMHA 2KX9A 1KA9F 4UCGA 3L66A 4MZ1A 3WBXA 1W1B1 3UNTA 2GZXA 4GVFA 3VNLA 2PAJA 1WOAA 2D2OA 3QZ6A 2WMFA 2Z1BA 2FLIA 4FPSA 3L9CA 3AALA 4H6EA 4HVXA 2PRMA 3IANA 1A5SA 2XJ7A 2Y70A 5CPNA 4ICMA 1R46A 2YXXA 3AZRA 4WQ6A 2PDMA 1A0DA 1NSJA 2CBIA 1P48A 1WKEA 3VINA 4Q3MA 5FJOA 3DGRA 4UTUA 2CIPA 2XIQA 3VFCA 3GBDA 3NZRA 3NR0A 4C7DA 1NDWA 4X22A 4GYPA 1W3KA 2YJQA 3N6JA 2WHMA 1W6TA 3BLDA 3E12A 5AZ0A 3UWYA 4XUYA 1HTIA 1CLVA 1PO9A 4N02A 4CU8A 1VLWA 2NXIA 3QOMA 4LAZA 1PEZA 4QBXA 4MFDA 2H3DA 2FZ8A 1EJSC 3URBA 3AMKA 4QS5A 2WNNA 4PGLA 2VX4A 3CUZA 3GVRA 4GQRA 2NVAA 2Q6ZA 4WY0F 4F2TA 3FGCB 2Y0FA 3EMZA 3WD2A 3LCHA 1TR1A 2QKFA 3CNYA 2CZDA 1UB3A 1XP3A 2QVHA 2YL9A 3ZJ6A 1SFSA 4CD8A 4ZXOA 4D8ZA 1X96A 3CL6A 4PN2A 4LBSA 4QE5A 4AX7A 2X1RA 1WXYA 2J24A 2RHGA 3LOTA 1EZWA 5BOEA 3BW2A 2GGEA 3M1ZA 3FA4A 1SM9A 4KMQA 4P8XA 2PRLA 2EKCA 4PTMA 4D6FA 4NXKA 2W62A 1A53A 2Z1WA 3NM1A 3Q65A 4NY2A 2YW3A 4PMDA 1TO3A 3V4BA 4WKAA 5CJ5A 4EAYA 4LX4A 3ZSTA 3TQKA 4JKKA 1PCKA 2JIEA 1JDDA 5LIUX 3OOQA 4FNUA 2VL4A 1FHUA 1SZFA 1PKLA 3VZZA 4AY1A 2X42A 4IMEA 2Q3RA 1I2NA 4P61A 3APGA 3CAQA 3SN0A 5CPSA 4FX7A 1OB0A 1U33A 3N2OA 1XJBA 1BF2A 4S23A 3C3UA 2GK1B 1RXOB 2PF0A 2QF8A 2OEJA 4XK2A 3E96A 2ALRA 4GI4A 2VEIA 8A3HA 1XQKA 1KGWA 1L6SA 3IPWA 3MMWA 3DN5A 1JUKA 1GQNA 3VNMA 1RLDA 3EWZA 5A94A 3Q45A 2PI6A 2L5HA 3STEA 3QHMA 3KVLA 3NIYA 3LCWA 2NQJA 1F73A 4BF9A 5BU6A 2YLLA 3UGRA 1UD2A 1CXEA 2Y63A 3THUA 3LHZA 1XYCA 2NUWA 3ZJ8A 5C9RA 3W6MA 4DJED 1TPH1 2J7DA 2XVNA 1NFBA 2E68A 4MUZA 2D0HA 1B3ZA 1QDSA 1S2WA 4IXHA 3BG9A 4XKMA 3EOOA 4ZZ9A 5F2MA 3AXIA 4RLIA 2O92A 2ADAA 4PYSA 3PZQA 4G56A 5FEPA 1BWVA 4LEFA 1XLDA 5H8PA 4ATLA 4X3ZA 3TK7A 3NGFA 4WSJA 4B3LA 3ZXWA 2WMGA 4YTRA 4JAWA 3S2JA 5ABEA 3FFSA 4B3ZA 2F6XA 5AN7A 2BY1A 4NIRA 2QDEA 2J7CA 4GLEA 2PTWA 