1J6WA

Crystal structure of haemophilus influenzae luxs
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
161
structure length
161
Chain Sequence
LLDSFKVDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLFAGFMRDHLNGDSIEIIDISPMGCRTGFYMSLIGTPNEQKVSEAWLASMQDVLGVQDQASIPELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKNEDLSLDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Signaling protein
total genus 41
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j6wA00
1JVIA 1IE0A 1YCLA 1VGXA 1J6VA 1J98A 1J6XA 1INNA 1J6WA 1JOEA 1VJEA 2FQOA 2FQTA 4XCHA 1JQWA 5E68A 1VH2A
chains in the Genus database with same CATH superfamily
5IYCC 4KC6A 4G7ZA 1UV7A 3S1QK 4C3IC 1TWGK 3S15C 4OIRA 1HI9A 4GTFA 1I50K 3GEIA 3TFHA 3N0CA 4GTEA 1HQMA 2Y3PA 1EI6A 4GTDA 1TWCC 4KN4A 3GTJA 3HKZL 3BUEA 5IYCK 2JA6A 5L46A 2A6HA 4A3KC 2JA5C 3S2HC 3K7AC 5M5XK 5IYDC 1B4AA 4C3IK 3S15K 2JA8C 2GSUA 5C4JC 3FKIA 4GZYA 5IOQA 3GTPA 4BBRK 4GFQA 3GTOA 2P8TA 3HOWC 1WCMA 3HXAA 2R7ZA 4QIWL 4LOWA 4A3KK 2JA5K 3S2HK 3K7AK 2NVTC 5IYDK 3VA7A 3I4MC 4GTBA 3TFJA 3HOZC 3HOYC 1G51A 2ZUFA 4BXXC 5EGHA 4OIOA 3HOWK 2WAQD 2V6TA 2YU9A 4KASA 1WQHA 2E2HC 3TTGA 5IP7C 4J3NA 4G0VA 1TWAA 1BS2A 4YFKA 3I4MK 1KQ4A 1O27A 5M3MK 3HOZK 2CW0A 3HOYK 4PABA 2CFAA 4KMDA 1Y1VC 2E2HK 4Y7NC 5IP7K 4A3EC 2E2JK 1O2AA 4P5AA 1R9TC 5IOTA 2W7VA 1USMA 3GEEA 1J6VA 3S2DC 1O24A 1XXAA 4KMAA 4XLPA 2FQOA 3RZDC 1I50A 3ERED 1ISEA 1Y1VK 2GAGC 4M1XA 1XPPA 4Y7NK 4BLBA 4A3EK 1XZQB 2PA8L 2B63K 1VRQC 5IP9C 3Q3QA 3S1MK 1XXBA 3S2DK 1RU0A 4LQYA 3RZDK 4YFXA 1O2BA 4A3DC 4BY1C 1SFOC 4C3JC 4LK0A 3GTQA 2KWAA 1J6WA 4KATA 4LR2A 4WJ4A 3HOXK 1F9NA 2O5JA 3G4AA 1YX2A 4A3LC 2FQTA 4BBSC 1I3QA 5IP9K 1WQFA 5CHPA 2VUMA 4AYBD 4BY1K 4AH6A 4C3JK 2R92K 3AQOA 2R93C 3H3VD 1XZPA 2WB1D 1WORA 4GTAA 1C0AA 2V6SA 4A3LK 5IYBK 3PO3K 3GTKC 1JQWA 3GIRA 4BY7C 1VLOA 5C4XC 1F93A 4G0WA 3QX3A 2GSNA 2XCOA 4C3HK 4GTLA 3AD7C 1Y1WC 2R93K 1WSRA 1O28A 3GTGA 4KDDA 3CQZC 3HKZD 1L0WA 4A3IC 2O5IA 3GTKK 4BY7K 5C4XK 5EGEA 3LAPA 4GTCA 1EQRA 