1J6OA

Crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
260
structure length
260
Chain Sequence
HHHHMVDTHAHLHFHQFDDDRNAVISSFEENNIEFVVNVGVNLEDSKKSLDLSKTSDRIFCSVGVHPHDAKEVPEDFIEHLEKFAKDEKVVAIGETGLDFFRNISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEAYEILRTESLPEKRGVIHAFSSDYEWAKKFIDLGFLLGIGGPVTYPKNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEPKYLKYVVETISQVLGVPEAKVDEATTENARRIFLEVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TatD-related deoxyribonuclease (TM0667) from Thermotoga maritima at 1.8 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords TatD-related deoxyribonuclease
total genus 103
structure length 260
sequence length 260
ec nomenclature ec 3.1.21.-:
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01026 TatD_DNase TatD related DNase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1j6oA00
2QVNA 2Z26A 4EPBC 4DLMA 4D8LA 3ISIX 3K4WA 5A6TC 4QS5A 1KRBC 4CNUA 4IFKB 1A4MA 4H9MA 1FKWA 4HA0A 1FWFC 4CQBA 4C6EA 4CEUC 3S2LA 4J5NA 2AMXA 1I0DA 2WM1A 3LY0A 3NURA 2CZVA 3RCMA 1RAKA 3EWCA 2G3FA 3AU2A 4KF1A 2PUZA 3URBA 3B40A 1ADDA 3MVIA 4EP8C 2Z4GA 2WJEA 4CQCA 4GX9A 3E2VA 3AUOA 3PAOA 4IH3A 2HQAA 3E0LA 4LAKA 5FSEC 1BF6A 3BE7A 4GXWA 4KETA 4C6LA 1EJWC 4IFOA 1QXLA 1DPMA 4ERIA 1YBQB 3A3WA 4DO7A 1R9XA 1VFLA 1NDYA 3IACA 3MDUA 3FEQA 4INFA 3UF9A 4F0RA 2E25A 3GRIA 4GC3A 4ERAA 1S3TC 4XAGA 2R1NA 4TQTA 4CNSA 3AU6A 3URQA 3F2CA 3LSCA 2FVKA 4RZBA 4IGMA 4LH8A 2YZ5A 3MTWA 2W9MA 2HNHA 3MKVA 2HPMA 4JOMA 2PGRA 2D2JA 1FWHC 3HTWA 4C6PA 4EPDC 4ZSTA 2YB1A 4J2MA 4P5UA 2ZC1A 2DVUA 3TN3A 1E9ZB 2Q01A 5LXXA 2YXOA 2GWNA 2GZXA 1RA5A 1EJTC 3EGJA 1HZYA 4G7EB 5CH9A 5E5CA 4C6KA 3QGAC 3CS2A 1UIOA 4MUPA 4LFYA 4IF2A 1EYWA 1A5KC 3N2CA 3K2GA 2QT3A 4NI8A 2I5GA 4DI8A 3OODA 3T81A 4AQLA 4DYKA 4E3TA 4GZ7A 3IRSA 5HMEA 1P6CA 3E0FA 1RA0A 2FVMA 2HBVA 1GKPA 1RJPA 4H9XA 2VC7A 2P50A 3F2BA 1ZZMA 4C6NA 2ANUA 3CAKA 2VM8A 4YIWA 4XD5A 4DI9A 3UBPC 1KRAC 2Z00A 1FWIC 3RN6A 1ONWA 4F0LA 4UBPC 2QPXA 3S4TA 1RJQA 1ITUA 3DC8A 4I6KA 4NG3A 2GOKA 2Z28A 3R0DA 3NQBA 1V77A 4C65A 4H9ZA 3GTIA 3S2NA 4B92A 3T1GA 1WXYA 2VHLA 4B91A 3QGKC 1XGEA 4GBDA 4IQJA 3UR2A 3GIQA 1A5OC 4H9UA 1YMYA 4HK5A 3SFWA 3OOQA 4KEUA 1FWEC 4GY7A 5FSDC 4R85A 4HK7A 3URNA 3OQEA 4UB9A 1J6PA 3LU2A 1V51A 1POKA 3E3HA 3KM8A 3GTXA 3OVGA 1A5LC 1P1MA 1YBQA 4V1YA 3PNZA 3S2JA 2VR2A 3GU1A 4C6OA 1YRRA 1XRFA 4RDVA 3IPWA 4IG2B 2BB0A 2OGJA 1K1DA 4C6IA 3OJGA 2D2GA 4DZIA 4H9VA 1V79A 2GSEA 4RDWA 3ITCA 4H01A 2Z7GA 4QROA 2R1MA 1K70A 5HMFA 4V1XA 3TN5A 1ITQA 3MSRA 2E1WA 1YIXA 1NDZA 4PE8A 1RJRA 1FWBC 1UIPA 2AQVA 3IJ6A 3UPMA 3T8LA 2OODA 2RAGA 4DIAA 1EJRC 1A5NC 1EJVC 2IMRA 4C5ZA 3TN4A 3LGGA 4C6DA 2O4QA 2AQOA 4XAFA 2HBXA 1P6BA 3WZ0E 4LALA 4BY3A 1KCXA 4QRNA 4KEZA 1ONXA 4H00A 1J79A 1EF2A 4CEXC 3GTHA 4XAZA 3B0XA 1QW7A 2VUNA 1PSCA 1M65A 4ICMA 2WJFA 4XAYA 2EG7A 4NP7A 2FFIA 3IARA 4F0SA 2PAJA 2BGNE 4I6VA 1KRMA 4PBEA 3O0FA 4C6FA 4KIRA 5AKQA 4IG2A 3QY6A 2QS8A 3LSBA 2ICSA 2GWGA 4XD6A 4HJWA 4KQNA 4GY1A 3DCPA 1NDVA 1NDWA 1FWJC 3GU9A 4C6MA 2YB4A 1FKXA 3HM7A 2R1KA 3GTFA 4QS6A 1A4LA 4IFKA 4C6CA 4WGXA 2O4MA 3RYSA 3ID7A 4G2DA 4IFRA 4R88A 4HK6A 3ICJA 4CNTA 4C6BA 4LEFA 4B3ZA 1UBPC 2Q09A 1W1IE 4RDZA 1POJA 2WJDA 4KEVA 2R1LA 4ZSUA 4RDYA 2HPIA 2FTWA 4GY0A 1EJUC 3FDKA 1O12A 2DVTA 1EJSC 3MPGA 3JZEA 1E9YB 2Z2AA 3TN6A 3GG7A 4C5YA 3F4CA 4WHBA 1J5SA 1NFGA 3EWDA 5HMDA 1I0BA 3LS9A 4QTGA 3GU2A 1PO9A 3F2DA 2UBPC 1PTAA 3CJPA 4LCQA 1K6WA 2P53A 2D2HA 1V7AA 3LGDA 4LAOA 2Z29A 3B0YA 3TNBA 1FWAC 4IGNA 3WMLA 4C6JA 2I9UA 3A4JA 4R7WA 2F6KA 3HPAA 2Z25A 1WXZA 4DLFA 4LANA 4DNMA 4C60A 4EPKA 2Z27A 3D6NA 1O5RA 2R1PA 4PBFA 4OFCA 2Z24A 1FWCC 3E74A 4J35A 4LCRA 1GKQA 4LAMA 3PANA 4ERGA 2OQLA 1JGMA 3PNUA 2A3LA 2ADAA 3RHGA 3E38A 3A3XA 3IGHX 4M51A 3UR5A 1YNYA 3V7PA 4LCSA 3G77A 1J6OA 4H9YA 2EG6A 2XIOA 2PLMA 3OU8A 1EZ2A 1R9ZA 3LNPA 4PCPA 4C6QA 2EG8A 4L6DA 3QY7A 4GYFA 3K5XA 4XD4A 2Y1HA 4CQDA 3FDGA 1PB0A 1RK6A 4AC7C 1FWGC 4KERA 1EJXC 3C86A 1M7JA 4KESA 4Z42C 2Z2BA 1R9YA 1M68A 4GX8A 3GIPA 3LA4A 2DVXA 1A5MC 2FTYA 3QY8A 4XD3A 3F4DA 4BKNA 3DUGA 3PBMA 2UZ9A 1GKRA 3O7UA 4DZHA 4QSFA 1XRTA 3S2MA 3MVTA 3IV8A 4GK8A 1IE7C 4RE0A 3URAA 1V4YA 2VC5A 1FWDC 4EPEC 1KRCC 3ORWA 2OOFA 1UMLA 4BJHA 3WYZA 4H9TA 3GUWA 3MJMA 2OB3A 3SO7A 2KAUC 3MDWA 4WVXA 1XWYA 4PCNA 4L9XA 1RK5A 4GOAA 2PGFA 4B90A 3NEHA 4G7EA 5G4HC
chains in the Genus database with same CATH superfamily