5HXMA 1KRAC 4EAMA 3TXZA 1OFQA 3TR2A 1YE6A 1BGAA 2YBTA 3R10A 1D3HA 2WQDA 5EFDA 3EPOA 2WBKA 3W85A 3KBNA 3KEHA 3POHA 3BURA 1TE1A 2QDGA 4GD0A 5AC4A 3APYA 4DN1A 2X7WA 1FBAA 3KCOA 3QY6A 3MP5A 1D8WA 4PODA 4NZ5A 2BXZA 4CNUA 3T07A 3A21A 5AYBA 3VOIA 4PBGA 2Q09A 2BV9A 2CC0A 2A7RA 1RY0A 2YFNA 4QAIA 2ZKMX 1EB3A 3IAQA 4WJ8A 4Q32A 4PFMA 1IR2A 3W24A 1C8YA 1W1VA 4S3JA 1P0EA 1G94A 1JDAA 1Q45A 4HOZA 5KETA 1HKMA 4YCPA 4PCFA 3FHQA 4UWMA 3VXGA 1EJTC 3LBOA 1E9IA 3MSDA 2DSWA 3UR2A 2Y62A 4AWSA 4ZQNA 4JTEA 4J27A 3UG4A 1TX2A 4KIEA 1W2PA 4C6OA 1Q4WA 3ZO9A 2UZ9A 4R3UA 3H70A 1JI2A 5A6MA 4MB1A 3G1XA 8RUCA 2YFOA 1UKSA 3AO0A 2P0OA 2VXNA 1VEPA 3SRFA 4PZVA 2FVLA 4YJ5A 4X0NA 3O07A 1Q6FA 4J4KA 3OPSA 3PM6A 4JTRA 2FHFA 3ELFA 4NAFB 1AW2A 5CGQA 1S3HA 2ZCGA 3SUWA 1DWHM 3F2DA 3DZ1A 4AUBA 3BOLA 2XWEA 4A3YA 2W27A 4XX6A 4DUOA 1E4IA 3QYSA 1W9PA 3IVSA 4FLSA 3A13A 3VU2A 3P0WA 2DIKA 2WVUA 3M0YA 4MZ8A 3UU0A 3CEPA 1JGMA 3STFA 1HO1A 1NY1A 1TTQA 2E8ZA 5A2AA 3A47A 2CYGA 3U0HA 5FF0A 5JQ9A 2IKJA 1CB2A 4EPEC 1SSGA 4MB4A 3S1VA 2I5GA 4WSHA 2VEFA 2JQXA 3IACA 5DMYA 3CUHA 1WE5A 2ANUA 3AWNA 1ISZA 1NELA 4XZ9A 2VHLA 5EMUA 2GUBA 1VFHA 4O8AA 2XFWA 4CNNA 1JDFA 5LNVA 2J47A 3B4UA 1GVOA 1RP9A 3NQGA 3VIOA 1XH0A 4F66A 1I8JA 1JPMA 1QI4A 3HGOA 4M1BA 1S5VA 1UCWA 4F0HA 3TYEA 1V77A 2BSLA 2VURA 4O17A 3R1ZA 4UCFA 2VX6A 3NEHA 4ZTYA 3ZT6A 5A6SA 5B7ZA 4OE7A 1A80A 4FLQA 1XIGA 1G9HA 2VMFA 3W70A 3T1GA 2FZMA 1MQQA 2ACUA 4JOMA 1IE7C 1NEYA 3ZFHA 3H2CA 2CLEA 2IQDA 2OSXA 3AJXA 1WBJA 4UOZA 2D0FA 5A6LA 3B04A 3W7KA 1R8LA 1RVGA 2PC4A 3TFCA 4PMUA 3B05A 4GBUA 1IWPA 2VQUA 4CVWA 3TOPA 3IK2A 3TOYA 3TQVA 2ZDRA 2VQTA 4AW7A 2Z7GA 3G6LA 4JTQA 1ELSA 4GZJA 4UQ9A 1JEZA 3N4AA 1OCBA 5AYIA 3MKKA 2JGQA 4OBTA 1WZMA 5J5RA 2Q01A 1I0DA 2P50A 3MSYA 1QWKA 1EJVC 3MKVA 4ZQPA 