2GSOA 3LAJA 4O2DA 1TWCK 1EK8A 3DXJA 1YNJA 1WOSA 1V5VA 2JA7C 4P9SA 3SZYA 4QJVA 3L4KA 2E2IC 1GE9A 3A8KA 5CJ9A 2JA8K 1Y1VA 5C4JK 4A3IK 4QIWD 1TWFC 5TMFA 2NVYC 3GTLC 2B63A 3PO2C 4A3BC 1ZVUA 1TWHA 4C2MC 4BKWA 3AD8C 2JA7K 4MEYA 3OEPA 2NVTK 4C45A 3FHZA 2E2IK 3S1RC 5C3EC 3NUHA 1TWFK 1USOA 3GTJC 1ZQ1C 2CFAB 4BXXK 3GTLK 4YG2A 2JA6C 5JFEA 3PO2K 1F7VA 4GT9A 2A68A 5E68A 4A3BK 1IQ0A 1EFWA 3GTMA 1PJ5A 4C2MK 2Y0SL 4YFNA 3FKIC 4PAAA 2R92A 4KB4A 5JVOA 4A3FC 3GTPC 3S1RK 5C3EK 3GTOC 3L4JA 1TWGA 4WILA 3AQPA 3OPFA 3GTJK 1WCMC 2R7ZC 4XLNA 2JA6K 1X31C 5IOSA 4Q4ZA 2PMZL 1VJEA 3FKIK 1R9TK 1YCLA 4LLGA 4KN7A 1J98A 1O26A 4A3FK 3I4NC 4G7HA 3GTOK 1SMYA 2YU9C 5D4DA 1O29A 2PA8D 4ZH4A 3S0XA 2RH6A 1TWAC 1TWCA 3BP8C 3M3YC 4KB2A 2V6UA 1VGXA 2JA5A 3I4NK 2YU9K 1DCOA 4A3DK 2A6EA 1XZPB 1SFOK 3FOFA 4A93C 3G4CA 1DCPA 4ILDA 4XCHA 1TWAK 4OIPA 3HOVC 1O2FB 4P5BA 4LJZA 3GEHA 3M3YK 5M3FK 3S14C 1XXCA 3T00A 4BBSK 1I50C 2D6FC 1PJ7A 1IS1A 3BP3A 1BGWA 2NVQC 4A93K 1WQGA 1K83C 3GTLA 3HOVK 3IPJA 3T01A 1DCHA 2NVXC 2E2HA 3S14K 1B4BA 2GAHC 3CAGA 3H0GC 5TMCA 4KARA 3GTQC 4BBRC 2NVQK 1INNA 4QJVB 4OINA 4XSZA 1K83K 3GSIA 3GDZA 3N3YA 1Y1WK 1PJ6A 3SZZA 1I3QC 4MEXA 2NVXK 2VUMC 3CQZK 1IE0A 4Y52C 3H0GK 1R9TA 3GTQK 3T02A 3FOEA 4G7OA 4MQ9A 5FLMC 1I3QK 4A3GC 3A8JA 1WOPA 3WODA 2VUMK 3HOUC 4A3CC 1IW7A 2WAQL 4JK1A 3OREA 3M4OC 4Y52K 1YNNA 1WIHA 4RMFA 4A3MC 3MMLB 2NVYK 4A3JC 3GTGC 3S1NC 1BDFA 2PHCB 4LK1A 5FLMK 1SFOA 2E2JC 2EBBA 1IL2A 4A3GK 1I6VA 3N0BA 4XSXA 3HOUK 4A3CK 1ZYRA 5M5YK 3AD9C 3ADAC 4KMUA 2Y0SD 3M4OK 1IBAA 4DDQA 1I6HC 2RGRA 4Q5SA 4A3MK 3S17C 1JOEA 4A3JK 3GTGK 4KAWX 3S1NK 2XCQA 2JH3A 1ZXOA 5IORA 3A8IA 3S16C 2R93A 2ZFZA 5C44C 2B63C 3GTPK 3S1MC 2PMZD 1I6HK 4G0UA 1WCMK 2R7ZK 2P5MA 1TWHC 3S17K 3GTKA 3LPXA 3RZOC 5FJ8K 1JVIA 2BE5A 1J6XA 4X6AC 3JSTA 3HOXC 1F7UA 4OIQA 5M5WK 2PPBA 3EQLA 1Y1WA 1K83A 3S16K 5C44K 4KMHA 5HL8A 1AB4A 2NVXA 4WJ3M 1XZQA 3CQZA 1DD5A 1TWHK 3GTMC 2ZUEA 4NOIA 3RZOK 1BJTA 1VH2A 3H0GA 1O25A 1WSVA 2R92C 4X6AK 4AYBL 3AH5A 4FM9A 3S1QC 1TWGC 1EH1A 4BLAA 2JA7A 4KM8A 3TFIA 5IYBC 3PO3C 2E2IA 2XCRB 3H3VL 5TJ3A 2WB1L 1ZBSA 3GTMK 4FZBA 1WOOA 1TWFA 3V4GA 2A69A 4KM9A 2NVYA 4C3HC
