1J6WA

Crystal structure of haemophilus influenzae luxs
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
161
structure length
161
Chain Sequence
b'LLDSFKVDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLFAGFMRDHLNGDSIEIIDISPMGCRTGFYMSLIGTPNEQKVSEAWLASMQDVLGVQDQASIPELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKNEDLSLDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Signaling protein
total genus 41
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j6wA00
5E68A 1J98A 4XCHA 1VH2A 1JQWA 1JVIA 1VJEA 1JOEA 1VGXA 1INNA 1IE0A 1J6VA 2FQTA 1J6XA 1YCLA 1J6WA 2FQOA
chains in the Genus database with same CATH superfamily
2W7VA 4GT9A 3HOUK 2PA8D 1J6VA 1R9TC 1JVIA 2XCRB 3AD8C 3IPJA 2PMZD 3S1QC 1AB4A 1IS1A 1KQ4A 2YU9C 3HOYK 4FZBA 4YFXA 5IYBK 3S1RC 4Q5SA 1IE0A 1IBAA 1SFOA 3TTGA 1EH1A 1SFOK 2CFAA 1BDFA 4A3MC 4A93C 5TJ3A 4OIRA 4BXXC 3GTPC 5D4DA 4QJVA 1I6HC 2JA8C 1ISEA 4MEYA 2B63K 1TWFC 3HXAA 2VUMA 2E2IC 5IYCK 2Y0SD 2VUMK 1RU0A 4GTBA 4A3JC 3AQPA 4XSXA 2R92A 2R92K 3RZOK 1TWGA 4KAWX 4Y7NC 5IP9K 4AH6A 3GTLA 1TWGK 4GTLA 2R93C 1XZQB 3BP3A 2RGRA 3GTLK 2NVQK 1O2FB 2NVYK 1I3QC 1EK8A 1ZXOA 4KB4A 1ZQ1C 3S2DK 1PJ7A 3ADAC 5M5WK 4A3DK 1K83A 4GTDA 1K83K 3RZDK 4AYBL 3PO3C 4P5AA 1DCHA 1VJEA 3EQLA 1USMA 4P9SA 2CW0A 4J3NA 3S2HK 3HOXC 3K7AC 3S16C 3GTQA 4X6AC 1O25A 2GSUA 2PHCB 3VA7A 4OIQA 4A3LC 1O2AA 2NVTK 1ZYRA 5IYDK 1WCMA 3S1MK 1WOPA 1WCMK 1BGWA 3S14C 4C2MC 3FHZA 3L4JA 3S15K 1INNA 1F9NA 2RH6A 4BY1C 4C3HC 1Y1WC 1C0AA 4GFQA 4A3KK 3MMLB 1IL2A 4MEXA 3GTJA 3OPFA 3S17C 4Y52C 1TWAA 4JK1A 5C4XK 1O2BA 3OREA 3M3YK 3S1NC 2ZUEA 2ZFZA 3HOWC 3I4NC 1O29A 2JA7C 4BBSK 4LQYA 4QIWD 4C3IK 5FLMC 3GTOA 1BS2A 3T00A 1SMYA 3GIRA 4XCHA 3GTOK 3CQZA 4G0UA 3CQZK 4WJ3M 1Y1VA 1F7VA 1IW7A 5E68A 1WIHA 1Y1VK 4KM8A 3HOVC 2E2HA 1VLOA 3H0GC 2GSOA 2R7ZA 1DD5A 3LAPA 1TWHA 3A8IA 3N0CA 5IP7K 3GEIA 2R7ZK 1I50C 5IORA 4Q4ZA 1XZPB 1R9TA 1WOSA 3SZYA 1VH2A 3GTGC 5C44K 4LK0A 3S1QK 3TFJA 4BBRC 5IYBC 3Q3QA 2A69A 3OEPA 2XCQA 2GAGC 2PA8L 4A3MK 4RMFA 4A93K 