3LRMA 3VDCA 4EPBC 2OWXA 4JTCA 1E6SM 3SW6A 3KBMA 3NQVA 3W7NA 1OADA 4PMDA 5CJNA 1HP5A 4IJRA 5AHMA 4J3UA 4FHAA 4KWUA 2V3EA 1OM0A 3DZ1A 3WF4A 3WFLA 4KBXA 1DWGM 3VNMA 1ZU8A 3AU2A 2OEJA 1TJRA 3OLGA 5FI8A 3SY5A 3G22A 1B2YA 3BCFA 2RFGA 4HSOA 4LUSB 4HPJA 2Z1BA 5DFAA 1Y8BA 3E0LA 2PWDA 3LCXA 3U5YA 4CNPA 1BWVA 1L8NA 4ERIA 2UV8G 3SCPA 2YDRA 1NDYA 3QW4B 1KA9F 1CXIA 3T0BA 1TQXA 1HJWA 4WSKA 5C9XA 1F73A 5I24A 3PTMA 5ECVA 3E2SA 5FAGA 1VFTA 1KBJA 4IUGA 3R12A 3A9IA 3HV8A 3IIOA 1N8FA 4I3GA 4MY8A 4YTQA 3MKVA 2YA2A 3R8GA 4IQDA 5BU9A 1FHDA 1EO7A 5FEPA 3N2XA 1ZCCA 5H91A 1EB3A 4C6KA 4GQQA 3NQAA 3H24A 1EYWA 2PLKA 3K2GA 3OODA 4DYKA 5BRPA 1Q6DA 1BVNP 4ZENA 1UA7A 3BANA 4X0VA 1S1PA 4F9DA 2VC7A 4QDMA 4PODA 5KMYA 1U5VA 2PCQA 3KEHA 2ASHA 1I75A 3EBVA 4F0LA 5CAHA 4L56A 3MB9A 4PMQA 5IHRA 2GOKA 1C8VA 5DT7A 2DUAA 2I14A 3FK4A 1VBRA 3NQBA 4U4MA 3R10A 4C65A 1JJKA 2VDGA 2VMFA 3CPUA 1EQCA 2PURA 3G18A 1GQIA 2CPUA 2D22A 1XM3A 1PBGA 4LRSA 3GIQA 3T08A 2RUSA 2FZBA 3LPFA 2RDUA 4HK5A 4MF4A 1NWTA 1SO6A 1J0HA 2PDFA 4XKMA 5I3KA 1JIBA 4GNVA 4NHVA 2PGEA 3PUDA 3E3HA 4Q8TA 4U10A 4JY9A 3TLQA 4WOQA 3VILA 3IV3A 3PUGA 3VMNA 2INZA 3TXZA 4IMDA 2B31A 4Q8QA 1H11A 3HG5A 2W91A 3S6DA 1A49A 4Y2WA 8A3HA 3OHIA 4WSJA 1GVSA 1OY0A 4S3EA 3CZLA 4O1EA 3PJUA 3FJ6A 2ZE0A 4C6IA 4LBSA 2DQXA 3KBWA 3DXIA 1FDJA 1DHKA 1KBKA 3VI2A 3G1VA 3CHCA 2F6XA 1QOQA 4MFEA 4E4PA 2WHKA 4JDBA 4F0MA 3LEPA 3NIYA 1XLGA 1P6BA 3XINA 3O6CA 1L2UA 1L9WA 4EWJA 2QDHA 4KFPA 3WF1A 1QW7A 2VUNA 2E40A 4LQ1A 2C1GA 2E09A 4FIQA 2PP3A 4K36A 4GVIA 5LA1A 2R14A 2XSAA 3RLGA 2D0FA 1UR9A 4A3YA 1BYBA 2J66A 3G8RA 4Z2IA 3BZJA 4B5SA 4DBDA 3O63A 4TVDA 3VFCA 1XIDA 1JD9A 4DB7A 2H8XA 4XTDA 2H90A 3DDMA 1R2TA 3GSMA 3RO8A 3VX1A 5CGMA 3N12A 3RYSA 3UWEA 5CQ1A 1SO4A 3W7CA 2OLSA 1EF3A 3LLDA 3R7MA 1KQYA 2D20A 4CNTA 3LX9A 5DRIA 2ZUMA 1DJIA 1RCOB 4O18A 1ZENA 1M5WA 3KL0A 4AW7A 3KW3A 3ZR5A 1LJYA 4E5TA 2G3MA 3JZEA 2VVSA 3H7VA 3LRLA 4DO5A 4HOZA 1V93A 1I0BA 3IJIA 3S6OA 2QPSA 4AIBA 4PH6A 3GFYA 3DAQA 3T2QA 3NSNA 4MZYA 1KC7A 1V7AA 3AZRA 2GL5A 4LAOA 2PLJA 2DZUA 2AOSA 1GJPA 3B0YA 5FJUA 1Z3NA 3WQDA 3SADA 4C6JA 3A4JA 3KOYA 2C8NA 3WJXA 3RG6A 2QCDB 3Q37A 3ARRA 1IHIA 2CLIA 3S5SA 3OVPA 4ZOAA 4UR8A 5FD0A 1B90A 4J35A 1YEYA 2HVNA 1VFUA 4UQDA 5AOUA 1JGMA 3PNUA 3T2PA 1TPVA 3E38A 4S3AA 3G6LA 2Y89A 4PEEA 4MWAD 3KCLA 3T55A 3S83A 1OGGA 2ZX7A 3CHDA 4AVFA 2HE8A 4H9YA 1S2UA 1GCYA 1A50A 3OU8A 5HINA 1PL9A 5C9UA 1R9ZA 1KV5A 4UC5A 1B3VA 4JPGA 3PP7A 4PSPA 2Y1HA 1H63A 3P7YA 1RK6A 4NF7A 3GH4A 1M7JA 1D3CA 5F2GA 2VEPA 4OU1A 2ZZ3A 1R9YA 5A3HA 1ADOA 2FTYA 4IMGA 2RDWA 2ZXQA 3B4YA 5TAOA 4F2TA 1DJWA 3W2MA 1Y7VA 1V3IA 3AFBA 5DMLA 1XQKA 3MMUA 4UTWA 1V4YA 2VC5A 4EPEC 5BXRA 4Y8EA 1X8CA 2YCLB 3WYZA 4A3HA 4J3TA 2PPGA 3W7GA 1W9VA 2E8ZA 1XCXA 2MUCA 3QF0A 2QVNA 2Y5EA 1JCMP 8CGTA 4JTIA 3EX3A 2AGKA 4B5WA 5AC8A 3W73A 1IQ8A 4CEUC 3K4AA 2AMXA 4D71A 1JXKA 3VKDA 2CHRA 2FTPA 2XYLA 2VR4A 1P4CA 3ITXA 4KF1A 2ZA2A 3WJWA 2QQ6A 3II1A 5IFTA 1MW1A 1QOPA 1TREA 5A8QA 1XYMA 3LRKA 1QNVA 3M0IA 3FKRA 2J7EA 3CV6A 2JIEA 1UWAA 4XTIA 2I57A 2GK1A 2UWFA 3T0AA 5LHFA 5I00A 5CGQA 3M44A 1ZJBA 3LHUA 3W37A 3DYMA 1XIFA 4JCLA 3UF9A 4G9PA 3LCWA 1K8CA 3UQNA 4B4FA 3K46A 3SCNA 2WKGA 3ALGA 1J4EA 1EP3A 4LW7A 3HMJG 1T0OA 2WV8A 4PTWA 3SRFA 5D9MA 3MUCA 5I79A 4ZQCA 3MHUA 3ZQ9A 4O13A 3VGDA 1YYAA 2PD9A 1EJTC 1HZYA 1G4PA 2YX0A 4XZMX 1AG1O 3TYAA 2HXUA 2Y0FA 1NIUA 3P80A 2MNRA 1XKYA 1Q6LA 1Q7ZA 2PDWA 2PWHA 1LT7A 3VXGA 3W7OA 4GCAA 4Z2LA 4I9AA 5A94A 5CBIA 4C6NA 4MSSA 2P0OA 2QCMA 1D7KA 3TYDA 2Y7FA 1FH7A 2DZXA 1P0EA 1MEHA 1W9PA 1A0CA 1Z42A 4H2CA 3VIJA 2VFGA 4KWWA 4ZO9A 3M7SA 3EX6A 3TAKA 3QVQA 1V77A 1NWSA 2X7WA 4B91A 1VR6A 1B3OA 3O0KA 4BF7A 3UNTA 3OA3A 3PTDA 3DFSA 1CTNA 1KFKA 4JKMA 4EOUA 4AZGA 5CKSA 9CGTA 1D8CA 2CLEA 5TNVA 1OGBA 1XLIA 4JQ4A 2DQWA 4C7FA 4XZIA 3WH7A 1FTXA 1P1XA 2Q3OA 4OKDA 1PS9A 3B8VA 1T40A 1IT8A 1GEHA 3SCVA 3LLXA 5D33A 4OV9A 1A5LC 2RJGA 2PDUA 2XGBA 1P5BA 2VKZG 2A3CA 3B06A 2WBKA 1G4EA 4IX2A 4M6UA 1PV8A 2A0NA 3NOYA 4JIHA 2QCNA 2OGJA 1K1DA 5FF4A 2I56A 1UD6A 3NM1A 4LC6A 1FHVA 4ZFCA 1GZGA 3R2GA 3XIMA 2FMOA 1DJGA 1CPUA 1DIDA 3UXIA 2OX1A 1JCTA 3APTA 4DXVA 4KT2A 4NJIA 3MC5A 4XWUA 4R7OA 4DF2A 3O8AA 5MHBA 4IM4A 1R8LA 3I65A 4MIMA 1XINA 1W6TA 4LUJA 1E6RA 1ZB5A 1W1TA 1W2VA 4I6VA 2XN1A 3GR7A 2F2HA 3W2UA 2VRQA 2G95A 1GVQA 2PU1A 5AKQA 4JTJA 1R2RA 4EF9A 5REQA 2W6RA 4RPQA 1OCQA 2RHGA 1JQXA 4BZYA 1WZLA 4WSHA 3CTTA 3P67A 1GZ1A 4OUEA 4H2HA 1VEPA 1CENA 4B5NA 4UTWC 1BRLB 1XH1A 4LRTA 4M6VA 4CKQA 4R88A 1XP3A 2VEMA 4KWOA 3N9RA 5BXPA 3O3RA 4HNUA 4ZR8A 3E0IA 4OWGA 2P1FA 3AHYA 9XIAA 4QG9A 4CNNA 4IQEA 3STCA 1EC8A 4C90A 3CEPA 3S9YA 3BDKA 4NAEB 1S38A 1TRIA 3QR1A 4AD4A 1EDGA 1TMHA 4XBJA 1M01A 4S1FA 2ACRA 3GXMA 1BXBA 2ZRUA 1J93A 4DNMA 5K9DA 2NVCA 3W25A 3M4HA 4H19A 3VKJA 3NZQA 3WN6A 2ZUSA 3TMLA 1E0UA 4PRWA 3CB3A 2GSJA 3NQ6A 3MO4A 2ZIDA 3R79A 3WF2A 4L65A 2QUVA 2YBTA 3RHGA 4ZQNA 1MQQA 3SSJA 1Q85A 5BOEA 2BHZA 3FXGA 2EG6A 2BY3A 2QUUA 3RILA 3LNPA 3SN0A 4AZ7A 4IOTA 4IIHA 1M03A 4IJBA 3PSWA 2X1SA 1X8FA 1PB0A 1RPXA 4AF0B 3UZYA 1SUXA 1W5QA 1BKHA 3TE9A 3T42A 4F79A 5T26A 1DORA 2PRHA 3FHQA 4I7UA 1JXJA 3RNDA 1MQPA 2V69A 2J9XA 5F4XA 3OGVA 3URAA 5KSWA 3C4UA 1CGWA 1XYBA 3ABOA 4ZL1A 1NY1A 2XVLA 3OBKA 4YNGA 5AZ0A 5CCZA 1PTDA 5H8PA 3ABQA 3NEHA 3LXCA 5KZ6A 4UXDA 5CSSA 3OPSA 3ARQA 4LB3A 4E6MA 4PUMA 3PJWA 3ISIX 1VIZA 3O2LA 5B7YA 1H61A 4A2RA 4W93A 2XVGA 2QPUA 2Q8XA 1M41A 1F8IA 3T4CA 2J88A 3QBUA 4CN1A 3RCMA 5E1QA 5CPQA 2EKCA 3TQVA 3QTPA 3UG3A 1T96A 5I07A 3VUSA 1KM4A 1AUSL 3B40A 3VNIA 3MANA 2X1TA 1YLVA 3THDA 2QJNA 4J3WA 1AQ0A 2WYSA 2ZUWA 1DWFM 4C6LA 3LK6A 3BGJA 4DO7A 3W1QA 2WMGA 2DU2A 1ADSA 4JHZA 3T2OA 4INFA 5M2FX 3VIMA 3C0JA 1U5JA 2DZSA 1H09A 2E25A 3GRIA 3GVVA 3DYPA 3LHZA 1TVPA 2XZ9A 3PSVA 4YTTA 5HR7A 3U7VA 4AF0A 2W9MA 2ZVRA 4MB4A 1ODUA 4C6PA 2A3HA 3TN3A 4Q3MA 3GM8A 3AJXA 2YXOA 5HDRA 2DORA 3DKLA 1RA5A 3RM8A 3F1QA 1IV8A 1MXGA 3O9NA 3QV6A 3WEZA 