1J6OA

Crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
260
structure length
260
Chain Sequence
HHHHMVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGVNLEDSKKSLDLSKTSDRIFCSVGVHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEAYEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGGPVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEPKYLKYVVETISQVLGVPEAKVDEATTENARRIFLEVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TatD-related deoxyribonuclease
publication title Crystal structure of TatD-related deoxyribonuclease (TM0667) from Thermotoga maritima at 1.8 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 103
structure length 260
sequence length 260
ec nomenclature ec 3.1.21.-:
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1j6oA00
4KQNA 4L6DA 1ITQA 3WMLA 2ADAA 2Z26A 2I5GA 4B91A 2R1LA 4DO7A 1A5OC 2UZ9A 4C5ZA 3F2CA 5HMDA 1I0BA 3MSRA 3UR5A 3PANA 4LCRA 4IQJA 1RJRA 1RA5A 1FWJC 3B0XA 3UF9A 2EG6A 3E3HA 1ONXA 1R9XA 4C6BA 4KEVA 4DI9A 4GX9A 2W9MA 3EGJA 4C6CA 1NDVA 1BF6A 1W1IE 4MUPA 2HBVA 3E2VA 4CNTA 4Z42C 4XAFA 5A6TC 2A3LA 2Z29A 4EPBC 1P6CA 4GXWA 4H9YA 3TN3A 4XD3A 2R1PA 2CZVA 4XD6A 4F0LA 1IE7C 3T8LA 5CH9A 4M51A 2OGJA 3RHGA 5HMFA 1XWYA 1EJSC 2DVUA 4H9TA 4XD4A 3IRSA 4C6KA 3S2LA 4C6IA 2GZXA 1QXLA 1EJTC 3EWDA 1ZZMA 3QY8A 3NEHA 4GK8A 4BJHA 3PBMA 4YIWA 3TNBA 3LNPA 4EP8C 4LANA 1I0DA 1EJVC 2Z2AA 5FSDC 4XD5A 3IV8A 2P53A 2PAJA 3LS9A 4OFCA 1PB0A 5E5CA 2Z25A 4H9XA 2Y1HA 2E25A 3V7PA 3GIQA 3K4WA 3QGKC 2R1NA 4G7EB 3UBPC 1P6BA 4C6NA 4PCNA 3CS2A 1RJQA 2VC5A 2FTYA 4DYKA 4KEUA 4H9MA 3S4TA 2D2GA 3UPMA 2G3FA 4CQCA 4I6VA 2UBPC 4ZSUA 3URNA 4KF1A 3S2JA 4RDYA 4CNUA 3PNZA 2VUNA 2Z28A 4V1YA 4CEXC 2D2HA 1E9YB 4TQTA 3WZ0E 4CQDA 4LCQA 3C86A 1FWCC 1KCXA 1UIOA 4H9VA 3FDKA 1KRBC 2FVKA 1A4LA 3GUWA 4ICMA 4IG2B 4JOMA 1EJWC 3MPGA 1UMLA 3GTIA 4GBDA 3KM8A 4D8LA 5G4HC 1A5MC 1V77A 3WYZA 3GTHA 4GZ7A 4E3TA 4C6DA 1DPMA 4RDZA 4LAKA 4BKNA 2VHLA 1EJRC 2GWGA 3DCPA 3GTFA 1KRMA 1FWDC 5AKQA 5HMEA 4QSFA 2AMXA 4QROA 1M68A 2VM8A 1RAKA 3BE7A 2F6KA 4IFKB 1EZ2A 4IGNA 4KEZA 4RZBA 3ITCA 1RA0A 4G7EA 1POKA 2WJFA 1KRCC 1O12A 3MDUA 4HJWA 1YBQB 4KIRA 2HPIA 1YMYA 3NURA 4I6KA 4IH3A 2VC7A 1XRTA 3AU6A 4EPDC 4BY3A 3IARA 3FDGA 4QRNA 4QS6A 4CEUC 2Z4GA 4C6LA 1UBPC 5LXXA 4KETA 1FWFC 2ZC1A 4HA0A 1ITUA 2QT3A 3OOQA 1K70A 3T81A 2O4MA 1EJXC 1WXZA 3A3WA 3GIPA 2Q01A 3QY6A 3UR2A 2YXOA 4IFRA 4LH8A 3N2CA 3ID7A 4L9XA 3E74A 4IG2A 2HBXA 4ERGA 1K1DA 1PTAA 1J6PA 3OU8A 2R1KA 1GKQA 1RK6A 3JZEA 4HK5A 2E1WA 2RAGA 4ERIA 1NDYA 3DC8A 4P5UA 1FWIC 3LGGA 3E0FA 2IMRA 4J35A 4PE8A 2BB0A 1KRAC 3IACA 3K5XA 4R7WA 3GU9A 4XAYA 3RCMA 1XGEA 1A5LC 4UB9A 3URBA 1QW7A 1XRFA 4IFKA 2FTWA 3OQEA 4LAMA 3A3XA 4H01A 3E38A 2YB4A 3ISIX 4C6MA 3F2BA 2GOKA 3MJMA 1HZYA 1NFGA 3OJGA 3F4DA 4C6PA 4C6OA 3PNUA 4DLMA 1ONWA 2EG8A 2AQVA 1YBQA 3B0YA 3MVIA 1RK5A 4GYFA 1FWHC 1PO9A 4RDWA 1YRRA 1V7AA 3S2MA 1R9YA 4IGMA 3PAOA 1J5SA 2OODA 1FWEC 2WJDA 3MTWA 4C5YA 2WM1A 1A4MA 4KERA 3GU1A 4C60A 1R9ZA 1V51A 1FWGC 2O4QA 4C6QA 3OVGA 1UIPA 2Z7GA 4XAZA 4AC7C 3AUOA 4PCPA 4DZIA 2PGRA 3B40A 3ICJA 3RYSA 3HPAA 3LU2A 2YZ5A 3NQBA 2GSEA 4B92A 1ADDA 1GKRA 2AQOA 2R1MA 4F0SA 1A5KC 4G2DA 1PSCA 3CJPA 3DUGA 3SO7A 3LY0A 4WHBA 1YNYA 2HQAA 3TN5A 4C6FA 2QVNA 1V4YA 3LSBA 1FKXA 4DNMA 2I9UA 4GY0A 4DI8A 2PUZA 2ICSA 3MKVA 1FWBC 4C6EA 2D2JA 4CNSA 3GTXA 3ORWA 4GY7A 1M65A 2QPXA 3IJ6A 4J2MA 3O7UA 4RDVA 4ZSTA 2Q09A 2Z2BA 4C6JA 1J6OA 3URQA 3AU2A 4LALA 3GRIA 1NDWA 4NP7A 4H9ZA 1EJUC 3TN6A 3LA4A 3LSCA 2VR2A 2FFIA 4PBEA 3A4JA 2XIOA 1EYWA 4R88A 1WXYA 4NI8A 3G77A 4WGXA 1P1MA 1E9ZB 2FVMA 1J79A 4R85A 4DZHA 3GG7A 1M7JA 3E0LA 4NG3A 2EG7A 2KAUC 1GKPA 4GC3A 3RN6A 3OODA 2HNHA 3HTWA 2BGNE 2YB1A 2Z24A 3F2DA 4B3ZA 4GY1A 4EPEC 2Z00A 4XAGA 2PGFA 1S3TC 1YIXA 4CQBA 1O5RA 3CAKA 2QS8A 4GOAA 4LFYA 4RE0A 2DVTA 4ERAA 4V1XA 1JGMA 4H9UA 3MDWA 3LGDA 2DVXA 2OB3A 3SFWA 3GU2A 1V79A 2PLMA 3O0FA 3URAA 4C65A 4GX8A 1NDZA 1EF2A 2WJEA 3MVTA 4LEFA 4UBPC 4QTGA 4PBFA 1VFLA 4EPKA 2OOFA 4WVXA 1A5NC 2P50A 3R0DA 4B90A 4IFOA 3QGAC 1POJA 3K2GA 1K6WA 4LAOA 2HPMA 4IF2A 2ANUA 3QY7A 4H00A 4AQLA 3EWCA 4F0RA 3HM7A 4DLFA 4HK6A 3D6NA 2OQLA 2Z27A 4J5NA 3IPWA 3IGHX 5FSEC 4DIAA 3F4CA 3TN4A 1FKWA 4INFA 2GWNA 1FWAC 1RJPA 4HK7A 3S2NA 4KESA 3T1GA 4QS5A 3FEQA 4LCSA
chains in the Genus database with same CATH superfamily
1QTWA 4KQNA 2DZSA 3BLKA 1OQFA 2XN1A 2OLAA 3J7HA 2PTZA 6REQA 1QUMA 3PUEA 1NELA 4Z2KA 1NARA 4UCFA 3T07A 3B0XA 4AMCA 4ZTYA 1I2OA 3R11A 1MFVA 2WCSA 3WMCA 2ACSA 4XVEA 4C1LA 1HT6A 3DKJA 2YR1A 4CUCA 3M64A 3WQCA 4Z42C 3EKGA 4GRSA 1BXCA 1EWDA 2PWUA 2R1PA 3S1WA 4F0LA 3T8LA 2VURA 4Y9MA 2OWWA 3C2OA 1E9LA 5CKSA 1Q8AA 5JH2A 1TO3A 2RJHA 6ALDA 4GKTA 3NDOA 3LCHA 2WSKA 1SYTA 3PBMA 2YJQA 1VJIA 3WLLA 2G97A 4LANA 2QJMA 1K8CA 1EJVC 1VBHA 2GJXA 3N11A 2XISA 3WLHA 3M46A 2FZ8A 1YADA 1H0GA 4IIFA 4PEEA 1ZFJA 3LM7A 3M16A 4GUGA 3ZXWA 1UWUA 4CD5A 3U6WA 3K4WA 2FHCA 4QGCA 1E15A 4O4WA 5IBXA 3OZOA 2YA2A 2J74A 3HURA 2VGFA 2QAPA 3QYSA 4KEUA 1M7OA 4OWGA 1Q6LA 1Q7MA 2D2GA 3AXIA 3UPMA 2WPGA 5H91A 3RMEA 2QPSA 4AWSA 3WNMA 1AH3A 2CHRA 3NGFA 3TZFA 2YDAA 2V67A 1XINA 4CNUA 3O07A 3LI0A 1J9YA 1FTXA 