3M4OC 4ILDA 1WOOA 3GTPA 4BXXK 2B63C 3A8KA 3GTPK 1I6HK 2PMZL 1TWFA 2VUMC 4C45A 2E2IA 2V6SA 3G4CA 2JA6C 1X31C 3RZOC 2FQTA 4PAAA 1V5VA 5IP9C 4LR2A 4MQ9A 1TWCC 1TWGC 1BJTA 1WSRA 4LJZA 3GTMC 2R93A 4KMAA 5CJ9A 3T02A 4A3EC 4AYBD 4G7HA 4LK1A 2NVYC 4BLBA 5M5XK 4A3CC 1I3QA 2Y0SL 2NVXA 1I3QK 2NVXK 4BY7C 5L46A 3FOFA 3CAGA 4KB2A 3RZDC 1UV7A 1DCOA 3GTQK 1YNNA 3PO3K 4XSZA 1J6WA 3AH5A 1WSVA 3GTKA 3HOZC 4GTEA 3GTKK 4PABA 3K7AK 2CFAB 4ZH4A 5IYDC 5C4JK 3S1MC 5IOSA 2JA5C 4A3LK 3HKZL 2Y3PA 1XXAA 1EFWA 4WILA 4KASA 4QJVB 3S15C 3S14K 4C2MK 3FKIC 1O24A 2A68A 3GTJK 2JH3A 2O5JA 2FQOA 1EI6A 1Y1WA 4YG2A 4A3KC 3GDZA 1TWAK 5EGEA 3V4GA 2V6UA 5TMFA 2O5IA 1WORA 4A3IK 1VGXA 4C3JK 5C4XC 3ERED 4P5BA 1YCLA 3S17K 4KC6A 4Y52K 5C3EK 3H3VD 1O27A 2E2JK 2D6FC 5JVOA 3HOWK 4KN4A 3GEEA 3A8JA 3I4NK 4KATA 4A3BK 4BBSC 4A3FK 1IQ0A 1YNJA 1J98A 1XZQA 2GSNA 3L4KA 4C3IC 3FOEA 1F93A 3S0XA 3CQZC 1JOEA 2WB1L 3I4MC 3N0BA 2E2HK 4A3GK 1O28A 1Y1VC 3HOUC 1TWHK 3DXJA 5IOQA 4OINA 3PO2K 1HQMA 4KMUA 2WAQL 4GTAA 3H0GA 1R9TK 4KMDA 4QIWL 3GEHA 3AD7C 1I50A 2YU9A 3HOYC 1I50K 3SZZA 4BKWA 2YU9K 1HI9A 1SFOC 2XCOA 5C44C 3S1RK 3GTGA 5HL8A 3TFIA 4KM9A 3GTGK 4BBRK 5IYCC 2JA8K 5M3FK 1WQHA 2BE5A 5IOTA 1TWFK 2E2IK 3GSIA 2R92C 4M1XA 3JSTA 4DDQA 3M4OK 4A3JK 2B63A 5M3MK 4WJ4A 1O26A 3GTLC 1ZBSA 4NOIA 4Y7NK 2NVQC 3LPXA 2R93K 4GZYA 2JA6A 2JA6K 1TWCA 3S2DC 4G7ZA 3GTMA 1TWCK 4A3DC 3GTMK 4GTCA 1J6XA 3AD9C 4XLPA 4A3EK 1K83C 4BLAA 2NVYA 1WQFA 2NVXC 4A3CK 2P5MA 3AQOA 4KN7A 4YFNA 4OIOA 4BY7K 5JFEA 3S2HC 3HKZD 3N3YA 1DCPA 3GTQC 2V6TA 3HOXK 2NVTC 3S16K 5TMCA 4X6AK 1B4AA 1WCMC 4YFKA 3BP8C 2KWAA 3GTKC 2A6HA 3HOZK 5C4JC 1PJ6A 2JA5A 1XZPA 1XPPA 2JA5K 5M5YK 4OIPA 3QX3A 4BY1K 4C3HK 1Y1WK 2EBBA 1XXCA 2ZUFA 3FKIA 3GTJC 4G7OA 5CHPA 1F7UA 3FKIK 1TWAC 1YX2A 1VRQC 4LOWA 3M3YC 1WQGA 4A3IC 4C3JC 4XLNA 3S1NK 1PJ5A 5C3EC 2JA7A 1ZVUA 1I6VA 2JA7K 5FJ8K 4LLGA 2WB1D 3BUEA 2E2JC 4FM9A 2A6EA 3TFHA 1G51A 2P8TA 3GTOC 1L0WA 1EQRA 3LAJA 4A3BC 2PPBA 4G0VA 4GTFA 1USOA 5FLMK 4A3FC 4KARA 2WAQD 4KDDA 3NUHA 1JQWA 3T01A 3G4AA 1GE9A 1B4BA 5EGHA 4G0WA 3H3VL 2GAHC 1XXBA 3WODA 2E2HC 4A3GC 5IP7C 2R7ZC 3HOVK 1TWHC 4KMHA 3I4MK 3H0GK 3PO2C 4O2DA