2HVMA 2PZ0A 1TTPA 4JTDA 1QR7A 1XLFA 2QIWA 3EWXA 3E6EA 1UP0A 3E0FA 2VR5A 3H54A 4B5UA 4JFTA 1EOKA 2EJAA 1C3FA 2Y8KA 1VFHA 2PF8A 3P2VA 1EHAA 3F7JA 4QHRA 3W74A 2JALA 4XISA 2BBFA 3BMWA 3MYOA 3BXWA 5LNSA 2VGGA 5BWFA 3B9NA 4YVXA 2FGZA 3HPZA 1LOSA 4DWSB 3PULA 3NZ1A 3CXOA 1O4UA 4R53A 3A5VA 4X9SA 3HQPA 3OLDA 3GXIA 4KW2A 2VL4A 2VENA 3STEA 1UR4A 3QQ1A 4MKVA 3LLFA 3TFXA 3PTQA 1OFOA 1VEOA 1EP2A 4DJED 1BYAA 4LS2A 4U33A 1XGDA 1DJZA 3R0UA 1GVEA 4MKNA 3OOQA 1WB0A 3UEQA 4WCJA 3TC6A 2PDBA 3OQEA 4NXSA 2IQ0A 2WKLA 4MJ4A 1GOWA 1ISVA 1L6SA 4LY8A 2Y24A 3C0QA 3KM8A 3GTXA 2ZX5A 3EDFA 4MUZA 3OVGA 2I17A 5IXEA 4UNLA 1JDDA 2CHOA 3PNZA 1MUMA 3BICA 2WSKA 4Q7BA 2ZZ4A 3KRSA 4KWSA 2G5WA 1HUVA 3JVAA 1U1UA 1PKLA 1YNPA 2AAAA 3DN5A 1AMYA 1TV8A 2ZZ1A 5B80A 1GPFA 3FX4A 4P2VA 3N4AA 1KTBA 5LIKX 2WHLA 2WW5A 1RJRA 4GPNA 2ZXDA 4OUIA 4K1WA 2VD8A 4Z2HA 4D6IA 3AAMA 1LBMA 3LGGA 3I10A 3IJLA 2AQOA 1QW9A 2NQ9A 2GK1B 4Z2KA 1W1B1 4LVDA 1ONXA 2DZPA 1E4IA 1VIWA 1XLLA 4ICMA 4ACZA 2CETA 2VGBA 2WVVB 4AY8A 4FX8A 4UR9A 5JXQA 4JL1A 3WQ5A 3W7QA 3QGVA 4HVXA 3M0ZA 4QISA 2XH0A 2ZRWA 1OFQA 1NP2A 4L61A 3WBEA 4DO6A 3U2ZA 4JKKA 1XH0A 3JS3A 3MKKA 2V2CA 1JG9A 4GGBA 5BMXA 2JGQA 2DUXA 4RXGA 3SJ3A 1EC7A 1NDWA 1K8ZA 1UZHA 5ABEA 3MSDA 3GU9A 2GUBA 3W83A 2WJZA 2YB4A 1XC6A 3VA8A 3B0PA 4V27A 5H8UA 2PI6A 4IPPA 4QP0A 4IL2A 4XUYA 2NLYA 2WAGA 2OJPA 5TF0A 1KM5A 4J27A 1CXLA 4NZ4A 1QJWA 1POJA 4AIOA 3ZT7A 3FYOA 4HHLA 1R47A 3A47A 1XLEA 3VDAA 5HQLA 2XISA 1PVNA 5HOSA 3T8QA 3KAOA 3H2OA 4RK8A 3UR8A 3LGDA 3WH6A 2A3BA 1G9HA 1RLDA 4R9XA 1ZAIA 4I8YA 4FZIA 1OFBA 1YPIA 4JN6A 2A79A 3ZWTA 3W7JA 1XYLA 4NAFA 3B8UA 3ZR6A 3GXPA 4JYDA 1AL7A 3O16A 1YDVA 1FWCC 3SUWA 5I3HA 3PANA 2YCJA 2PDKA 2E5BA 2PC8A 3VGFA 4FNRA 1NWUA 1UZ1A 4NZCA 6REQA 3W85A 4JTQA 1WZAA 1X1OA 5BU6A 1E0TA 3VDGA 4JFUA 3PJTA 4R9OA 5PTDA 5AYIA 1Q65A 3WQPA 2XIOA 1CXHA 3OA5A 3GDTA 2VOTA 3NM3A 4GQGA 3MBFA 2ZQ0A 2VFFA 2H3BA 5HWJA 2P3EA 3FDGA 3AWNA 2OYLA 2VTFA 2PDXA 2W4XA 1LM1A 4FLOA 4CVUA 3SCOA 1SW7A 2EKGA 2Z2BA 1EZWA 1W37A 3B9DA 4DWSA 7REQA 3SCWA 4BKNA 1VHCA 2HRWA 3QXBA 4YHEA 1V3LA 2A4AA 5FEZA 4D6DA 2PWUA 5EBAA 3TFCA 1TWDA 2C79A 2OOFA 1ZBVA 7PTDA 1BWKA 3WFZA 2EO7A 4L9XA 1VFSA 3GQYA 2YDQA 2ZRVA 1TPFA 3KOXA 1H5VA 4MGGA 1ISXA 5H1WA 2IKIA 4E38A 3PZUA 3IGXA 2FKPA 3PBYA 1UP2A 5C70A 1VS1A 4ILSA 5FF3A 3ARWA 1AH4A 1WKEA 2JKPA 1UZ4A 4DBEA 4FF7A 5SWUA 1CGVA 1F3XA 4J5NA 5ABFA 3IRDA 1XBVA 3B05A 2OMAA 2CZEA 2CZVA 4TOQA 1L0PA 5A6JA 1KLYA 1DYSA 3ABZA 4H1ZA 3H2AA 2G3FA 2PUZA 2BXVA 2IQTA 2WC4A 3ZT6A 4M56A 4H6EA 3TX9A 3E2VA 3QOKA 5HNTA 4BWLC 2PB1A 1KM0A 4AHQA 4RR4A 4JYFA 1M7XA 2IKGA 4E2BA 3CLMA 2ZKMX 3K30A 3FIGA 3IVSA 3QYQA 1OCBA 1P7TB 3SIMA 2YL5A 1CLXA 1GHSA 3NPWA 5LIUX 4AZIA 4W4QA 1WPCA 5HULA 1X6NA 3YPIA 1IYXA 2JF6A 2QUNA 3AU6A 3CUXA 2FB3A 4NX5A 4XV0A 2C91A 1HGYA 5T8GA 2O9OA 4U3AA 3MP3A 5HPCA 1F3EA 4XIAA 3KVLA 1OF6A 3I6RA 1F61A 2V6AA 3ARVA 3VOHA 3QGAC 3WL0A 4CU6A 3DG3A 2ZUVA 4CD6A 3PZVA 5AY7A 4AQLA 4E3TA 4QX4A 2QNEA 4B9YA 1G94A 3TU9A 1WOAA 3CO4A 2G3IA 1RJPA 1DTUA 3F2BA 3AMKA 3TQKA 2YDSA 2ANUA 3H8AA 2PWEA 3CUFA 4QM1A 1J11A 3NPXA 1EDTA 5AHLA 1M3UA 3STPA 1ITUA 4GH1A 4I6KA 2YOCA 3M64A 3GG8A 2B0MA 3TTQA 2C7FA 1XIIA 4QDWA 2BG5A 4QJ1A 3FNDA 5AC7A 5HUOA 5EMYA 3QGKC 1FCVA 1R7OA 4DN1A 2CEQA 2NV1A 3FAWA 1QNOA 5E6ZA 1Q2RA 4GQ0A 4AD5A 3GYEA 2IPFA 2A85A 3SFWA 3OTRA 4D1JA 4KEUA 2PS2A 4GFIA 1HKIA 3HPFA 3IWPA 3CGTA 2X2GA 2W3ZA 5DXYA 3HZ3A 2NV2A 4FOKA 1REQA 1XDJA 1BXNA 1Q7QA 2VRKA 4MWAA 3M9YA 3AQUA 4IIEA 5E0KA 2YKKA 3GU1A 4Y9PA 1UH2A 4O52A 1XRFA 4NAEA 1US0A 1FCUA 2SFPA 3CHVA 1QWGA 1TR1A 1HKWA 4ZA0A 1ZLPA 1ITCA 2DFAA 3C8NA 3CZKA 2J9YA 4QROA 2R1MA 2D3NA 5C71A 2E1WA 1E6XM 1KTCA 2YCEA 1NDZA 4LT9A 3P5ZA 3SCUA 3W24A 1JAEA 1PYMA 3W1LA 3N14A 4CGTA 2ZX8A 2G96A 2WM0A 3UT0A 5CSYA 1F2JA 1C8YA 1W1VA 5CJMA 5DEZA 2O4QA 3MCNA 5LNWA 3LENA 4LALA 2UY3A 1F4HA 3W3OA 5BOFA 1J79A 2XIJA 3ZZ1A 3NL5A 4QJ3B 3UGRA 1E70M 4L7ZA 1JGIA 4A8NA 2PTZA 2ZDRA 3EWBX 3SQMA 5GNYA 1ZP3A 2IKJA 4Y6GA 3LG3A 1TPWA 5G1MA 5RUBA 3B0UX 3FFSA 1A0EA 2MANA 1GQLA 4NZFA 4X60A 3W2NA 3DEQA 5LIWX 3WDPP 1FP8A 3N25A 4IXHA 4NSBA 1WDRA 5C55A 3PUEA 5CC7A 3FS2A 4YPJA 1GOXA 4P8UA 3DCPA 4L1XA 1FWJC 4KEMA 4L1WA 1XI3A 3S9IA 3WDQA 2FIQA 4GG9A 1G5AA 4IFKA 4JNZA 4QJ4B 3EPMA 1WUFA 4R34A 1ZTVA 4J3VA 3AOFA 5IRPA 4QAIA 1M04A 1CWYA 4MTVA 4AZCA 3H70A 3T09A 4I5UA 2NUXA 4AAJA 4Y9OA 3HA1A 3LTPA 1KM6A 2PTDA 3OQ8A 3W1NA 4MNKA 2PDYA 4I7VA 5IFPA 3FLUA 4W88A 1UWQA 1S5MA 5EU9A 4DXKA 4MVAA 2VOMA 3BL3A 1HVXA 3BAIA 4L9ZA 1O12A 3VNKA 3W1PA 3LOTA 2J77A 3TN6A 1UH3A 2A7NA 3V3WA 3V0TA 3LHVA 1J5SA 4HZMA 1CCWB 1CI1A 1GNXA 3BJTA 4Z0SA 5A95A 3RR1A 5M17A 4N02A 3UVAA 2WQPA 1ISYA 1WYIA 2OGYA 2BLEA 5HA7A 4QE5A 2BV9A 4Y9NA 4JX4A 2POTA 3T6CA 1NJJA 3UZ5A 1IXPA 1Q6CA 4MB5A 1N82A 1YTEA 4LCRA 3N04A 2QV4A 4WK9A 2QCHA 4HZ7A 3CAVA 1LL6A 2J62A 3EWYA 2WMFA 3CNYA 4RL3A 2GQAA 5FAJA 3V1HA 1JZ6A 4J3XA 2O56A 1EZ2A 2XFYA 1E9IA 1KFCA 1CYGA 1OEPA 5C9RA 1LWJA 4FSAA 3VC6A 3AO0A 2OQYA 1WCGA 1B54A 3UNDA 4GYPC 3G3DA 4WY0F 1F4AA 4I5RA 2GVYA 1KXHA 1W32A 1K03A 2EJ1A 3QC3A 5CPOA 3A24A 4BS0A 4W87A 2OX4A 1LWHA 2QF7A 4K1GA 1Y65A 2ABAA 4MJMA 4L1GA 4NIRA 3KP0A 2R6OA 1Q13A 1QFEA 1D8WA 