1J6WA

Crystal structure of haemophilus influenzae luxs
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
161
structure length
161
Chain Sequence
b'LLDSFKVDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLFAGFMRDHLNGDSIEIIDISPMGCRTGFYMSLIGTPNEQKVSEAWLASMQDVLGVQDQASIPELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKNEDLSLDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Signaling protein
total genus 41
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j6wA00
1VJEA 4XCHA 5E68A 1YCLA 1J6XA 1JQWA 2FQOA 2FQTA 1JVIA 1JOEA 1IE0A 1J98A 1J6WA 1VH2A 1J6VA 1VGXA 1INNA
chains in the Genus database with same CATH superfamily
4G7ZA 5EGHA 1WQHA 3GTMK 2Y0SL 1C0AA 1JOEA 4RMFA 1ZQ1C 3DXJA 4C3HC 4C3JC 3HOYC 4FM9A 4P5AA 5IP7C 4YG2A 3GTPA 2P8TA 4A93K 1USMA 3GTJC 3A8JA 4BBRC 2NVTK 3S17K 3S1MC 1ZYRA 1I3QC 3N3YA 4A3LK 1YNNA 1O27A 3FHZA 1ISEA 1BJTA 2R7ZC 3HOXK 2V6SA 4YFXA 2XCOA 3ERED 4G7OA 4KMAA 3EQLA 4PABA 3GTGK 3GTKA 4LK1A 3AQPA 2GAGC 4YFKA 4A3JC 3T00A 4A3KK 1K83K 4A3MK 3BP8C 2A6EA 3GTMA 4BY7K 3SZZA 4KB2A 3HOVK 1DCPA 3GTOA 2ZUEA 1VRQC 4BLBA 2B63A 3Q3QA 1YNJA 3T01A 1XZQB 1IW7A 5IP9C 1X31C 5IOSA 5TJ3A 3PO3K 3GTPC 4A3BC 3K7AC 2A69A 4NOIA 3I4NK 3S1QK 5FLMC 4XCHA 3GTGA 3PO2C 4BXXC 4X6AK 3AQOA 5D4DA 4GTLA 3RZOC 4BKWA 3A8KA 1EQRA 1O2FB 2BE5A 4QIWD 3VA7A 1K83A 3CAGA 3FOEA 3S14C 3GTKC 2Y3PA 1HQMA 3G4CA 4KC6A 2CW0A 3S1RK 3GTMC 4QIWL 3HOWK 4XLNA 2JA6K 4LR2A 1YX2A 2VUMK 2R92K 4A93C 4MQ9A 2B63C 1I6VA 4AH6A 3L4KA 2RH6A 4A3GK 2NVTC 3S17C 4G0WA 1WORA 5M3FK 3GTPK 4A3LC 3HXAA 2ZUFA 5C4XK 2WB1D 2GAHC 3HOXC 4QJVB 1WSRA 3GTGC 2O5IA 5C4JK 1TWCK 1SMYA 2PHCB 4A3KC 1F7VA 2JA8K 5C3EK 1K83C 4A3MC 4KASA 4XSZA 5M5YK 3S16K 2WB1L 3S2HK 4BY7C 2JA6A 3HOVC 2VUMA 2R92A 2NVQK 2NVYK 4KDDA 3S1NK 5CJ9A 5M5XK 1BDFA 1WQFA 4GTEA 4AYBL 3GTOK 1WOOA 4J3NA 2CFAB 4MEYA 3PO3C 2B63K 1J6XA 3I4NC 3S1QC 1XXCA 3V4GA 3N0BA 1TWCA 1IS1A 2PA8D 4X6AC 3RZDK 1TWFK 3M4OK 3WODA 3AD9C 4PAAA 4A3DK 1VGXA 4GTDA 3FKIK 2JA7K 1AB4A 4LK0A 2P5MA 5IYDK 2NVXK 4BBSK 4Q5SA 2A68A 2PA8L 