chains in the Genus database with same CATH topology
5E68A 1J98A 4XCHA 1VH2A 1JQWA 1JVIA 1VJEA 1JOEA 1VGXA 1INNA 1IE0A 1J6VA 2FQTA 1J6XA 1YCLA 1J6WA 2FQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E68 A;  1J98 A;  4XCH A;  1VH2 A;  1JQW A;  1JVI A;  1VJE A;  1JOE A;  1VGX A;  1INN A;  1IE0 A;  1J6V A;  2FQT A;  1J6X A;  1YCL A;  1J6W A;  2FQO A; 
#chains in the Genus database with same CATH topology
 2W7V A;  4GT9 A;  3HOU K;  2PA8 D;  1J6V A;  1R9T C;  1JVI A;  2XCR B;  3AD8 C;  3IPJ A;  2PMZ D;  3S1Q C;  1AB4 A;  1IS1 A;  1KQ4 A;  2YU9 C;  3HOY K;  4FZB A;  4YFX A;  5IYB K;  3S1R C;  4Q5S A;  1IE0 A;  1IBA A;  1SFO A;  3TTG A;  1EH1 A;  1SFO K;  2CFA A;  1BDF A;  4A3M C;  4A93 C;  5TJ3 A;  4OIR A;  4BXX C;  3GTP C;  5D4D A;  4QJV A;  1I6H C;  2JA8 C;  1ISE A;  4MEY A;  2B63 K;  1TWF C;  3HXA A;  2VUM A;  2E2I C;  5IYC K;  2Y0S D;  2VUM K;  1RU0 A;  4GTB A;  4A3J C;  3AQP A;  4XSX A;  2R92 A;  2R92 K;  3RZO K;  1TWG A;  4KAW X;  4Y7N C;  5IP9 K;  4AH6 A;  3GTL A;  1TWG K;  4GTL A;  2R93 C;  1XZQ B;  3BP3 A;  2RGR A;  3GTL K;  2NVQ K;  1O2F B;  2NVY K;  1I3Q C;  1EK8 A;  1ZXO A;  4KB4 A;  1ZQ1 C;  3S2D K;  1PJ7 A;  3ADA C;  5M5W K;  4A3D K;  1K83 A;  4GTD A;  1K83 K;  3RZD K;  4AYB L;  3PO3 C;  4P5A A;  1DCH A;  1VJE A;  3EQL A;  1USM A;  4P9S A;  2CW0 A;  4J3N A;  3S2H K;  3HOX C;  3K7A C;  3S16 C;  3GTQ A;  4X6A C;  1O25 A;  2GSU A;  2PHC B;  3VA7 A;  4OIQ A;  4A3L C;  1O2A A;  2NVT K;  1ZYR A;  5IYD K;  1WCM A;  3S1M K;  1WOP A;  1WCM K;  1BGW A;  3S14 C;  4C2M C;  3FHZ A;  3L4J A;  3S15 K;  1INN A;  1F9N A;  2RH6 A;  4BY1 C;  4C3H C;  1Y1W C;  1C0A A;  4GFQ A;  4A3K K;  3MML B;  1IL2 A;  4MEX A;  3GTJ A;  3OPF A;  3S17 C;  4Y52 C;  1TWA A;  4JK1 A;  5C4X K;  1O2B A;  3ORE A;  3M3Y K;  3S1N C;  2ZUE A;  2ZFZ A;  3HOW C;  3I4N C;  1O29 A;  2JA7 C;  4BBS K;  4LQY A;  4QIW