2PGFA 2ZWZA 4Z1YA 5FF0A 1SFLA 2CLLA 4JICA 3UVIA 3VNDA 3VIIA 1ZBCA 4M0XA 2EQDA 4RUBA 3KBVA 1IIGA 1SJDA 4H9MA 3R1ZA 3T0TA 4XO6A 4WDTA 4AD1A 3ANVA 5D2TA 2VO5A 1RCXB 4HMNA 2PTXA 1KTNA 2F84A 5KITA 4L4LA 3EWCA 3M5ZA 5J8LA 3TXVA 3CEUA 3NFUA 4EAYA 3KZSA 1ZBWA 2G4JA 3K8KA 1RY8A 5L9FA 4UMAA 3PVFA 3EXTA 2O7SA 5CZKA 1XJBA 1HP4A 1JQVA 3TJ4A 1ZGDA 1PDZA 3W1UA 4KETA 1JCYA 1A80A 1EJWC 4H6QA 4V15A 1YBQB 2ZE3A 3ZWSA 1OIFA 1TB3A 2FZDA 1L6FA 4EXQA 2V5JA 2ISWA 1FWTA 4DO4A 4AZHA 3U8GA 1QBAA 1UG6A 2GVGA 4JIQA 3KOFA 4A2SA 1MI3A 3A4WA 3OVQA 4LYQA 4OVXA 3CT7A 3URQA 5F4SA 3UGVA 2OT1A 2ZRXA 2JEPA 5HWMA 4K2SA 2DSWA 2DJXA 4S2BA 1AW1A 1JDCA 3TJIA 1F3TA 2WSYA 4DYJA 1TPH1 1H62A 1TWIA 3ZLFA 3OYXA 2Q01A 3H12A 2PWFA 2ZBTA 2NSXA 2OO0A 2GZXA 4HTBA 1OX6A 5I3IA 1NSJA 5BNKA 4LFYA 4G5DA 2D0HA 4JHOA 2QCLA 4JTSA 4J4KA 1VFOA 2Z1VA 4GZ7A 1A47A 2W62A 2GVJA 2IPWA 2GPTA 4M5PA 2A3EA 2R94A 3CL6A 2D24A 1B3YA 4KFNA 3NL2A 4IMCA 2XIBA 3NR0A 3ZR4A 1WX0A 7ODCA 4P7RA 3S4TA 3SCRA 2RH9A 3UA3A 3MKCA 4NG3A 1RUSA 1C7SA 3C3UA 2ZRZA 1RP9A 4O54A 5AYXA 3VCRA 1VKFA 3ZJ6A 1E15A 1W8GA 1NP0A 2FH8A 3S2NA 2F61A 1B4KA 5JU6A 4NKCA 1N8IA 1IEWA 3VTRA 3L2MA 1W5PA 3OYZA 1KFJA 3QC0A 2HTMA 1WDSA 3WF3A 1GEQA 2HSAA 1S5NA 1US3A 1CGTA 4J1OA 4XUGA 3FJ4A 4PGLA 4XSMA 1FUYA 4P7NA 3C2YA 3CZ8A 4XAPA 3R25A 5A1AA 1XH2A 1SZFA 4B3KA 4RNJA 1UKQA 1N55A 4JXCA 3F4NA 1SW3A 1WKYA 4F2UA 2GQ3A 4Q7IA 3GYCA 3QW3A 5GJMA 5KZMA 3U4FA 2O92A 2XFRA 2V3FA 2WPBA 1I2NA 1OT1A 2W61A 4C7DA 1K7FA 3HB9A 5DLCA 4M1BA 5HMFA 5D9OA 1J96A 1XLHA 4QEEA 2QW5A 1QO5A 5C5YA 3TC3A 4GCXA 4UTHA 1UIPA 4IP7A 3WLRA 1Q8JA 2OODA 4TV5A 3CUHA 3UZZA 2ZTJA 2B7PA 4N9BA 1QCWA 1RZMA 3IGUA 1UR0A 1OFAA 3AHZA 4AYSA 1T8XA 1KCXA 2VEGA 5EKYA 3WBWA 4GA8A 4AUBA 1PKYA 1GORA 3MMDA 3GUGA 1UWSA 3DFTA 2GJRA 2PAJA 2BGNE 3W02A 1E4MM 1WKFA 2C0AA 1PCKA 3M5VA 3NNTA 3CHEA 1JL8A 3N9KA 2HMCA 4P8VA 3WDIA 4HU3A 5CZTA 5D03A 3RRXA 3K13A 4UZSA 1J18A 1WBJA 3U48A 5DMYA 5FESA 3UR7A 1B9ZA 3V36A 3T4WA 3GS6A 1S3HA 2OFJA 1K9DA 3KRBA 4IL0A 2YFOA 4NILA 1OK6A 3E12A 3WMCA 1ICPA 4FX6M 1NTHA 3IK2A 1VENA 4GACA 5CPLA 3UG4A 1UD4A 3HOJA 2VELA 3QQ0A 4H6KA 3P8JA 2PWGA 4IPJA 4X22A 3BLIA 3KL5A 2XPKA 2E9MA 1SR0A 2VZOA 3MHGA 2Z2AA 3KTXA 4GHRA 2O55A 3FCPA 3CQHA 1NFGA 1UMYA 1EXBA 3EWDA 3CT2A 4QTGA 1K8YA 3N2MA 3UWUA 2G41A 2OTDA 4LCQA 1QTWA 3W7LA 3BSGA 2PDGA 4FPSA 5FJIA 1KFBA 1XFBA 1TSIA 1OWQA 3WSUA 4RLIA 1WBHA 1ONRA 1W1ZA 2Z27A 3U2CA 2EPKX 1NOUA 1MW3A 1ZY9A 2DIJA 5TBOA 4XK2A 4FNUA 3NQFA 2ZVIA 4XVEA 2PLCA 4JYEA 3BGAA 3V7PA 5C2XA 1UD8A 5I7GA 1WAUA 3QHMA 2ACUA 1R3TA 4DJFC 1PWLA 1H7RA 3HG4A 4POCA 3WD0A 3WQ4A 7A3HA 1B4EA 2GDVA 3PM6A 1R3RA 3AIBA 2H9AB 3EXSA 3SCTA 3V4BA 3L5MA 2DT2A 1A5CA 3RO6A 1G01A 2DZBA 3CYJA 4NUWA 5AFDA 1QHOA 3AHXA 1XCFA 4A6GA 3W70A 1J2BA 1VCVA 4F9JA 3SO7A 1XWYA 4GOAA 4M80A 2E8YA 3QHOA 1GQKA 1KKRA 3UG8A 2QJJA 3JU2A 1E1EA 3BSMA 3IS4A 3EX4A 1O5KA 1R30A 4D8LA 1E6ZA 1GOOA 1Y5XA 4DM2A 2BVYA 1PTGA 2C16A 1D9EA 1JUBA 1EYEA 3N2BA 4XVDA 3RX4A 4LY4A 1PEZA 3PPFA 1VLWA 3RRAA 3QHNA 2CBUA 1W54A 5B7ZA 1ZQ5A 5DMMA 3LM7A 1XSJA 1FY6A 4LVAA 3NTYA 2DPEA 4PBGA 4YS1A 2YL6A 3APGA 4TMBA 3B8TA 1MXSA 4WKAA 4WF7A 2X1UA 3G8EA 3S9ZA 1ZPTA 3UY8A 4PEKA 3HU7A 4FNQA 1H2JA 1P0DA 1P6WA 4UUIA 4TVCA 3WY1A 3A9BA 1MWOA 1XCWA 3UCQA 4TO8A 2WZIA 5FACA 4DEFA 1W9XA 1R9XA 1GG0A 5H2ZA 3RDKA 3FEQA 5T9CE 2E6YA 1EEPA 4EE9A 2AKZA 5T9BG 1ZL1A 4XAGA 3WMBA 4RV8A 4L9YA 3TSBA 1JYWA 2EXOA 3ITTA 4S2CA 4F3HA 1ELSA 1G6CA 4E8DA 4IGHA 3TROA 4M24A 3UCCA 5CZJA 1KBLA 1JEZA 3NL3A 3WQ8A 1AK5A 5CG7A 1SGJA 3Q65A 1M7PA 1UIOA 1MRQA 3POHA 2IW0A 4MLJA 2WBGA 5C7HA 1F9CA 1NH6A 1XYFA 4GYKA 2YIHA 3GK0A 3SRDA 4W7WA 3PPGA 4IMAA 3WX7A 5A69A 1ZZMA 1S2TA 1AW5A 3GVGA 5EMLA 1QASA 1VF8A 2E6FA 3QMTA 3E2RA 3MZ2A 1TPUA 1O1HA 4AHOA 2Z28A 4UFIA 4JTLA 3ATZA 5FL1A 2D3LA 3W86A 3EWUA 4Y7EA 3PB0A 1AA1B 1ZALA 2PTYA 3OEXA 4WKHA 4TX6A 3L4YA 4QLLA 5D04C 4LGXA 1H50A 1QPOA 2NT0A 3BK0A 3HV9A 4ADTA 3EWWA 4H7ZA 3FN9A 5AVHA 4HK7A 3KUMA 2V82A 2G37A 7TIMA 1JFXA 3VKCA 4MM1A 4GNJA 1U30A 3BW2A 2ZDSA 3NQ2A 1B3ZA 2GGJA 2YLAA 2NQHA 4AEEA 1ZJHA 1ODZA 3IJ7A 1DQWA 3GH5A 1LORA 1W5NA 5I02A 3CAWA 5CPMA 2CWNA 4AXKA 5F7UA 4PR4A 2NW0A 1TVLA 4UNKA 4QNWA 2PODA 3GW0A 5IHSA 2Q8ZA 3K1DA 4BQ5A 1XICA 3BQ6A 4FNPA 4BF9A 1A5NC 3B0VC 3TN4A 4Q4SA 3PHAA 1HKVA 1W5OA 1D7FA 4JNYA 1H51A 2GLKA 3A22A 3RXZA 2H6RA 2XSXA 1GJUA 4D6CA 2J7CA 4HSNA 2CERA 4UOZA 1HVQA 1B5TA 4XBSA 1PIIA 1CGXA 5HUPA 3ONBA 2CBJA 3TONA 2DT0A 4LNYA 5LZLA 4KIRA 4LJ3A 2VCCA 1YTDA 4CCCA 3P82A 4ZQRA 1XQLA 5FF2A 4KQNA 4JTAA 4EXAA 1W3IA 2G4FA 3XISA 3GZ3A 1VFMA 4KMQA 2J74A 2ONEA 4ZB0A 3RJYA 1UUMA 4N9EA 1E4NA 4ZE5A 5K9XA 3B3DA 1IXNA 3HG3A 3DFPA 2Q09A 1UKSA 1CGUA 4QLKA 5A6AA 1EWEA 2IUZA 1DIOA 4OQVA 2VC9A 4FEZA 3EKGA 3GXNA 3GWQA 5DY2A 2PDPA 1E9YB 5LYRA 4UMCA 5A6LA 4FK9A 1F05A 4X3ZA 8XIAA 4BQ2A 1D3HA 1K7XA 4YYCA 3D3AA 2AKMA 1JRCA 4IGNA 5FJOA 3OZMA 4W9TA 3QZEA 3CQ0A 1O60A 1MDLA 3PZNA 4DRSA 3GNRA 4D72A 4O1DA 4JFWA 3UW6A 5IOBA 1DJYA 2WXDM 4FR6A 3LNMA 4NJJA 4PB4A 4XZ9A 4ERGA 5U7SA 2OQLA 3KS5A 1Q66A 4AZ5A 4LNCA 2EEXA 2IPJA 4LPCA 1RR2A 3L4VA 3BH4A 1E71M 3UERA 4DJEC 4A05A 4US5D 2PLMA 5BMWA 1EA9C 1BWLA 3IVUA 1XIGA 4DF0A 1XX1A 2FHCA 4NZ3A 