2XJ7A 1EIXA 1TPFA 5CPSA 3WH6A 3CHCA 4CQDA 5RUBA 1KCXA 2VVSA 3EOLA 1QBBA 2FPTA 4JYEA 2V2DA 4EXAA 1LRNA 3KM8A 4Y9PA 2E8ZA 5D9PA 1PHWA 3G1RA 2V82A 3CWNA 2DSKA 1QW8A 2W91A 3FXYA 5JIPA 1J01A 1XRSA 4FPSA 3MQTA 5ABGA 4Q3MA 4DAIA 1KBIA 5TF0A 4JR5A 1J2WA 4RNFA 3V3WA 3MDUA 1QHZA 1OG6A 4HHMA 2D73A 3UP8A 2BX7A 4B5TA 5CG0A 3RCYA 3AZTA 2PDWA 3T0TA 1J11A 3IJ7A 1UASA 3RITA 4MMWA 2GL5A 3PTMA 1VS1A 3EWXA 5B80A 1UBPC 3GW3A 1HL8A 2CNCA 1MRAA 1ZP3A 4PGLA 2FTPA 1ITUA 4F3HA 3QPEA 3OYZA 1D9EA 1TV7A 1T8XA 1H2JA 5DRCA 4ZB0A 4K8HA 5FEZA 1XYAA 3GR4A 2X7WA 4ZGYA 4DWSB 2HTMA 3AS3A 1ZALA 1Z48A 4JN6A 4FXFA 2GDVA 3UCQA 5FI8A 4GI4A 1ZBWA 3SN0A 1GVQA 2IS7A 2BB0A 1W1ZA 3G8EA 4Q8PA 3WLIA 3KBWA 1EQPA 1LUCA 5LA1A 5I03A 6REQB 3IAQA 4BCEA 2Y2WA 3URBA 1CI1A 5HQEA 3RPMA 2OELA 1XH1A 4EWJA 4Z1CA 1IEXA 3AJXA 5FJTA 1FDJA 3ITXA 2ON3A 6PTDA 4C6OA 3PUDA 4NXSA 5KEZA 2EG8A 2A3HA 1RBAA 2F2HA 3VX0A 3OGRA 3W7RA 3CNYA 2AL1A 1I2PA 2F84A 4RZ4A 4ZFMA 2REQA 1UH2A 4FIRA 3MMUA 3CTTA 3DFTA 5FJRA 1W37A 3TTEA 1HF6A 1RXOB 2VDGA 1G0CA 2VOTA 3NEVA 3W28A 4BQ5A 4ZZ9A 1SJBA 1W1PA 3WD1A 2OO6A 4FALA 3B40A 3UVAA 4HA4A 4JTUA 2GSEA 1R6WA 1YTEA 3W88A 1GKRA 2QCMA 1YX1A 2ZUNA 2Y63A 3KL5A 4YNGA 2FYMA 1A5KC 4EF8A 4PSPA 3APGA 1FXPA 3G5EA 2PP1A 4UTTA 3GH7A 1RVKA 3DKLA 4C6FA 1E0UA 1V6WA 2E7FA 5C2XA 5CAKA 1GQJA 5I0DA 4JXCA 2A3BA 4U3AA 3NPUA 4C6EA 1IGWA 2OFJA 3GR7A 3KWSA 2FHBA 4I8DA 4FOJA 3I6RA 4QM1A 3DBNA 3GRIA 3W3OA 4TVUA 4UTJA 4A4AA 3LA4A 5C9XA 3W26A 1ZLPA 1QBAA 3ABXA 3DFSA 3DHFA 4JHOA 4P7OA 4TV5A 5IOBA 1J79A 1W17A 2VNCA 1M7JA 3QR3A 5AY7A 4IXHA 3BAXA 2C7FA 1GKPA 1ME8A 3WNOA 3LD5A 3RN6A 3LV6A 1Q3NA 4PMYA 3E5BA 4PB5A 3F2DA 4V2XA 1BGGA 4A2SA 1R38A 4NRSA 3QR0A 4L64A 1NWUA 5C55A 3WK1A 4MB5A 2VVNA 3GVQA 3PBUA 1TTPA 3CIXA 1EZWA 1O6IA 1M1BA 2OB3A 3VILA 5AB3A 3SFWA 2FPYA 3IJ9A 1JVNA 1Y5XA 3K4DA 4S1FA 2DU2A 1XX1A 2VO5A 1WDRA 3L4TA 3CAVA 2WW5A 4NT0A 1P0NA 5GJNA 1A0DA 3ITYA 4GQQA 3TSBA 1JF6A 1K6WA 4LAOA 1US3A 3NQGA 4H00A 4GO8A 4RPPA 1MW0A 1PS9A 2HNEA 5G2IA 4RXFA 1CZ1A 4P2VA 1MYRA 3C5QA 4DIAA 1B3ZA 3H24A 4B3LA 1UWTA 1JDFA 4AWTA 4L80A 3F4NA 5H8PA 4QS5A 3LYEA 1YNPA 1LL7A 5E6ZA 3U2EA 3N25A 4UTKA 1UQYA 2X16A 1GUVA 1I0BA 1LUCB 4XKMA 4LCRA 2QF8A 4AY8A 1FWJC 1ZP4A 1CXHA 2V38A 4NJIA 1GQNA 4TTUA 4ILSA 4EWND 4H04A 3N2XA 1F07A 2GPTA 3LZ3A 1UR1A 1YQ2A 1BG4A 1H7RA 1OJXA 5CPLA 1TVPA 4QG6A 1JDAA 4G8TA 4M51A 4PMNA 1W3LA 3A21A 1L8NA 1WP6A 3A13A 4GVFA 2RDXA 4XB3A 3WNNA 3DG6A 1OC7A 1QXLA 4LVFA 1VBGA 3EWDA 1IYXA 2PRHA 4E6MA 4BA0A 2V5LA 5I09A 3B0UX 4EP8C 4PMUA 4RE2A 1OIFA 3MWCA 1YDYA 1SZGA 1WO2A 5U4NA 3ITVA 2DP3A 1N7KA 1XIEA 1XLKA 2ZRZA 5LZLA 4ZTXA 2ZYFA 3RM9A 5JIWA 3BLOA 3ZJ6A 2GGHA 3GNRA 4XZ9A 4X9SA 4MOZA 1MFUA 4KWOA 1J93A 1A47A 4Z2IA 1PWMA 1OYBA 4WRHA 3SCUA 2WOQA 4Y2WA 2XU2A 3LHWA 3MCMA 4MYXA 2WVUA 4RPQA 3W1TA 1FQ0A 4J3WA 3W7NA 1B57A 5LYRA 2YSWA 4FNPA 4H9VA 1NTHA 1FWWA 5CC3A 2WSQA 3GUWA 3FYYA 2CWXA 1EJWC 3R8GA 4DXXA 1X1ZA 5AZ1A 3B8VA 1DXFA 4PUJA 5I07A 3ANUA 1M9HA 1VQTA 2B0MA 1ZAHA 1WDDA 3CEUA 4KH2A 2NLYA 4G1NA 3LLXA 3TW6A 1ZS2A 3T78A 4LAKA 4HPXA 4R33A 5EB8A 3RAOA 1HIZA 1YDVA 2ZQ0A 4A05A 2Z1BA 2VM8A 1S5TA 1NWTA 2WCAA 3WUGA 3N9SA 2VJXA 1WCGA 1QOQA 2PMQA 3CZGA 1F6PA 3VKJA 1UUMA 1XSKA 5F2LA 1JI1A 2ZUVA 2Z4GA 3AICA 1KBKA 1HGWA 3RRXA 5LHEA 3LDVA 2QNEA 3NQ2A 2V2HA 1GONA 4BZYA 4R3UA 1GG0A 2V68A 1VGAA 4UTWC 2V5BA 4NNCA 3W4RA 2GVLA 2FHFA 3SSJA 2ZX8A 1J18A 1FWIC 1BTMA 1LORA 2QJGA 2B31A 2DPEA 4A2RA 3MKCA 2RFGA 3UT0A 3IACA 5CCZA 3MUAA 2XIBA 3LHUA 5G4WA 1V93A 1CXKA 3QVQA 3OQEA 1MUWA 1DQXA 1HZYA 2DJLA 4TXEA 3GXTA 1G4TA 2X1SA 1AQHA 3S6TA 1A0CA 3VM7A 3VIJA 3UA3A 3QMRA 4HD5A 2E5DA 1GNXA 3ZS4A 5IXEA 2VOMA 2ZX5A 1TV3A 2OODA 2P5NA 3RX3A 3ZLFA 5BXSA 3FAWA 5FJIA 1FWGC 3WL1A 4H41A 1XFBA 1KC7A 3C8NA 1G67A 1Q13A 1UIPA 3FV9A 4CVUA 2W5FA 3W22A 1VJZA 2C1IA 1OVDA 2BODX 3ATYA 2F61A 1IQ8A 1UPPA 3ARQA 1GOOA 1P5BA 3ZIZA 1HL2A 2ZZ5A 3G22A 1B9BA 1GYMA 1OCNA 2YDQA 5KZDA 3SO7A 4S3JA 5A6AA 2Z1VA 1JCJA 5H2ZA 4O28A 5CGTA 1UC4A 1DIKA 4YHEA 4DNMA 4EK7A 5LIKX 1XCWA 1B54A 3VOCA 1D3HA 4MNLA 3V5FA 3F1QA 3VOGA 1VHNA 3HGSA 2PA6A 1HO4A 1MEHA 1GQLA 2Z2BA 2QW5A 4WCJA 1BYDA 4IPNB 3LN3A 1QNSA 4Z2HA 3L4UA 3PG8A 1U1HA 3C2FA 3AIEA 1ZB5A 1WXYA 1CXEA 1G69A 9CGTA 4IIHA 4NI3A 2TPSA 3NNTA 1DHPA 2FVMA 3AMKA 3A4WA 3UXKA 4F0HA 2W66A 2EPLX 1I45A 2XSXA 4NQ1A 2G3IA 2Z1KA 3KAOA 1REQA 4AW7A 1TPUA 2PP0A 3OGSA 4GUIA 3ZMRA 4OGZA 4PMXA 4XK2A 3RG6A 3CC1A 4CQBA 1O5RA 1R3VA 4JTEA 3IGSA 3EYPA 1M53A 4I7WA 5LNVA 1S5MA 3E2QA 4MKVA 1IIHA 4FLOA 3LHYA 2WMJA 1V5XA 4Z1BA 3IJLA 1TPB1 1RCQA 4YTUA 2WHJA 3KOZA 2CHNA 3R5EA 1P1XA 4MDPA 3S6OA 1JDEA 1C3FA 3GHSA 3WF1A 5A1AA 2OQLA 1XW8A 3NSMA 4WXZA 1XF0A 3TN4A 3TSMA 1VFFA 1TQXA 3SCPA 5A2AA 1SO4A 3W1XA 4O0KA 1HXJA 4O57A 4N7QA 5AHNA 2PDXA 3G24A 1EP1A 3TJLA 1V08A 1KXQA 3UFYA 1UJQA 3MP3A 2QDGA 2WLZA 5CZSA 2NWRA 4Q8UA 4JTCA 4R53A 3HPXA 3A64A 4AIOA 2W9MA 3MUIA 4C6CA 3ARXA 4P7QA 1VLWA 5HQLA 5A6TC 4LT9A 2ZUWA 3O3RA 2BZNA 2NX3A 4WD0A 1JYXA 2NVAA 4WY0A 4G56A 1XWYA 4N9EA 4DF1A 4XD4A 4D1IA 4FLRA 1PIIA 4AHQA 1Q6GA 4IP5A 3AHXA 4JX6A 4JQ2A 2FQIA 4DF2A 3HA1A 3LRMA 2XHYA 1NU5A 4M7SA 4EAYA 2QCNA 1QRQA 5EY5A 1XQLA 3IV8A 3P61A 5CPNA 