chains in the Genus database with same CATH topology
1JVIA 1IE0A 1YCLA 1VGXA 1J6VA 1J98A 1J6XA 1INNA 1J6WA 1JOEA 1VJEA 2FQOA 2FQTA 4XCHA 1JQWA 5E68A 1VH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVI A;  1IE0 A;  1YCL A;  1VGX A;  1J6V A;  1J98 A;  1J6X A;  1INN A;  1J6W A;  1JOE A;  1VJE A;  2FQO A;  2FQT A;  4XCH A;  1JQW A;  5E68 A;  1VH2 A; 
#chains in the Genus database with same CATH topology
 5IYC C;  4KC6 A;  4G7Z A;  1UV7 A;  3S1Q K;  4C3I C;  1TWG K;  3S15 C;  4OIR A;  1HI9 A;  4GTF A;  1I50 K;  3GEI A;  3TFH A;  3N0C A;  4GTE A;  1HQM A;  2Y3P A;  1EI6 A;  4GTD A;  1TWC C;  4KN4 A;  3GTJ A;  3HKZ L;  3BUE A;  5IYC K;  2JA6 A;  5L46 A;  2A6H A;  4A3K C;  2JA5 C;  3S2H C;  3K7A C;  5M5X K;  5IYD C;  1B4A A;  4C3I K;  3S15 K;  2JA8 C;  2GSU A;  5C4J C;  3FKI A;  4GZY A;  5IOQ A;  3GTP A;  4BBR K;  4GFQ A;  3GTO A;  2P8T A;  3HOW C;  1WCM A;  3HXA A;  2R7Z A;  4QIW L;  4LOW A;  4A3K K;  2JA5 K;  3S2H K;  3K7A K;  2NVT C;  5IYD K;  3VA7 A;  3I4M C;  4GTB A;  3TFJ A;  3HOZ C;  3HOY C;  1G51 A;  2ZUF A;  4BXX C;  5EGH A;  4OIO A;  3HOW K;  2WAQ D;  2V6T A;  2YU9 A;  4KAS A;  1WQH A;  2E2H C;  3TTG A;  5IP7 C;  4J3N A;  4G0V A;  1TWA A;  1BS2 A;  4YFK A;  3I4M K;  1KQ4 A;  1O27 A;  5M3M K;  3HOZ K;  2CW0 A;  3HOY K;  4PAB A;  2CFA A;  4KMD A;  1Y1V C;  2E2H K;  4Y7N C;  5IP7 K;  4A3E C;  2E2J K;  1O2A A;  4P5A A;  1R9T C;  5IOT A;  2W7V A;  1USM A;  3GEE A;  1J6V A;  3S2D C;  1O24 A;  1XXA A;  4KMA A;  4XLP A;  2FQO A;  3RZD C;  1I50 A;  3ERE D;  1ISE A;  1Y1V K;  2GAG C;  4M1X A;  1XPP A;  4Y7N K;  4BLB A;  4A3E K;  1XZQ B;  2PA8 L;  2B63 K;  1VRQ C;  5IP9 C;  3Q3Q A;  3S1M K;  1XXB A;  3S2D K;  1RU0 A;  4LQY A;  3RZD K;  4YFX A;  1O2B A;  4A3D C;  4BY1 C;  1SFO C;  4C3J C;  4LK0 A;  3GTQ A;  2KWA A;  1J6W A;  4KAT A;  4LR2 A;  4WJ4 A;  3HOX K;  1F9N A;  2O5J A;  3G4A