1QHZA 2WKJA 1KBIA 4X9YA 1I2QA 3L4XA 1X1ZA 3BJFA 1JZ4A 3OLEA 1FWGC 3GIYA 4DELA 1J01A 3C86A 3CV1A 1RALA 4UQ9A 2DT3A 3SQLA 2OYKA 1PKMA 4DJDD 2PP1A 5D8ZA 1DP0A 2ZOXA 4YU1A 1DQUA 4MYXA 1K8XA 4LB4A 1KFLA 2HK0A 4UTIA 1SZEA 4GK8A 4RE0A 2V68A 3CMFA 3EDJA 4FR1A 1W9UA 4NL1A 5CZ0A 3MJMA 3PR2A 1XBZA 5DX7A 4NYYA 3VOJA 3UZWA 2QKFA 1MRAA 4IIBA 3GB6A 4FP1A 2V63A 1AODA 1EFZA 2Y7EA 2Z26A 4P61A 2O7QA 4Q8NA 3MHFA 5EYWA 2OZTA 2VI0A 4HNNA 4Q6JA 3PPHA 3LN3A 4AWUA 1X1NA 4HA3A 4C6EA 4YWIA 3GHRA 3NVDA 4J28A 3WQVA 1HO1A 1AH0A 1A0DA 4RPPA 5CJ5A 1G1YA 2E4TA 4K37A 1FXPA 4GH3A 2Q02A 3URBA 3V75A 1Y5VA 3GO2A 3N3MA 4KGLA 3L65A 4HKPA 2PDHA 4GKTA 3PWAA 5CBBA 1WV2A 1WP6A 2DH2A 3N9SA 3CU2A 1LBFA 5C2GA 2HZGA 3CHFA 4GIYA 1QOXA 5CC6A 2PD5A 3FKKA 3GHTA 5CZSA 4P7QA 1VFLA 1L6WA 3IACA 1DWIM 2QAFA 1DXEA 4MOZA 3U4AA 4LBUA 3VOIA 2PBOA 5A6KA 1SZNA 1OFPA 2GVEA 3I3BA 4ERAA 3D47A 1XSIA 1LF1A 2X1RA 3G1YA 1J0KA 3FVMA 5ABFB 3ARZA 3FJNA 1OCJA 3NG3A 1X6LA 2FLIA 2OR2A 2D2JA 2PDMA 4CU7A 1IEIA 2YB1A 1KGUA 4P5UA 2YPIA 4MAVA 5EMUA 4GGHA 3UXKA 3EGJA 2CKSA 3TWAA 5CH9A 5IDZA 1V6YA 2HS8A 2I7GA 2C15A 2HV5A 4IF2A 4NI8A 4BQ3A 3VE9A 3S8HA 1V6XA 1BQCA 4CLMA 2WMKA 2FVMA 3CIVA 4PFMA 2NX1A 4GMEA 3KL3A 4AG0A 4NY2A 2ZXBA 4PMYA 1PHQA 3ARXA 4DI9A 3RN6A 1SJBA 3A13A 1RJQA 3NO1A 1FDZA 2CITA 1KXVA 1S5VA 4ZO7A 4QIUA 3UETA 4ORMA 4Z1DA 2TYSA 4KH2A 4I90A 3MA8A 3PZOA 2NQJA 1E6NA 1A5AA 4H9ZA 1UP3A 4WY0A 1JZ2A 1FCQA 3WLIA 1R7AA 3V1PA 4Q8MA 1MDRA 3GXTA 1A5OC 3TQPA 3VGBA 1BVZA 1ZCOA 4EAMA 1K3UA 2QIIA 3EAUA 3EB2A 3AMCA 3P74A 4QQ3A 1P43A 2Y7DA 4GQRA 2DT1A 3WNNA 3VD3A 2OEMA 1POKA 3VZYA 1AMKA 3GDKA 4YJ5A 2BY1A 4HA1A 4GRSA 3WBAA 4RKAA 4PTNA 1UKOA 2NT1A 4MHBA 4FLSA 3S1VA 1JCJA 1WAWA 3N1AA 1QI5A 3NDYA 5HJLA 5D02A 3LQLA 3CUZA 2DZTA 4FXSA 1MFVA 1ZUAX 2GUUA 3ITCA 4H01A 1K9FA 1NF7A 1WKDA 2YL9A 4WDUA 4U5KA 2KZHA 1IEXA 4JZ5A 3KVJA 1ITQA 3MSRA 3N11A 2ACSA 3GLCA 2VCBA 3N4EA 2PGWA 3CWOX 4Q6XA 3EX1A 3ZJKA 3T0DA 4DIAA 5CGTA 1B9BA 3N17A 4E0CA 3TAOA 1OK4A 3WK2A 5F4WA 4KEZA 3AALA 1P48A 1BF2A 4JTUA 3M7WA 5I78A 1GYNA 4O8AA 1RPKA 4XZNX 1QNQA 4EF8A 4IISA 4PBEA 4BR1A 4S3GA 3MUZ1 3H53A 5I6SA 4UFMA 4MNJA 3DH7A 3ZOAA 1OYCA 2V9DA 4LUSA 4QR6A 1H1ZA 1ZS2A 4ZOBA 2V0TA 1C8XA 5G4WA 3ZXWA 3AS1A 3ZIZA 1XG4A 3BV4A 4HOWA 3TYEA 3W7MA 3W71A 6PTDA 3IEBA 2QLYA 3VFLA 2R1KA 1A4LA 2VJXA 4C6CA 2R82A 4WOZA 3AYSA 2O4MA 4ZOCA 1VH7A 3TWBA 3SAZA 3WUBA 2ALRA 3R94A 3SFKA 4HK6A 1X96A 1KCKA 3RIKA 3B9OA 2ZCGA 1GJWA 2JEQA 3W28A 3WF0A 4L4OA 1VRXA 5K2ZA 4BCEA 1LT8A 4UMBA 3SR7A 3FSUA 4TXEA 1V5XA 4LYRA 1EUAA 3IUDA 2FTWA 3V5OA 3AIEA 5A6SA 3MPGA 1IT7A 2G3JA 3I7QA 3SUVA 2VZVA 4O57A 1XDLA 2Y63A 3DENA 3M0LA 1NAL1 2OELA 3TNBA 2GQ9A 2CZFA 1GYLA 2I9UA 4ES4A 1W3NA 2Z25A 4QQUA 3MP4A 4JEJA 2WNNA 4C60A 3HJZA 3QM3A 1FH8A 5D2WA 3W1XA 3GE7A 1E9LA 8RUCA 2WZEA 4LAMA 1VJZA 2O9TA 4DJDC 4IIFA 4N4PA 1DJQA 3A3XA 1IT0A 2A21A 4M51A 4US6A 3LMYA 1CECA 1W3JA 2VX7A 2BHYA 4M7SA 4F0KA 5D4YA 3EWZA 1K4GA 1FWNA 5FKYA 4E2DA 2OSXA 2XVPA 5JBEA 4GYFA 4LVBA 3W6YA 2Y8UA 3ZS4A 1JAKA 4HHPA 3KVKA 1BQGA 4KESA 3P84A 3NZRA 3HQ1A 5GJNA 1TA3B 3GIPA 3M6DA 3LA4A 1UJQA 3MBDA 4IIDA 2ABBA 3CL7A 4GISA 1RH9A 3S2MA 3PBVA 3EPNA 2YA1A 3IV8A 1MUWA 4ASTA 8XIMA 1PAMA 3KRUA 1FWDC 3MSYA 1KRCC 4AEFA 1V03A 1E55A 1W9DM 1GOKA 4QNEA 3GNDA 5LA0A 1JFHA 2FDSA 3ALFA 5G2IA 2P0IA 1PDYA 2F9RA 1O5QA 3MW7A 1O95A 1U5HA 1A4MA 2I5QA 4IHCA 4ECLA 2NX3A 3LDVA 4H7CA 3TSDA 1C92A 4MPQA 3LY0A 3TK7A 2WMHA 4IPLA 4QE1A 3INPA 1PYFA 4JTGA 5BXTA 4OBSA 2WOQA 3ABSA 1B1YA 1LUCA 3R0KA 4CN4A 3WNMA 1PUDA 1GVRA 4FF5A 2P5NA 4CQCA 4GX9A 1YXYA 4WRHA 1S2CA 2Q71A 2WVUA 3OBAA 1SVDA 4W5ZA 1BF6A 4YCOA 1BGGA 3N3TA 4LYPA 2QCFA 4CD5A 1R3YA 1QXLA 2G3NA 1EEXA 3A3WA 2PDQA 3F4WA 1KWKA 1I60A 1WO2A 4FNSA 1W2PA 1PX4A 1E56A 1X98A 3PB2A 4GC3A 3RF9A 3LQGA 3V5CA 3SUTA 3QPYA 3NOEA 3CQKA 3NEVA 1TELA 3DOPA 5I23A 2XIQA 1JZ3A 4TTUA 3BQ5A 3WLNA 1E3XA 2FFCA 3KTCA 4JOMA 1AJ2A 4PB5A 3BAYA 4EPDC 1C91A 3S5OA 1R3QA 2J8GA 4J2MA 1QDSA 5A8GA 4ATWA 1VD6A 4B5TA 4Q4KA 1HIZA 1YPXA 2V81A 1I45A 1UD5A 3DFHA 1R6WA 4ML4A 1XD1A 4G56A 3ANYA 4EKJA 2I5GA 4NU7A 3SJNA 1Q6RA 3O1NA 1QT1A 2NVDA 1FRBA 4IJCA 3AIQA 4W8LA 2QXWA 1W17A 3VCNA 1HL2A 4YIWA 4XD5A 2WCSA 1HL9A 1R38A 2QDDA 3QV9A 5JMUA 1QAPA 2GYIA 1Z69A 3R0DA 3GXDA 4W85A 1GTEA 5DMNA 1N7KA 1ONEA 3E96A 4F40A 3EOOA 3ARYA 4JTHA 3MY9A 4Y96A 1UOKA 4HU8A 3W75A 1YMYA 3USBA 2CWXA 4GINA 4ZFMA 4GZJA 4GY7A 1MVYA 3VIOA 4L4PA 4A8RA 3WQCA 1WZMA 3C2VA 2VCAA 5E6YA 3QR3A 2WWCA 1RBLA 3PBGA 4YLWA 1BVWA 3B9AA 5KZDA 1MEWA 3CIXA 1V0LA 1YRRA 4K7VA 2DV0A 4Q22A 3HGSA 3RCYA 3OZYA 1QWKA 2YLLA 3VKBA 4O1CA 3W7IA 4WDXA 4AX7A 3GZAA 1CB2A 3H55A 3RR4A 4E2OA 4O4VA 2RJHA 1YIXA 4PUEA 4DY1A 3B8DA 1OYBA 1ENUA 3K1GA 2BWGA 3UWWA 1SMDA 2BODX 1M6JA 3KOZA 2OVLA 1ME8A 2CXEA 4CD8A 4J40A 2WPGA 1G69A 3TR9A 3S5ZA 1UASA 1TG7A 4K8HA 3G1RA 4HNTA 4B2DA 3UJ2A 1E5JA 3P5YA 5HATA 2GOUA 2ZA3A 3DGRA 1AL8A 4JN8A 1FH9A 3UXAA 2QMJA 4FS9A 1N2VA 2E9BA 3QZAA 4JX6A 5EL1A 3DFQA 3FA4A 1MZHA 1TV5A 5D32A 3LSBA 3WUFA 1DJXA 3CAQA 1FBAA 2WMIB 5AHFA 1NFPA 5BCAA 5F2MA 1FKXA 4M29A 4HU4A 3PPCA 3B4UA 5LIYX 2OOGA 3S1UA 4O19A 1UZDA 1J9YA 1EGMA 3IIXA 4IFRA 3BLDA 3CZEA 2BASA 1UBPC 1CXEA 1W1IE 4D6JA 