1J6OA

Crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
260
structure length
260
Chain Sequence
b'HHHHMVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGVNLEDSKKSLDLSKTSDRIFCSVGVHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEAYEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGGPVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEPKYLKYVVETISQVLGVPEAKVDEATTENARRIFLEVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TatD-related deoxyribonuclease
publication title Crystal structure of TatD-related deoxyribonuclease (TM0667) from Thermotoga maritima at 1.8 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 103
structure length 260
sequence length 260
ec nomenclature ec 3.1.21.-:
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1j6oA00
4RDWA 1FWFC 4F0SA 1GKPA 1NDWA 4CQCA 4ERGA 1UIOA 2P53A 3IGHX 4D8LA 4RDYA 1NDYA 1EJTC 3URBA 2PLMA 4XD4A 2AQOA 3WMLA 3AU2A 3E2VA 4DI8A 1FWEC 4KESA 1FKXA 3LGGA 4LANA 4INFA 4E3TA 4UBPC 3GTXA 4QSFA 1YIXA 3GTIA 4KERA 2Z29A 5HMFA 1EJWC 3S2MA 2Q01A 3QY6A 3LNPA 4XAZA 3LU2A 3WZ0E 4J35A 3OU8A 1FWJC 2GWGA 3LY0A 1RAKA 4H00A 1PO9A 3A3WA 4DYKA 4GXWA 4CEUC 3IPWA 3F2BA 3URAA 3UR2A 4H9VA 3KM8A 1YNYA 4G2DA 1M7JA 4LCRA 4WHBA 1I0BA 4L6DA 2Q09A 5FSDC 2ZC1A 1P1MA 3A3XA 4KEZA 2I5GA 4IFKA 1A5KC 4KQNA 4V1YA 3E74A 2I9UA 2A3LA 3DCPA 4LAKA 2Z25A 1IE7C 4PE8A 1M65A 4DNMA 4PCPA 4RDVA 3PNUA 3UR5A 3T1GA 4IG2A 2HBXA 4WGXA 1A4LA 2RAGA 2R1MA 2OOFA 2WJEA 2IMRA 3RCMA 2GZXA 4OFCA 4KETA 4UB9A 4NG3A 4HJWA 5A6TC 4WVXA 3QY8A 1WXZA 4C65A 1XRTA 2GWNA 2QT3A 4EPBC 2KAUC 3S2LA 4R85A 3ICJA 1M68A 1R9ZA 1XRFA 2D2HA 3MKVA 1XGEA 1V79A 3RHGA 1A4MA 4ZSTA 4C6IA 2XIOA 3PNZA 3TNBA 2Z27A 3HTWA 3UF9A 2PAJA 4C6LA 4B90A 3LSBA 4GY7A 3OVGA 4GC3A 2OODA 3RYSA 4CEXC 4HK7A 1RK6A 1EJXC 3GIPA 3A4JA 3S4TA 4ERAA 2W9MA 3GIQA 3QGAC 4C6CA 4IH3A 1YRRA 1FWHC 4IGMA 2FFIA 3TN5A 1ONWA 3UBPC 3IJ6A 4L9XA 3F2DA 4MUPA 2YB1A 1O12A 2FTWA 4C60A 2VC7A 3LGDA 1JGMA 4Z42C 1ITUA 2HBVA 4QTGA 1KRBC 1R9XA 3BE7A 4B91A 2QS8A 1KRCC 4C6DA 2GSEA 3S2NA 3D6NA 2D2JA 1A5MC 3K4WA 4LEFA 2YB4A 1P6CA 2UBPC 4JOMA 3O0FA 4XD3A 2DVTA 1RJRA 2EG6A 1I0DA 2ADAA 4RE0A 4H9UA 4XAFA 1ADDA 3IV8A 4GYFA 3E38A 1PB0A 1FWGC 1V7AA 4CNTA 3MVIA 4H01A 1FWDC 4C6MA 3MJMA 4B92A 2Z28A 4IFRA 1ZZMA 4PCNA 1YMYA 1NDZA 1A5OC 4LCQA 4GK8A 4DIAA 4BY3A 4G7EB 3N2CA 4H9YA 3GU2A 2P50A 4H9ZA 4R7WA 3ISIX 2YXOA 3LSCA 3EWCA 3WYZA 2WJDA 4LCSA 1FWIC 3G77A 4P5UA 1HZYA 4GY0A 2Z2AA 3SO7A 4GBDA 4B3ZA 2HNHA 2HPIA 4F0LA 4M51A 1RJPA 4CQDA 3TN6A 3NEHA 3NQBA 2Z26A 3TN3A 3DUGA 3EGJA 4HK5A 4NI8A 3QY7A 4H9TA 3B0XA 5AKQA 1W1IE 4XD6A 5E5CA 3O7UA 3OJGA 4KEVA 3URNA 3F4DA 3FDGA 4C6PA 1EF2A 3E0LA 2VR2A 1FKWA 3S2JA 4IFOA 2VM8A 1J6PA 1WXYA 1UBPC 4J2MA 1ITQA 4BKNA 4CNUA 1UMLA 2R1KA 4LAMA 3MDWA 4F0RA 2HQAA 4PBFA 4C6QA 4DI9A 4PBEA 4LFYA 4DZIA 3CS2A 3GG7A 3PBMA 4H9XA 1KRMA 3OOQA 4C6KA 4C6FA 3HM7A 2ICSA 1RK5A 3GU9A 5HMEA 3V7PA 2R1LA 2R1NA 3T81A 4DO7A 1UIPA 3FDKA 3MTWA 3LS9A 1GKQA 1J79A 4ICMA 3IRSA 2AMXA 4HK6A 1GKRA 2YZ5A 1FWBC 4C6EA 1RA5A 4C5YA 4DLFA 2VHLA 1J5SA 3R0DA 4GX8A 2VC5A 3OODA 1V4YA 2D2GA 2FVMA 4KEUA 2GOKA 1KCXA 3IACA 4ZSUA 2EG8A 4G7EA 4C6JA 4EP8C 1POKA 1QXLA 1VFLA 1J6OA 4GOAA 1XWYA 3B40A 4C6OA 2Y1HA 4NP7A 4IQJA 2F6KA 2E25A 3URQA 4DLMA 3E0FA 4C5ZA 2Z4GA 1FWCC 4TQTA 2OGJA 3SFWA 3CAKA 4QROA 4CNSA 3B0YA 4R88A 2WM1A 2FTYA 3IARA 3RN6A 3FEQA 4LH8A 4AC7C 2PUZA 1A5NC 4KIRA 1EJRC 4DZHA 2Z00A 1YBQB 3CJPA 4J5NA 2QPXA 1KRAC 2EG7A 3TN4A 2FVKA 2DVUA 2Z7GA 1RJQA 1PTAA 1NFGA 3MDUA 3GUWA 2Z24A 2WJFA 3UPMA 4XAYA 2G3FA 5HMDA 5LXXA 1A5LC 3C86A 2QVNA 3PAOA 4YIWA 4HA0A 1BF6A 4AQLA 3AUOA 4H9MA 3ID7A 2VUNA 4V1XA 2CZVA 1K70A 2OQLA 4I6VA 1S3TC 2E1WA 4QS5A 4EPKA 1EJSC 1FWAC 1K1DA 2O4QA 1POJA 3K5XA 3AU6A 1EJUC 1EZ2A 1EJVC 3GTHA 1R9YA 4IF2A 4GZ7A 3GRIA 2DVXA 4XAGA 4LAOA 3HPAA 2OB3A 3GU1A 1K6WA 1QW7A 5FSEC 3EWDA 3LA4A 5CH9A 3GTFA 2PGFA 2PGRA 3PANA 2BGNE 3K2GA 2AQVA 2O4MA 4GX9A 2BB0A 2ANUA 1DPMA 1E9ZB 4IFKB 4C6BA 1P6BA 3T8LA 2HPMA 4ERIA 3OQEA 3MVTA 4CQBA 1EYWA 5G4HC 4EPDC 4IG2B 1RA0A 4QRNA 2R1PA 1E9YB 3MSRA 1NDVA 4IGNA 4RDZA 3JZEA 4BJHA 4KF1A 3F4CA 3F2CA 1YBQA 4I6KA 4GY1A 3ITCA 1ONXA 2UZ9A 1PSCA 4RZBA 3DC8A 1V77A 4LALA 3ORWA 4XD5A 3E3HA 2Z2BA 3QGKC 4QS6A 1V51A 3NURA 4C6NA 4EPEC 3MPGA 1O5RA
chains in the Genus database with same CATH superfamily
1JDDA 5FF7A 3PUOA 3LDVA 1RXOB 3GXPA 2EPHA 5FEWA 2ZXAA 5ABFA 5D02A 1M04A 4RDYA 4YCOA 5I78A 2QV5A 4DI8A 4KESA 3RG6A 2HVOA 1FWTA 3W73A 1VJIA 3MW7A 4S3CA 3VA8A 2ALDA 2BY2A 1L8NA 2QUMA 2VCBA 1UHVA 1CB2A 3AXKA 4FXSA 4H00A 2J8TA 4ZA0A 3ITTA 5AYBA 4B5UA 2HEJA 1JCXA 1QNRA 3K8LA 3Q2DA 4LBUA 4FOUA 2GOUA 2DSZA 1W3IA 1W1B1 5A8OA 1NELA 3IRDA 3NQGA 2GDVA 1N8IA 1G6CA 2X0YA 2F6XA 4DNMA 1D3HA 1PX4A 3T1GA 1GJUA 1LRNA 3U5UA 3BG9A 3KDNA 4Z1AA 4HHLA 4A2SA 4NJIA 1BWVA 3VOIA 1ONRA 2X1UA 4H6KA 2QPUA 2ZRVA 2DP3A 2ZZ7A 2YCLA 1T6MA 2VZOA 5CZTA 3HV9A 3PTMA 1A4MA 4G1NA 4G6CA 1HKVA 4H1ZA 4HJFA 2NXHA 3RCNA 4XZWA 3VE7A 1B0IA 4A29A 3KDOA 4ZENA 1XIHA 5EMKA 2AAAA 1U5HA 3S4TA 2WOQA 1TV7A 3VNJA 3GIQA 3QFEA 4MUZA 4XBKA 3CNYA 2OYMA 3TYBA 2CESA 1Y5XA 2SFPA 1UR1A 2G8ZA 2GSHA 3VDBA 3CQJA 4HCLA 