5I06A 3PZVA 3BL3A 3VNZA 1C8VA 5HWNA 4GZEA 3XINA 5ABFA 2JGYA 5LGZA 2VRQA 2E77A 4GACA 2DQWA 2POTA 4H9MA 5CPTA 1JPIA 4FB7A 4A3HA 3MT1A 4K7VA 3U5UA 1EGMA 3MV01 1PV8A 1ME9A 3PJUA 4HNUA 5D2VA 3KL3A 1M3UA 2GJRA 4OZOA 3CZ8A 1FH7A 4PULA 1R3TA 5GVJA 4US5A 3FOKA 3LHZA 1SFJA 2EBNA 2E6AA 3LLFA 4GQ0A 1PZ2A 1TE1A 4Y9NA 1FHUA 2PDQA 3CMFA 2JQXA 4IMGA 2VCBA 5HUPA 4F66A 3ZJ7A 3TROA 5L6UA 1KM3A 1V77A 3FHAA 4MFEA 3P3BA 1QAPA 4DJEC 3MZ2A 1SFTA 1BWKA 3THDA 4O52A 3WLMA 3VZYA 2QCDA 3NZ1A 2IKGA 2QDDA 3DCPA 1KRMA 3SCWA 3IJIA 2VX5A 4XIMA 1NF7A 4DZ5A 1WDWA 1V3HA 1C9DA 1E6NA 4J27A 3GXNA 3DYOA 2BVTA 1RA0A 3K46A 3QC3A 5HBFA 4ZR8A 1KM6A 1GOXA 1Q5MA 4N02A 3GYCA 3FGCA 3QFEA 5AVNA 2E9LA 2OG9A 2C0HA 4LC8A 3W7QA 5KITA 1AL7A 4ES4A 1E40A 3K1GA 4N4PA 1NP0A 5LXXA 3G1YA 1RUSA 3HJEA 1FWFC 4E4UA 3O6AA 2DT3A 1IF2A 1S5VA 3FA4A 3C61A 4A3RA 3M0XA 4K1WA 3N2CA 3E74A 5HJYA 2G5WA 1M6JA 4LJ3A 2RAGA 4PFHA 4I8YA 3JS3A 3WJSA 3N1AA 5F4WA 2BXVA 3D0CA 1KRAC 1Q4WA 4DUXA 4KCUA 1TWIA 1WX0A 2CLHA 4AU0A 3W23A 4AZ7A 4Q8NA 1S2CA 1QW7A 4HNTA 3SRHA 3D3AA 4V27A 1PEZA 3ISIX 1XG3A 4FLQA 1XCXA 5E1QA 2QQ6A 4KFOA 4ADSA 2DY3A 4W5UA 4GYFA 1WZLA 3S2MA 1C93A 2GQ9A 4GA8A 1FWSA 4RW5A 1J5SA 4WY0B 3MP4A 2ZXAA 2WM1A 1A4MA 4KERA 2ZXDA 1R9ZA 1XYLA 4ZOBA 1MZHA 4HYWA 3CMJA 1TPEA 4ZBCA 4DZIA 3RLHA 1QASA 1O5QA 1VYSX 4K36A 4WKFA 3HBLA 4MPQA 2ZDRA 2XH7A 3HGRA 3C8FA 1H7OA 4ZO7A 3SCNA 3DFOA 3W53A 2PDLA 1LLWA 4JNMA 2ATSA 5HNTA 1YEYA 3LY0A 4IOTA 2QMKA 2HQAA 3PSVA 5ABFB 3H23A 1WBJA 4UUIA 3AHZA 3LTSA 2NX9A 3MKVA 2G3NA 2P8CA 3MYPA 2QPXA 4J2MA 4RDVA 1TTJA 3GC5A 5BU9A 2G96A 5D30A 1CBGA 3O63A 3VAVA 3ALFA 4PBEA 2ZWYA 4PMJA 3A4JA 1EYWA 2ZWZA 1HQTA 3E49A 5DMMA 3VD7A 2CC0A 4IX2A 2OZ0A 2EG7A 1R0MA 4YTRA 2PDFA 4MKNA 2XWEA 3OODA 1C92A 2VEGA 3HTWA 2HK1A 2QCDB 2H6RA 1E6QM 1ZBCA 3CAQA 3QQ0A 3UJRA 1XLGA 2VCCA 1EH9A 3RXZA 4GNKB 3N34A 1VENA 4DJFC 1QNQA 2HZGA 2DVXA 5MHBA 2ZRWA 2PLMA 3BW3A 1NDZA 1KXHA 3FGCB 1LWIA 4ZMGA 4JGDA 1QMLA 2NQ9A 1OGBA 4B4FA 3BOFA 1QNOA 5EL1A 1HVQA 2X40A 3LQGA 5D38A 3WLQA 3WJYA 3T08A 2FZBA 1KCKA 3QY7A 1A5BA 2V5JA 1JEZA 3N19B 1S38A 4DPQA 3KLLA 4TTGA 3CUIA 4YTSA 4CQAA 5FF7A 2GWNA 4HK7A 4HOWA 3WQ5A 5I23A 3B8IA 3KRZA 3NZGA 1J0YA 3WF2A 1CLVA 1LL6A 2WV8A 4EPBC 5IHRA 3K8MA 3FVDA 3A23A 1KM5A 3LRLA 4KWSA 2V30A 4MUZA 2C18A 1VIZA 2ZDSA 3NZQA 1ZAIA 3JR2A 2C16A 5FF2A 1K9TA 3ME3A 3GH5A 5EMUA 3KUMA 4EXBA 1W1YA 2PWFA 1ZCCA 3E12A 3R25A 4GXWA 1C8XA 3R13A 1KNWA 4XD6A 4D6FA 5G2WA 3OA3A 3NWRA 2YDRA 1OZQA 5IFPA 2HVMA 4C6IA 2CLOA 4AFYA 2FB3A 3HQ1A 2HJPA 4NZ5A 1H7NA 4LUYA 3ONCA 1V8EA 2MNRA 1XBXA 3RGTA 2R9RA 3OO2A 1B4EA 2J7CA 5BW6A 2WWDA 1NIUA 3O15A 1BXBA 2PPGA 3WCZA 3MO7A 3E0VA 1E71M 5D2WA 3LLDA 4WDUA 4WLCA 4C6NA 2DH3A 2VFIA 4IQDA 2EKGA 3CS2A 1FH8A 1VZWA 3GVGA 4S39A 5CBIA 3C0QA 1LWJA 1TMLA 1L0PA 1IIGA 4YJ5A 3HIJA 1F6YA 1AUSL 2G3FA 2QR6A 3MCOA 5D37A 4D6IA 1LG2A 2Z28A 2D2HA 1AH0A 5MF5A 4ZQRA 4PR4A 3NUKA 2DIJA 2FVKA 3CHEA 3IUIA 4CCZA 4HU8A 1A5MC 5EGRA 4E4FA 1HP5A 4QG8A 4HZ7A 7PTDA 1A3XA 1DPMA 2OVLA 3RUBL 3KDOA 3KZPA 2DT2A 4QSFA 2WMGA 3LOTA 5D33A 2FMOA 3WH9A 4KS0A 5DMYA 4LQ1A 3MSYA 4G7EA 1B1YA 1XC6A 2J7BA 5CLWA 2WHMA 1F8IA 1T8QA 4FMVA 4AYGA 4QEHA 4IH3A 3TQVA 3BAWA 3GNPA 2F38A 4CEUC 2IPWA 4M6QA 4TX9A 4PMVA 3NJ3A 1O68A 3WSUA 4HA0A 1AZ1A 1PCKA 1WXZA 3CB3A 1VD6A 5G1MA 2YXOA 5K4XA 2XIJA 4JQ1A 3CV6A 1RCOB 4L6OA 2R1KA 1OCJA 3OBEA 3GNDA 1DWJM 4EOUA 2E1WA 2OU4A 2X1UA 3KZSA 3UESA 3LCFA 1XP3A 5CLTA 5K9DA 3EWZA 5IHSA 3PJTA 1XIDA 3GU9A 4UB9A 2F6UA 4ZQCA 2JKPA 1UP2A 2KX9A 4BI7A 3SUSA 3E2SA 3TYUA 3SJ3A 3OIXA 4KCTA 2PDBA 3KRUA 2YCEA 1X8FA 2FLIA 6TAAA 1XD0A 3LG3A 2ZE3A 1Q66A 4W88A 3FYOA 3B06A 1FDYA 4PMDA 4LAUA 4NAEB 2GOUA 1PVNA 2OKOA 2C91A 2JE8A 4I5XA 2UV8G 1HUVA 4JS3A 1EB3A 2E6YA 2XN0A 4L4MA 3B0VC 1BYBA 2GGEA 2ZRYA 2A3EA 1SW0A 3REQA 5D8ZA 4DUOA 4RNIA 3W01A 3WQGA 4E2OA 1KGXA 4HKPA 1JZ6A 1R8LA 1OFEA 1JCMP 1QJWA 4YPJA 2EQDA 4J4KA 4REQA 1X7FA 3QOKA 4PUEA 3WDQA 5A6SA 4IPPA 1CGXA 3AMDA 4Y8EA 4P8XA 3O7UA 4WSHA 4C6JA 1J6OA 1AJ2A 4LAZA 1OC6A 3EKLA 3EOSA 5KINA 2YDSA 4S2BA 4NI8A 1C90A 1UWQA 1XYBA 2I56A 3L2MA 1AZ2A 4HCDA 3T2QA 2QJNA 2HMCA 3VGHA 4DN1A 2YW3A 3BUVA 1FFRA 1RALA 1GVIA 1W54A 6TIMA 4A3YA 4JPGA 3VOHA 3PPFA 5F4SA 2Z24A 2Y61A 1J0ZA 4S2CA 3UU0A 1QPNA 2J7GA 3G6MA 4NUWA 4EPEC 1S3TC 4V15A 4PUNA 1GG1A 4RE0A 2PBGA 1F05A 2X2GA 1IXNA 5HATA 4DJEA 1C29A 4B3KA 3GHTA 2G8ZA 4XV0A 5I3IA 3ZO9A 3U2CA 4C65A 4EACA 1EF2A 2OOFA 4WVXA 1PKYA 1EDTA 3IJ8A 3BAKA 3H70A 5GNXA 3U2ZA 2NQLA 2PD9A 1G9HA 3KS6A 3LUTA 2VZTA 2DDXA 1XKYA 3TKFA 2HPMA 4KKXA 3I3EA 5BZAA 3TTYA 1RBLA 4B5XA 4NX0A 4B5WA 1R3YA 3K8KA 2ZX7A 4NRRA 1CX9A 4J7RA 1V3IA 4KRUA 2YXGA 1XLMA 1TR9A 2PI6A 3IGHX 3QMTA 4MZYA 1G4SA 2ALDA 4INFA 2VI0A 3FW6A 4F79A 1OFOA 5HPOA 4D8ZA 2VELA 4QR6A 1OX4A 4GZJA 3CZLA 3B9AA 4B91A 1GTEA 4DO7A 3H2FA 1H5YA 4KGLA 1OFBA 3BVJA 4C5ZA 4FSAA 3OPSA 4D72A 5A95A 2C79A 2BXYA 2GFTA 2GYIA 3GHRA 2ZZ4A 3CT7A 4D6HA 4W8AA 4DI9A 3AMLA 5I02A 3WDPP 1BF6A 2PTWA 3QGVA 3NG3A 4UOZA 3UZZA 2EHHA 1KO0A 2CZVA 5D03A 3VTRA 2QVHA 4NKCA 2ISDA 4C6KA 3T0BA 2BP1A 1C8YA 3DN5A 2VUYA 5B7YA 1M7XA 4US5D 1KM2A 4YTTA 3EWWA 4AVFA 1DXIA 1OK6A 2DZWA 3WLJA 4BJHA 2D3NA 3RU6A 4JL2A 2E5BA 