3GR8A 4DPQA 3EA2A 2BGSA 2WSRA 2NXIA 4RDYA 5DQPA 1IGWA 2V5LA 1Z44A 3FDKA 3KXQA 4DJEA 2DVTA 1L6YA 1EX5A 4OZOA 3E02A 3LUTA 1ESWA 3F4CA 3Q4DA 3LS9A 3OG3A 3F2DA 4JTRA 2QF8A 4TMCA 1VPYA 2OEKA 3AROA 4U5IA 3W1TA 2D2HA 3W27A 2BVDA 1FWAC 3WFAA 4FIRA 4PCSA 5AYYA 3RGTA 4N2YA 3HPAA 4AD3A 1J2WA 3SM0A 1OQFA 3VIGA 4WLCA 4DLFA 4LANA 3A3HA 5HNRA 1GKQA 3ZSSA 5LGXA 4OBRA 4YCPA 4IUOA 1L6GA 3NPVA 1YNYA 1XR2A 3MV01 2X41A 1RV8A 1VBGA 4K3ZA 3BLOA 2QJGA 2PWVA 1BG4A 2R9RA 3IIZA 1C7TA 2OZ3A 1BSIA 2J24A 2HS6A 3IJQA 3VMOA 3P62A 1U33A 1ZHAA 1KR1A 1OFDA 1AVAA 1EGZA 3SSZA 4MB1A 3F4DA 3O7UA 4H8VA 1H7XA 5D05A 2NXHA 3BVJA 3VZXA 3N73A 4PUWA 4CD7A 3LPGA 3SRHA 4E3VA 2OB3A 3C61A 1H7WA 4DZAA 4GFSA 3P6LA 1HJXA 4O0QA 4U31A 5IBXC 2E5CA 3P8IA 1U2YA 5EGRA 2WANA 2DSZA 3G1HA 3HN3A 1J5TA 4KCVA 2VUYA 3H7RA 1V0KA 2WO5A 3KFTA 4S23A 2P3ZA 3VPLA 1I0DA 3NWRA 3DG6A 3BCDA 3PBWA 2EPOA 1I9CB 2CNCA 2WMJA 1RQBA 4MNLA 4M7TA 3VM7A 1RAKA 5KETA 2DUZA 5C9WA 4P7OA 1UA3A 1IR1A 4JY8A 4PTVA 1H1YA 1K7EA 3PAOA 1TWWA 3W00A 4RXFA 1X97A 4E8GA 3BE7A 4GXWA 3UFYA 2JFEX 1Q8AA 4BI5A 1THFD 2V3GA 3WNLA 4YTRA 3KLLA 2DZAA 2A7PA 2IKHA 1XPGA 1WNOA 1ZP4A 4MJZA 4GUHA 3BLPX 4I9MA 1WZKA 3HPXA 4AFYA 2W5FA 2YGYA 5FJPA 5J5DA 4UOQA 3F2CA 3N18A 1HO4A 3ARSA 1Q2SA 3UZXA 2VDIA 2PGRA 1SYTA 2CLFA 3N4FA 1AZ2A 1FWHC 5DBTA 4FOUA 4ZE4A 4HNVA 4GI9A 3TP4A 2C0HA 1TV4A 2ZC8A 1DVJA 4LAZA 2PU0A 4IZGA 2J25A 3G6MA 2G50A 4G6CA 3G1DA 1UROA 1E73M 1QUMA 1GT8A 3ITGA 4LV9A 1KLZA 3MUXA 4P8WA 3WQFA 1F6KA 3NXFA 3LHYA 4UQCA 4XQ6A 4TX9A 2R91A 3ZJ8A 3C2FA 3GVRA 4H9XA 1DXFA 3GBEA 3C0SA 2P50A 2X2YA 2E0PA 1MUCA 4CCDA 3UBPC 5MF5A 1JPHA 5K7JA 3CL8A 4B15A 1CIUA 1TIMA 1TZ9A 3IVTA 2A5HA 3ZM8A 2QULA 4DNHA 3BLEA 2FZ8A 3WUEA 1KB3A 1TWZA 2GGGA 5DBUA 3FA3A 3T1GA 5DCDA 2VHLA 2J4GA 4Q33A 4GBDA 4C7GA 4IQJA 1A3XA 1QNRA 3LPOA 4W7UA 4JCMA 5DF0A 1LRTA 2J7DA 3UXDA 3QYSA 1XDMA 3WJZA 4HD5A 1FWEC 1R5YA 1TJ0A 4JTEA 2E77A 4EACA 2CBIA 2QV5A 1DIKA 1JCLA 2A7RA 5D9PA 4HOXA 3GC2A 5EMMA 5ECUA 3RU6A 1T7LA 4PMUA 4E4FA 4FXJA 3QOMA 3S2JA 3W2KA 3FHAA 4GD0A 3UYIA 4MJ2A 3KRZA 1KFWA 4D8AA 2E3ZA 3IIVA 4B3LA 1VC4A 1Z41A 3T78A 4HNLA 2WHJA 3BAJA 1PWMA 3LXBA 4BA0A 1SR9A 3L0GA 2E67A 1S1RA 3SUSA 4BQ4A 1B30A 1EJRC 2CZDA 1TTQA 3UWQA 2CLMA 3FSTA 3SI9A 2ZXAA 3WZ0E 3HGJA 3FEMA 4ADSA 2BXYA 3P81A 3CPGA 3QPEA 1JPDX 2EG7A 1VBHA 1BG9A 4NP7A 2FFIA 4F0SA 2H8ZA 3RFAA 4GJ1A 1ZBKA 2QS8A 4UIOA 1XL9A 4DWDA 3UCDA 3W84A 3ABXA 3KCOA 3HFTA 1B3WA 5FF7A 3SDOA 2GVLA 1PE1A 1SM9A 4ADUA 5JH1A 4JNMA 3NQ7A 1FWSA 3R6IA 4HGXA 4HA4A 3UWVA 3P0XA 1TX0A 5IBXA 2POZA 3MUIA 2BX7A 4V28A 2F6UA 1X6UA 2QJHA 1JI1A 3EMZA 5EFDA 4O12A 4AIEA 1F3WA 2JGYA 5AECA 2FPTA 3WJSA 4FNTA 4JIIX 2E7FA 1PZ3A 2VDHA 1OT2A 2E6DA 4FOJA 2Z29A 3H21A 3W81A 3C2RA 2CYGA 3BSHA 3REQA 2ZZ2A 2J75A 1I2PA 3ZT5A 2FZNA 3RK8A 3S1XA 1V3KA 2DZWA 2HEJA 5AN7A 3BLLA 4R5EA 4H6RA 2XH2A 2XJ7A 3LYEA 3S1WA 1E6PA 1XIHA 3VVGA 4NRSA 3GHSA 1GOQA 1DQXA 1VCGA 2Y6ZA 1KM1A 5C9ZA 1J6OA 4S3CA 1HQTA 3O6YX 4ZO8A 3L4ZA 4ZOEA 1QPKA 3EKLA 1E1CA 3AXXA 2WVTA 1EUNA 2PEVA 5E09A 2G97A 1QK2A 4KERA 4ZQPA 2WSQA 1EJXC 4LVGA 3REQB 2PDNA 5A5WA 4BEUA 2BXZA 1VHNA 3H2FA 2QDEA 4HZ6A 3E9AA 5AC5A 1IXOA 3QY8A 3DHFA 3DUGA 3H2MA 5HMSA 4XZLX 4UOJA 2XIMA 5XIAA 4TUFA 1WXJA 4NT0A 1IE7C 2J79A 4I8DA 2EPMX 2F7FA 1TWSA 4A3UA 1JF5A 1QPRA 4RCXA 2QT3A 1GGOA 4XZHA 3VUPA 3NVTA 2V2DA 4GJIA 1KRBC 3T0CA 3GVWA 4AHPA 4CQBA 5A6MA 4KRUA 4DPPA 4KWVA 4TV6A 3TMQA 3GNPA 3WQWA 2H3DA 2C6QA 1S46A 3UESA 1M7OA 1QK0A 4OGZA 1UCWA 4HP5A 4AB4A 2Z4GA 2WMIA 4DUVA 3HPSA 4ACYA 6XIAA 4NX0A 1K02A 1EX1A 5D38A 3VD7A 1HX0A 2KX9A 2D23A 2HQAA 1UQZA 4HQVA 2J6VA 3SN1A 3MMTA 3GW3A 3VU2A 3WL1A 4IFOA 3WLJA 1CX9A 2GGHA 3AS0A 4FLRA 2BHUA 3VOCA 1BHGA 3G5EA 4CN6A 3GDRA 2BMBA 3HMCA 3MSGA 1RBOB 2XFWA 4UTMA 4TQTA 4CNSA 5BRQA 1DIEA 2HPMA 1KCLA 5JBDA 1W1YA 3UG5A 1UH4A 5A2AA 1U22A 5LA2A 2VT0A 2OZ8A 1E9ZB 1GOMA 4JR5A 2E9LA 5D9NA 1XRSA 4G7EB 1A53A 1O94A 3G0SA 4GZEA 5EFFA 1S5TA 4K39A 1YE4A 3VGGA 3ARPA 2VQUA 1KW1A 1A5KC 2W27A 2CU0A 4MDOA 4JTKA 3QMSA 1H0GA 2YR1A 3OGSA 1IZJA 4O0ZA 1AJZA 2Y7GA 3TYZA 5CG0A 4MZ1A 3G3MA 1RHCA 5BOOA 2WNQA 1V7YA 3DFOA 1XIMA 1K4HA 3B03A 1FWIC 4NZ5A 3AISA 4UBPC 4GVGA 1TV2A 4Q8VA 3DC8A 3E0WA 2VWSA 4JAWA 2R8WA 3L4UA 4YMZA 3HQOA 3WLOA 3AZSA 4FB7A 1I4NA 4HN4A 3NZGA 1W91A 4AD2A 4BHYA 1TCDA 1U1JA 3GTIA 4R3UA 4HSHA 1MO0A 4B9ZA 4Y90A 1TRDA 3BAKA 1O7AA 2VNCA 4ZO6A 4MWAC 1XIEA 2XU2A 2FHBA 1KQZA 1TFVA 3VINA 1I1XA 2VVNA 2Z1XA 4ONVA 3R13A 3S6TA 3U6WA 3KVMA 4IT1A 4KIEA 3WLHA 1IR2A 5HJYA 3URNA 3MU7A 3ATYA 3DESA 2OG9A 2D2OA 3LU2A 1V51A 4I9JA 3BG3A 1BPLB 1ICSA 3E49A 1TE1A 3QLLA 2GSHA 4EX4A 1JDEA 1DV7A 2AL2B 4IPNB 4PMRA 2FVLA 2VR2A 4US5A 3RPMA 1NARA 2BY0A 3ES7A 3TZNA 4ZCWA 3PZGA 1XW8A 3W22A 2FGLA 4BI6A 7ENLA 5C0QA 4QEHA 4HTYA 3H2EA 3NUKA 3TA6A 3C2OA 1HJVA 3SGUA 4IWWA 9XIMA 4H8HA 3UA4A 3KBNA 1LUCB 1W5MA 4PE8A 3RU8X 1YKWA 3L0NA 3NCOA 3EOSA 2VFHA 5I09A 2DZVA 2RAGA 2C71A 1XBYA 5KINA 3DBPA 1BKSA 2WC7A 1MW2A 1B57A 4ZEPA 4BY3A 2TRSA 1JYXA 4H00A 2NV9A 3OZPA 5FJRA 5KZEA 1B3XA 5E0FA 2ZZ5A 5FCZA 2Z7KA 3CH0A 4Q4RA 3N2OA 2X09A 4IG2A 4EWND 4GUGA 4MY1A 4HJWA 4OOZA 5GNXA 1KKOA 1WDQA 2W92A 4WD0A 4QDPA 4WKFA 3TTYA 3BOXA 4GXPA 