4HA1A 4GINA 3WL1A 3LGDA 1TWZA 2BXZA 2VCAA 3W86A 1QW8A 1ZJAA 2QMKA 4I7VA 3EA3A 5BWFA 3K4DA 1KRCC 1CNVA 1V0LA 2BTMA 3S2NA 1MNZA 5HR7A 5D9PA 2VFGA 1WUEA 3W88A 1R3YA 2QUVA 1I4NA 3E96A 3TYAA 4XSLA 2P8CA 5DT5A 3HG3A 3W7NA 4YTUA 5LA1A 4D1IA 2FLIA 3EEGA 3FY1A 3TEVA 2XISA 4MDOA 3RGTA 3G1HA 3WNPA 3UCQA 1UR2A 2VRJA 3QYSA 4GJJA 5CGMA 2QKFA 1HP4A 6PTDA 1M53A 3S42A 2Y8UA 4GNVA 2EPMX 1UR9A 4K68A 1HZYA 2PWFA 4E38A 3UEQA 3W1TA 1HIZA 2CXGA 1MEIA 3TQKA 3J7HA 1W1IE 1WBJA 3FA3A 1WKEA 1G69A 2TODA 3OJGA 1OZMA 5G1YA 1PAMA 3GO2A 4J2MA 1J0IA 3B8VA 3BANA 1LL7A 1ME7A 4B5NA 5LKYA 2FPYA 3A9IA 4W5UA 4TTGA 3WLQA 3ARVA 3VTRA 1RK5A 3LQGA 1XCWA 5DLCA 4S3DA 2R94A 1UZDA 2XGZA 8TIMA 1UUQA 1V7YA 1KM3A 5EFFA 5D9OA 4AYGA 3NA8A 8CGTA 3ZYZA 4GJ1A 2ZC8A 2RJGA 4XUGA 2NVDA 3KBNA 3RK8A 2QCDB 5A2CA 2B31A 1JCTA 4CCCA 3CMFA 4O1DA 4D6DA 1KV5A 2FVMA 1Q4WA 4D1JA 4IOTA 2D24A 5HWJA 3HFYA 3ZR6A 4KPLA 1IYXA 2TYSA 2CZ5A 5I06A 1ITXA 1MW2A 3H2AA 2X42A 5AYYA 5BXTA 1UASA 2KZHA 3BAKA 1R2RA 1TQXA 1O1HA 3QZ6A 1F61A 2F6KA 5HXMA 1K9DA 2Q3RA 1UWQA 2B0MA 3RM8A 4URIA 1A0CA 1EYEA 4R88A 1EKOA 3WLPA 4KWVA 3IARA 4G1KA 1V8EA 4UTTC 1PZ3A 1VS1A 4RR4A 4DZHA 3Q4DA 1YBQB 3TZFA 3F5KA 4XZIA 4MZYA 1BQGA 4S3KA 2XVPA 1X6UA 3RIKA 1PZ0A 2Z7GA 3KOYA 3FYOA 1OX6A 1Q45A 1Z89A 5D09A 3GYEA 5BNKA 3WH6A 3VD4A 2C1IA 1TJPA 5IDZA 3D0CA 3H4XA 8XIAA 1XLAA 3GLCA 2QVNA 2O92A 2GL5A 4HA0A 4PC8A 1AUSL 3PJTA 4EPKA 4PCTA 3OZYA 3PZ9A 2O56A 2WW5A 3DAQA 1IXOA 1E0UA 2XM2A 1AJ2A 3OZPA 3VCRA 1EJUC 4X0NA 5DN1A 3USBA 4DQWA 4XAGA 1HNYA 3O1NA 1QNOA 4L4MA 5LNWA 1QW7A 1BWLA 3GR4A 2GFTA 2PGRA 3R12A 3ZVIA 1EZWA 3Q58A 2HS6A 5CG0A 3CEUA 1AA1B 1A47A 3KZSA 2HPMA 4GIAA 3LHYA 2NZLA 4U31A 3CBWA 1AQ0A 1FCVA 2D3NA 5JIPA 3R5EA 4C90A 4Y6GA 3WIJA 1WKDA 1KXTA 4X60A 3SURA 4XUYA 4UTKA 1AW5A 3SCVA 1PWMA 1L6SA 3ORWA 4ZXOA 2Z2BA 2B7NA 5CBIA 1V51A 2DZXA 4ACZB 5JXQA 3MCOA 5ABGA 3NZQA 1FFRA 1DEDA 1F4AA 3MUY1 1XW8A 4CQCA 1ZS2A 2BNJA 2QXWA 1UIOA 4L1XA 2GQAA 8A3HA 2J47A 2PLMA 1LWJA 3LI0A 3ZT5A 1C8QA 1VF8A 2XSBA 3D3FA 5TAOA 1KD0A 2FHCA 3I7QA 3A3WA 4JEQA 4DZAA 4Z2GA 3WLLA 4PTNA 1KA9F 3UR2A 4H9VA 4L7ZA 1M7JA 4AEFA 3ZFHA 4I7WA 3W1QA 4GABA 2J13A 5HQLA 3PZOA 3E0WA 4IIDA 1P1MA 3I7SA 1XH0A 2VX6A 4M29A 4KEZA 3DKJA 2X09A 1Q6DA 1XHGA 2BXVA 1A5AA 2XG9A 4L4PA 4DXXA 4PE8A 3AJXA 2Y4SA 1I2PA 3M07A 5CLWA 5A94A 2FH8A 2E67A 2WJEA 2IMRA 5E09A 4J3XA 5FCZA 2NUYA 1FDJA 2WJZA 1IV8A 3ZLFA 1ZCOA 1QASA 1JUEA 1WXZA 2D0GA 4ZO6A 5FF3A 1M6JA 3VE9A 6REQA 2VTFA 4PMNA 4HA4A 4AW7A 4JX4A 1R5YA 1CW2A 1XGEA 3QR0A 4PTXA 2ZRXA 3WG6A 3W4RA 2VVSA 1GPFA 3BG5A 2EGZA 5LIUX 1XF0A 4GY7A 2ACUA 2Q8LA 4GC3A 2YL8A 2Y62A 4GXPA 1CXEA 2NWSA 2VC9A 3I3BA 1CLXA 3GX9A 4PEEA 3VFCA 3TAKA 1E0XA 1OK4A 4LUSA 2HROA 4TMBA 4W86A 5I03A 3EA2A 3DFYA 4JIHA 3WDPP 4B9ZA 1E4IA 5LNUA 1Q8AA 5BMXA 4MAZA 3AYSA 4EE9A 4EXBA 5D03A 3RM9A 1SSGA 4JQ4A 3NO5A 2PP0A 4ATWA 4LAZA 4GYFA 4IMCA 3RX3A 3WBXA 3WJXA 3MHFA 3P74A 1RY0A 3TA6A 1ZZMA 1OCQA 2VL4A 2HS8A 3SEPA 1P43A 3KVJA 1SFLA 5T9CE 1JG9A 3N3MA 5FJJA 2E6AA 1ZLPA 3WFZA 3OEXA 3LBMA 4D6HA 4KKXA 5D9NA 4GY0A 3ARSA 4JFUA 1VYRA 3WK0A 4LRSA 1TFVA 1UR4A 1WOBA 4I3GA 5DCEA 4AXNA 3ITYA 4BHYA 4BCEA 4JCMA 2DJXA 4ZZ9A 1MRQA 3DOPA 2O9RA 4E2OA 2JGYA 1OGSA 4TTUA 1E6RA 4NJKA 3SM0A 2F6UA 1ISXA 2QLYA 3CMJA 3GR8A 4JIRA 2ZKMX 3WNNA 1G01A 3BMVA 1QOPA 4C6KA 3PBMA 4X9YA 3C6CA 4NNBA 2C8NA 5HMEA 3DC0A 1UIPA 3UU0A 2X0SA 4BF9A 1J79A 1PPIA 5FIPA 2PODA 1RA5A 4DLFA 4BI6A 3V18A 1JULA 3K1DA 1FFQA 1HJXA 5IDIA 1UZ4A 4KEUA 3NR0A 2REQB 3CM4A 2A6LA 4MADA 5E70A 5BOFA 4PTDA 1UC4A 1H09A 1WZAA 3ABZA 1F3WA 3EOLA 3L5AA 1O7AA 4QG9A 4DBSA 5BU6A 2W27A 1AZ2A 2E25A 4JTQA 3UW6A 4BS0A 1HO1A 4CNSA 3RO6A 1PIIA 4BEUA 2PZ0A 1WNOA 2J4GA 3VUPA 5LXEA 3AHXA 2Q8ZA 3VNLA 2WQDA 1I75A 4YN5A 4LNCA 3E02A 3NL5A 5HUOA 1UUMA 3C0JA 2PP1A 4HU3A 4H04A 1J12A 1MXGA 1PTAA 3BDKA 1FCQA 1ADSA 2DSUA 1K8YA 3W7CA 5CG7A 4IPLA 2R8WA 3G1YA 3LTYA 1MYRA 3C86A 3ATYA 4YIWA 3VZZA 2OQLA 3HQ1A 4XV0A 4RK8A 1Q66A 1TRIA 4QS5A 4J1OA 4UZUA 1SW3A 4FX6M 2NLIA 2Y24A 3GC5A 4N2YA 3KE0A 3QPYA 1EZ2A 4IF2A 4KWUA 4GXMA 3MHGA 3GRIA 2Y0FA 2XPKA 2F38A 3DEQA 3WLJA 4DRSA 1U1JA 4WJ8A 2OB3A 3GNOA 5FSEC 3EWDA 2XWDA 1GT8A 2BV9A 4JEJA 3AMLA 4O4VA 1HKMA 3E9AA 4A8IA 4PN2A 5F4WA 2WXDM 3W7IA 3GD6A 3EDKA 1VCVA 3WQOA 1US0A 3MSGA 2D1ZA 3LGEA 3TW9A 4ADSA 2WKLA 1LBFA 4ZQPA 4W8AA 4JNMA 4F8XA 5ABEA 4IX2A 4ZR8A 3L5MA 1QRQA 1E9YB 1CI1A 4N7QA 5BYWA 5M17A 1B3WA 4PMXA 1GYMA 3FK4A 2OT0A 3DGRA 3N3TA 4ZOEA 4MY1A 1R47A 1LRTA 2QQ6A 3DHUA 2E9MA 3BAWA 2OGYA 4C1NB 1WXJA 4GVHA 1TUXA 4GE8A 1LUCA 3FA4A 1ISWA 1FWFC 3HJEA 3ZJ8A 2WZTA 1PX3A 4F0SA 4MWAE 1NDWA 4A8RA 3D3AA 3F4WA 4P7NA 1WUFA 2X8RA 1DQUA 3CL6A 1EO5A 3QPZA 1Z7AA 4BQ3A 5ABTA 7REQB 3EZ4A 1QWGA 4XD4A 3TCEA 3MV01 4RV8A 1W9DM 3E2VA 4L4OA 1W17A 1ME8A 4IXHA 1RQHA 2FKPA 1EQCA 4NSBA 5U4NA 4OQVA 1AW2A 1QATA 3SCPA 4M6PA 3L5LA 2A7NA 4HKPA 2R6OA 3LU2A 2V3GA 3K46A 1EA9C 3LY0A 1RAKA 3VIPA 5HJLA 1R86A 4GBUA 3E49A 4IXXA 3RRXA 2VWTA 1ZTVA 1CGUA 3M64A 1UROA 4DXVA 3LRLA 2I5GA 4S3BA 4HOWA 4NX5A 3B0PA 2VX5A 3QBUA 3QH2A 4AMCA 3WF3A 3IGXA 2WZMA 2GGJA 4NRRA 4HNUA 2ISSA 4JTFA 4HJWA 5A6TC 1D8CA 7A3HA 3L12A 3VNYA 3VD9A 1R9ZA 4NKCA 3F4VA 4M3PA 