D;  4C3I K;  5FLM C;  3GTO A;  1BS2 A;  3T00 A;  1SMY A;  3GIR A;  4XCH A;  3GTO K;  3CQZ A;  4G0U A;  3CQZ K;  4WJ3 M;  1Y1V A;  1F7V A;  1IW7 A;  5E68 A;  1WIH A;  1Y1V K;  4KM8 A;  3HOV C;  2E2H A;  1VLO A;  3H0G C;  2GSO A;  2R7Z A;  1DD5 A;  3LAP A;  1TWH A;  3A8I A;  3N0C A;  5IP7 K;  3GEI A;  2R7Z K;  1I50 C;  5IOR A;  4Q4Z A;  1XZP B;  1R9T A;  1WOS A;  3SZY A;  1VH2 A;  3GTG C;  5C44 K;  4LK0 A;  3S1Q K;  3TFJ A;  4BBR C;  5IYB C;  3Q3Q A;  2A69 A;  3OEP A;  2XCQ A;  2GAG C;  2PA8 L;  4A3M K;  4RMF A;  4A93 K;  3M4O C;  4ILD A;  1WOO A;  3GTP A;  4BXX K;  2B63 C;  3A8K A;  3GTP K;  1I6H K;  2PMZ L;  1TWF A;  2VUM C;  4C45 A;  2E2I A;  2V6S A;  3G4C A;  2JA6 C;  1X31 C;  3RZO C;  2FQT A;  4PAA A;  1V5V A;  5IP9 C;  4LR2 A;  4MQ9 A;  1TWC C;  1TWG C;  1BJT A;  1WSR A;  4LJZ A;  3GTM C;  2R93 A;  4KMA A;  5CJ9 A;  3T02 A;  4A3E C;  4AYB D;  4G7H A;  4LK1 A;  2NVY C;  4BLB A;  5M5X K;  4A3C C;  1I3Q A;  2Y0S L;  2NVX A;  1I3Q K;  2NVX K;  4BY7 C;  5L46 A;  3FOF A;  3CAG A;  4KB2 A;  3RZD C;  1UV7 A;  1DCO A;  3GTQ K;  1YNN A;  3PO3 K;  4XSZ A;  1J6W A;  3AH5 A;  1WSV A;  3GTK A;  3HOZ C;  4GTE A;  3GTK K;  4PAB A;  3K7A K;  2CFA B;  4ZH4 A;  5IYD C;  5C4J K;  3S1M C;  5IOS A;  2JA5 C;  4A3L K;  3HKZ L;  2Y3P A;  1XXA A;  1EFW A;  4WIL A;  4KAS A;  4QJV B;  3S15 C;  3S14 K;  4C2M K;  3FKI C;  1O24 A;  2A68 A;  3GTJ K;  2JH3 A;  2O5J A;  2FQO A;  1EI6 A;  1Y1W A;  4YG2 A;  4A3K C;  3GDZ A;  1TWA K;  5EGE A;  3V4G A;  2V6U A;  5TMF A;  2O5I A;  1WOR A;  4A3I K;  1VGX A;  4C3J K;  5C4X C;  3ERE D;  4P5B A;  1YCL A;  3S17 K;  4KC6 A;  4Y52 K;  5C3E K;  3H3V D;  1O27 A;  2E2J K;  2D6F C;  5JVO A;  3HOW K;  4KN4 A;  3GEE A;  3A8J A;  3I4N K;  4KAT A;  4A3B K;  4BBS C;  4A3F K;  1IQ0 A;  1YNJ A;  1J98 A;  1XZQ A;  2GSN A;  3L4K A;  4C3I C;  3FOE A;  1F93 A;  3S0X A;  3CQZ C;  1JOE A;  2WB1 L;  3I4M C;  3N0B A;  2E2H K;  4A3G K;  1O28 A;  1Y1V C;  3HOU C;  1TWH K;  3DXJ A;  5IOQ A;  4OIN A;  3PO2 