4PN2A 4MHBA 3AYVA 4WDTA 4QFUA 1CGVA 4L65A 3PB2A 4OUIA 1BKSA 4OOZA 4O1BA 5ABHA 4NZ3A 2KZHA 1GQKA 1HJQA 3MMTA 1WZMA 2Z25A 3RRAA 3V7PA 4XBJA 2R1NA 3UGVA 5CSSA 4DXVA 3NQ6A 1RJQA 2ASHA 1XGZA 3CQKA 3S5NA 4RNHA 1AMKA 4XVDA 4ZOAA 4NAFB 3VNDA 3L0NA 5E0CA 1F3WA 3WH8A 1AW1A 1Z7AA 4RL3A 1BWVA 2AMGA 3F03K 5AN7A 5U7SA 1H1ZA 4QG9A 2V9DA 1JQVA 3URNA 3EDEA 1LCOA 2BGQA 4G5DA 8XIAA 4QCFA 3WZ0E 3MWAA 2AOSA 4IIBA 1C7SA 4ATWA 4BI5A 1A4LA 3WQ4A 1W6TA 2OLSA 4D8LA 1Z8AA 1XLDA 1HKWA 3QSRA 2PZ0A 4R27A 4DUWA 1VFHA 2A4AA 1TJ0A 3UYCA 1LTDA 4LVAA 4US6A 1RCXB 1DTUA 2AMXA 1B3XA 5AC7A 1XDLA 1EZ2A 3LCWA 2J9ZA 5DANA 2XIIA 1NOWA 1EHNA 5AYIA 3UCDA 3B3DA 1Q7QA 1QNVA 1YMYA 3ABOA 1PDYA 3DFYA 4J3VA 1RR2A 3M5VA 5E6YA 3W2MA 4ZXOA 1LBMA 4XSMA 4JKMA 4AMAA 5DY2A 2G3JA 2Q02A 1NWRA 2E9BA 3VD9A 4GXPA 4DJFA 2VWTA 1ZJAA 1DJQA 2GJLA 2WNQA 1EJXC 3A3WA 4UNIA 2E8YA 4Q32A 3VX1A 3VO0A 4JCMA 2IQTA 1PTAA 3PPGA 3OU8A 3EXSA 1DORA 1W9PA 1C7TA 3W2LA 4FF7A 4YCPA 4P5UA 1IR2A 4IHCA 3Q94A 4IIEA 4HSOA 1ICQA 2YCLA 4OBRA 3KBMA 3T6CA 5HWJA 2FB2A 3VGBA 4M6PA 1EX1A 1JCXA 1XGEA 3SADA 2WAGA 4NYYA 4GCAA 3MUZ1 1MO0A 2GOKA 1XS2A 3WQOA 3LZ5A 3TYEA 1ONWA 4GCXA 3BPWA 1HTIA 4TOQA 2OTDA 3BDKA 3KBVA 1KCZA 3LBMA 1JI2A 3U5YA 3W7CA 5FD0A 1EOKA 4UQBA 2H8ZA 1TZZA 3S47A 3KRSA 3VK5A 3TC6A 1V51A 3G1AA 3IANA 4CCCA 1PE1A 1SFSA 3UETA 1CEOA 1T7LA 1W9UA 4V28A 3WKZA 4FNQA 4M81A 2FZ9A 3WNLA 5BYWA 1MNSA 4IMEA 4MZ8A 1M7PA 2YZ5A 7TAAA 2EPNA 4Y96A 4HNNA 4M82A 3W7LA 1XXXA 3LCXA 1MEWA 1W32A 4AHPA 2D69A 4N0RA 4UQAA 4A22A 4XBSA 1V4YA 1JL8A 5FEPA 2XINA 1BSIA 4UQEA 3QHOA 1EWEA 5FOOA 4Z1DA 3MO4A 4WJXA 2HWGA 4BS0A 1H61A 4NZFA 3THAA 3EWYA 3GK0A 1OIMA 3VNIA 3SQMA 4RZ5A 3DFPA 2V3EA 1L6GA 3TTSA 2NLIA 4KCWA 1EJUC 1KD0A 1IXQA 1WXJA 1JCLA 1H1YA 2VZVA 1OD0A 3G77A 1V02A 4W85A 3GG7A 2VR5A 1OD8A 1O4UA 1O95A 2E6FA 3ARUA 3VD3A 5HPCA 2PDNA 3PJXA 4ADUA 1JUEA 4O11A 1UROA 2PWDA 3CUJA 1KR0A 1WAWA 4S3DA 3C4UA 2PD5A 4JQ4A 5C6MA 1VBRA 2ZRXA 1FP8A 1TELA 1YIXA 4HSNA 4L4PA 4GOAA 3VE7A 4JFWA 2VMFA 5C0QA 4H9UA 3RFAA 1XLCA 3CUXA 1VJSA 1R3SA 1XDJA 1Q2RA 1QI3A 1PHQA 2DZVA 4GX8A 1RLCL 4EPKA 3R8RA 5CBBA 3UPWA 2P50A 2WSYA 2YYUA 1RD5A 1PTGA 2J8GA 3C0SA 3WDIA 2WC7A 1U1JA 3H4GA 5TQLA 1U5VA 3EEZA 2PLCA 3S3GA 1R2TA 2ABAA 2QF7A 4GYKA 4NJJA 3NO3A 3HM7A 4HHPA 4XTDA 4GJIA 2DW6A 4HU0A 5I3FA 3WQVA 4M80A 4AZCB 3VU2A 2YLLA 4M56A 4Q4MA 2UY4A 1IXOA 3S2NA 2ZA1A 1EP3A 1XD1A 5J5DA 3FEQA 3OGVA 4UTMA 3PBGA 4QCEA 2YCLB 4GD0A 6ENLA 4FXSA 2X1IA 2YZRA 4NJHA 4L1GA 1E6SM 3UZYA 3MSGA 1RJRA 2JALA 3BMXA 1Q2SA 4AZ5A 4WDXA 3UF9A 2VWSA 4JFSA 2AAMA 2ZZ1A 1GGOA 4ICNA 3TW9A 3WK0A 2INEA 2WMKA 4N9CA 4E8CA 2QGYA 5HMFA 3VINA 1GOMA 3LCGA 3FEMA 1GPFA 1BFNA 4IL0A 1ZGDA 2CZ5A 1TVLA 3R94A 2GDUA 3CUFA 5C54A 2A7RA 2A3CA 3T55A 4YVPA 1G5AA 4LNCA 3NCOA 3UR7A 2O9PA 2P53A 4FNUA 3CB8A 1BYAA 1TJPA 3WJWA 2B81A 4MKSA 3SI9A 3NIYA 5BROA 2Y4SA 1IHIA 2BDQA 1GVSA 2RUSA 3H53A 3E02A 1OEPA 1PYFA 1FCVA 1WA3A 3W74A 2UWFA 1XYZA 3W1AA 2YFOA 5D2YA 1UA7A 3F5JA 4HNOA 2GSHA 4RDYA 3ELFA 1TV8A 1F6KA 1U30A 1VFSA 4F2UA 1UZ4A 3CMGA 3V1PA 1UHVA 5C7HA 4HPNA 1VBUA 3UGRA 1GZJA 1FUYA 2GUYA 1SZRA 1E6PA 4GABA 4C91A 3GNOA 2ACRA 1WB0A 4GZ7A 5BRBA 4C6DA 4RDZA 5FEXA 2VHLA 1BRLA 3GTFA 2Y5JA 1W1B1 1TIWA 3VVGA 4PL2A 5BU6A 4QROA 1M68A 3P74A 4MWAD 3EZ4A 5FESA 3QW4B 4KFPA 1POKA 2DFAA 3SY1A 5A6BA 3TOPA 4NZJA 1QPOA 3UXDA 2C19A 2HPIA 4WIWA 5JBEA 1LL4A 2CLPA 1OK4A 3ZQ9A 5D09A 2RGMA 1VR6A 1W1TA 1Q45A 3HF3A 4H6QA 1B4KA 2DZXA 1HL9A 3F4VA 4LUJA 1WV2A 1BGAA 4C6LA 3L0GA 1ZBKA 4LBUA 3MZNA 3W70A 5LGXA 4ZFCA 1AA1B 1O7AA 1GYNA 3Q45A 3BO9A 5EBUA 2Q01A 1LDCA 4WOZA 3W7HA 2E3ZA 2A6NA 3DBPA 4DHGA 3W37A 1JD7A 2OWXA 2FDMA 1B30A 1WPCA 3DXIA 1KWGA 3U48A 3UJSA 2Y24A 5TD4A 3W2NA 4MLJA 2QUUA 5BOOA 3M41A 4LUTB 1NQKA 1NOFA 1TA3A 4MNKA 4Z2GA 3ZLHA 3CUZA 3BLEA 1W5MA 3TMQA 3EKZA 1OGSA 3TWBA 2CFFA 4Z1YA 4IFKA 2CWNA 1QW9A 4CD7A 3OJGA 3E2RA 1OFDA 5I3DA 5HAOA 3VNKA 5H6HA 1V6VA 1QPQA 1JCNA 3CH0A 1NJJA 3F7JA 4CU7A 3HB9A 3UZWA 2CW6A 2J7EA 1OINA 2CLEA 2Y7EA 2WLYA 3EX2A 2NUYA 3OP2A 4HZ6A 1ZJIA 2CKSA 3LPGA 3OVGA 3UXAA 2QULA 3NR0A 3P84A 3WNKA 2Z7GA 4F0KA 3UVIA 4HQVA 3Q58A 4FF5A 1QNRA 4PMQA 3FHQA 4EF9A 2YA1A 2B7OA 3HQOA 2VENA 4MDOA 3O2LA 2FJKA 2QAFA 4G2DA 1IXPA 4ZOCA 1TPWA 1EQCA 3JRKA 1AG1O 4XZBA 2XVLA 3L4ZA 3MA8A 2V6AA 3FS2A 1AFSA 2J66A 2PCQA 5F4XA 2VD9A 2ICSA 3AO0A 1FWBC 1PX3A 2FKPA 2D2JA 3GTXA 1NH6A 3UY7A 2I5IA 3ZR4A 2Q09A 1MWOA 2C1HA 4D2JA 2V3FA 5EKYA 3A24A 3CHFA 3NQCA 1ZJHA 5FJPA 1I2QA 3PJWA 4XAPA 5BXTA 1JDDA 2POZA 5IRPA 4M6UA 2QIWA 4AEEA 3GXPA 1UP0A 2JEQA 1MVYA 2E40A 4O53A 3S42A 3SQSA 1UG6A 2D22A 2KAUC 3BGAA 1OFQA 3H2EA 3V0UA 4KMQA 1MRQA 1U2YA 4AG0A 1LLZA 1AW5A 2BXZA 2O7SA 1THFD 4GKLA 4LV4A 2YL8A 4JICA 1BRLB 3QJAA 2ZZ6A 4JTLA 1VLIA 1N55A 4YU1A 1IT0A 4MB3A 1A3WA 4ROPA 2BY3A 4D1JA 3W1UA 4F2TA 3NXFA 4Q8MA 3A6OA 4YN5A 3M5XA 2RDTA 4DXKA 3N3MA 4W7VA 3TNOA 5EMJA 3XISA 7REQA 3W7IA 3WUFA 1FCBA 5HQMA 4JTHA 5CJ5A 1W1A1 3TA6A 1E51A 3RILA 3RLVA 2JEPA 4JNYA 3NDYA 3AWNA 5HR6A 3G1VA 5I00A 1OZMA 3I6TA 1FKWA 4LYRA 4GLEA 1MXGA 1RJPA 3PZUA 1GQIA 2AGKA 3NQVA 2XZ7A 4MIMA 4D9PA 1XBVA 1DP0A 3DYMA 5ECUA 3WF4A 2UZ9A 3NQ8A 2VZSA 3VCCA 3PB0A 3INPA 3USZA 