4L9ZA 3VIMA 3VMNA 4ZSTA 3KTXA 4Y96A 3VDCA 3VOHA 1UWIA 3AWOA 4HMDA 1OB0A 1CXHA 4NZJA 2NLYA 2VRQA 1R8LA 3LCIA 2GGHA 2O55A 1U5VA 3G1SA 4CEXC 1AJZA 4LVAA 2XFRA 4GH3A 4GYPC 1QJWA 2PC8A 2ZE3A 2RFGA 4M81A 4ERAA 3S9YA 3U2ZA 3Q45A 3A13A 2XJ7A 2ZA2A 3JU2A 1X7IA 3KHJA 3DHPA 1JRBA 1VCGA 3FAXA 3T08A 4F66A 1WAWA 1GTHA 1ODZA 3CV1A 1TA3B 1C92A 2A3EA 5AHMA 1ME9A 4PUDA 4GQBA 2GJPA 3EX6A 4MUPA 1XIGA 3TQ0A 3O05A 1YPFA 2WMFA 3KWSA 4WK9A 3LD5A 1UP0A 3IVSA 5GPRA 2BHYA 3JUGA 2E09A 2ZDSA 2F2KA 1ZFJA 4R34A 2E6YA 9XIAA 4JOMA 3VD3A 5BXRA 4O1FA 3WEZA 4AVFA 2DZWA 3VDHA 1ADDA 1RP9A 4FMVA 5I09A 4KEMA 5HJXA 2NQHA 4H01A 3ZOAA 2VVNA 3LN3A 1TZ7A 3PAJA 7CGTA 2GGIA 1W54A 2PDCA 3ISIX 3T2PA 1JVNA 3POHA 3LSCA 5E1QA 2CZEA 1PX8A 3PB0A 5BOEA 4YTQA 1FWIC 2BOEX 1OEPA 3NSMA 3EXSA 3TN6A 1W5QA 3EGJA 3DERA 3QY7A 1P0KA 1XYZA 1DVJA 4XD6A 1ZAHA 1CIUA 2PE4A 2FZ8A 1H7NA 1FKWA 3L0KA 3C2OA 4LVGA 4CNUA 1JEZA 1Q85A 1YXYA 2PEVA 2XFWA 1EO7A 2XN1A 1BKSA 3LBCA 3W00A 3NO1A 2GK1B 3V16A 1UOZA 5A95A 1NH6A 3DIPA 3GK0A 2ZXQA 3R13A 3DFQA 5LIKX 4EKJA 5IXEA 4GWEA 2PC4A 1MMFA 4EF9A 1R3VA 3NQCA 5A6KA 4L4LA 3LHTA 2J7GA 4I9MA 3QSRA 1EGVA 5AVNA 1H7RA 3LG3A 2V63A 2VEKA 1XCXA 1JI2A 3TR9A 3LCFA 5BWAA 3DYPA 2PTXA 3CIXA 1V0KA 1XWYA 4EAMA 3W28A 2H90A 4I8DA 5D32A 1CCWB 4NYUA 3EMCA 1ZNNA 3EWZA 4Y9NA 3GG0A 5JH1A 3G1VA 1J18A 5FJUA 3R2GA 4FX8A 3VOCA 3FEQA 2DT2A 1QWKA 1DJXA 1B9ZA 1I2OA 4KWOA 1KFEA 3UG8A 3PZTA 1IQ8A 2P8BA 4UTLA 2VWSA 1EIBA 1KGWA 1RJQA 5CCZA 1NIUA 1H2JA 1NFGA 3TR2A 1NF7A 4WY0A 2G3FA 4DJDC 1R7AA 2J9XA 4CN1A 2PTZA 4PTWA 1G0CA 4CD7A 2CLPA 1T7LA 2A21A 1GVYA 4JHMA 1S39A 1E70M 2XGIA 3ZR4A 1FX6A 1CECA 1D3CA 3RR1A 5I3DA 2YDQA 4HPGA 1N82A 1YNPA 4LAOA 1ZL1A 4XO7A 4PR4A 1WDWA 1OCBA 4RNFA 5E6ZA 1EX5A 4UXDA 4AY7A 3WL0A 4U10A 1Q13A 1N7KA 3G1RA 2DY3A 3NGFA 3LX9A 3HIJA 3V5OA 1LZOA 2ON3A 4UTWC 1V6XA 1XXXA 4LAUA 1EXPA 3MMUA 3G8RA 4JDBA 1XISA 3BCDA 1V08A 2CLFA 3S5NA 2Z1VA 3GVWA 2FB2A 3E3HA 4JBRA 3NURA 2XZ7A 1VD6A 1W1VA 1WZKA 3VOFA 3BW4A 4EAYA 5BOOA 5D38A 1QOXA 3H70A 1FHUA 4JYFA 4WDUA 2DSWA 3VILA 2AGKA 3N4EA 3C61A 1QHZA 1IEWA 3VIJA 3F5LA 3ABOA 4DN1A 4ZMGA 3MZNA 3OZMA 3FGCB 1FKXA 1K9EA 1OCJA 1Z44A 1XD1A 1BG4A 3WN6A 1EJWC 1NARA 5MKGB 3ARZA 3GZAA 3NM3A 4WJEA 5RUBA 2VXNA 2PLCA 4IMEA 2DIEA 5A8PA 1E6QM 4FS9A 1WCGA 1JCYA 3E2SA 2Z25A 5D2TA 3T78A 2GVLA 1RLDA 3GQYA 2HV5A 1UWRA 4JYDA 1F73A 4DBDA 4RJEA 4NJHA 3RX4A 3WQWA 4NAEB 4OFCA 5A6BD 4IP4A 2HNEA 1L6GA 2J7DA 4NZ3A 5DQPA 4NZ1A 2QT3A 1WZMA 3BURA 3WD0A 1QK2A 1V79A 4XAPA 2A1YA 4YWIA 4LC6A 3W37A 2B4GA 3FVMA 4HZ8A 3VD7A 1UYQA 3UJ2A 1DTUA 4MJZA 4TVUA 4AD1A 4PMRA 3Q65A 1ITCA 3U2EA 1WDSA 1FWSA 4W93A 4HHPA 1KM4A 1AVAA 2E6DA 4HK7A 2ZX9A 5A2BA 1JYVA 2F84A 2XSXA 2ZXDA 1TB3A 2D73A 5CEWA 2A3BA 4IPNB 3NVTA 2WM0A 4OV9A 3R8RA 3PUDA 3QR3A 5FEZA 3ZLGA 3VIHA 4PCSA 1V5XA 4L9XA 4MFEA 2Y8VA 2INZA 4FLRA 4RUBA 1PCWA 1XH2A 2FTWA 2YR1A 3DN5A 1JGMA 4ADUA 5AY7A 1WBHA 1X38A 2ZA1A 2XH2A 1AMKA 3A9BA 4F4RA 3D6NA 4YYFA 3ITOA 3S0CA 3LCXA 4MPQA 3EDDA 3SRFA 1JAEA 1SW0A 4RZ5A 1UWUA 1J5TA 3IV8A 3E38A 4RNJA 1V7AA 3LB0A 3DG3A 3T4WA 3FS2A 1W91A 1O5XA 1FWDC 4JIQA 2Z28A 3G8EA 5K3VA 4O10A 1RD6A 4MB4A 3NPUA 2DEPA 1KO0A 3QMTA 1KXQA 1OG0A 4LUIA 3EOOA 3GHUA 2HVNA 4DEFA 5A6BA 3FJNA 4TV6A 3N29A 3WQGA 4IUOA 3VAVA 1FRBA 3DBNA 1UKSA 1OM0A 3AC0A 3NQBA 3DUGA 1XQKA 4F0KA 3N9RA 4IHCA 2V81A 3GVVA 4H3DA 4Q8TA 1ZQ5A 1XBYA 1J93A 4JQ3A 1TQJA 3MSDA 4AX7A 3NL3A 3P82A 2BHUA 4O14A 4E8CA 2ZA3A 4HSHA 1JZ2A 1YYAA 1LOLA 4D6CA 1MDRA 2WC3A 3U9IA 1K8ZA 1DORA 1F4HA 3EKZA 1LBLA 4KFOA 1G4SA 1JDCA 4LFYA 4Z2KA 1HTIA 5TQLA 5DELA 1XM3A 4QLLA 4WSJA 4LYQA 1UJPA 4KWWA 2JQXA 4XQ6A 3OLEA 4ZE5A 3KL0A 2ZUWA 3C2VA 1VEOA 5DCDA 3SSJA 3FDKA 1TV4A 4AZ6A 2VJXA 1MZRA 3GHRA 3FKRA 4GFSA 3N2OA 4S3EA 1O1ZA 3SUUA 4JQAA 1GK8A 4MWAA 1NSJA 3ALGA 4FNPA 3CWNA 3ERPA 1DL3A 4NXSA 3CWHA 2QNEA 2EG8A 2BGSA 1IZCA 2ESCA 4G7EA 3VCCA 5GVJA 1Q4NX 3TZNA 2JE8A 4D9PA 4QNEA 4OE7A 2BMBA 2V5LA 1EFZA 4LC8A 4NP7A 5DRCA 4I9AA 4IMAA 3SFWA 3GXIA 3CTLA 1X39A 3OPSA 3RN6A 5L9FA 3ZQ9A 2B81A 2CBIA 1KM5A 3CJPA 4DJDD 5CAHA 4S3GA 2E7FA 3BAYA 5FD0A 3CUIA 3AAMA 3LCHA 4AZ7A 4ORMA 4P7LA 1N55A 4K7YA 1Q6GA 4ROPA 1QTWA 2VZTA 3AIVA 1QFEA 4JKLA 5F2LA 4WGHA 2ONEA 4ZFCA 3LMZA 3HQOA 4TU1A 4AHOA 2JF7A 2V8ZA 3FW6A 4DO6A 3LMYA 3O6CA 4NILA 1DQXA 3G6LA 3PTQA 4KH2A 3H12A 5D30A 1OC7A 3NQEA 2DUAA 2VDGA 3LHWA 1AD4A 3M16A 1Z42A 3TOYA 1QI2A 3UG4A 4GQQA 4PUUA 1RCQA 5M03A 4UTIA 5E93A 3I3EA 3GG1A 3U5YA 1GYNA 5EB8A 4ZE4A 3QOKA 1VEPA 3OBEA 4LSBA 3ANYA 3WQCA 3BICA 3K2GA 2BY1A 3PK7A 2ANUA 4ADTA 4O52A 4DY1A 4IFKB 1SQ7A 3WDIA 1IEIA 5FAJA 3WEOA 4KBXA 5LSMA 3W7JA 1XI3A 2JIEA 1J0JA 5FJOA 5G4HC 3CU2A 3GC2A 1TCDA 1R3SA 3GNXA 4Q4PA 2ZUTA 3TMLA 3O2LA 4IGNA 4RDZA 2VGIA 3TC6A 3DC8A 4LALA 3ES7A 2OG9A 3WELA 4HPJA 4XK2A 2CIPA 1JYWA 3MC5A 1MQQA 5I3IA 3QXBA 3KAOA 5G5IA 3VKBA 4M1RA 1GKPA 4MJ4A 2ZUNA 4L5ZA 2CC0A 3JRKA 1IEQA 5FKYA 4GUIA 3WK2A 1I1XA 2QCNA 1O66A 4FNQA 1LQ2A 3TDFA 2AQOA 5EA9A 3LGGA 4LANA 3PZIA 2O9TA 3BVJA 2Z29A 3VCNA 4PL2A 1PYMA 1TJ1A 1Q6FA 3ZJKA 3AHVA 1QBBA 2XIQA 3IPWA 3KBJA 5DMLA 2EPOA 3B4YA 3BAXA 3VNMA 4PBGA 2NUXA 3ZM8A 3YPIA 1V6YA 3E74A 5CPOA 3CAVA 1ESWA 3LM3A 3W76A 2ZUVA 