2OSWA 4D9PA 1DOSA 3PS7A 5F1VA 3HF3A 1TPB1 3ICJA 4B3ZA 5C2CA 2W63A 1J0JA 3GDBA 5DN1A 4J9JA 1JCNA 1ITXA 4WIWA 2HE5A 1Q6EA 4LUIA 4O16A 5GNZA 5LHEA 3OHMB 3TTSA 3WQEA 5CC5A 5JBFA 4BF5A 3LHWA 4OT7A 2XH7A 3EKZA 3TIMA 1LRQA 3W7RA 3GU2A 2DP3A 1CLVA 4O50A 2UBPC 1PTAA 3CJPA 1K6WA 2P53A 2PDJA 1TPEA 2BGQA 3OP2A 4QLJA 3LERA 4DJFD 3NXLA 3ANUA 3GBDA 1F8MA 1XXXA 4EPKA 2Y8VA 2HDJA 4PBFA 4RNFA 5CLWA 2Z24A 3A6OA 2V5CA 4D8ZA 3L5AA 2ZX6A 3QRHA 1I8JA 4HCHA 2V30A 4JTFA 4UFJA 1R3VA 3W26A 3O05A 2AMGA 3HURA 3G77A 4O11A 1NOFA 2OWWA 2VX5A 3D5HA 3B8SA 4QJ5B 3DIPA 2QAPA 2OSYA 1RD6A 1DXIA 2XFFA 1UJPA 3LBOA 1US2A 1FX6A 2Y88A 4HHMA 5H8MA 3EDDA 4JTTA 1V08A 1OD0A 3C56A 4GX8A 1G4SA 3E5BA 2X8RA 1GKRA 3TJLA 3ITYA 3R5EA 2Y2WA 4UFLA 4RZ6A 1XGZA 3GAYA 3U7BA 3MCMA 4LV4A 3JZUA 3I4EA 2X0HA 3AI0A 4PYSA 4BJHA 5ABHA 5LXEA 2EAWA 4HU0A 3T05A 1BTCA 4Z2GA 5A2BA 4AEOA 1O5XA 4EANA 1NEYA 5J5RA 4YVPA 4RE4A 3TJXA 4OBTA 1D2KA 1OIMA 1V6UA 3SEPA 4HZ8A 3EXRA 5HQMA 3U3HA 1Y5WA 3ITLA 5AHNA 3W1RA 2ZA1A 1KXTA 2ISVA 2YW4A 4ZZ9A 5C6MA 2ODOA 1RVGA 2PP0A 3QV8A 3W2JA 4MY9A 3LMZA 1TIWA 4RW5A 1KGWA 2WJEA 3VKKA 2IS7A 4IH3A 1CLKA 2GDQA 3GC5A 5I0DA 4LAKA 3LCHA 1P0KA 3UPWA 3WH5A 1DL3A 5DT5A 1A5BA 4ZGYA 3B04A 3IUHA 1V0NA 4RE3A 4NNBA 3N13A 4N42A 2YBUA 3G1FA 3MI3A 1OB0A 3AHVA 4GUJA 1Q6GA 4Q8WA 3SECA 1LG2A 3C5QA 1JYVA 1KXQA 1OBAA 2HROA 3GDLA 4JQ1A 4XG1A 1XV8A 1GYMA 1K6AA 2BTMA 1W56A 4U2ZA 3M47A 2ACQA 1OG6A 2HNHA 2X30A 4H8UA 2ZFAA 1ECQA 4DZ5A 1EQPA 3UPBA 3G1XA 4ZSTA 1FXQA 3NO3A 4NZJA 3OIXA 3GC4A 1RSCA 5HAOA 3NDOA 3R8HA 4PL1A 1GPWA 3ZFHA 1X39A 3W07A 4MPKA 2X42A 3SY1A 3NSXA 3M43A 1QW8A 4Q4OA 2DGAA 4BFAA 3EEGA 2XWDA 5CPNA 2XZ7A 1ZAHA 2BSLA 1UPMB 4CUCA 4KCTA 2PSNA 3WDJA 1S5WA 3SGZA 4C1NA 2ISDA 3SGGA 1IGSA 2J7BA 3EOLA 3MYPA 5CSRA 1DE5A 5JH2A 2ISFA 4G1KA 4JS3A 1H7NA 2X1IA 2OLAA 6REQB 3ENLA 1GQJA 3RPTA 3KDNA 3A21A 3NJ3A 5FSDC 4R85A 3BW4A 3B8WA 4CQ8A 3AC0A 5DXXA 4NAFB 2V3DA 1SO3A 4G1NA 3L4TA 3GNNA 3ZYZA 1GW9A 4K68A 2JKAA 5TD4A 1VCFA 4LBRA 1AQHA 1YBQA 1FHLA 4IICA 4Q8UA 2WQDA 2FJUB 1PZ0A 4IG2B 1U83A 3BO9A 2XH4A 5G1YA 4BEQA 2NX9A 2D2GA 4HYWA 3ELFA 3DERA 1OX4A 1EH9A 1P0NA 2PE4A 3GXFA 3O15A 3TN5A 3W23A 1R46A 5HWNA 5D30A 3G0XA 4CVWA 1F7BA 2W0UA 4ALDA 4NQ1A 3K8LA 1Q6FA 1UR8A 4QCEA 3VNJA 3S47A 5F2LA 1DE6A 2VURA 3GTHA 4XAZA 4H4IA 3CZGA 3G0UA 1PSCA 2BNJA 2X0SA 2V38A 1O6IA 4OE7A 4IPIA 3LCFA 2W66A 4HCDA 2XHYA 1YTKA 3FA5A 3MWCA 3SZ8A 1B31A 3RMEA 2VX6A 4FX7A 3DX5A 4L6HA 2ICSA 4QSHA 2GWGA 4XD6A 2AL2A 3NYZA 3MI6A 1RQEA 1XLJA 1M53A 4M19A 1S2VA 1NDVA 4ACZB 3I6EA 1MNZA 3Q2DA 1LL7A 1TV3A 4QS6A 3OVRA 2PBGA 2DH3A 3CBWA 4WQ6A 1EDQA 4CCZA 4DBWA 4MNMA 5CLTA 3T7VA 1UD3A 2NWSA 4OECA 1AH3A 4Q4MA 4O8RA 1DJNA 4GIEA 4DWSD 4AMCA 2PDLA 4KEVA 2PZNA 1PZ1A 2VGFA 4ZSUA 4N6FA 4JD4A 5IDIA 1RD5A 2NZLA 4PMJA 1GHRA 4LOCA 3UJEA 3DHDA 2WLZA 1A3HA 1XUZA 2CZ5A 1GQNA 1KCZA 4PMOA 3KLKA 3ARTA 4UTKA 1LQ0A 3GNOA 5D09A 1XIJA 1PX3A 2XIIA 3BARA 5LNUA 1H7OA 1VYSX 2O9RA 1JF6A 3W82A 3DI1A 3H6OA 2VZSA 1J0IA 4PMVA 4HMDA 2FHFA 3LCLA 1TZZA 4JIEA 3TZFA 4JHMA 3RX3A 4KFOA 2EBNA 3N6QA 1MXDA 1E0XA 4TX8A 3ZSTA 1HXJA 4LCSA 1CNVA 4DM1A 1IEQA 1Q4NX 1H49A 1MQRA 3K4DA 4R27A 4OHQA 1KM2A 4L6OA 3L2IA 2VFEA 2VFIA 3M0XA 3S5YA 3CB8A 1M68A 3I4KA 4HJFA 5AYZA 3W2LA 1BRLA 1PPIA 1XIBA 4XD3A 4N9CA 1KBBA 4V33A 4QSFA 4FXFA 5A8NA 2A1YA 3TW7A 4AIUA 3R43A 4UCFA 2NWRA 3WK0A 1QI0A 2O0TA 3G1AA 2LLEA 2Q8LA 3THAA 5A8OA 2DW6A 3GUWA 2CXGA 2DEPA 4LS1A 3AXIA 1HKMA 5CC3A 1QMLA 4UNIA 1YXDA 3DFNA 4ZXOA 4XZWA 3L66A 1LDCA 2Y5SA 5BW6A 3ME3A 4DLMA 3S2CA 5FIPA 3ECQA 3N6HA 4UZUA 4QS5A 2CBVA 1FKWA 3D3FA 2A2IA 2CW6A 1YX1A 3TOPA 4L5ZA 5JQ9A 1VPQA 1IXQA 3PFMA 1T6MA 7CGTA 1V3MA 4GXMA 3BJSA 4GO8A 1MW0A 1I1WA 1J0YA 2J7GA 2J27A 4HN8A 3TTOA 5E9XA 4JEQA 3LBCA 3IAPA 2B4GA 2JQXA 2WCGA 2WB5A 2FQIA 1X38A 4FAMA 1G0CA 5HANA 2Q3RA 2YXGA 3GH7A 4WJXA 1W3TA 2ZYFA 3U2EA 1VFFA 1ZNNA 3BOLA 1QATA 3I68A 5HXMA 5FJJA 4M1RA 4HT3A 1PHWA 5D37A 3HFYA 2ATMA 3W76A 2YZ5A 3MTWA 2AQWA 1Q6QA 1V6WA 4AWSA 3E1F1 5AZ1A 3KZPA 4N0RA 3SQSA 2XG9A 4GZIA 3EA1A 2FB2A 3RCNA 3IGSA 1IZCA 4F2BA 1E3ZA 5DO8A 4XB3A 1W9BM 4H3DA 5LIXX 4LUYA 3TYCA 3GD6A 3IRSA 3GY1A 5E9AA 1QBBA 4M82A 2Z1KA 3BAXA 2VP8A 4A35A 2GUYA 3VM5A 5K4XA 3WMSA 2RDTA 3NO5A 1QPQA 1OF8A 4M81A 2ZICA 5E70A 1C9DA 1LOLA 3O6DA 2QCDA 1PKNA 3OG2A 3QFWA 1NF0A 3O07A 3W1MA 2CESA 3G24A 3K8MA 3B97A 4YTSA 3TW9A 2JK2A 1VRDA 5LGZA 3Q58A 2YYTA 3SCSA 3ZVIA 5I77A 3A4AA 4GIRA 1K9EA 6A3HA 1FCBA 3WD3A 2XM2A 3WLSA 1OG0A 1LP6A 3P14A 1HJQA 3V18A 1V3HA 3AZTA 3P93A 5T91A 1LG1A 2VFDA 1OC6A 4LYKA 3W01A 1WOBA 1LTDA 4MB3A 1BAGA 1S2WA 1P1MA 2FPYA 4V1YA 2D69A 3QSRA 3ZVHB 1E40A 1VLIA 4YN5A 1HF6A 2ZZ6A 1TVNA 1EIBA 2W79A 3H2NA 2J78A 3IAQA 3S42A 3VNYA 2Z1SA 3VOGA 1HG3A 3OJGA 3WLMA 3AXHA 1V79A 3KWXA 3WLTA 2FGBA 1VQTA 4PTMA 3TQ0A 3BG5A 2QCCA 4DBSA 4GC4A 3BUVA 3C0LA 2CCRA 4J3SA 2QVHA 2RGLA 4UQEA 4HIBA 2B7OA 2AQVA 4S39A 4NXKA 4DQWA 1UB3A 1XRVA 3F4VA 2WVVA 4UTTA 2RDXA 3H4XA 5BYWA 2P76A 1PCWA 4CCEA 1EF2A 3WBYA 3TTEA 1D3GA 3WK1A 1L8PA 2VX4A 2FJKA 1ZJAA 3GG0A 3VDBA 2P10A 1OHLA 3MV11 4CD4A 1TR9A 1KO0A 3LGEA 3R89A 1RVKA 6XIMA 4REQA 2B81A 3JRKA 4B5XA 5G2HA 3CK5A 4JIPA 4Y9MA 2OT0A 1HGWA 2ATSA 4HPHA 