1JDCA 3BZGA 3F5KA 4YWIA 3BOXA 3WENA 3H8AA 4EE9A 4KEVA 4GX9A 1TYGA 1SJAA 5AZ0A 2J75A 3KCJA 2WANA 1JFHA 2OSYA 3TN3A 2J25A 4F40A 2C3ZA 5C9ZA 4JHZA 1JYWA 3BARA 1F74A 4JHMA 3M0VA 3MCNA 5CZTA 4TX8A 4H9TA 2V8ZA 1OHLA 3S2LA 1L6YA 1IR1A 2GZXA 2JKEA 4Q8QA 4L7ZA 2J9YA 4M8UA 3L7RA 3AYTA 4YYCA 3TFXA 3MHUA 3AIQA 4ZENA 2J9XA 3WD4A 5EMMA 2R94A 2Q6ZA 1E4IA 4MJMA 1FWTA 1N8FA 2D2OA 2YBTA 3SCQA 2QDEA 5DCBA 5AHLA 4NJGA 4LF2A 3G1HA 3H2CA 3OG3A 3IVUA 2H3BA 4Q4PA 3O8AA 1JPMA 5M03A 3BJTA 2VC5A 4IMDA 4NXKA 5D32A 4ZOEA 2ZC8A 3U9IA 3H54A 1VAHA 3NQFA 3SUUA 4M19A 5C70A 3DI1A 4K7YA 5M3WA 2WCGA 7TIMA 1WUFA 3WJZA 1Q6EA 3T09A 4CLMA 1RV8A 1WDQA 3NVDA 3B8WA 4AD4A 3H7VA 4G9PA 4NL1A 1UWRA 3VKCA 1FWCC 1TJ1A 1GZ1A 2GUBA 1TZ9A 3HMJG 4K38A 4R9XA 4DJFD 2AAAA 4A3QA 3DIPA 4GVHA 2BVYA 3PBVA 1ODUA 4N9BA 2G50A 2A21A 1P0DA 1XI3A 4MYAA 2WNZA 1PTDA 4S3AA 3FJ4A 1SO5A 3B9DA 1EJRC 2P3EA 3CHVA 1TE6A 3W7EA 4PTMA 1Z6KA 4JTJA 2AGTA 4QLLA 3WF3A 2BTMA 1D8WA 2HRWA 2CESA 5FJJA 3OG2A 1KTNA 3M1ZA 4W4QA 1OT1A 2BHYA 2OXNA 3TMLA 4I6KA 1KBJA 4I5RA 4PSRA 4L1XA 5IFTA 3HV8A 2VD8A 1OF6A 1B9ZA 4D6EA 1W3NA 2OX1A 4MB1A 4PTNA 1BYCA 1QO2A 3OOQA 2EO7A 3WLKX 4LUIA 1US2A 2BBFA 3VOJA 3PTKA 1Q6OA 3VDBA 1QU4A 5FJUA 2BHZA 4JIHA 1PCWA 1F3XA 4LS1A 3HFTA 5AC6A 2O7QA 4DO5A 2QZRA 1EOMA 2GK1B 3UWUA 1WUEA 3BLLA 2Z1SA 2BWGA 2ZA3A 2XVGA 3EOUA 3MS8A 3I3DA 2XH4A 2E6DA 2YFNA 3GVWA 2TRSA 3AXHA 2QEZA 2FTWA 3T4CA 4A6GA 3ANVA 3M5ZA 3VCNA 1ZNNA 4RX0A 3TDFA 5FF0A 3LPOA 3G2GA 1RK5A 1PO9A 3N9RA 4I90A 3L4XA 1E4NA 1SW7A 4IGMA 3S83A 3PBYA 1YYAA 4BEQA 3O6CA 3S5SA 3SB0A 1GYLA 2CXEA 3EMCA 3GO2A 4ZB2A 1R3RA 3T0CA 5LNRA 4S3FA 1X6LA 4O8RA 3PTQA 1XIJA 2EJAA 4XBKA 3L9CA 1OFPA 3HPAA 4AXKA 1UKOA 3NQBA 4MNJA 1QOXA 4LY4A 3QFWA 1QWKA 2R1MA 3VGEA 1NOUA 3VE9A 4H4IA 1BHGA 4JCLA 4EIVA 4IICA 2NQ5A 1A80A 4LC6A 2QVNA 3T8QA 4U3CA 4JTTA 2P0OA 1L9WA 3BXWA 3NL6A 1Z42A 1ZL1A 1JNDA 1X6NA 4GI8A 4JTQA 3AYSA 4XZHA 1JPHA 3V35A 1ZTVA 1PZ0A 3R6IA 1EA0A 3KVLA 3VNYA 1MNZA 2JF6A 1R86A 3DERA 3OHIA 3TN6A 4J3TA 3ZT6A 3TH6A 5CJNA 2EKCA 5BCAA 2YPIA 2CBVA 4AY1A 3A4XA 3IK4A 3L68A 3CXOA 1P1MA 3CQIA 3WEZA 4J40A 1XCFA 4LUSB 2ZUUA 3GD6A 1TIMA 1GW9A 3CBWA 2GGGA 4LYPA 4JKLA 1OBAA 1CGYA 3L5LA 3HJZA 3ITGA 4GFIA 1Q6QA 1XIGA 3PSWA 5LA0A 5HA7A 2YCIX 3HOJA 3VZXA 2PGFA 1V3LA 2Q3OA 1OADA 4AF0A 4GNVA 3S1XA 1EUNA 5K9CA 4JY8A 2HS6A 1AQMA 1DV7A 3N04A 3LGDA 3RX4A 1EIBA 4EKJA 1SW3A 2BGSA 4LVGA 1JXKA 1QR7A 4WOQA 1E1CB 1VFLA 3CWOX 4LSBA 5DO8A 5A8QA 4H8HA 2WC4A 2XFYA 3K2GA 3VABA 4O10A 1MZRA 2ANUA 4AQLA 2NXGA 4FX8A 1NM9A 4DZAA 5HOSA 4IMAA 4XZIA 3EAUA 3WQ8A 3P8JA 5AYYA 3B03A 4PCTA 4DNHA 3W0KA 5I3KA 4S3BA 3ECQA 4KWUA 4MWAE 1R2SA 4JDYA 3GYEA 1VKFA 1A5OC 2J62A 1MQRA 4DJDC 3AXMA 3AS0A 3WDRA 1P0EA 1R9XA 3VI2A 3MUXA 3B8SA 1W3HA 3ENLA 3QN3A 4FX6M 3HQPA 3JVAA 3W86A 1W91A 2Q3RA 1N8IA 9RUBA 4O18A 1SSDA 2G95A 3A9BA 1G4EA 3CO4A 1CDGA 1IEWA 1S5WA 4O1DA 3DYPA 1S5NA 1H3GA 4B5SA 4YWSA 3OVQA 4IGHA 7XIMA 2XUCA 1J0KA 3BGJA 4BF7A 1YDOA 3LEPA 2Z2AA 3RDKA 4AWEA 3QEZA 3AHYA 1UKSA 3WD0A 4P8WA 4U2YA 4JIPA 1EDGA 4UWMA 2WK2A 5IDZA 4YVXA 3MW7A 3UBPC 3EA2A 1H41A 4Q4OA 3APYA 4UFJA 4HMCA 1CTNA 4JTGA 4ADTA 2CEQA 3EB4A 1KTCA 2J7DA 2WMIB 4DBWA 4X2PA 1OFAA 1XIHA 2GGJA 4O0QA 1PZ1A 1EFZA 1HW6A 3M47A 4B2DA 4E3VA 1CWYA 1NP2A 2WWCA 2B7PA 1MMFA 1US0A 3TYZA 2RH9A 2HK0A 1OG0A 1KWKA 1OCQA 2JBMA 4Q8WA 3TW7A 4X0VA 5C8BB 3TYCA 5CGMA 4Q22A 3W1RA 1X1OA 1E55A 4QE1A 4LPCA 3NFUA 1YPFA 1WKEA 1DJXA 3WBEA 1XLHA 2BOGX 3WY1A 2H9AA 2NV1A 4CN6A 1A3HA 1XIBA 4GJ1A 3BJSA 1IWAA 4AF0B 1UZDA 2E5CA 3KBNA 4X2RA 2OMAA 4ZL1A 1WZAA 1XBYA 5T91A 5HDRA 5KZEA 3SR7A 4ALDA 2TAAA 2OQYA 1O12A 4HJWA 3DESA 2PTDA 1YBQB 4XUYA 3N4EA 5LIXX 4H7VA 3M0KA 4HJFA 3AU6A 1OABA 4IQEA 5E9AA 3EPMA 1RLDA 4QS6A 4GYJA 3UERA 4K3ZA 1KBBA 3UWZA 5XIMA 5MKGB 2ACUA 4Q8VA 1J12A 1K70A 4PUMA 3ZJ8A 2ZIDA 3CV7A 2P0IA 2BY2A 3U0HA 4O16A 1F9CA 3AMCA 4AISA 3P80A 2VRKA 3NSNA 1VPQA 3VDHA 1FVPA 3LTYA 3L21A 3LTPA 3CQJA 1M41A 3E0FA 4MVAA 3IWPA 1BWLA 1PL9A 1PJ9A 2YCJA 2PRLA 2VEMA 1RP8A 1S2UA 5JUVA 1R87A 1V3MA 1J0JA 4XAYA 3L0KA 4C1NA 4O54A 3MSDA 2XSBA 4DM2A 2VEKA 2OSWA 3PM6A 4H01A 2XGBA 3W1PA 1AL8A 3KVMA 1PUDA 3LRKA 4DLMA 2QXWA 4MGGA 2X05A 3MVIA 2PRMA 1YXDA 3VMOA 2VDHA 2C0AA 3WBWA 2RDWA 4Z08A 4LX4A 4C5YA 3QV6A 1ECQA 4C60A 4MZ1A 3M7SA 6XIAA 1ISXA 2ZZ3A 2BLEA 3FA5A 5AHFA 1GEQA 2Q8LA 1DEDA 3ERPA 3S1GA 1XH0A 4YTQA 3MV11 5CSYA 2DSUA 3W76A 1TMHA 3IUHA 2EPOA 1IWPA 1TCDA 4OV9A 3NXLA 1FCUA 3WMSA 4GUFA 5LIYX 2FFCA 5T9BG 4YCOA 4ZEPA 2DUZA 3B9EA 1Z44A 1UD3A 4F4RA 3OLGA 3W24A 1F5ZA 2E9MA 3LPPA 3UY8A 1GOIA 2ESCA 4ENLA 4LBRA 4LALA 4X0NA 1NDWA 4NZ1A 4UCGA 4HSHA 3LSCA 1XG4A 3UWEA 1JGIA 4X3ZA 2HVOA 4R88A 3THQA 5EMKA 2I14A 2PCEA 4LU0A 1E9ZB 3RNDA 2NWSA 3M0JA 5EMYA 4GIAA 4LYKA 2BVDA 4ZQMA 1MW3A 1PPIA 1UR2A 4W87A 3E0LA 1QDSA 3TFCA 4IP7A 3R4IA 1NFPA 1W9BM 2I57A 4I9TA 1HJXA 2UY2A 5AYBA 1W1VA 2XDFA 4AD1A 3BTNA 3KL0A 2W0UA 1B90A 2H9AB 4OUEA 3GHUA 3N17A 3S5ZA 3BMVA 3OYXA 4ZQNA 3R12A 3EXTA 4WF7A 3STEA 4ZA0A 1GCYA 4JY9A 1ENUA 5HXMA 4XZWA 3AAMA 3HV9A 3DH7A 4A8LA 1UD5A 1V0MA 3QF0A 3SCSA 1K9FA 2PLJA 1UD4A 3PR2A 1IT7A 4PBFA 4H7CA 3EXRA 4GISA 3LERA 1UA3A 3AROA 3R0DA 3VFCA 4U10A 