2I1OA 2POTA 4RE2A 2OEMA 5KEZA 2YFOA 4MM1A 3UR5A 3HOJA 4L64A 2OLHA 3R10A 2R1MA 4FSAA 1XIIA 4QJ5B 2XHYA 5BRQA 2F8QA 4DXKA 3A21A 2E40A 3TVAA 1FDZA 1LROA 3CHFA 5D33A 3M5ZA 4I5UA 4L6HA 4KRTA 3HPFA 3MO4A 3FNDA 3W24A 3TP4A 3DYMA 4B90A 2YDSA 3LYEA 4WDXA 4OBTA 4ZQRA 4UOJA 4HPXA 2OKOA 2P10A 3ARYA 4S3AA 1HG3A 5D37A 3DECA 5AECA 2AAMA 3AIWA 3MI6A 3WX7A 1IT7A 3L2IA 5KITA 4WKFA 3C56A 1V02E 3R6IA 3CV6A 3DG6A 3MWAA 4NXKA 2ISDA 3F2DA 2NWRA 1R7OA 2H3DA 4LUTB 4PFMA 3R8GA 3H23A 5C9XA 4Y8EA 1KRBC 4HSNA 4C6DA 1AQFA 4EF8A 4DJED 2WKJA 3AXMA 4O17A 5C70A 2D2JA 3AO0A 2XZ9A 3STPA 3GNRA 3O9NA 1UW9A 2NXGA 2OYLA 2F7FA 1ICPA 1FWGC 1M41A 1QK0A 2WCGA 3H2NA 4JDYA 2JIWA 1TWSA 3NNTA 4ZXLA 2PTYA 1SU5A 3GR7A 5DRIA 4QQUA 1XBZA 3HGOA 3VGFA 6CGTA 2P50A 2YYUA 5C0QA 3H7VA 3BV7A 4YVPA 3GH7A 2WWCA 1IF2A 3OIXA 1VJSA 4P5UA 1AQMA 1XLGA 3GBDA 1FWWA 1ADOA 2D0FA 2HPIA 4E5TA 1EPVA 2Z26A 5GQBA 3CV7A 1OYAA 5LA0A 3WJZA 4NI8A 4AVOA 4OT7A 2E1DA 1IR2A 1E6PA 4UIOA 1HQTA 1XSIA 1JZ7A 2JK2A 3LOTA 4WXYA 4IFOA 1W37A 3G6MA 3QV8A 2CW6A 4DI9A 1ICQA 1W3LA 3W1RA 2ICSA 2VZSA 5FL1A 2QJHA 4REQA 1AL7A 1IWPA 4M0XA 1X1OA 4RPQA 3MTWA 1VC4A 3CAWA 1R85A 4GHRA 4QXIA 5I3KA 5BCAA 1LM1A 1H0GA 3N2MA 1EQPA 3W1LA 5DF0A 3ITGA 3TYEA 3BGGA 3STFA 2VDIA 3POCA 3R0DA 5AB3A 1L8PA 1V4YA 4DJEA 1H41A 2C15A 3DHFA 1RVKA 2OEKA 1ISYA 3NQFA 1KCXA 4Q7IA 6A3HA 4GOAA 5HBFA 1QT1A 3N18A 2PMQA 1NWSA 2Z4GA 3RU6A 1L6WA 1UCWA 1KFBA 3QGVA 5AZ0A 3UXIA 4LH8A 4AHPA 1F3EA 4MWAB 3OGRA 4LU0A 4Q4SA 3WUEA 3NCOA 1E1CB 4LS0A 2JKPA 3B8SA 1SMAA 3M0VA 1UZ1A 1KM0A 5DT7A 1R3RA 3U2OA 3IGSA 1BSIA 2DIKA 4DJFA 1NWRA 3HQNA 4N4PA 4AZ5A 4FXJA 2O7SA 3W07A 4AEOA 5IFPA 1EOKA 2YCEA 1TRDA 4OKDA 4NAFB 4A8LA 3HPSA 4J3VA 1O94A 4BQ4A 2GYIA 3FIGA 1OF6A 3ZT7A 3DFSA 2A2IA 2C79A 1TPH1 1TV8A 3S8HA 3RMJA 3PJWA 4GQGA 4TX9A 3C3NA 4N9CA 5H1WA 4HN8A 1SFJA 3ABSA 4PSRA 1E3ZA 5CH9A 3GTFA 1SZNA 1VBGA 3UCDA 4JY9A 3N13A 1S2CA 3RMEA 4KRZA 4FF5A 4IT1A 3CWOX 2XWEA 1GJPA 2WYSA 1AODA 1EDQA 4KCWA 2RH9A 5H91A 4F2BA 4ERIA 1W8SA 2Y8KA 3WKZA 1W5MA 1G7UA 1TPDA 2A79A 4HQVA 2QJNA 3T55A 1WB0A 4L80A 3GNDA 1SR9A 3U3HA 4F9JA 4ZQOA 3JZEA 3T9PA 3F2CA 1NP2A 3DESA 3IJ9A 3MUXA 3T6CA 1BVZA 2UZ9A 3A5VA 4O53A 4BR1A 1QPKA 2ZX5A 5AHNA 7TIMA 3TTYA 2XN2A 5HPOA 3KVLA 4QLKA 2ZX6A 3UXKA 4Z2JA 2QMJA 1W6TA 3IUIA 1SM9A 1GG1A 2PU0A 3URBA 3VD5A 3TW6A 1Y65A 2Y7EA 1VBHA 4YYCA 3B0VC 4KGJA 3H6OA 2BVTA 4PUWA 4MWAC 3HB9A 2ZWZA 2BLEA 3HFTA 4KERA 1KBJA 5HMFA 3U0HA 2XH4A 4JFSA 3QY6A 3W2LA 2XVNA 4J35A 1FWJC 2DUXA 1JYXA 3LCGA 3WJYA 3KFTA 2FH6A 2UY4A 2WSPA 1EC9A 3NL2A 2QULA 3TXZA 1WP6A 3A3XA 1XBVA 3TSMA 3L4TA 4JAWA 5A6AA 1KWGA 3M6YA 5I3FA 1NU5A 4TXEA 1OFOA 4S1FA 2D0HA 1TMHA 3KCJA 1LT7A 1UKPA 4Z0SA 3HGSA 3GKFA 1OWQA 4JIPA 3R0UA 3VNDA 4G7FA 1XGZA 1S5TA 3GAYA 1H7PA 2WC7A 1Q65A 2E5CA 1M7XA 1CT5A 3P6LA 1XLLA 1NM9A 4R85A 3SR7A 1C3FA 4IIHA 4UQBA 3H4GA 2EQDA 5TD4A 1E5JA 3RHGA 4MZ8A 2XIOA 4OHQA 3TNBA 1IGSA 2X30A 1JPHA 2Z27A 1QUMA 4GI9A 4RZ4A 1K6AA 5D8ZA 1DV7A 1EDTA 3WQDA 2GJXA 1EGMA 4CQAA 3GY1A 5EMUA 3UY7A 2VEPA 3MBFA 1YRRA 2WQPA 2O0TA 3IK2A 3PPHA 4JTAA 1M3UA 2W92A 3DDMA 2CCRA 5I77A 2Z1BA 2Y61A 3DFPA 1OABA 3G1DA 3TUUA 1PKLA 5C9UA 3KEHA 5LGZA 2V67A 2HBVA 1FQ0A 1MFVA 2PGWA 2GSEA 1U1HA 4JPGA 5D9MA 5C71A 3NSNA 2XVGA 3C2FA 1UQYA 1J0ZA 4CVWA 3E5BA 2ADAA 3AIRA 4RE0A 1V03A 3M5VA 4Y8FA 2QF8A 1GYLA 3N73A 3FHQA 5EBUA 3V0TA 1KCZA 1W3JA 2DZVA 2X7WA 3AALA 3MS8A 2P1FA 3OZOA 1KTBA 2ZTKA 1EBGA 4Q33A 3LNMA 5HOSA 1SPQA 1C93A 4LUYA 3S83A 3FYPA 4QISA 4XWUA 1A5UA 4R7WA 1XFCA 1Z32X 1KGUA 2J62A 1TMLA 5H8MA 3M0KA 5F1UA 5ECUA 4KWSA 1PHQA 3SRHA 4Z17A 3AFBA 1KBKA 1Q6QA 2UY2A 3ZJ6A 1REQA 1AG1O 4HK5A 4YVXA 3KW3A 4S2BA 2FZNA 4K8GA 3KTCA 1EWDA 3URNA 4LGXA 3UJFA 3SAZA 5REQB 5A8MA 4C1KA 4BQ2A 2Y5JA 3LCWA 1UBPC 3C2YA 1I45A 3ZSSA 4Z1BA 4EIVA 4F0HA 3B8WA 1S5VA 3CS2A 1MFUA 3HM7A 2XINA 1WE5A 4QDWA 2OCZA 2QAPA 2OYKA 4IIBA 1Q7ZA 2R1LA 4FHAA 4HMEA 3T44A 1QNPA 3IANA 3T81A 4XKYA 1VPYA 3AIEA 4LS1A 4QM1A 3PZUA 1ALDA 3P67A 1OFPA 3GFXA 4MGGA 1J9YA 3EWUA 5JVLA 3KOXA 4IMDA 4ZO7A 1XL9A 4FR6A 3LLXA 3DKLA 3S1XA 3BOFA 3QVQA 3IAPA 1BPLB 3H54A 2ZVIA 1UR0A 5C2XA 4V15A 1P1XA 1JZ4A 3GXFA 3ES8A 5M1TA 1THFD 4C6JA 1POKA 1W31A 2DZPA 3U7VA 4CVUA 3QLLA 3WEMA 2YA0A 3K8MA 3G0UA 4C6OA 5H2ZA 4MKNA 3B9AA 1K4GA 4PA8A 3UVAA 1JCJA 1HKIA 3LLFA 1GNXA 4US5D 2PBOA 1B4KA 3FXGA 3SQLA 5TIMA 2FDSA 3VIFA 3WH7A 4PMQA 1KM1A 1S2VA 4E8DA 3S1GA 4MMWA 3NXLA 4CD5A 1C8YA 3B8IA 1XUZA 2GGGA 1B30A 2J78A 3FJLA 2QYGA 1A3XA 4HCHA 3BH4A 3SJ3A 3GZ3A 1SJBA 2VENA 3S2CA 1K3UA 3P80A 3REQB 4ML9A 2V3FA 1EUAA 2J6VA 3APYA 5HUPA 3CK5A 1IWBA 2HK0A 3B97A 5CZSA 1L9WA 1FP8A 1T8XA 4D6JA 1XDMA 4N02A 4Q32A 3AYVA 2CZVA 1K70A 3U2CA 1B3YA 2QW5A 1S3TC 1U1UA 1VIZA 3MUCA 1QBAA 1K8XA 1K1DA 4EK7A 2CETA 1R9YA 4UZSA 4G9PA 4HZ6A 1UA3A 4D8ZA 2DVXA 2J7EA 1QO2A 1YEYA 4X63A 1EHNA 5IBXC 4TX6A 2DDXA 2ZZ1A 2PGFA 4QCFA 1OD8A 1LG2A 1ZHAA 4K7VA 1FH8A 3N17A 4KFPA 1UPPA 3C4UA 5D4YA 3W7MA 5IHSA 1W1PA 3A4AA 1GVRA 1VJZA 1LF1A 3P84A 1XIFA 2PWHA 2Y85A 1EYWA 4HD5A 1DHPA 3AS2A 2V5DA 2YBUA 1M5WA 4GZEA 3WLNA 2V6AA 3SDOA 3CO8A 2MANA 3I4KA 3T09A 1F6PA 3R1ZA 3INPA 2NV1A 4CQ9A 5LA2A 4CU6A 4GY1A 3VKDA 1EL3A 2GDUA 4FNSA 3E2RA 