A;  1YX2 A;  4A3L C;  2FQT A;  4BBS C;  1I3Q A;  5IP9 K;  1WQF A;  5CHP A;  2VUM A;  4AYB D;  4BY1 K;  4AH6 A;  4C3J K;  2R92 K;  3AQO A;  2R93 C;  3H3V D;  1XZP A;  2WB1 D;  1WOR A;  4GTA A;  1C0A A;  2V6S A;  4A3L K;  5IYB K;  3PO3 K;  3GTK C;  1JQW A;  3GIR A;  4BY7 C;  1VLO A;  5C4X C;  1F93 A;  4G0W A;  3QX3 A;  2GSN A;  2XCO A;  4C3H K;  4GTL A;  3AD7 C;  1Y1W C;  2R93 K;  1WSR A;  1O28 A;  3GTG A;  4KDD A;  3CQZ C;  3HKZ D;  1L0W A;  4A3I C;  2O5I A;  3GTK K;  4BY7 K;  5C4X K;  5EGE A;  3LAP A;  4GTC A;  1EQR A;  2GSO A;  3LAJ A;  4O2D A;  1TWC K;  1EK8 A;  3DXJ A;  1YNJ A;  1WOS A;  1V5V A;  2JA7 C;  4P9S A;  3SZY A;  4QJV A;  3L4K A;  2E2I C;  1GE9 A;  3A8K A;  5CJ9 A;  2JA8 K;  1Y1V A;  5C4J K;  4A3I K;  4QIW D;  1TWF C;  5TMF A;  2NVY C;  3GTL C;  2B63 A;  3PO2 C;  4A3B C;  1ZVU A;  1TWH A;  4C2M C;  4BKW A;  3AD8 C;  2JA7 K;  4MEY A;  3OEP A;  2NVT K;  4C45 A;  3FHZ A;  2E2I K;  3S1R C;  5C3E C;  3NUH A;  1TWF K;  1USO A;  3GTJ C;  1ZQ1 C;  2CFA B;  4BXX K;  3GTL K;  4YG2 A;  2JA6 C;  5JFE A;  3PO2 K;  1F7V A;  4GT9 A;  2A68 A;  5E68 A;  4A3B K;  1IQ0 A;  1EFW A;  3GTM A;  1PJ5 A;  4C2M K;  2Y0S L;  4YFN A;  3FKI C;  4PAA A;  2R92 A;  4KB4 A;  5JVO A;  4A3F C;  3GTP C;  3S1R K;  5C3E K;  3GTO C;  3L4J A;  1TWG A;  4WIL A;  3AQP A;  3OPF A;  3GTJ K;  1WCM C;  2R7Z C;  4XLN A;  2JA6 K;  1X31 C;  5IOS A;  4Q4Z A;  2PMZ L;  1VJE A;  3FKI K;  1R9T K;  1YCL A;  4LLG A;  4KN7 A;  1J98 A;  1O26 A;  4A3F K;  3I4N C;  4G7H A;  3GTO K;  1SMY A;  2YU9 C;  5D4D A;  1O29 A;  2PA8 D;  4ZH4 A;  3S0X A;  2RH6 A;  1TWA C;  1TWC A;  3BP8 C;  3M3Y C;  4KB2 A;  2V6U A;  1VGX A;  2JA5 A;  3I4N K;  2YU9 K;  1DCO A;  4A3D K;  2A6E A;  1XZP B;  1SFO K;  3FOF A;  4A93 C;  3G4C A;  1DCP A;  4ILD A;  4XCH A;  1TWA K;  4OIP A;  3HOV C;  1O2F B;  4P5B A;  4LJZ A;  3GEH A;  3M3Y K;  5M3F K;  3S14 C;  1XXC A;  3T00 A;  4BBS K;  1I50 C;  2D6F C;  1PJ7 A;  1IS1 A;  3BP3 A;  1BGW A;  2NVQ C;  4A93 K;  1WQG A;  1K83 