3ZWTA 5DMLA 4IFOA 4IJBA 2QCEA 1POJA 3RJYA 3GBEA 5TNVA 3UJFA 1QI5A 4BFAA 2QCCA 4K2SA 4CNPA 2XTKA 2W4XA 3VIKA 1O5KA 3A3HA 1HKJA 3VC5A 4ECLA 5FSEC 4XG1A 3F4CA 2Y5EA 4BR1A 5JBDA 2CLKA 1IEQA 1RHCA 3KS5A 4HN8A 4KESA 1VCVA 3AHVA 2BASA 1I75A 1OYCA 2E68A 3A9IA 3AQUA 5EYWA 1HG3A 3AWOA 5HMDA 3UR5A 4C1NB 4AYSA 4RE3A 1X38A 3EX6A 1FX6A 2VEPA 3UG4A 3E3HA 4ZXLA 1VFUA 1W5NA 4DQWA 4TIMA 3G0UA 1BVWA 3GAKA 3EMZA 1XJBA 3E0WA 2PWHA 2A3LA 3ZR6A 1KQZA 3GM8A 3MUCA 2PDHA 2V0TA 3BK0A 2DUXA 3N4FA 3AS1A 3C3NA 4QJ3B 3WFLA 3PULA 1CXFA 2Q8ZA 3W1NA 2WKJA 4E8DA 3G0XA 4GH1A 2BS9A 4U28A 1ZBVA 4J3XA 2E1DA 5EFFA 3GXFA 4DX3A 4UOJA 3W83A 8A3HA 1W5QA 1RPKA 3NQDA 4GC4A 1IGSA 1XQKA 3LS9A 1E0TA 1O60A 2Y1HA 2ZFAA 1AQ0A 1P0KA 3WDHA 1P6WA 1X6UA 3STCA 4H19A 3KHDA 4W93A 3S4TA 4LW7A 3V0TA 1MXDA 2OOGA 2J8TA 4HYRA 2GVYA 3H6OA 4U31A 4RNJA 3EDKA 4TV6A 5F1UA 5FF3A 3MBDA 3E6EA 4I7VA 1MI3A 3W6LA 3FDKA 3H4WA 2XSAA 3AZRA 5J5RA 5C9RA 4IG2B 3I6EA 4PA8A 1ISVA 4K1GA 2YBVA 5D9OA 1UW9A 2NW0A 1SPQA 3GAYA 5F2IA 2WQDA 1WDSA 3SGGA 5C2GA 2QUNA 4JIQA 1W5PA 3HO8A 1H09A 3BAYA 3D3FA 3W2KA 3PZMA 3P81A 1RAKA 4X22A 3L23A 3A12A 4GYPC 4KEZA 4KT2A 1YTKA 1Q4NX 3S5OA 1E56A 1S2AA 2NVCA 1DJGA 1Y65A 2VXNA 1X96A 4FI4A 1F8MA 3KVKA 3U2OA 1Y5VA 1GK8A 2VC7A 1UWSA 4FHAA 3VMPA 1GT8A 4WKAA 1AK5A 3L4WA 1XLBA 5DX7A 3O06A 2MUCA 4AX7A 3PUGA 4O1CA 4IQLA 4LH8A 3B0PA 1PBGA 3A22A 2Y62A 4ERGA 4LYQA 2IKJA 1J0IA 1RK6A 1T0OA 3OZYA 1T96A 1J8VA 3LBCA 1J5TA 3DC8A 3IGXA 4HCLA 4DWSD 5C2CA 2NUXA 3EPOA 5LA2A 2WSPA 2QJIA 3DFNA 1KKOA 1EXBA 2OX4A 1F73A 1L2QA 5BXPA 3QTGA 3UNTA 3PZIA 2Y5SA 1E5NA 2JIWA 1MQQA 5I5RA 1OSEA 3YPIA 4XZLX 1AD1A 3LMZA 1PX4A 3CK5A 5D4YA 2AQVA 3K1DA 3U8GA 1KR1A 3H7RA 3O6YX 2WKLA 2OZ3A 4UTFA 4DJDA 3R2GA 4J1OA 1HKVA 2YLAA 4CU6A 4IX0A 4GBUA 5AECA 3FN9A 3LXCA 5HUOA 4QQ3A 2FDSA 1XM3A 4Z0SA 2P88A 1RBOB 3VZZA 3VC6A 4CNOA 3U4AA 4O14A 2DGAA 5G4EA 2GJPA 3PVFA 2IXVA 3BZJA 4QLJA 2QCFA 1HO1A 3DUGA 5M1TA 2E67A 2PS2A 1JCTA 4ZO8A 5E0KA 1QK0A 3NL5A 1KLZA 1Q65A 3VNJA 3WMBA 4DI8A 5HNRA 1WQ5A 3WL0A 1M03A 3ATZA 3NAVA 2ZE0A 1VF8A 4GO9A 3PPCA 3II1A 1DXEA 2HISA 1JZ7A 2FFIA 2F6XA 2XIOA 3FSTA 4F48A 1VEOA 3MC5A 1EXPA 2E0PA 4DZHA 2XZ9A 1CPUA 3O1NA 3FVMA 3SDOA 4GC3A 4R7JA 4LRTA 2HNHA 4KEMA 3ZLGA 5JQ9A 4DB7A 1R2RA 2X7VA 4B3ZA 4UMCA 4GY1A 3IJQA 3QRHA 1G1YA 3KXQA 5A6LA 4TR9A 4LFYA 1ICSA 1GVRA 1DKWA 3UR8A 4FP1A 3MP5A 3MI6A 1E72M 3STGA 1Z89A 4TVCA 2HS8A 4M24A 4DYEA 3RR1A 1V6YA 4Z2JA 3AIBA 2GQ8A 3O0FA 2VFHA 1D7KA 3GXIA 4X9YA 2CBUA 1J4EA 4B90A 4JDBA 4XO6A 5A3HA 1JZ5A 4PTVA 2WZEA 3QGAC 3R58A 4WJEA 2HSAA 5I77A 5A5WA 3GB6A 5DXYA 1FY6A 1F4HA 3B8TA 1XR2A 2DT1A 3KOFA 5E9XA 4NVTA 4DLFA 4HK6A 5JVLA 4NIRA 4AD3A 4FNSA 1LQ2A 1QHPA 2J77A 2Z27A 3BMWA 2QGHA 3W2JA 1EX5A 4MJ4A 2DSWA 3GUGA 1EEPA 3F4WA 1NWSA 4JYDA 3WQ6A 1Z3NA 4H6KA 3Q2DA 3E1F1 3EOOA 3RF9A 3ABZA 1DWGM 3M07A 1X98A 4UTLA 3PANA 4FNTA 1CGTA 4JQAA 1RA5A 3AXKA 4Z2LA 3DG3A 4A21A 2EG6A 4IPLA 3H22A 4HYVA 3QHNA 3WELA 3RO8A 1TX0A 1NDVA 3OBAA 4QDWA 4LS0A 1W1IE 4S23A 2WO5A 1AQFA 1I2RA 4JTRA 5IM51 1V0KA 3CM4A 1FBAA 2PBOA 4XO7A 2FZMA 4EX4A 1ZHAA 3QZEA 2VTFA 1VPYA 2G37A 4B2DD 2WQPA 4LVBA 3QLDA 1QI4A 2W62A 2CLFA 4J28A 4RK8A 3CPUA 4GQRA 3V5CA 3KEHA 4F8XA 3IV3A 1EJTC 1M04A 2NQHA 4MJZA 4XISA 2YYTA 2J8FA 3DHDA 2OZTA 4G7FA 1BF2A 4FK9A 1T5AA 4OKDA 4E5TA 4XWUA 3PFRA 3W6MA 2FZNA 1WKFA 2I16A 8TIMA 4JFUA 1RSCA 2W6RA 2BSLA 1JZ4A 2CCRA 3V75A 2PWGA 5REQA 5K9XA 4PCSA 2E25A 3GDKA 5LIWX 3D5HA 3BOLA 3ABQA 1XC4A 5KTLA 4GGHA 2CERA 4ZODA 3R10A 9XIAA 2VGGA 3TJ4A 1KM4A 4CQCA 2D0HA 4JYFA 4DBSA 2WKGA 1U83A 3GZAA 4ICCX 4KF1A 3S2JA 4UZSA 2C8NA 4AB4A 3W7KA 3P0WA 1UIOA 1DJHA 4FXRA 4JQ3A 2Z7KA 1KA9F 2QV4A 2PDPA 4JOMA 2J6XA 4GBDA 3GDMA 4QJ5B 3VD5A 4XQ6A 4AXNA 3TQPA 3GTHA 3IEBA 4A8RA 2OO0A 3M44A 5C9UA 4ZVJA 4O50A 4BKNA 2A85A 2GWGA 3WUEA 1F3TA 1LBLA 2WVVB 4O1FA 1TQJA 3QQ1A 3SN1A 2W3ZA 3FJNA 3NOEA 3GKFA 1FH9A 1QPKA 3FK4A 3ZOAA 4E38A 4RZBA 1KGUA 1AJZA 1XIIA 2NVDA 1ICPA 2WHLA 3VFLA 3MI3A 3WK3A 2PB1A 3BH4A 2IPFA 3FSUA 4IJCA 1R7AA 3W25A 3W38A 2ATMA 1UR3M 2HE8A 3ARPA 2V5CA 2O92A 3S9ZA 3WLRA 2PF8A 4GPNA 4XKYB 4NF7A 3KTCA 2VX6A 1QWGA 1WOAA 3EDJA 3LCIA 5E09A 3T81A 3G0SA 3S5YA 2RGLA 2VFGA 3OLIA 2GGIA 4P7NA 3TE9A 2PLKA 1AODA 3AOFA 4HK5A 5T8GA 1DJWA 3LGGA 3IIOA 4FLSA 4S3CA 3H2OA 3NGJA 3DZ1A 3ANYA 3W02A 2WZIA 3UJ2A 5D02A 6A3HA 3NPXA 4B5NA 1ZRQA 3L66A 2ZICA 4WSJA 4C6MA 2EXOA 5GPRA 3MJMA 1SSGA 4ZCWA 1ITXA 1NF0A 1V7AA 2ODOA 2QPUA 4YL2A 3O9NA 4U33A 3TONA 1QATA 1M5WA 5CC7A 1K8XA 4ZE4A 4QBXA 3UZXA 4UR7A 2O4QA 2V3DA 3U3HA 3IIPA 3PC0A 4RXGA 3CTLA 3UWWA 4LV9A 5DY3A 4LGXA 5T9CE 3QYQA 3CPGA 4PCPA 3ARZA 1LLOA 1ESWA 2WSRA 1KFJA 3ES7A 3DFQA 3BSHA 2NV2A 1ADDA 2HVNA 4F0SA 5AFDA 2Y0FA 4FX7A 1YNYA 5REQB 2Z1XA 4HPHA 4LOCA 3HZ3A 5BOFA 2FJUB 4JNZA 2R14A 5G1TA 5LNUA 3LCLA 3ARSA 1LQ0A 2CZDA 3ORWA 4GY7A 4NZ4A 3KCLA 1SMAA 1V6XA 3CAWA 5B7ZA 1LP6A 4UMBA 4RW3A 4ZO9A 4EVZA 2ZCGA 3FFSA 3CZJA 4QDMA 3DECA 3UD6A 3PZQA 3W7OA 2Y6ZA 4NAEA 4HOXA 1ZSXA 2WBGA 1MEIA 2RJGA 5F7UA 1Z9AA 4GJJA 1QOPA 1W9XA 2OR2A 2A1YA 2O56A 2JFEX 4OU1A 3SN4A 3HU7A 2VZOA 4X61A 3PK7A 1HJUA 2Z00A 1UWAA 4ZO6A 3MANA 4MFDA 5AHIA 2GVGA 2WC3A 5CC6A 3T44A 3C3UA 3IK2A 