K;  1HQM A;  4KMU A;  2WAQ L;  4GTA A;  3H0G A;  1R9T K;  4KMD A;  4QIW L;  3GEH A;  3AD7 C;  1I50 A;  2YU9 A;  3HOY C;  1I50 K;  3SZZ A;  4BKW A;  2YU9 K;  1HI9 A;  1SFO C;  2XCO A;  5C44 C;  3S1R K;  3GTG A;  5HL8 A;  3TFI A;  4KM9 A;  3GTG K;  4BBR K;  5IYC C;  2JA8 K;  5M3F K;  1WQH A;  2BE5 A;  5IOT A;  1TWF K;  2E2I K;  3GSI A;  2R92 C;  4M1X A;  3JST A;  4DDQ A;  3M4O K;  4A3J K;  2B63 A;  5M3M K;  4WJ4 A;  1O26 A;  3GTL C;  1ZBS A;  4NOI A;  4Y7N K;  2NVQ C;  3LPX A;  2R93 K;  4GZY A;  2JA6 A;  2JA6 K;  1TWC A;  3S2D C;  4G7Z A;  3GTM A;  1TWC K;  4A3D C;  3GTM K;  4GTC A;  1J6X A;  3AD9 C;  4XLP A;  4A3E K;  1K83 C;  4BLA A;  2NVY A;  1WQF A;  2NVX C;  4A3C K;  2P5M A;  3AQO A;  4KN7 A;  4YFN A;  4OIO A;  4BY7 K;  5JFE A;  3S2H C;  3HKZ D;  3N3Y A;  1DCP A;  3GTQ C;  2V6T A;  3HOX K;  2NVT C;  3S16 K;  5TMC A;  4X6A K;  1B4A A;  1WCM C;  4YFK A;  3BP8 C;  2KWA A;  3GTK C;  2A6H A;  3HOZ K;  5C4J C;  1PJ6 A;  2JA5 A;  1XZP A;  1XPP A;  2JA5 K;  5M5Y K;  4OIP A;  3QX3 A;  4BY1 K;  4C3H K;  1Y1W K;  2EBB A;  1XXC A;  2ZUF A;  3FKI A;  3GTJ C;  4G7O A;  5CHP A;  1F7U A;  3FKI K;  1TWA C;  1YX2 A;  1VRQ C;  4LOW A;  3M3Y C;  1WQG A;  4A3I C;  4C3J C;  4XLN A;  3S1N K;  1PJ5 A;  5C3E C;  2JA7 A;  1ZVU A;  1I6V A;  2JA7 K;  5FJ8 K;  4LLG A;  2WB1 D;  3BUE A;  2E2J C;  4FM9 A;  2A6E A;  3TFH A;  1G51 A;  2P8T A;  3GTO C;  1L0W A;  1EQR A;  3LAJ A;  4A3B C;  2PPB A;  4G0V A;  4GTF A;  1USO A;  5FLM K;  4A3F C;  4KAR A;  2WAQ D;  4KDD A;  3NUH A;  1JQW A;  3T01 A;  3G4A A;  1GE9 A;  1B4B A;  5EGH A;  4G0W A;  3H3V L;  2GAH C;  1XXB A;  3WOD A;  2E2H C;  4A3G C;  5IP7 C;  2R7Z C;  3HOV K;  1TWH C;  4KMH A;  3I4M K;  3H0G K;  3PO2 C;  4O2D A; 
#chains in the Genus database with same CATH homology
 5E68 A;  1J98 A;  4XCH A;  1VH2 A;  1JQW A;  1JVI A;  1VJE A;  1JOE A;  1VGX A;  1INN A;  1IE0 A;  1J6V A;  2FQT A;  1J6X A;  1YCL A;  1J6W A;  2FQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...