2E9BA 3AQUA 1L2UA 5D9NA 1VPQA 1BPLB 2QUTA 2BHUA 1F3WA 2PDGA 1E0XA 3HG5A 3NQBA 3KWXA 5ABFA 2CITA 4NT0A 4IX0A 1F74A 1FKXA 1NTHA 1M53A 2ISFA 3WD1A 5FJUA 5G1TA 4Q4PA 3PUGA 2ZZ4A 4WDTA 4WY0B 3EWDA 5GNYA 3RPDA 1KLYA 5D9MA 4FOJA 2J9YA 5E0CA 2QUVA 2Y2WA 3GG0A 4CEUC 2FVKA 3IJDA 1UH4A 3ATZA 4NI8A 1CXLA 3R0KA 3LHWA 3WENA 1IWBA 1V6TA 3HQ1A 2NQ5A 3U6WA 5GNXA 1RD6A 1EWDA 2MNRA 4RE0A 4ZL1A 3PPHA 1UA7A 4UTHA 5BXRA 1N2VA 3NNTA 1UWRA 4DJFD 3V5OA 3M6YA 3N13A 4IP5A 4MWAC 2A4AA 3WQDA 1ZZMA 4EKJA 1PV8A 5DY2A 3W6YA 4GI8A 1JYVA 4AVFA 1W54A 4YTSA 4KEVA 3CHCA 2E6AA 1A0EA 4LCQA 5A8PA 2YGYA 4WX2A 2F8QA 1HKVA 3CL7A 1MNSA 2YX0A 4AVOA 3R5EA 4M7SA 3U5YA 2VRKA 3AU2A 4D71A 3L5AA 4DBSA 4IGMA 4FK9A 4S3BA 3SADA 1B57A 1B3VA 2EJAA 2XVKA 3QTPA 3K46A 2EG6A 1Q8JA 1XIHA 1EPXA 2VGIA 5DELA 3SCVA 8CGTA 4F3HA 1KWKA 3ABRA 1I4NA 3SY1A 3O2LA 1PHWA 5FF3A 1KGXA 4HT3A 1SZGA 4A4AA 3GU9A 3AYTA 5D9PA 3FJLA 3KTCA 4L6HA 4WJEA 3WF0A 3KWSA 2ZZ3A 3H53A 3MUZ1 3OA3A 3NWRA 1C90A 3GU1A 1EP2A 1MW2A 2EPMX 3LPOA 4PCPA 5LIXX 3PZOA 4HNOA 3POCA 1VCGA 2WOQA 4KRZA 2JBMA 3KHJA 1BSIA 4ZE4A 4QGCA 4TV6A 2ZXAA 2Z6JA 3P5YA 2OT0A 3AU6A 3UY8A 2Z2AA 2PDIA 3OGVA 2GQAA 5I0DA 5AHIA 1EL3A 5BZAA 4PMNA 1QU4A 1W5OA 4XVEA 4D6JA 3B9DA 4TX9A 2EO7A 3AOFA 3LM7A 2FJUB 2CLHA 4WK9A 4GHRA 4OECA 3STCA 2Q02A 4YL2A 5JBDA 1FWCC 3P8IA 2Z2BA 3SSZA 2XIJA 1PTGA 4JY9A 3SCWA 4UFKA 1NP2A 2ZUMA 3B03A 1UWQA 3VIHA 1V3KA 3I7SA 1H3GA 1K4GA 5FA5A 4MVAA 4UOJA 3WQ8A 3R0DA 4PRRA 4OOUA 1IT7A 3WF3A 1TFVA 3ZS4A 4OHQA 3GX9A 1YMYA 4LAOA 3FJ6A 2YYTA 3MZ2A 3ECQA 4X9SA 3G3MA 1LLOA 2O9TA 1S1RA 3SUSA 4O52A 3PNUA 4IG2B 1HGWA 2WB5A 3OP2A 1F8MA 4GZ7A 3MVIA 1XIEA 4TV5A 1TQJA 1AL8A 4DYKA 1XLHA 5C70A 1K8YA 3SCOA 4GVHA 1HQTA 4URIA 1BGGA 2J62A 4Q4RA 1J01A 3GW0A 3P14A 1XYLA 2PDKA 3VDBA 2CPUA 3QC3A 