1I6NA 1UZHA 1PKNA 4ZB5A 2PDUA 1TWDA 2JF7A 1BXNA 3URAA 4JTSA 4UBPC 2NX1A 4GIRA 1EKOA 3CL8A 2AKMA 2W63A 4GYPA 1Q7ZA 3UWVA 5DN1A 3EWBX 1BLIA 3DHUA 1AH4A 5XIAA 1LZOA 3P93A 5M2FX 4GWEA 2XWDA 3WFAA 2GJXB 4O15A 2ZOXA 2IPJA 1FWAC 4POCA 4MTVA 3GKAA 1K77A 1HP4A 4U5KA 4L6DA 2CITA 4O17A 3ZSTA 4QLKA 3P0XA 1EDQA 1OM0A 1WBHA 1Q85A 1JG9A 2PDGA 4IQJA 4HBKA 4JEQA 4D6GA 2H3DA 2QHAA 1FHVA 3POHA 1JIBA 1W3IA 2Y70A 1I2NA 2PP3A 2R82A 1S2TA 4KBXA 2Z29A 3L2IA 3EB3A 2RDUA 1BD0A 5I78A 3IAPA 4XD3A 3WLNA 5LKYA 2QDHA 1RP9A 1WYIA 2PDCA 2PU0A 1W56A 3N13A 3P2VA 4XIAA 3NOYA 3TWAA 3CV2A 1HFBA 3TK7A 4CD6A 2A7PA 1KFBA 3D47A 1OCBA 3SSZA 2WZTA 3COTA 4E0CA 3W7MA 3V5OA 1D3CA 3LNPA 1W3KA 5F2MA 1ADSA 4A29A 1X97A 4Q33A 1CNVA 2WM0A 1TWWA 2WHKA 1SR0A 2FMNA 1LJYA 4OFCA 3PY2A 5E5CA 4GHRA 2XPKA 4S3GA 4H9XA 2CBIA 4WQ6A 4CKQA 1SU5A 4QE4A 2PODA 3W7GA 3R79A 2ZUTA 2J7HA 3O0KA 1RVGA 3SRFA 1BAGA 4IPJA 1Q6FA 2AQWA 5M5DA 1EUAA 3NYZA 4I6VA 5A2BA 2UBPC 4DAFA 4FOUA 4Q7NA 3W72A 2XFRA 3NSXA 2D1ZA 3PNZA 1XDMA 1IEVA 2C1GA 4LS2A 3G3DA 1MDRA 4LCQA 3C86A 1K9DA 1C9WA 3WLTA 1CB2A 4KCVA 1ZU8A 2ZA2A 4OT7A 3RPDA 4O1EA 2J88A 2ZBTA 3N6JA 5FF4A 2PC8A 4DO6A 4D6CA 3V18A 1Z32X 3CLWA 5M17A 4ZQPA 2AKZA 5TAOA 1TPDA 3KOWA 4CN4A 3MB9A 1YW1A 3VMNA 2CPUA 3BE7A 2XG9A 2OEKA 4L56A 1U1UA 4OQVA 1SGJA 1ZAJA 3HGJA 2YL6A 3TQ0A 4L6HA 2Y8VA 1HKKA 1JNEA 2X0SA 4NSBA 5ENLA 1MUCA 4WY0F 1YPXA 4NAFA 2REQB 3U4FA 5I3GA 2CHOA 3IARA 4RCXA 1G7VA 3K13A 3FDGA 1OX5A 3UWYA 3P62A 4N2YA 3UZJA 4ASTA 4DJDD 1N8WA 2PDKA 1EJ7L 3VIFA 1BVNP 1TB3A 4UNLA 1CENA 4DWDA 1EL3A 3UWQA 2XVPA 1DWIM 4QAWA 5FJOA 3SGZA 3NL3A 1S3HA 1J6PA 3RM4A 3ARTA 3CU2A 3UG3A 4WUIA 1GHSA 3N6QA 1G6CA 9XIMA 4MAVA 4ERIA 4BWLC 2IMRA 1ONEA 1TTIA 2VC6A 2X1TA 4RV3A 5L9FA 4M0XA 4B4HA 3ONBA 3VKAA 4FO4A 1W9DM 3BLPX 4C6PA 4H7ZA 3PNUA 1GJWA 1TUFA 3MI2A 1OF8A 1EC9A 1GZGA 5LHFA 4PRRA 4K8EA 2CZFA 1P43A 4D6JA 3PAOA 3POCA 4TU1A 2YIHA 1SQ7A 1E4MM 3UEQA 4AIEA 1E9IA 3N6HA 1R5YA 1SO3A 4D71A 3T2PA 2Q71A 1PX8A 2P8BA 3HPSA 5A6JA 2OWCA 5IDIA 1T40A 4OBSA 1H1NA 1WKDA 2OJPA 3ZWSA 1OB0A 3ALGA 2WZMA 1JYNA 4PZVA 4P61A 1PSCA 2VQUA 3CJPA 2UY5A 1IZCA 3Q65A 3WDJA 3KRBA 1N2VA 1S46A 2PE4A 4F9JA 3LSBA 4UTIA 4JX5A 1HN1A 3UYIA 1VRDA 4GY0A 1OT2A 4AEOA 3VIOA 3UQNA 1X1NA 4M1BA 4CNSA 1LG1A 3BANA 3Q4DA 1HGYA 3IJ6A 3EDFA 1RZMA 3TIMA 3GSMA 4N42A 4DVOA 1TZ7A 2VGBA 5FA5A 4QP0A 3QQWA 3HGOA 1OGGA 1V3KA 4JTFA 3KW3A 2CLIA 4QNEA 4Q8OA 2OEMA 1T99A 7A3HA 4FR6A 3DC0A 2BOFX 2EPHA 4NG3A 4Y7EA 1XBZA 3BSGA 2IPGA 3VIMA 4QSHA 3BV4A 5CPMA 1K02A 5DEZA 2PTYA 1LRQA 2QUTA 2FGBA 2WMHA 2CYGA 2BFGA 3RPTA 5BWFA 5C9WA 3CAKA 1JZ8A 2DVTA 1IT8A 4WKHA 1CXIA 5A8PA 1JCYA 1OC5A 4C7GA 4OIFA 4PYSA 4IMFA 4WXYA 1FFQA 1UPMB 3GU2A 3WBYA 3FYPA 4W89A 2Z0IA 4H8NA 5CJMA 4H2CA 3BG9A 5BMWA 2PZNA 3FCPA 3DX5A 3SFKA 4X63A 2XFFA 3TVAA 1DHKA 2EEXA 1K6AA 4O1AA 5CAHA 3QSTA 4RR4A 4IF2A 1NSJA 5I24A 3GDRA 3D6NA 3VGGA 4M29A 4ROQA 3LI1A 3DG7A 5J8LA 3TCSA 3W71A 5K2ZA 3TV8A 3T0DA 3DDMA 3T1GA 3CL7A 4QJ1A 4C7DA 3KX6A 5CXPA 3HMCA 2Y7GA 4OJYA 1DJZA 1VHCA 4WX2A 2I5GA 2OGYA 3UG8A 1DJIA 3C2YA 5FAGA 5AC8A 2VFEA 2DZBA 1ODZA 3M6YA 4H8VA 3KTSA 1DOSA 3T40A 3KBJA 1R3QA 4LF1A 3LB0A 3EGJA 3SRDA 3ZZ1A 4O13A 1EA9C 1PWLA 3E2VA 1UYQA 5K7JA 2WMFA 1P6CA 3N12A 1VFTA 2WVSA 3W6YA 1IE7C 3FX4A 5T26A 4LRSA 1VH7A 1VFOA 3H2AA 1D2KA 1GTHA 3HG4A 5HJLA 3K4AA 3T9PA 1ZZMA 4TMBA 3T7VA 3TU9A 3NEHA 4E2VA 3ARRA 4YIWA 4WGHA 3SEPA 4BQ2A 2X2YA 3W84A 2B7QA 3R8HA 3RJXA 5FSDC 4AZCA 5D8WA 1O1HA 4AY7A 2INZA 3UZ5A 2PAJA 3VOFA 3N18A 5I3JA 1PB0A 1UWIA 5FAJA 4DBDA 3R0UA 5AC4A 3TA9A 3C52A 2OKTA 4HTBA 1TJRA 3AC0A 2OZ8A 5KZ6A 2FTYA 4DYKA 1ZY9A 1JQXA 3QZAA 1XLIA 2VDIA 3QTPA 3ZFHA 2YL9A 2IQDA 1KXTA 4Q8TA 1H4PA 2Y88A 3GC4A 2VUNA 4MWAC 3IIXA 5H8UA 3DENA 1GOQA 1SM9A 3B8UA 3LV5A 4UR8A 4A35A 4Q7IA 1VYPX 4AWUA 3WQFA 1MDLA 1TV4A 3Q67A 3W1MA 3GY1A 1IZJA 1FHLA 4NNBA 2VC9A 1GW1A 4WEVX 5KZMA 1H5VA 1XYFA 4K8GA 2QCGA 4UNKA 4LEQA 3M5YA 5FEWA 1H7XA 3P5YA 3VIIA 3LENA 3N2MA 1JZ2A 1KV8A 5AKQA 5DXXA 4PB4A 3MHFA 4HVXA 4F0MA 1XSJA 4BK9A 5F2GA 4CVWA 2EPMX 2DZAA 4IGNA 3FKKA 4Z0JA 2X30A 2X8RA 1JAEA 2HV5A 3CLMA 2IW0A 3TLLA 3AI0A 2NSOA 2DORA 2DH2A 4IGSA 3NURA 1I9CB 4B15A 1A5UA 3KLKA 3P8IA 5CSRA 2DW7A 2WPBA 1JPKA 3AMGA 4RLIA 1UR0A 3H55A 2YW4A 2VCAA 1LF1A 3VDAA 1UOZA 1KXVA 4C90A 1VP5A 1D8CA 1XFCA 3PF3A 3DGBA 3PP7A 3WQPA 2D20A 3GFXA 4KETA 4ML9A 2ZC1A 3WQEA 2DJXA 1SO6A 4BI6A 2Y8UA 3SUWA 4UMAA 4WZHA 2ISWA 4IFRA 3N2OA 4AZIA 1AJ0A 3CO8A 6XIMA 2HBXA 1UR9A 5CEWA 4S3EA 5JMUA 3FJLA 2C6QA 5JXQA 1GKQA 2X41A 2E4TA 5E70A 4O8AA 1EC7A 1TPVA 1X8CA 3S2CA 2VEFA 3BGGA 3IVSA 1A49A 1SJDA 2GQ3A 1TWZA 5CGQA 1BPLB 3LK6A 4QJ4B 1XGDA 3H7UA 1ELSA 4LAMA 2DUAA 3BCFA 3VYLA 2ISSA 2VT0A 1LWHA 3QZ6A 3VUPA 2TYSA 1JAKA 3SJNA 3WFZA 3FKRA 3RLUA 2FH8A 3SAZA 4UFIA 5DELA 3WIJA 3GR8A 1BEUA 2O9RA 1FWEC 4O19A 5LNSA 3R1ZA 1E1FA 3P67A 2DSZA 4V33A 3G8RA 4HCHA 1MUMA 3FNDA 3NO5A 1H7WA 2J24A 2E28A 1Y7VA 4IIDA 1EC8A 1REQB 7CGTA 4H83A 1S1PA 1XKJA 3ICJA 1EBGA 2QUMA 1IEIA 1XYMA 2ZRVA 3C0LA 4PEKA 3B4UA 1ZQ5A 2VEIA 1H49A 4DUVA 4I9AA 5G5IA 1W9VA 4FZIA 3PS7A 4MF4A 3TN5A 5FL1A 1RY8A 4LUTA 1UZ1A 2IKIA 3VDCA 2BMBA 3C2RA 5CG7A 4X60A 1DIDA 2I9UA 3GDLA 4IJRA 