C;  3GTL A;  3HOV K;  3IPJ A;  3T01 A;  1DCH A;  2NVX C;  2E2H A;  3S14 K;  1B4B A;  2GAH C;  3CAG A;  3H0G C;  5TMC A;  4KAR A;  3GTQ C;  4BBR C;  2NVQ K;  1INN A;  4QJV B;  4OIN A;  4XSZ A;  1K83 K;  3GSI A;  3GDZ A;  3N3Y A;  1Y1W K;  1PJ6 A;  3SZZ A;  1I3Q C;  4MEX A;  2NVX K;  2VUM C;  3CQZ K;  1IE0 A;  4Y52 C;  3H0G K;  1R9T A;  3GTQ K;  3T02 A;  3FOE A;  4G7O A;  4MQ9 A;  5FLM C;  1I3Q K;  4A3G C;  3A8J A;  1WOP A;  3WOD A;  2VUM K;  3HOU C;  4A3C C;  1IW7 A;  2WAQ L;  4JK1 A;  3ORE A;  3M4O C;  4Y52 K;  1YNN A;  1WIH A;  4RMF A;  4A3M C;  3MML B;  2NVY K;  4A3J C;  3GTG C;  3S1N C;  1BDF A;  2PHC B;  4LK1 A;  5FLM K;  1SFO A;  2E2J C;  2EBB A;  1IL2 A;  4A3G K;  1I6V A;  3N0B A;  4XSX A;  3HOU K;  4A3C K;  1ZYR A;  5M5Y K;  3AD9 C;  3ADA C;  4KMU A;  2Y0S D;  3M4O K;  1IBA A;  4DDQ A;  1I6H C;  2RGR A;  4Q5S A;  4A3M K;  3S17 C;  1JOE A;  4A3J K;  3GTG K;  4KAW X;  3S1N K;  2XCQ A;  2JH3 A;  1ZXO A;  5IOR A;  3A8I A;  3S16 C;  2R93 A;  2ZFZ A;  5C44 C;  2B63 C;  3GTP K;  3S1M C;  2PMZ D;  1I6H K;  4G0U A;  1WCM K;  2R7Z K;  2P5M A;  1TWH C;  3S17 K;  3GTK A;  3LPX A;  3RZO C;  5FJ8 K;  1JVI A;  2BE5 A;  1J6X A;  4X6A C;  3JST A;  3HOX C;  1F7U A;  4OIQ A;  5M5W K;  2PPB A;  3EQL A;  1Y1W A;  1K83 A;  3S16 K;  5C44 K;  4KMH A;  5HL8 A;  1AB4 A;  2NVX A;  4WJ3 M;  1XZQ A;  3CQZ A;  1DD5 A;  1TWH K;  3GTM C;  2ZUE A;  4NOI A;  3RZO K;  1BJT A;  1VH2 A;  3H0G A;  1O25 A;  1WSV A;  2R92 C;  4X6A K;  4AYB L;  3AH5 A;  4FM9 A;  3S1Q C;  1TWG C;  1EH1 A;  4BLA A;  2JA7 A;  4KM8 A;  3TFI A;  5IYB C;  3PO3 C;  2E2I A;  2XCR B;  3H3V L;  5TJ3 A;  2WB1 L;  1ZBS A;  3GTM K;  4FZB A;  1WOO A;  1TWF A;  3V4G A;  2A69 A;  4KM9 A;  2NVY A;  4C3H C; 
#chains in the Genus database with same CATH homology
 1JVI A;  1IE0 A;  1YCL A;  1VGX A;  1J6V A;  1J98 A;  1J6X A;  1INN A;  1J6W A;  1JOE A;  1VJE A;  2FQO A;  2FQT A;  4XCH A;  1JQW A;  5E68 A;  1VH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...