4UQAA 4XBJA 1R5YA 1F61A 1MW1A 4JFTA 1MUWA 3HGRA 2WW5A 3BLKA 4C1NA 5CBIA 2AL2A 5G5IA 2NT0A 3OZOA 1C91A 4MWAB 2EPHA 4W88A 4AEOA 3OO2A 4FX6M 1GCYA 3FVMA 2WNZA 2WVSA 3MT1A 3E74A 5EU9A 4DLFA 1PJ9A 2DZSA 1B5TA 3SUUA 3WDPP 6ALDA 5ENLA 3FV9A 3CQJA 4BA0A 1W3LA 5AC8A 3R11A 4R33A 3UVAA 1SFJA 1H41A 4LBRA 4FOKA 4XKYB 1EEPA 2QJGA 1JG9A 3GNXA 1O7AA 3GHTA 4ATDA 5A8QA 3KP1A 2RGLA 3L0NA 5E1QA 4YYFA 3F4DA 4NAEB 4AAJA 2IKHA 1F07A 2XIIA 4J3UA 3QGAC 4EANA 1DQXA 5TBOA 4WXZA 4UBPC 4HHPA 3UW6A 1TV8A 4O0KA 1JCMP 4NKCA 4P7QA 5LA0A 3KBMA 4Q22A 2FIQA 1JGIA 4WZHA 3VD3A 3KRUA 4ZEPA 2X8RA 4FNSA 2GQ9A 3OVRA 4DJDC 2D23A 2OFJA 2WVVA 4N6FA 3WJXA 5FOOA 4RNJA 1DV7A 1YTEA 3AICA 3FGCA 5G1YA 4GPNA 5REQA 5HWNA 4O12A 2ZADA 4G5DA 2V8ZA 1KFKA 3SCTA 2VFEA 1ZCCA 5A6TC 4QITA 4M3PA 1RY8A 2AMXA 1UC4A 3NEVA 3NQ8A 3GIQA 4JTHA 1RK6A 1J93A 3W7QA 2V5DA 1GYLA 1PKYA 5HPOA 2F2KA 4EIVA 3VUSA 5BXSA 5IHRA 4J3TA 1ICPA 5BU9A 4LANA 4NZ1A 4EPBC 3IARA 4TVCA 4RZBA 1U83A 2NXGA 1QW9A 1XDLA 2DVXA 3CV7A 1UBPC 1QO5A 3S83A 4B2DA 2AQWA 3BJTA 2GVLA 4QNWA 3OGSA 4UTJA 2UY5A 3K2GA 3WNOA 4GCAA 1OIFA 4WGXA 4AVNA 4Z2JA 3L4YA 2SFPA 2DUXA 1MSSA 1RQHA 1NH6A 3T0AA 3LXCA 2YL5A 4R85A 2DJLA 2BHZA 1TZ9A 1XW8A 3AIBA 3QGVA 5FAJA 1AJZA 3WQFA 1ZP3A 4DWDA 2JFEX 2JGYA 1B3YA 5EBAA 1YX1A 3SRKA 1U5JA 4U33A 4DVOA 3AI0A 3HU7A 2X1UA 1UD8A 4CN4A 1FP9A 2W79A 4MWAE 3OHMB 3PUEA 4E6MA 4CQDA 2X09A 2PWGA 4DXXA 4NP7A 1KWGA 3W7PA 4A05A 4BEUA 3ZVHB 3O6CA 3PPGA 4L1XA 4E0CA 3LERA 4FNQA 2CHNA 3U57A 5M03A 4QSHA 3KS6A 1KM2A 2DZAA 4HMCA 3NFUA 4ZB2A 1L6FA 3MV01 3IUDA 4HGXA 3URAA 4AB4A 2DT3A 1H11A 3HZ3A 1FDYA 1CNVA 1BSLA 4JTUA 3M0XA 4A29A 1PB0A 3BWWA 3E0IA 1FOBA 2XIMA 4MG4A 2XU2A 1BD0A 2VZOA 4ZSTA 3DGBA 3WEMA 4TMBA 2RH9A 1H4PA 1R3TA 1BXBA 3PS7A 5AVNA 3S8HA 3W2KA 4GH1A 1JUEA 