1I4NA 3L65A 1NAL1 3W1QA 3GG8A 2D3LA 3K8LA 4H2HA 4D6DA 4YYFA 4M7TA 3CT2A 3SM0A 2NXHA 3VKBA 4KFNA 2F2KA 4MJ2A 3MY9A 2FH6A 2W67A 5KETA 2XH2A 4H9ZA 2VR2A 1AW2A 3UW6A 3WH5A 4R34A 4NYUA 2I17A 2NXIA 3EMQA 3OIHA 1UBSA 1KQYA 1K9EA 3GNNA 4R85A 3BW4A 4DRSA 1XLFA 1NEYA 5D9MA 4XX6A 3SIZA 3SUVA 5DFAA 3OLDA 3OEXA 2QCLA 4FS9A 2INFA 2QS8A 2BHUA 3HG5A 1G7UA 1CGUA 1LOQA 3GLCA 5A69A 2W79A 4L9YA 4V1XA 4UOQA 4KWVA 2HDJA 1A50A 2VR4A 3LX9A 1W2VA 4HP5A 2A6LA 2IKHA 1LYXA 2PDMA 2XIMA 3QPZA 2HEJA 1E4LA 1DQUA 4R7OA 4QTGA 2D23A 3IVTA 4TO8A 3OQ8A 1ONRA 5K3VA 3BV7A 1QFEA 4XZMX 1UUOA 4JTKA 4HN4A 4CCEA 2VGIA 4GE8A 1Y8BA 5BOEA 4UQ9A 3U7VA 1FCQA 1P0BA 1OYAA 4YLWA 5EMLA 1O5XA 4J5NA 4FIQA 3TX9A 4H3DA 1ECEA 3G1DA 4PFMA 2BOEX 1UKPA 1TKKA 3BQ5A 4I5UA 4I3GA 3CYJA 1LOSA 1U5JA 1T6MA 2WJZA 2PFHA 4HNCA 3QHMA 3L2LA 2Z26A 1W3JA 2ZUSA 3QW3A 2PURA 3C56A 3MUY1 3TUUA 2VKZG 2OYMA 5A8OA 4YS1A 4UTHA 3UXIA 4JIRA 1E0WA 2XFWA 1GJPA 4C6BA 2G4FA 4BWLA 1RY0A 1TV2A 2JIEA 3OBKA 4CNTA 1V0LA 4R9OA 3EA3A 4HMEA 1TRIA 4AZHA 4HNLA 1VEPA 3ZT5A 2NV9A 5CH9A 4PODA 2OGJA 3RHGA 2DVUA 1ISYA 4A3UA 1E6XM 4MNMA 3STPA 3W2UA 1B3VA 2QV5A 3NVTA 4HZ8A 4KGJA 3I4KA 3TXZA 2Y7DA 4FA3A 3VCRA 3C2EA 2YGYA 4WDWA 2H90A 1K4GA 1Y5WA 3QC0A 3H2NA 3NQMA 4AZ6A 3APTA 3PUOA 5EA9A 3LQLA 5PTDA 2PF0A 2RHGA 1TR1A 2UY3A 3M6DA 5A6MA 4AZBA 3GWQA 3V1HA 1MW2A 2JKAA 2ZKMX 4DYJA 3GIQA 3QGKC 4GUJA 2HROA 4WSKA 2OEJA 3G1XA 2YX0A 4EXQA 3BW2A 1IV8A 4JFVA 2G3MA 5JU6A 3I10A 3WEMA 1DWHM 4Y9AA 1MW1A 3KHJA 1LT8A 1UD8A 3U57A 4CNNA 3AFBA 1LOLA 4KRZA 1V6TA 4W86A 3RK8A 3PWIA 1TPH1 4V1YA 1E9YB 4TQTA 2NQJA 4MPKA 3GG0A 3GG1A 2XM1A 2IQ0A 1Q6DA 1A0EA 3KDNA 1Q63A 1RQEA 1H7PA 1KM0A 2AL2A 4PUDA 1TX2A 1XYCA 1UMLA 3GTIA 1L6FA 4GINA 5G4HC 3PG9A 1U33A 4UIOA 3OVPA 4E3TA 2WXDM 4GH3A 4IMCA 1F4AA 3W7PA 3QBUA 4A8IA 1FWDC 2IXUA 4NX5A 1DWFM 4UTWA 4XZNX 1JF5A 3BG3A 3L5AA 3O6DA 5AYXA 2NSXA 3WLSA 3OA5A 3W07A 2XGIA 1VPXA 3KCOA 3SZ8A 3VDGA 1TPC1 3GTNA 4FOKA 4JKKA 4DJED 4HMDA 4N4QA 3DI0A 5DLCA 3WNPA 1TREA 2GVJA 3QKEA 1U5HA 1TJ2A 2A3AA 2EF9A 2FIQA 1XPGA 1BSLA 4UC5A 1KFCA 2A79A 2O4MA 1XLLA 1QK2A 3RR4A 1K7XA 4C1KA 1W2PA 3WBAA 3TAOA 4GZIA 3ID7A 4JN8A 1N82A 3GXDA 1K1DA 3AIUA 3USBA 3OLEA 1V0NA 4URIA 1PIGA 3M7WA 2ZX6A 3NM3A 4PBGA 1DVJA 2PDIA 3OW1A 1V03A 3EBVA 4EANA 5H8MA 3KVJA 3EEGA 4NZCA 1XRFA 1JFXA 5A8NA 3E38A 4N6EA 3F2BA 1GHRA 2TODA 3F4DA 4R5EA 1P7TA 3P6LA 4AIUA 4MG4A 4LB4A 3SURA 1KFWA 1KCLA 2G41A 1KB3A 3FAXA 2PC4A 4RDWA 3M4HA 1Q6RA 2RKXA 2CXGA 1W8SA 2BY0A 5ABTA 4NNAA 3ITLA 5D05A 1VCGA 4LNYA 3W73A 1VRXA 1SVDA 1MXSA 1OWQA 2DZUA 1O1ZA 3S0CA 3T0AA 1W5OA 4AC7C 3GC2A 5DMNA 4B92A 4QHRA 2GK1A 5D2XA 2ZZ7A 5DCDA 3N14A 3PZGA 2A0NA 2VRJA 5FACA 2P10A 4PTDA 1H63A 3GFYA 5A6KA 4S3KA 3M0LA 3M9YA 3UG5A 1R3WA 4PUUA 3BLFA 3TYAA 3EWUA 3LXBA 2OPJA 4UFKA 3M0YA 4NP7A 3BC9A 4BQ3A 1KV5A 4IISA 1PDZA 2J78A 3PHAA 4Q4RA 3WLPA 3S9YA 2Z6IA 4RUBA 2FVLA 2AL2B 2CLMA 3WQWA 4GXMA 2V81A 3WJXA 1T41A 4HPJA 4JN7A 4MWAA 3W75A 1B31A 1D7FA 1H51A 3K30A 2J47A 3NPWA 1IWBA 1UD6A 2ALRA 4H6RA 2OCZA 4JTAA 3WUBA 3EB2A 1UB3A 3TXVA 2GDQA 3PN8A 1DE5A 3CQHA 3WK2A 3MMWA 3VIHA 4WR3A 1GVFA 1A5NC 3KP0A 3NA8A 2ZTKA 3TZNA 3MBFA 3SECA 1VBJA 2BNJA 1YLVA 4IIGA 1DIEA 1P48A 2OT0A 4YMZA 4IUOA 2D0GA 2BVWA 6CGTA 4XSLA 1HKMA 2YA0A 2HCVA 5DRIA 1H0IA 1TUXA 3PAJA 4PRTA 3I3BA 2GQAA 4E4PA 2HXUA 4HA3A 5G1YA 3CYVA 4LUSA 1A53A 1E6RA 3L12A 3SQLA 4PB3A 1GORA 2BY1A 5LSMA 3SCVA 3NM1A 2V5DA 4KWWA 2R1LA 2DV0A 2J6VA 3W7JA 3N2TA 3MSRA 1MQPA 3VD4A 4PCFA 4P8UA 5DF0A 3TYDA 1AD4A 2ISVA 4QIUA 4CD8A 1XLJA 5AOUA 5JH1A 1ONXA 1TRDA 1JUBA 1E5JA 3KBSA 1P7TB 1YKWA 4XAFA 4FR1A 1E1CA 4CGTA 4JEJA 1A5AA 3RLGA 1J2BA 4IUGA 4W9TA 3TJXA 4DBUA 5I3HA 1QPRA 3ZM8A 1KW1A 1E3ZA 3NQAA 4MLRA 4K37A 1XRVA 4K68A 2G4JA 3QOMA 2WYSA 1SFLA 3AIRA 4UFLA 4KIEA 3QMSA 3WO8A 3A4AA 4UZUA 3TNBA 3NPVA 3FXGA 4LVDA 3WX7A 3CL6A 4XD5A 3OHMB 3SUTA 1HNYA 3QKZA 3HPZA 1XL9A 1UJPA 3LBOA 1EBHA 4FXJA 2A2IA 2NQZA 2W61A 1YXCA 3QR1A 3RU8X 4G7EB 1P6BA 1DE6A 4QQUA 1K03A 5HJXA 4J3ZA 1TV5A 4B9ZA 4B16A 4GNJA 3NO1A 1PYMA 5BRQA 4ZSUA 5GQBA 3BURA 4FNRA 3LXAA 3DOPA 1G01A 3G3MA 4QNWA 2F9RA 4FAMA 1EHAA 1ZJBA 8XIMA 3CEPA 3EOEA 1RQBA 2MANA 3SW6A 1C8QA 4W7UA 3MPGA 3B4YA 2QJJA 5LIUX 4GI6A 4YXGA 3WYZA 3L67A 3MYOA 1Q6CA 3G6LA 2W27A 3PZNA 4MWAB 3L4VA 2DEPA 4QE5A 2WNWA 5AHEA 4GMEA 1RQHA 4HPGA 2A5HA 4ZQOA 5BMXA 2JGQA 4IPIA 2PSNA 2WB5A 3JUGA 2IUZA 2F8QA 1S2VA 3MHGA 3P7YA 1DYSA 2CU0A 2Y8KA 1GWJA 2WJFA 2DQXA 1XICA 5I79A 4RZ6A 4GI9A 2WMIA 4BY3A 2Q8XA 4QISA 3QH2A 4Z1AA 3CPRA 3I7RA 3CHDA 5CZJA 4H1ZA 1SZFA 1WOBA 1F3EA 3ZR5A 3TJIA 2CLLA 4B5VA 2V3GA 2PDJA 4NY2A 3EDDA 3KP1A 4C7FA 1VYRA 1OFRA 1CGWA 3REQB 3A5VA 3JZEA 4IXXA 3OB8A 2NT1A 3TOYA 2V69A 3NL2A 4O0ZA 3GQYA 3JZUA 3FA3A 4HZMA 4LXFA 1UOKA 1PXGA 2FGZA 4REQB 1JYVA 5I7GA 4S38A 3PWGA 2PWVA 1EEXA 1E1EA 1H60A 3W1LA 4HGXA 3GW0A 3STFA 2R24A 4ACZA 4IT1A 1YBQA 3B0YA 2QIIA 1PIFA 1YRRA 1GOWA 4ACYA 4I7UA 3N15A 5AHMA 3H21A 3GFZA 2OSXA 3N2BA 3CGTA 5KSWA 4NJKA 5MKGA 3UCCA 3CWHA 4C6QA 1K8ZA 2I7GA 1K7FA 1KKRA 3AUOA 1A5CA 3BCJA 1GVYA 4L4OA 2QYGA 3VPLA 1I1WA 1UC5A 5CQ1A 1L6WA 1U22A 3W27A 1KTBA 3LU2A 5CPOA 3PWAA 1XLEA 3ABSA 5BXRA 1JR1A 1UQZA 3VIPA