3VGBA 1D2KA 4ZQMA 3CGTA 4C6NA 4EPEC 3MPGA 3VX0A 4RDWA 4QEEA 3NQDA 1WZLA 1R38A 1F5ZA 3TJ4A 1W9BM 3VDGA 2ISFA 7TAAA 1W9VA 4UOZA 1RZMA 1XIMA 3PM6A 4DB7A 1BRLA 4NF7A 5C2CA 3PTKA 2GUBA 3CB8A 4Q7BA 1HGYA 1B4EA 1CENA 3GFZA 4E3TA 4MJMA 4FI4A 3XIMA 1QAPA 3EOEA 3UZ5A 4A3UA 4LJ3A 1HW6A 3VIGA 2GWGA 4DYKA 5TBOA 1PV8A 4EVZA 1BSLA 4IISA 4IJBA 1HP5A 1VFHA 2I9UA 3QC0A 2V30A 3H2OA 4HZMA 1TPC1 1TVPA 1FH9A 3UG5A 1NWUA 1SMDA 4RV3A 4IG2A 4JN6A 5LIWX 1A4LA 3AHTA 4QLJA 5JH2A 1H7WA 2ZBTA 4CNPA 4YTRA 4NZCA 4N9EA 1QW9A 1TR1A 3TIMA 5CPNA 2V82A 4KGLA 4P8XA 5B80A 1M7OA 3N9KA 3IIPA 4NUWA 3WFAA 4FF7A 3UR7A 2RDUA 3TTSA 4P8UA 1XRVA 4C6LA 5A2AA 4Z2HA 3NOEA 1I8JA 2PS2A 2E68A 3DU0A 1XIJA 5HANA 5LNRA 1L2UA 1XDLA 4XZHA 2PCQA 2VO5A 4BZYA 1P48A 4C6CA 4FAMA 3ELFA 3V75A 4AZCA 5I3HA 1HT6A 2WVTA 3V1PA 2PDQA 3PF3A 4BWLA 1TPVA 4W85A 1E0TA 2R14A 2X40A 4QDPA 3SGGA 2PDNA 4AB4A 3VGDA 1Z3NA 1O12A 4QE1A 3TA9A 4J27A 2C19A 3RPDA 2H3BA 3M0LA 2GJXB 1XINA 4US6A 3WDQA 1J11A 3UA3A 4QDMA 1PJ9A 2G4FA 2WPGA 2AKMA 2QV4A 4WUIA 3FSTA 3EOSA 4X2RA 5AC5A 4J7RA 3VNIA 1MXDA 3M46A 1B57A 3GE7A 5HQMA 3UWEA 2BVWA 2VEGA 4JTIA 4GKLA 1JNEA 1NWTA 1EGZA 1J0KA 4JTTA 1JUKA 3O8AA 1EOMA 5F4XA 1PIFA 2WMIA 3W2UA 3BJFA 4HNCA 3KS5A 4PH6A 2WJDA 4JICA 3GVGA 3JS3A 3RNDA 3N6JA 4O18A 3L65A 5HATA 2H6RA 1KFCA 3OP2A 2QJGA 4K39A 3W7DA 1XLKA 5IRPA 1FDYA 2Z6JA 3E0VA 3NM1A 1E6SM 1CX9A 1OC6A 4F0MA 4AAJA 2HMCA 1ITQA 4BKNA 3OA3A 1DWGM 3BLFA 2D22A 4LVDA 2HQAA 4YTSA 3CT2A 4PBEA 1YXCA 3C0QA 3SUTA 1Y5VA 3IV3A 4R7JA 1C9DA 4AXKA 1L6YA 2PRLA 2ZTJA 3GU9A 4FIQA 2B7QA 1YPXA 3V7PA 3G0XA 2R1NA 3P7YA 3BARA 4LVFA 4HNTA 3EB4A 4O1BA 3I65A 2H8XA 3F1QA 5IOBA 3S1WA 4HK6A 3Q37A 1RBAA 3BZGA 3SCNA 1GKRA 4XZBA 5KTLA 4CU8A 1J5SA 4XX6A 4ZQCA 2V2DA 4A2RA 2YA2A 3SADA 1HL9A 5EYWA 2PDJA 2E8YA 3KXQA 4B3LA 1XFBA 3G3DA 1ECQA 1W0MA 3B40A 1P0NA 1E0WA 3VPLA 2PI6A 1GQIA 4W89A 1WDQA 1OVDA 4J9JA 3G22A 1OFQA 4GYKA 2E0PA 3W75A 1GQNA 3PPCA 3CEPA 5FOOA 3W7GA 2P5NA 4L56A 1SZGA 1PKNA 2CHOA 2Z00A 2VKZG 2C18A 1GW1A 1CLKA 3W7EA 3SGZA 1K9TA 3O6YX 5KMYA 1AJ0A 1T0OA 3NL6A 4H6EA 2W62A 4Y9MA 1DJZA 3BL3A 3W84A 1W56A 1IT0A 5L6UA 2CXEA 1EA0A 4QX4A 1GVQA 1LTDA 3BCJA 2Z24A 1OK6A 3DFNA 3AS0A 3QMSA 4JZ5A 3LHVA 2IPJA 3OTRA 1JAKA 3W27A 1JI1A 1Z41A 4UUIA 1ZBVA 4H8NA 1HJUA 3P14A 4I9TA 2IKGA 3QF0A 3WH9A 4XBSA 6ENLA 3W83A 3ZVHA 4GZ7A 2YA1A 4QP0A 3R11A 1S2AA 1TTIA 1UD5A 4YU1A 1ODUA 3GHSA 4I7UA 1O5QA 5HA7A 3TAOA 3RRAA 3VX1A 4OUEA 1ZB5A 5HR6A 3PANA 6TAAA 5TF0A 2O4MA 4DWSD 1E72M 3VKKA 3AQUA 3T40A 1E9ZB 4NHVA 1WX0A 1OC5A 3MYPA 3P0XA 5JBEA 3ITVA 4RNIA 1V6VA 2HXUA 2PDHA 3GTNA 4GI4A 5E9XA 1V3MA 3CXOA 2IPWA 4QRNA 1P7TB 5K9DA 4GIEA 2P76A 4UTHA 1OIFA 1H4PA 3IVUA 3EAUA 3SGUA 4G56A 3GXTA 1DIDA 5MF5A 2PDBA 1MO0A 1JQXA 2J66A 3ARPA 4CKQA 1K7EA 2EPNA 1G4PA 1VKFA 3CIVA 3WK1A 3TWBA 3ANVA 4UFLA 3M1ZA 1W9UA 1BVNP 1H1YA 4UWMA 3BLPX 4O8RA 1KQYA 3GYCA 1M01A 1KWKA 1Y0EA 4LPCA 4J2PA 1FWEC 3QQ0A 4ZOCA 3HV8A 4HIBA 3LPOA 4JTEA 3W25A 1W5PA 1CXFA 5KSWA 3C3UA 1D7KA 1FVPA 4Q4QA 2F2HA 3L2LA 3TSBA 1TJ2A 1ZALA 3W82A 4CD6A 4H6RA 3KM8A 4GRSA 1Q5MA 4DAIA 1NY1A 4OOZA 1UOKA 1VFTA 4Z1DA 3GBEA 2QCHA 1W1TA 3AIUA 1GVEA 4UQEA 4EXAA 1QPRA 2E9LA 1OFAA 1CWYA 4DWSA 1H7OA 3CMGA 2ABAA 3PSWA 2Q6ZA 3KBSA 1OX4A 1R87A 4Y9OA 3MJYA 1XRTA 4UQDA 4EPBC 1WDRA 4ICNA 4JTCA 2EKCA 3WF0A 4WIWA 4MY9A 4Q4MA 2WVVA 2XH0A 1KBIA 5T9BG 3G1FA 3CQHA 3TLLA 2PAJA 2ZZ5A 2VUYA 1KLYA 3A12A 3OVGA 3IGUA 4EXQA 1L2QA 3QSTA 4ROQA 5C55A 3A4JA 4LOCA 3E6EA 1HO4A 5CZJA 4MKVA 3M47A 1XGDA 2FFIA 1G9HA 2WSYA 2ZZ6A 4PMVA 1DJNA 2G96A 1AW1A 3H55A 3MWCA 1GOIA 3IJ6A 2FZBA 1LBMA 1OINA 3EX2A 5J5DA 5LIXX 1VGAA 4AY8A 2CLOA 4TX8A 1BYAA 5EL1A 1CTNA 1QNQA 1VR6A 3M0MA 1NOUA 3KCOA 1FHDA 3O0FA 1HKJA 2VQTA 1V93A 2EG6A 4DBEA 4H9UA 5F2IA 2C7FA 4JQ2A 2OZ8A 1T8QA 2QCGA 3HMCA 4Z0JA 1DKWA 2PDMA 3CPRA 4CNTA 2NQJA 4S3FA 3KOWA 1GZ1A 3SCUA 1T5AA 4LCQA 1A3WA 2CNCA 2GGEA 3KS6A 4MPKA 4D72A 4B2DD 4U28A 3LBOA 3U48A 5I02A 1OD0A 5JBDA 2XFFA 3VOGA 2OSXA 3ME3A 3MT1A 4OUIA 1Y7VA 4CCDA 3ATZA 1OT1A 3OHMB 5DXXA 1BG9A 3UJRA 3NEHA 4U5KA 4F9DA 5AHLA 3LK6A 4QG8A 2OZTA 3RITA 2X2YA 4IM4A 4HYRA 4TR9A 4H9TA 1R46A 2WBKA 4A3QA 3BW3A 2L5HA 3VC6A 4J3UA 4KEVA 4Q6XA 3F4DA 4W5ZA 4FLOA 2G3NA 2IUZA 1JD7A 1P0EA 3THAA 4YMZA 2OR2A 5CSSA 2DORA 4O0QA 1UR8A 3H2MA 1PDZA 1XRSA 4OECA 1T99A 2ZADA 1XYMA 2PZNA 5FJIA 4DNHA 3EOUA 2CHRA 3HGRA 3PUEA 3R58A 3BK0A 2VOMA 1LDCA 5KINA 1Q2RA 1OZQA 4O12A 2BY0A 5H6HA 2XH7A 1PE1A 3RO8A 4N0RA 4LRTA 3LUTA 4MF4A 4PSPA 1E4NA 1BD0A 4Q8UA 3AICA 2E8ZA 1H5YA 4AHQA 2BVYA 4O13A 4O54A 1E15A 3U57A 3D46A 1P0DA 1NOFA 9CGTA 3IACA 3WUGA 4WF7A 1FXPA 1QXLA 4TMCA 2EO7A 1QR7A 3C8NA 1G7VA 1R0MA 1VPXA 3GDMA 3NWRA 1KFKA 2AL2A 1S2TA 2OU4A 3OLIA 2H9AA 5CJNA 1GQLA 5DMYA 2B7PA 3F7JA 4QQ3A 1TWDA 4B2DA 2VZUA 4FZIA 1EWEA 4BWLC 5EMLA 1AH4A 3HA1A 1L0PA 3THUA 4ML4A 4W4QA 2QPXA 4JTGA 1FCBA 3ARXA 1JGIA 1RBOB 2O9PA 4K36A 7PTDA 3LHUA 2AQWA 3W0KA 2QJJA 3MBDA 1FWNA 3QYQA 3AIBA 3EX3A 2Y5SA 4NL1A 2ZX8A 4WKHA 5ABFB 1TJ0A 4PYSA 2QDHA 5LXXA 2JFEX 4P2VA 1Q7MA 3S47A 1JR1A 2DW6A 2DZUA 4R7OA 3MCNA 4S38A 3CHDA 1FH7A 4X9SA 4PRWA 1JF6A 1FWAC 2ZUMA 3EPMA 1Z8AA 3APGA 4GVFA 4MLRA 3R25A 3UXLA 1UPMB 