2DSUA 3AYVA 4NVTA 4JQ3A 4UTUA 4C6MA 1VZWA 3HM7A 3BLFA 3AXMA 3QFEA 4I7WA 4WGXA 4YL2A 4A3QA 2RKXA 1R3WA 4LEFA 4GVFA 2E28A 4PZVA 2BDQA 3RUBL 2D73A 4QG6A 3CO8A 3SCQA 5LKYA 1FDYA 3QMRA 1EJUC 1R2SA 1FWRA 2VQTA 3TEVA 1NOWA 1ZFJA 1XF0A 5F2IA 4F66A 3MQTA 5AC4A 3BAWA 1PO9A 1FA2A 4WXZA 4P7LA 4D2JA 1F5ZA 2YSWA 3HGRA 3V16A 3AMDA 5MKGA 4F8XA 3IJ8A 2JF7A 4WY0B 2BZNA 3WMLA 5AB3A 1JNEA 5CBJA 3AUJA 3BW3A 1LOQA 4O4WA 1REQB 4Y9AA 1RQHA 1Z89A 2ZZ7A 1A5UA 1XLCA 3AYTA 2FPVA 2R1PA 4A8IA 4DJFA 3WD1A 2ZUUA 1QHPA 2A3LA 1SMAA 2Z2UA 2GJNA 5DELA 3AICA 4RNHA 3GX9A 5DANA 4ZBCA 4UTLA 4GNKB 3C8FA 2NQLA 3AS2A 4PUUA 3N2TA 4A21A 3U2OA 4C6QA 2GFTA 2WZTA 1LQAA 3W7EA 1KV8A 1RXOB 1XHGA 3FAXA 3OW1A 1OABA 3I3DA 4R7JA 3MZNA 2D1ZA 1FWWA 4MDPA 7XIMA 2OKOA 1T41A 1V3JA 1CXFA 2L5HA 2XVNA 4ZB5A 3VD9A 4Z08A 3GG1A 4ATDA 2C18A 1HTIA 2C14A 3TCEA 4ZMGA 4K8GA 3LB0A 5K3VA 3CUGA 4DJDA 3ITVA 2KAUC 3MDWA 4DWSC 1F74A 1S2AA 4FMVA 2PDCA 1DHPA 1Z6KA 3S46A 2EF9A 4G7EA 4U2YA 4KRTA 4GYPA 5REQB 3S3GA 1E72M 2VXNA 4H04A 5CAKA 2XTKA 4URIA 3CUIA 4IFKB 3G1SA 3JUGA 4HA0A 5K9CA 4LSBA 2WM1A 4O14A 3GKFA 4MLRA 1W31A 3VCCA 1UKTA 2CLHA 1GW1A 4DUOA 3TLLA 3O06A 3MCOA 2BS9A 1CT5A 1ADDA 5J04A 1BFNA 4W8BA 3BWWA 5DRCA 3GAKA 3DGBA 2YXXA 1XISA 3BMVA 1XFCA 1R86A 1XLKA 1SPQA 5E0CA 2A3AA 4N9DA 4HYVA 4BI7A 2CKRA 3TR2A 1OZQA 3BG9A 4S3DA 3LCIA 3RJXA 3AMLA 1NQ6A 3PY2A 4PCFA 1I2OA 1V02E 4PL2A 2YCKX 3WD2A 3UU0A 4FO4A 3GDMA 1DWHM 3KDOA 4KKXA 1W1PA 3LSCA 2FVKA 4Z1BA 4AC1X 2ZUNA 3LHTA 2PRMA 3POCA 3RMJA 2QCGA 1K77A 1Z48A 2G8ZA 1PIGA 1QI4A 3HTWA 2IPGA 1V6TA 2ZC1A 1TZ7A 5LXXA 4AX6A 3UD6A 2FZMA 3W53A 1JCXA 5BRBA 4MWAB 5GJPA 4TU1A 5LNVA 5LSMA 4MUPA 1XSKA 1E51A 1BD0A 1FHUA 4TTGA 4DI8A 3EZ4A 7REQB 2J7HA 1UW9A 5HMEA 3QQWA 1GVIA 1RA0A 5U4NA 1XD0A 4RW3A 1XUUA 2Z0IA 3GKAA 2VM8A 4J2PA 2Z00A 1NELA 4UQAA 2HJPA 1ISZA 4CNOA 1TX2A 1XLMA 2INEA 3N29A 3FOKA 3WEMA 1I6NA 1AFSA 4MWAE 1CB7B 2Y4SA 4XKYB 3QJAA 1E0WA 2YBVA 1UUQA 4IP4A 1SFSA 4M6QA 6CGTA 1XGEA 3LCGA 5MKGB 2C1IA 1JPKA 3VGHA 3LV6A 5A6BD 2TMDA 1TKKA 2QGYA 3DG7A 1XLBA 3KHDA 1OFRA 2WWDA 4J3ZA 3KBJA 3VIHA 4QG8A 2Y61A 1RLCL 4Z1CA 1LL4A 4UB9A 1AQMA 3N6JA 3D0CA 1FFRA 4L80A 4Z1AA 3AXKA 5HNUA 3LI1A 2PC4A 2XINA 5HQEA 5TIMA 1HT6A 3NGFA 3RLVA 2QEZA 5G5IA 2J13A 2CLPA 1IEVA 3UP8A 5KEZA 1OFEA 2BB0A 1OC5A 4TR9A 3NQGA 5D2YA 1UD2A 3WBXA 1P7TA 4H9VA 4JIRA 2IXUA 3WJYA 3T9PA 4E2VA 2EHHA 5ENLA 1TJ2A 1LLWA 3GNXA 3UJRA 1AQFA 4UWMA 1UYQA 1GUVA 2BFGA 1E43A 5FEWA 3NGJA 2V2HA 4TVUA 1W8SA 1EGVA 2HXTA 3DECA 4L4MA 5G4EA 3RM4A 2REQA 4C5ZA 2FMNA 3DKJA 2I16A 1BEUA 3CH9A 5A8PA 3LZ5A 2NUWA 1J8VA 1DKWA 3EPOA 4QRNA 1VAHA 3TDFA 1TV7A 5E93A 2YFNA 3W38A 1EC9A 1PX8A 1G7VA 3CYVA 3W6LA 1V8EA 2WJFA 4XAYA 1IWAA 3WK3A 2BOEX 2J8TA 4ZQMA 1VPXA 4C6FA 1M9HA 3WDRA 3ZO9A 1S39A 4YHGA 3H4GA 2C1HA 1Q63A 4ATLA 3HBLA 3AIUA 2CIPA 3IJ9A 1VJSA 3W87A 2WVSA 1XLAA 2E5DA 3Q67A 1EWDA 3TOYA 3ID7A 6TIMA 3VNLA 2YYUA 3W7PA 1YW1A 3WNPA 1H41A 3BC9A 4ZVJA 4AWEA 3L68A 3NQMA 1UHVA 5GQBA 1ECEA 2XDFA 2WJDA 4O1FA 1TA3A 2H9AA 3SURA 2INFA 1VGAA 2NQZA 3BCJA 3PZ9A 3H4WA 1AD4A 3GG7A 4C5YA 3TW6A 5HMDA 3BURA 4PC8A 4QGCA 3RM9A 2YDAA 3L5LA 1DWAM 3UWZA 3FYYA 4OOUA 1EKOA 4PUKA 4R7WA 3L4WA 2Y70A 5EMKA 3EA3A 1JZ5A 2Y62A 1O5RA 3L0KA 4J7RA 4ZTYA 4PN2A 4B4HA 4PB3A 1F07A 1YDYA 2FDMA 1FOBA 3FYPA 4O10A 5JIPA 4Z0JA 3UWYA 1F76A 4AZBA 5TQLA 3WLPA 3SRKA 3I6TA 1XYZA 1A3WA 3LTSA 4HB7A 1JPMA 4IP5A 4NI3A 4PCPA 3STGA 4KS0A 4L6DA 4HNCA 2WNZA 1DTNA 1GONA 4AZCB 4ZODA 3KX6A 4AY1A 2EPNA 4C1NB 3HO8A 3NQDA 3BLKA 2UY5A 4IGSA 3EMQA 3PBMA 4DZHA 3TC7A 2V8ZA 3V0UA 3RITA 3AHTA 3MVTA 4LU0A 3TYBA 2OCZA 3ZLGA 3W4RA 1ME9A 4N7QA 3T44A 3NA8A 4DUWA 3NQEA 4LAUA 1UMLA 3VIFA 3GTNA 1LQ2A 1C9WA 3PJXA 4EK7A 4YVVA 3QH2A 5D2XA 4LF2A 1GTHA 5BROA 1Z32X 3WUGA 3TKFA 3PWIA 1SZRA 3NZPA 3S2LA 1OC7A 1SFTA 4BWLA 3N19B 1UWIA 1CGYA 2DJLA 3LBMA 3AS3A 2P8CA 4JKLA 2VEIA 3PTKA 3C2EA 3Q94A 4Q4QA 1V02A 2EPHA 4JGDA 2NXGA 3W6MA 3ES8A 4LEQA 2PMQA 5AHEA 5L6UA 3V0SA 2QZRA 1QI2A 2WHMA 4FLQA 1CXKA 4PTXA 4REQB 4IXXA 2WLYA 2NVAA 2YCLA 2HCVA 3T07A 1ZAJA 3A23A 5K4ZA 1MZRA 4KPLA 3WKZA 2REQB 1UQYA 1RBAA 1K9TA 3RPDA 2QCEA 1O68A 1H60A 1S3TC 2ZTKA 2R1NA 2GDUA 1SJCA 4UQBA 3QKZA 2FH6A 3CV7A 3OO2A 4O15A 1HW6A 4AYGA 2DVUA 3VX0A 2DIEA 3CWNA 2HWGA 1TO3A 2OO6A 3PZQA 5ABTA 4PCTA 2CHNA 1Q4WA 1KR0A 1F6PA 2V5DA 1OD8A 3WELA 6ALDA 4IIGA 1IWBA 3PN8A 3PZTA 1QRQA 1PXGA 2PTWA 3MT1A 4AY7A 3HQNA 5DCBA 1GKPA 1WQ5A 1QI3A 3CAKA 3M0VA 1JNDA 4F4RA 2UY4A 4JBRA 2QPXA 2NSOA 4ZXLA 1EJ7L 1J10A 4GBUA 3UYCA 1WDPA 3E5PA 4Q8PA 2WC3A 4B92A 1T8QA 3WCZA 4YTUA 3WQ6A 5BWAA 1QPNA 1DEDA 2X40A 3S5NA 5C54A 4HCLA 3SN4A 4H9UA 3NPUA 3WH9A 5EA9A 3MUY1 2X05A 2E68A 4A4AA 1JPIA 3OB8A 1TMLA 4MKSA 3W29A 1Q6OA 4X2RA 5A8MA 5CPSA 1J6PA 1EBHA 1W1A1 4DAFA 3GFZA 4HMEA 3QR0A 4S3FA 3TNOA 1OJXA 1ML1A 3DI0A 2DSVA 1OYAA 3U9IA 4UCGA 1E6QM 3L12A 3KTSA 3IPWA 3IK4A 2YJQA 3VD5A 2JBMA 2NLIA 4E4UA 5CSUA 1JUEA 1O66A 3BGGA 4RDWA 2Y85A 2X0YA 5AHIA 2Z7GA 5I03A 4YWSA 1Z7AA 3CQIA 2CLOA 3PZIA 1CDGA 1V0MA 5H6HA 4NJKA 1UR1A 4ORIA 3CMJA 3WDHA 2ZADA 3VABA 3EOUA 4C1KA 4RV3A 3IJ6A 1GZJA 1R0MA 4K38A 3VIPA 4AISA 2IQDA 3LV5A 1EJVC 2IMRA 2VYOA 3MP5A 3S0CA 3FXYA 3L67A 4S38A 3VK5A