2BY2A 5EL1A 1XLBA 4S3FA 3VKAA 1OEPA 4KWUA 4RJEA 4LY4A 5HAOA 4XIAA 4N9EA 4UTWA 4DUVA 5HMFA 4H1ZA 1RQBA 3HPFA 4HMNA 4QCFA 1OZMA 2HRWA 1GW9A 5D2TA 4I9AA 1LL7A 3QXBA 5F4XA 2PDWA 4OOZA 2INEA 5HJLA 4CNPA 1Q7ZA 1SGJA 3CUXA 1V0MA 4NG3A 3MPGA 1X6UA 4C6KA 3VCNA 3SY5A 4O1EA 1UWTA 4GJIA 1SJAA 1W31A 3AS0A 3G5EA 5A6JA 3GNDA 1POKA 3EEGA 2OMAA 3TWAA 4C1NB 4IIFA 2P88A 3GR8A 3CIWA 3W2JA 2JEPA 4QR6A 4N4QA 4Y96A 2NVCA 2EAWA 4PRTA 3H22A 4LS1A 1O94A 1RLCL 1KD0A 1LLZA 4M19A 4D6CA 2ZUUA 3CIXA 4IMFA 1IV8A 2PWEA 3FHAA 1UR4A 5CXPA 3C0QA 4XQ6A 4O54A 1LL6A 3P60A 2XGZA 4KS0A 1GPFA 4KCVA 2OT1A 3WJSA 1TA3B 3CL8A 3NQVA 1GVEA 1O5RA 2ZRYA 5GJMA 3TCEA 5I00A 5DMMA 4H19A 5H8MA 3WK0A 1XIBA 1UC5A 2VC9A 3QKZA 3LNMA 3M4HA 2HK0A 3CH0A 1EC8A 4JTGA 3KW3A 2Z24A 3P74A 3KS5A 4DJEA 3HIJA 2OWXA 4O57A 5L9FA 1DORA 3MHGA 3RYSA 2ZXQA 3IJ7A 4GMEA 2FYMA 1BLIA 1QNRA 3WLRA 2NQ9A 5C9UA 3TYCA 2PTYA 2ZX8A 1S1PA 4H7CA 4E4UA 4L6DA 3N4EA 2DORA 1TE6A 3W2UA 4ZFCA 1XBZA 4DJFA 6CGTA 4EK7A 5CZSA 1CT5A 3MKCA 2F6UA 3HQNA 2PRHA 3PTKA 5JBEA 1XIIA 2NLIA 1QPKA 3GXPA 1XV8A 4XAPA 3SQSA 1UZ1A 3VABA 3CC1A 1B3OA 5H8UA 3ITGA 3IGSA 4K2SA 4HSHA 3BGAA 2QR6A 3LXAA 2PSNA 3L4UA 1A0CA 3SRHA 3WF4A 1DXIA 3UPMA 1BFNA 1K9EA 3H6OA 4LWWA 3USBA 3ZZ1A 1HW6A 3L67A 2MANA 2FFIA 4C6FA 1QPRA 3AIVA 3C4UA 4M6VA 4PB4A 1L8NA 2WM0A 1QPOA 1UWIA 2EG7A 3NO3A 4BZYA 4LUSB 5HUOA 3G24A 2YXOA 1TUFA 1JQXA 1ZAIA 4FHAA 1KR1A 3IUHA 3DIPA 4S3EA 3FDGA 1R7AA 4H00A 5EYWA 1GT8A 3VK5A 4GNVA 2ISDA 1D2KA 3W1TA 1PWLA 3G6MA 1FDZA 4FB7A 2X30A 1KXQA 4IMCA 1WUEA 4K37A 2CZFA 3W88A 3FVDA 1E1CA 4GIYA 1UZ4A 1WYIA 2G97A 1EIXA 4HA1A 4ATWA 2E1DA 7REQB 2VR4A 3FOKA 2HROA 3R7MA 4Q8PA 3CQHA 5AKQA 5AYZA 1CW2A 3GDRA 3L7RA 2FQIA 1E5JA 3R43A 2NSXA 1F76A 2VJXA 3P5ZA 3VGHA 1R6WA 3VX1A 1KCXA 2BZNA 5DF0A 