3IS4A 3N04A 3W01A 3NQVA 3HPAA 3A22A 3VXGA 5A6MA 1K6WA 3B8TA 2X7VA 4WR3A 2QZRA 1BXCA 2Y70A 5HNUA 2BB0A 1GQJA 1JPMA 1EP1A 2NSXA 1XYCA 5KETA 5K9XA 3M9YA 3SCQA 2YBTA 1MEHA 2ATMA 1LP6A 1G4EA 4JTHA 1B3ZA 2WHLA 4IZGA 1AFSA 4BEQA 1FWRA 1UG6A 3H26A 3QTPA 4UNKA 5FACA 4BJHA 3F4CA 3QJAA 1HL2A 3KLLA 4W8BA 3ITCA 1S5NA 3PZVA 1K4HA 4H7ZA 4GZIA 2ZFAA 3C0SA 2YCLB 4RL3A 1SJCA 3FJ6A 1BQCA 3RLHA 3EBVA 1XIBA 2CBJA 3I4EA 4C7GA 3UJEA 2WAGA 5AC8A 3KRUA 2YL9A 3HU7A 4D8LA 1NDYA 3SN1A 4HPHA 3WMLA 1B3VA 3DH7A 3WJSA 4INFA 4Y90A 5T26A 4A22A 3TV8A 3NPWA 1HVXA 1DJQA 2DT3A 3V36A 1JDAA 4N6EA 3BLEA 3WZ0E 3W1UA 1RQBA 1KR0A 4ZO8A 2C0HA 4PMDA 3HURA 3RFAA 2PTWA 1XYAA 5M2FX 3FN9A 3ABXA 2W63A 5D04C 4MLJA 4F79A 5EY5A 3DCPA 2NQ5A 4Z1YA 2RUSA 2EKGA 4XZ9A 3CL8A 4GQRA 4XB3A 2VYOA 4N9DA 1G94A 2RAGA 3RCMA 3ZO9A 2PGEA 4NG3A 3TH6A 5IHRA 1VEMA 3KBVA 4DF2A 2QUTA 2VOTA 4FNUA 1XPGA 2J77A 5HWMA 3OVPA 4BI5A 4I90A 2DSVA 1RH9A 4M1BA 3FX4A 1ML1A 1H7XA 4UMAA 2J79A 2ZE0A 3M5XA 1HKKA 2GSJA 2GVYA 3CZJA 3VM5A 2FMOA 3LSBA 4P7OA 2XN0A 5EMJA 1JZ6A 2DH3A 3P5YA 3PSVA 5A1AA 1JCNA 3MV11 3QZAA 4GCAA 3PTDA 1PKMA 4MYXA 1EP2A 3IVTA 1FWHC 1UD3A 1TX0A 1VFUA 1C29A 2UV8G 4ZB5A 3UBPC 5DY2A 2OLSA 3OW1A 3CUHA 3N6HA 2XIJA 1TTJA 1ZSXA 4ZODA 2OZ3A 2OVLA 1CGYA 1UD6A 3NYDA 4QR6A 2OSYA 2VC7A 1J0YA 3MUIA 1A3HA 2ZZ3A 1UP3A 1U33A 3BE7A 2WV8A 3FFSA 1PS9A 1A5MC 4ECLA 1DHKA 3N34A 4DPPA 4LEFA 5K7JA 3UPWA 4Q8VA 1GOMA 2YCKX 3OBAA 3CLWA 5LHFA 1QHPA 5FAGA 4JGDA 3VMOA 3L0GA 2FIQA 5G2IA 3NIYA 5G1TA 3C8FA 2D69A 3APTA 3NQAA 1H60A 1UD4A 4H9YA 3TW7A 1MVYA 5CJ5A 4RNHA 3N14A 3L68A 3S9ZA 4GYJA 3K13A 1XSJA 4HYVA 3IIVA 4AISA 3QEZA 2VDHA 4MSSA 2HCVA 1M9HA 1RJPA 4FOKA 5AOUA 4WKAA 1XLIA 2PD5A 3M0HA 2V3DA 1OX5A 1R2TA 3B0XA 5AKQA 1PKYA 1F8IA 1UUOA 2CU0A 1EP3A 2VR2A 3R7MA 3S2JA 4U3CA 1J6PA 3BJTA 1B90A 3AI0A 2X41A 5F2GA 4GCXA 4R27A 4HN4A 3ZWTA 3EPOA 4DZIA 4H9XA 3NEVA 1ZAIA 2Y5EA 2VR5A 1VP5A 3P8IA 4K2SA 3RR4A 4GNJA 4LYKA 3RILA 1VENA 2VEMA 5A3HA 2IQDA 4Q6JA 1GKQA 4CD8A 1GGOA 1S5WA 4O4WA 2E4TA 1JZ5A 5BW6A 1V0NA 2PSNA 4UTTA 1IIHA 3IJ7A 2OSWA 5D8WA 1KCLA 2HWGA 2PD9A 5AHIA 1QNVA 2XYLA 2YW3A 2GOKA 2G37A 5FL0A 1H50A 5D2YA 3T0DA 1IHIA 4DM1A 3W7KA 4EACA 4E2DA 3MY9A 2WZEA 1E73M 1YQ2A 3PUGA 1XJBA 1FWCC 4TQTA 4FLQA 3IJLA 5FA5A 5C6MA 4Z2IA 2V69A 1BHGA 1P5BA 3M0XA 2A3AA 5GJPA 2WM1A 2FTYA 3BQ5A 3KOFA 3G0SA 4IL2A 8XIMA 5CGQA 5F1VA 1WKYA 2J88A 1K77A 4AC1X 4K38A 4QFUA 3E12A 2GVEA 2GVGA 4GLEA 1KRAC 3LEPA 2TRSA 2PWDA 2FVKA 3NZ1A 4AWTA 3GUGA 1EXBA 3GDBA 1J10A 2WB5A 3MMWA 2Z0IA 4HZ7A 4CD4A 5EBAA 4B5VA 3KVKA 3WMSA 3NYZA 1NQKA 1KXHA 3MHUA 4DBUA 4ONVA 1E9IA 3CZLA 2X16A 1WDPA 3IAQA 3L4WA 1EJSC 2V0TA 4TIMA 3VU2A 1E56A 1WKFA 3N2BA 2QCDA 1OHLA 1LCOA 3GU1A 3GH5A 1W9PA 2QAFA 1FOBA 1RUSA 3G24A 3TFXA 2QJMA 4MNJA 2P3EA 4NT0A 4HGXA 5C9ZA 3WQ5A 3H7UA 4C6BA 1P6BA 1GHRA 3LTPA 1AH3A 4JIIX 1GONA 3AUJA 3E5PA 1Q6OA 3AJ7A 4KT2A 1MNSA 1XLJA 1UQZA 4LXFA 1TWWA 1X8FA 2QUNA 2NX1A 3W1NA 4KF1A 3VABA 2WPBA 1YBQA 3T05A 2V2HA 1V77A 2PCEA 5CQ1A 2WCAA 6REQB 2ACRA 1D8WA 4J3WA 1X98A 1JDEA 4LWWA 4D6FA 1OYBA 4IQDA 1W5NA 3PWAA 4MKSA 2OWWA 1BAGA 1E4MM 3WCZA 3B9NA 4UTJA 2F9RA 2PBGA 1JNDA 2TSYA 4AF0A 1YLVA 4BQ5A 3A3HA 5CSRA 1TG7A 3U4AA 1JFHA 2PDYA 3WO8A 4QSFA 1O68A 4M7SA 3GTIA 1U30A 1FHLA 4QBXA 1DJGA 3ZSTA 5K2ZA 2Q01A 5CXPA 3PBGA 4Q7NA 3LNPA 3PY2A 4LUSB 3GW3A 1A0DA 3LPFA 1TO3A 2G5WA 4CEUC 1QO5A 1M7PA 4N9BA 4G2DA 2C13A 4RPPA 1XSKA 2HRWA 5FSDC 2ZZ2A 3BPWA 4DF0A 2XM1A 5JIWA 3P61A 1Q2SA 3FJ4A 2E9BA 3TYDA 4O11A 2FMNA 1EJ7L 4WDWA 1OFBA 2ZYFA 5DBTA 2X1SA 3W29A 1PHWA 3CLMA 5I3GA 4UQCA 2ZDRA 3CZEA 3OYXA 1I2RA 5AZ1A 1VAHA 5BRBA 4IPIA 1VQTA 3BAIA 4LNYA 3ICJA 1SGJA 3IIOA 4IP7A 1TYGA 2WCSA 3HGJA 3MKVA 1I9CB 1OYCA 1CGXA 1RSCA 2QDEA 4CGTA 1ZRQA 3HTWA 3TNOA 3VOJA 2PWUA 2YL5A 3VI2A 2YCIX 4HOXA 3VM7A 3P5ZA 4MDPA 3GIPA 2EEXA 5BZAA 2HISA 2WANA 1EEPA 1OGGA 1YX1A 1XC6A 3QLDA 5CZKA 4E3VA 3SB0A 5K4ZA 2GLKA 3RF9A 3TTOA 1JCLA 5DBUA 4UTUA 1TX2A 3KWXA 3JR2A 3WSUA 4WOQA 3NFUA 2VRKA 2OELA 1QHOA 1BXBA 2Z1SA 5AHFA 4Z42C 3H8AA 3T0TA 4V2XA 1SUXA 3B05A 4OBRA 3S3GA 3HG4A 4MG4A 4NI3A 1ECEA 1QOQA 2RDWA 1VBJA 2UBPC 4DO4A 2C3ZA 2BZNA 3W1AA 3WDRA 4A4AA 1FUYA 1HJQA 3MVIA 4XIAA 2BDQA 4MNKA 4HPNA 1ICSA 2V9DA 3UXDA 3AXHA 4QEHA 4A21A 3ITLA 4F3HA 3OHIA 1FY6A 4OV4A 1OSEA 4FALA 3AS3A 3MI2A 4X0VA 3ARRA 3MU7A 4QIUA 4AD3A 1SO6A 3N12A 3WH5A 1E6XM 3ENLA 2W66A 3GHTA 5F2MA 3V5FA 4CNNA 4KRUA 3SO7A 4LY8A 1TZ9A 2W3ZA 1GJWA 1F3XA 3TTQA 3WLIA 2GUYA 4E6MA 1VRXA 3DI0A 1LQAA 5IFTA 1JPIA 4C6PA 1RPXA 3S5SA 5EGRA 5FF4A 1WXYA 2CPUA 4O1CA 4JTUA 3AHZA 2GJLA 4UFJA 4PMUA 3MDWA 4C6QA 4NNCA 3GG7A 1CXIA 3W22A 3KBWA 4JFVA 4RCXA 2JKEA 3UWYA 4XG1A 3LCLA 5FF2A 4FP1A 1JUBA 2BP1A 3ALFA 3F4NA 2AMXA 3O06A 2J8GA 1QI4A 3UT0A 2YZ5A 1KKRA 2VHLA 2ZRYA 2BG5A 4BF5A 2CLMA 1CEOA 5M3WA 3B4UA 3LV5A 3HMJG 1MW0A 1RALA 2WMJA 3ANUA 3CH9A 1N8WA 3BC9A 1B31A 1PVNA 2QJIA 1X1NA 3VDAA 3LENA 4LEQA 4C5ZA 1JIBA 4KMQA 4GJIA 3CAKA 1LL6A 4ATLA 2ZWYA 4WSHA 2VEFA 3HBLA 3ZR5A 4HVXA 5LHEA 1CXLA 2W5FA 4BF7A 3NG3A 3WLTA 4FA3A 5HJYA 3HPZA 1P4CA 3B0UX 4AIOA 4O50A 4I5RA 1LUCB 1ZBCA 2A7PA 3LI1A 3W38A 4B5WA 3ZS4A 5A8NA 5I3JA 2WLZA 1F2JA 2FPTA 3CPUA 3BOLA 1BYBA 3DYOA 4HNLA 3RAOA 2C14A 1YDOA 4MOZA 1UBSA 5HAOA 3ZLHA 3OVQA 4NX0A 4TV5A 1BTCA 3ID7A 2PWVA 3H4WA 4I6VA 4WSKA 3UZZA 3FXYA 3TJIA 5ABHA 2YCJA 3STGA 3L4VA 2NX3A 4DHGA 4M5PA 4K8EA 1EJVC 4BFAA 2HK1A 1A0EA 4JX6A 3AHYA 2ZRUA 2V5JA 5MHBA 1BGAA 2REQA 3A4XA 2V5CA 3CZGA 4Q22A 1VFMA 1CDGA 4ASTA 1VFSA 3C2EA 3N19B 1Q8JA 3WQPA 2ALRA 3N9SA 1V3JA 3N6QA 4LVBA 3O07A 3OG3A 2PU1A 4JS3A 3LQLA 3FSUA 4JTLA 3AOFA 3UZWA 4IIGA 4Y9AA 4PUKA 1W3NA 4P7RA 1ONEA 1IXQA 3B3DA 3WQ4A 3SQMA 2IXVA 2YXXA 4W7VA 1PL9A 3PZMA 3W53A 2NV2A 2XIMA 1VYPX 4P8WA 1HKWA 3UWWA 4GVGA 4W87A 2HJPA 4A6GA 1KV8A 4GC4A 2W0UA 3A4WA 3N2TA 5A6LA 2J6XA 4GACA 1L6FA 3JW7A 3NQMA 5EKYA 5LIYX 1BWKA 2ZUUA 1UMYA 2BASA 4KS0A 3C52A 2QCLA 3VKJA 3WQVA 2Z1XA 2NVCA 2VX7A 1VRDA 3S2MA 5BXPA 4JFWA 2J24A 3GNNA 4AZHA 1HJWA 2WMGA 1B3OA 3VIIA 2QGHA 1GOOA 1N8FA 2EJ1A 4NU7A 3F2BA 1J2BA 2DPEA 1YNYA 1AK5A 3RCYA 4LCRA 3HZ3A 4L6DA 5BRPA 4B5XA 2G4JA 2G3JA 1UC5A 3PR2A 1A5KC 4E4FA 4Q3MA 4AH7A 3NDZA 1B5TA 3TLQA 4AF0B 3SJNA 4LAKA 3TKFA 1MDLA 4WY0F 3TROA 2NX9A 3TWAA 3BW2A 4A3RA 4JTRA 3KP0A 3TTEA 1H3GA 1TPB1 4H7CA 2HBXA 3OYZA 2PP3A 4WGXA 5C9WA 4GYPA 4AY1A 5M5DA 3GDLA 4KETA 4LBSA 3AZRA 1QPNA 3R79A 1VH7A 1XH1A 3RJXA 3NXFA 3PZGA 3CTTA 1E5NA 4MYAA 4J4KA 4LX4A 3QW4B 2VFFA 4C1NA 3COTA 3TU9A 1DBTA 3IEBA 2R82A 4IX0A 4C6IA 4D8AA 4U2ZA 1RBLA 3CT7A 4QAIA 4J3SA 1DJYA 3TX9A 3W02A 4O28A 2OODA 7REQA 3BV4A 2RDTA 5DY3A 1YADA 3QN3A 4BK9A 1XP3A 1QI0A 2QDGA 5H8UA 1VIWA 3NO3A 4FIRA 2BX7A 1K02A 1XLEA 2UY3A 3C2RA 5HNNA 1OFDA 3TN5A 2VNCA 1ONWA 3AMDA 3L4YA 1EIXA 3W71A 5CLTA 2I5QA 2G50A 3O15A 5FF0A 3G2GA 3ABRA 4AIEA 1ENUA 3P0WA 2YB1A 3W7PA 4IUGA 3CAQA 3TE9A 3CQIA 1R9XA 1DJHA 1GHSA 2QS8A 4LT9A 5HNTA 5DCBA 4C7FA 1SYTA 4K1WA 3K4WA 3ZMRA 4LYPA 4HNOA 4A05A 4ACYA 2YOCA 4FR1A 4HCDA 4L65A 3VZYA 2GQ8A 1GUVA 4DX3A 5DO8A 5GJMA 3SCWA 1DIOA 4PCNA 2PLJA 1NDZA 4LY4A 5FESA 1UKOA 2E77A 4OU1A 3SI9A 1YDNA 3GSMA 4BY3A 3MMDA 1ZPTA 1DE6A 3GU2A 2DZTA 3PJUA 3M0IA 2YDRA 3EWCA 2VFIA 3DXIA 2WVUA 5E0FA 5KZDA 2NV9A 3QC3A 1EC8A 1LLZA 4B16A 3BSHA 5JQ9A 1DIEA 4GBDA 4FO4A 4AG0A 2NW0A 3TJXA 2MUCA 4RW5A 1R30A 1V3HA 5I2UA 5LNSA 1PYFA 2C1GA 2R24A 2EAWA 4X2PA 3MQTA 3AYTA 2TPSA 4IPPA 4NYYA 4ES4A 6ALDA 1TA3A 3T7VA 1I60A 3WUBA 4CU7A 1XPYA 2Y7DA 3NOYA 3L0NA 3MUZ1 2TAAA 1P0BA 2YZRA 4FXRA 3I6TA 4U2YA 2OJPA 4WY0B 4RE4A 3PG8A 3AMCA 2EBNA 3W7RA 3ZJ7A 2Y2WA 5CBJA 3WMBA 4F40A 2DU2A 2RKXA 1H11A 1PWLA 2V5KA 3FOKA 3T07A 1T96A 4AFYA 1E51A 3VIKA 4O8AA 3DBPA 1QI3A 2OKTA 3T2OA 1CXKA 1QMLA 1TIMA 1LLWA 4JFTA 3QHMA 3EWYA 4KCUA 4RXGA 2BOGX 4QSHA 3S1UA 4R9OA 1KFLA 3BLKA 1W32A 2OO0A 1IR1A 1VFLA 1J6OA 4GI6A 3DI1A 4NASA 2EPLX 3DFTA 2PDFA 3GXDA 5CC5A 2XTKA 4PMZA 4DJDA 3U6WA 2PB1A 2PURA 2IKHA 3B0YA 3W7LA 2D23A 1XG3A 4NRSA 3WQFA 3TSDA 3KX6A 1XYLA 3M0YA 4M82A 4JTSA 2XIIA 4AC7C 2PUZA 3ZIZA 1A5NC 1TE1A 1IXPA 1GZGA 4ILSA 3V0UA 2DZAA 1SJAA 4FX7A 3SCTA 2QGYA 2DVUA 1Y5WA 2RGMA 5U7SA 3VVGA 1BVWA 1MUWA 3THCA 2PPGA 3MDUA 2ISVA 2WJFA 1KBLA 5FJRA 5AFDA 4ALDA 4OBSA 1TTQA 1C7TA 4IPJA 4XAYA 3P81A 2GK1A 5HMDA 1A5LC 2FZMA 1JD9A 3HG5A 1TJRA 4H9MA 4W88A 3PBUA 3E2QA 2QCFA 4PMYA 4UTWA 1W3TA 1YDVA 4D2JA 4ZO9A 3K5XA 3AU6A 5XIMA 1US3A 3KCLA 1XQLA 3WF2A 5G4WA 1HXJA 1XLDA 5B7ZA 1MRAA 1UD2A 2OXNA 3WBWA 4E8GA 4X22A 1IWAA 3L4ZA 3ONBA 2F61A 3CB3A 4YPJA 1J96A 1T41A 4AD2A 3VK5A 2FZDA 2I17A 2I57A 3MSRA 3PJXA 3S6OA 3W70A 3WENA 2WWDA 3HN3A 3W6MA 1V6WA 5IM51 5FEPA 2G41A 3E0IA 1W5OA 2I7GA 4GD0A 4QJ3B 1AH0A 1WV2A 3UZYA 2A0NA 1VHNA 3RDKA 4ERGA 2PLKA 1VYSX 4RX0A 4AU0A 1EJTC 4YLWA 3S46A 4X61A 3S5YA 2FQIA 1BYDA 1CB7B 1OIMA 2QHAA 3L4UA 3WFLA 4Z1CA 1A5CA 1SZFA 2ODOA 4YHGA 1Q6EA 3SUWA 5KZEA 1GTEA 3A24A 5CGTA 4PTMA 5I6SA 1XBXA 3WNOA 4HU8A 3V4BA 2V38A 1ZJIA 2YIHA 1DWAM 2A85A 3QV9A 5BROA 2Q09A 2ZC1A 4LB3A 1HFBA 2PRMA 3WLOA 1DWIM 2V3EA 2ZZ4A 1V3KA 5J5RA 1UWSA 3CASA 3PNUA 3QTGA 3UPBA 4YXGA 4GPNA 5CJMA 1UB3A 4E4PA 3PPFA 4C65A 1MW3A 1K9FA 2GWNA 2KAUC 3GAKA 1W2VA 1KQZA 1F8MA 5D2WA 1XRFA 2FTPA 3MI3A 2VURA 4XIMA 1H62A 3U4FA 4R5EA 3CIWA 1U22A 1BGGA 3R8HA 2YKKA 4OIFA 4M6QA 1KNWA 3L21A 3PHAA 4ICCX 4W8LA 2XVKA 2G3IA 1AD1A 1RK6A 4K37A 5FEXA 1IGWA 5AYIA 3FGCA 4X3ZA 3IIXA 4IH3A 5C5YA 1VB9A 4WQ6A 3SY5A 3QKEA 1F05A 4NVTA 1Z9AA 4IIEA 3P93A 5MKGA 2DGAA 4Y9PA 1W2PA 3UWUA 3TOPA 1K7XA 3CUFA 4UR8A 2NUWA 1EDGA 2GDQA 3BAJA 1JPKA 1YE6A 1MSSA 3B8UA 3PWGA 1JXKA 1W8GA 3OGVA 5HDRA 4PL1A 4EWJA 2ZCGA 1W1A1 3UESA 1DOSA 3MO7A 3AZTA 5AC7A 3BXWA 1C90A 4J3TA 1I0DA 4WEVX 3IJQA 1A80A 4NAEA 3PZQA 3QR1A 1PB0A 2DH2A 3RU8X 5A8GA 2PWEA 2YXGA 3TJLA 4IFRA 4J3ZA 1TPUA 2IQ0A 4PUEA 5I79A 2HZGA 3VGHA 4G7EB 3N2CA 3M43A 1BXNA 4AWUA 4O19A 3WYZA 2VR4A 2ZX7A 2WC4A 3W9ZA 1W9XA 2WSRA 3UYIA 4MVAA 2X1RA 2HNHA 1H61A 1XG4A 3GC4A 4JKMA 1OY0A 3TN3A 1LJYA 4POCA 5FJPA 4L1GA 3QHOA 4FB7A 2Q8XA 2EHHA 3LERA 3FDGA 2C71A 4L6OA 4AVNA 3ARUA 4H4IA 3EMZA 3KOZA 5DFAA 1R2SA 1UMLA 2R1KA 3CUGA 2DUZA 2VD8A 3PBYA 3H2FA 2V5BA 4A8NA 2PF0A 3A6OA 2YDAA 3R89A 1Q6LA 1EEXA 4HB7A 3NQ2A 3OB8A 3MP3A 1K8CA 4LF1A 1J01A 1I6NA 2QCCA 4MNLA 3WD4A 4CN6A 2NSOA 3GVRA 2OX1A 2E5BA 1DTNA 3E1F1 3LRMA 4XO6A 1HJSA 2PDGA 4C6EA 4H2CA 3ONCA 3CHVA 2XGBA 4D6GA 1ZUAX 4TOQA 5I5RA 1XKYA 3G3MA 1I2QA 3WDHA 