1VJIA 3P62A 3INPA 4XO6A 4ML4A 5D02A 1O5QA 1W9VA 2J74A 2Z6IA 5FCZA 3ES7A 4CKQA 3W72A 3ZVHA 2RFGA 1BG4A 3MJMA 1WAUA 2DW7A 3C5QA 1XWYA 1QNOA 5GNZA 5CG7A 1K8ZA 1UKQA 3LGGA 1H7WA 3M0IA 5HJXA 3TX9A 4XSMA 1LWIA 1W3IA 2P3EA 5LXXA 3BOXA 1GQLA 3LPGA 3CIVA 3QV6A 2Z0IA 4Y9NA 1H1YA 1BYDA 3BLEA 4GY1A 4ZOAA 3UF9A 4MWAD 3IJLA 3T81A 3CXOA 3PSVA 2WQPA 3UNDA 2YDRA 3ME3A 3D5HA 1EGVA 2YIHA 1K77A 3ARUA 3EYPA 4AZGA 1V0LA 2TRSA 4O13A 1H7NA 3CTLA 3ABSA 3UESA 3NYZA 3IUIA 4S3AA 1FQ0A 1KV5A 4JGDA 2AOSA 3JZEA 1P43A 3CHEA 2IPFA 4JYDA 3LMZA 3COTA 1BVNP 3U7VA 4J3WA 2A0NA 4E2VA 3G0UA 3W7MA 3ZR4A 3UWUA 1B54A 3LI1A 4MMWA 1IYXA 3O05A 4YTQA 3SCPA 3SCUA 1TPB1 4XD5A 2XUCA 1XYBA 4S3GA 1OX6A 4UFJA 4EP8C 2B7QA 2VDGA 4F0RA 2ZZ2A 2OKTA 4MOZA 1P1MA 4H01A 4RX0A 3NVTA 3EB3A 2WSYA 3FSUA 4CD5A 1Y5WA 1IT8A 2V3GA 1KM4A 3LCLA 3VZYA 3AXXA 2XTKA 2JKEA 1S39A 5TAOA 2FTWA 2J6XA 4UR9A 4QAWA 3WNPA 4D9PA 1RH9A 1UWAA 4CQCA 2X2GA 3H12A 4F8XA 3AXKA 3IVTA 2Q8XA 1LOQA 2WJZA 3K8MA 2OTDA 1J79A 3UG3A 4L4OA 4Q4QA 1F9CA 1E3ZA 3W1RA 3C3NA 1TPVA 3S5OA 3UWWA 4AHOA 1PWMA 3FJ4A 1HL2A 5E6YA 2OXNA 5A6BD 1F7BA 1MW3A 1D3CA 1IEWA 3NZPA 3G18A 2DZBA 3LDVA 1CYGA 1DWJM 4H04A 2D2GA 2GSHA 4V28A 4Z0JA 1MZHA 3L4VA 4HN8A 3LV6A 1KXVA 3HTWA 1AZ1A 4K38A 4IUGA 3O63A 1J0IA 1GKQA 3P81A 3GK0A 1SZRA 4TX8A 4AQLA 5EMMA 4WSKA 1XG3A 1VQTA 1E6QM 3CUFA 1C3FA 5L6UA 7TIMA 4B5VA 5CC3A 4OTKA 5D2YA 4MJZA 3WNKA 4OBSA 2OQLA 2DW6A 4UTLA 1FWNA 1HIZA 3PNZA 1FY6A 4LUJA 1SYTA 4GC3A 3RM4A 1W8SA 1T0OA 4QROA 4AD5A 3NSXA 3QN3A 1GPWA 1TTIA 3UCQA 3TE9A 1DJGA 2PGWA 5GVJA 2Y7EA 1DTUA 1JYNA 2HV5A 1GZ1A 1FHVA 3QEZA 4W8AA 3NM3A 2BVTA 3S1WA 5KSWA 3AC0A 3H7VA 2JALA 4JHZA 2ON3A 4GY7A 3NURA 1U5HA 5FAGA 3TW9A 2O9RA 5HNNA 4PUWA 5IRPA 1CDGA 4D6DA 3NQAA 1JCXA 3MWAA 3QQWA 2FZ9A 5EMKA 1S2TA