2FZ9A 2A3CA 2D20A 4EANA 5F7UA 3F5JA 1IZJA 3BSMA 4ORIA 3NZRA 3SUSA 3FEMA 3MA8A 1HVQA 1G5AA 4U3AA 1XLMA 1XICA 3PULA 2D3LA 3QPEA 3IUHA 2OOGA 4Q8QA 3THDA 3CO4A 1KBBA 3MB9A 3RM4A 2RJHA 2EXOA 4WRHA 1YW1A 1MZHA 1IT8A 2GJNA 1IZKA 4DPQA 4U5IA 2YLAA 1EHAA 3UPMA 3UNDA 4YNGA 1KM6A 3WNLA 1HUVA 1F76A 3H2CA 3WD2A 3IUDA 1LWIA 3OG2A 4N42A 4GIYA 4W7UA 5CSUA 1EB3A 1B54A 1TZZA 1IEXA 1POJA 4FPSA 1A50A 4HMCA 4LV4A 1TV2A 3LLDA 2BHZA 1W1YA 1PZ1A 1RPKA 2RGLA 3LZ3A 3RUBL 3RJYA 3LA4A 2EPKX 5GJNA 2IXUA 4P8VA 1DWFM 3PP7A 4AUBA 4ZOBA 4GX9A 4JN7A 2HXTA 2XUCA 4NY2A 3EKGA 4RXFA 3AYRA 1P6WA 3MVTA 4JN8A 4HTBA 3W2JA 3W3OA 4NIRA 3BWWA 3EWWA 1DXEA 3RLVA 5HQEA 4IGHA 3WLHA 2YW4A 3EWXA 4K3ZA 1EX1A 3MZ2A 3L23A 2BGQA 2INEA 4M7TA 1F9CA 1KM2A 4XKMA 5XIAA 3VKAA 4YTTA 1GOXA 1KB3A 3TFCA 1BF2A 3R4IA 3T0CA 3T0AA 4C91A 1YKWA 2VGFA 4NNAA 4UNLA 1RQEA 1J0HA 4WDTA 3QRHA 3FV9A 1OBAA 2POZA 4B15A 4AWSA 4QCEA 4FOJA 3M6DA 1D9EA 4GO9A 2CLIA 4OWGA 2AMGA 3UG3A 4D6EA 2W61A 3G1XA 2DQXA 4TUFA 1SO5A 4G8TA 4AD4A 1VHCA 1BEUA 1XS2A 4UQ9A 2I16A 4XAZA 2ZRWA 3WQ6A 1Z69A 2JGQA 2WO5A 2C16A 4GXWA 4JQ1A 1I1WA 1N2VA 1JJKA 2IPFA 4WHBA 3FVDA 1M03A 4MAVA 5HWNA 2GQ9A 3ABQA 3GNPA 1ZJHA 3EYPA 4TO8A 3LXCA 4GGHA 2WNWA 2FPVA 4IFKA 4M8UA 4EWND 4CNOA 1WQ5A 3MP4A 1B3XA 4ZL1A 3BGAA 3EXRA 1H63A 1KGXA 2GVJA 3LHZA 1O4UA 2G0WA 1M65A 4PCPA 4HU4A 1F6YA 4O0ZA 4PMJA 4A35A 1J8VA 2YPIA 1UWAA 3SRDA 3I7RA 3N2XA 3P2VA 1YE4A 2QF7A 1YNQA 3QY8A 2CKSA 1H5VA 3UY8A 2PDKA 3PBWA 4I8YA 1O95A 3A47A 3I6RA 2Z1WA 3SN0A 3QZEA 1E6NA 4JTKA 1NEYA 4AIUA 3WLRA 4GUGA 3NZPA 3KRSA 5JU6A 4AX6A 2FVLA 1PTGA 2AOSA 2VX4A 2ZVRA 3BOXA 4UMCA 2Q02A 4AD0A 2WHJA 2FHBA 1XYFA 1DIKA 2DFAA 5CPLA 3LTSA 4KW2A 1UZHA 2P3ZA 3KRBA 1J2WA 5KZ6A 3SQSA 4JD4A 1AZ1A 1H49A 3PN8A 1KXVA 4OTKA 2WMHA 1UA7A 1G67A 2CYGA 2PDIA 3O63A 3SIMA 4UQAA 4C60A 1KW1A 1NAL1 3U7BA 3EDFA 4GGBA 3IJDA 2R9RA 1BTMA 2NQ9A 2ZOXA 2XDFA 4REQB 1SO3A 5DMNA 3PZNA 1AQHA 2J7CA 4MTVA 1O6IA 1X6NA 3W81A 4XVEA 1Q3NA 4B4HA 3LV6A 2X0HA 1RJRA 4M6VA 1BYCA 3LRKA 4XAFA 4J40A 3S6TA 1WPCA 1QCWA 1HL8A 1A53A 4H41A 1DYSA 2J74A 4XZNX 5A5WA 4RW3A 1YMYA 1LRQA 2JBMA 4W84A 1PTDA 3WLKX 1WA3A 1HJVA 2RDXA 1JDFA 2IKJA 1NQ6A 3NUKA 1Z6KA 3VGGA 2AL1A 3PVFA 4GZJA 1SFTA 4AZGA 1XKJA 3OLGA 4F0LA 4ZGYA 3QHNA 1DWJM 1VFOA 4CQDA 1BFNA 2CLKA 2XIBA 1S3HA 1TREA 3ZZ1A 3I68A 5DX7A 1MEWA 1B1YA 4Q4OA 4MZ1A 4BA0A 3L67A 4WD0A 2OPJA 4BI7A 2ZXBA 1TUFA 4ZCWA 3H24A 1E9LA 2ZQ0A 1LG1A 2Y63A 4GUJA 4LUTA 3AMKA 2JEPA 5G4EA 4DWDA 4OGZA 4HP5A 4GIRA 1UH4A 2ABBA 3L4XA 3LS9A 4ICMA 3FCPA 4H8VA 4IIFA 2P88A 4M24A 3WK3A 2WMKA 3O6DA 1YXDA 3HJZA 3KP1A 1FWBC 1H1NA 5LYRA 3NQ7A 3OODA 4NQ1A 1SJDA 2CZFA 2J75A 3CH0A 4MB1A 3EMQA 4I9JA 4ZSUA 4Q8OA 4US5A 2VELA 3IWPA 1DE5A 4YL2A 4MWAD 2DSKA 3D47A 1GVSA 1UH2A 3E0FA 2YX0A 3SCRA 4AZBA 1FBAA 1XIDA 4QROA 4O15A 3UWQA 1MWOA 4CCZA 3MCMA 1GG0A 4HHMA 4KIRA 1TE6A 3LXBA 3OVRA 5CSYA 4DJEC 5PTDA 2C6QA 2DW7A 3KRZA 2NT1A 3TN4A 3EKLA 3WD1A 4XZMX 2A3HA 4JHOA 4AIBA 5CC7A 3TMQA 1FA2A 3I3DA 2WZIA 5C9RA 1VLIA 2J27A 1K7FA 1W3KA 2FDMA 4MIMA 1RCOB 1DJIA 5DANA 1YTDA 4KFNA 1BF6A 2YL6A 2X1TA 4V1XA 4KIEA 3B04A 1NVMA 3UGRA 3V3WA 4HOZA 2Y7FA 3WF1A 2O4QA 3EX4A 4QJ1A 3M4HA 3IK4A 4FNTA 1RVGA 2E6FA 2INFA 4WXZA 1LL4A 2WLYA 4DJFC 4H8UA 4IMFA 2C91A 1W3HA 4GG9A 4O1AA 3UNTA 2AQVA 3W87A 4XBJA 1DPMA 2AKZA 5BU9A 3SECA 3UQNA 1GCYA 3T8LA 3FLUA 4B5TA 3VNZA 3L66A 3QOMA 4IWWA 2CFFA 4CQBA 6XIAA 4MFDA 3UFYA 3BSGA 3STCA 1QU4A 3OO2A 5C7HA 4GUHA 2CWXA 4UFKA 2Y7GA 2CZDA 1A5BA 5E6YA 4CUCA 1PSCA 1E1CA 2A5HA 1RCXB 3AWNA 2JF6A 4GA8A 3QFWA 3G18A 4XVDA 2WVSA 2P53A 2Z6IA 5AVHA 2QDDA 1S1PA 4NAFA 2J7FA 3NTYA 4U4MA 3QKZA 3AU2A 4GNKB 1HX0A 4QNWA 3SY1A 2WHKA 3VFLA 1ELSA 1CGWA 2GQ3A 4LTSA 3OU8A 5K4XA 3CUXA 4J28A 3BGJA 1PO9A 2WHMA 1JQVA 3QM3A 2XU2A 2TMDA 3RPTA 3TK7A 1OGBA 4HYWA 2XSAA 4YJ5A 3DFOA 1IIGA 1JZ8A 4KQNA 5JUVA 2C0AA 4OJYA 4W9TA 2A3LA 4Z08A 1F3TA 3AMGA 3BCFA 1IE7C 3VUSA 2DZBA 3KVMA 4K8HA 1DQWA 2CLEA 1XLBA 3QQWA 1KTCA 2CLHA 1EBHA 4ZTXA 5CBBA 3GKAA 2R91A 3S2LA 3M5YA 1MUCA 3ZXWA 2LLEA 4A3YA 4IQLA 1K03A 3P60A 3PBVA 1LOQA 3ARQA 5C2GA 1FCUA 4ZBCA 4LB4A 3UJSA 3ARWA 4JR5A 1EC7A 3B8DA 1UKQA 3PB2A 1X7FA 4OOUA 2VQUA 5EFDA 1S1RA 3GDKA 4ZTYA 2KX9A 1REQB 1EJXC 3CHEA 5EMYA 2B7OA 1ZY9A 1J4EA 3WNKA 3IJIA 3VNKA 1TCMA 2ASHA 3GIYA 4LS2A 3GWQA 1XR2A 4JNYA 5BMWA 2JALA 1TVNA 1FP9A 1OQFA 6TIMA 5EU9A 2A4AA 4MJ2A 4FNRA 1NTHA 4CQ8A 4HT3A 4ATDA 5A6SA 1ISZA 2BBFA 1XCFA 1ITUA 3O3RA 3W6LA 3JZUA 1OCNA 4B91A 3IIZA 3BLOA 3QV7A 5D2XA 4FK9A 1EF3A 4XKYB 2YB4A 1P6CA 5CPMA 2CBVA 2HE8A 4XD3A 4IJRA 4LBRA 4WZHA 2YLLA 5KZMA 2YYTA 1NOWA 1X1ZA 4PZVA 1E6ZA 4R33A 4C6MA 1TR9A 3W1PA 2HSAA 2ZIDA 2MNRA 1A5OC 1XUUA 3MSYA 3W6YA 4PEKA 4PUNA 1KC7A 5CAKA 3P62A 3W7HA 5DXYA 2NQLA 2DT0A 4E2VA 3G77A 1R3TA 5E9AA 2OFJA 2VGGA 4PTVA 3NZGA 3GG8A 1TSIA 4JCLA 3UA4A 2YJQA 3W7OA 3QW3A 4PCFA 5E5CA 3EB3A 4K1GA 1EF2A 1Y8BA 3E0LA 3L2MA 1ZBKA 4K6AA 4XISA 1F6KA 2Q3OA 3W23A 3GB6A 2FFCA 4F0RA 4YCPA 2I9EA 3A64A 1Q6RA 3B9DA 3WBAA 1XV8A 5A8QA 3OOQA 5AHEA 3W2KA 2NXIA 1I2NA 4DZ5A 3B03A 5ECVA 1SZRA 3SFKA 4JL1A 1EH9A 1NF0A 3P3BA 2VFDA 1E55A 3IRSA 2WK2A 4UCFA 2CKRA 2ZUSA 4AYSA 4HBKA 4GX8A 2VC5A 1ZJBA 2D2GA