3S1RC 2YU9K 2E2JK 4GTCA 2NVYA 5IYBK 3HOWC 5IYCK 2JA6C 4A3CK 4DDQA 2VUMC 3AD8C 3H0GK 1BGWA 4P9SA 2R92C 4G0VA 1WOSA 3JSTA 3A8IA 1XZQA 4A3GC 1G51A 1TWFA 1PJ6A 4BLAA 1L0WA 2W7VA 5C4XC 1WQGA 1PJ5A 3IPJA 2FQOA 1XZPB 2JH3A 2XCRB 3FKIA 1Y1WK 2JA7A 5C4JC 1TWCC 3AH5A 3HOZK 2NVXA 2JA8C 2YU9A 4GTAA 2EBBA 5C3EC 2ZFZA 4KATA 3CQZK 4KB4A 4A3FK 3S16C 2GSUA 3L4JA 3S2HC 1WSVA 3AD7C 1V5VA 3M3YK 1TWHK 5IOQA 4P5BA 3H0GA 2E2IK 2R93K 3GTLA 2NVQC 3I4MK 4A3IK 2NVYC 3S1NC 1KQ4A 5IORA 2E2HA 3GIRA 3GTOC 5L46A 4WJ4A 3HKZD 4ZH4A 4KM9A 2A6HA 4OIPA 2RGRA 4A3EK 4BY1K 4GT9A 3OEPA 3S2DK 1Y1WA 3FOFA 4XLPA 3LPXA 1IQ0A 1WIHA 3GEEA 5JFEA 1TWFC 3RZDC 1F93A 4KM8A 1I50K 3M4OC 2WAQD 3CQZA 4QJVA 4LOWA 4A3DC 1J6WA 3GEIA 2V6UA 4KMHA 3FKIC 2JA7C 1VLOA 5IYDC 1TWHA 1RU0A 2NVXC 4BBSC 4YFNA 2YU9C 2E2IA 2E2JC 4C45A 2R93A 1R9TK 3BUEA 5IYBC 3OREA 1ZBSA 5IYCC 4A3CC 1IBAA 3H0GC 3GTLC 4Q4ZA 4XSXA 4KMUA 1ZXOA 1O26A 1TWAK 4WJ3M 5CHPA 3S0XA 4OIQA 1I50A 3OPFA 3TFJA 1B4BA 4C2MK 1O25A 4ILDA 5HL8A 4Y52K 1Y1WC 2JA5K 3HOZC 1O2BA 3TFIA 5TMFA 3BP3A 5C44K 1R9TA 1IL2A 1J6VA 3CQZC 1WCMK 4A3FC 2O5JA 3LAJA 4KARA 1UV7A 1O24A 2GSNA 4OIRA 3M3YC 1TWHC 2GSOA 3QX3A 3S15C 1HI9A 4Y7NK 4FZBA 2E2IC 1GE9A 2R93C 1ZVUA 1TWGK 3I4MC 4A3IC 2KWAA 3GTQK 1Y1VK 1TWAA 4MEXA 4C3IK 1SFOK 3GTLK 4G0UA 3LAPA 4LJZA 1JVIA 4A3EC 4BY1C 2E2HK 3S2DC 3T02A 5JVOA 2JA5A 4O2DA 3MMLB 3HOUK 1I50C 5E68A 1I6HK 1WCMA 1XXAA 1IE0A 1XZPA 1PJ7A 4WILA 1USOA 4OINA 3H3VD 1O2AA 2V6TA 4C3JK 2PMZD 4C3HK 4KAWX 1R9TC 3HOYK 1TWGA 4JK1A 3TTGA 5IP7K 1DCHA 5TMCA 1J98A 3GTQA 1Y1VA 3GTJK 3S15K 4BBRK 1F7UA 5M5WK 3S1MK 3G4AA 1XXBA 1SFOA 3GEHA 3H3VL 1VH2A 4KMDA 4KN4A 1INNA 1I3QK 5IOTA 2PMZL 1WOPA 4LQYA 2D6FC 2R7ZK 1B4AA 1TWAC 1VJEA 3NUHA 2XCQA 4OIOA 4C2MC 4A3JK 3N0CA 1YCLA 4Y52C 5M3MK 2PPBA 1O29A 4GTFA 2JA5C 1EI6A 1F9NA 2FQTA 3HKZL 5C44C 4GZYA 1WCMC 3TFHA 1EFWA 3GTJA 3GSIA 3GDZA 1O28A 3ADAC 4Y7NC 1JQWA 5IP9K 1I3QA 1TWGC 4A3BK 2WAQL 3SZYA 2R7ZA 3GTQC 3K7AK 1Y1VC 1XPPA 5FLMK 4C3IC 3PO2K 4BXXK 1EH1A 1SFOC 4GTBA 3RZOK 1EK8A 1BS2A 4GFQA 2Y0SD 4LLGA 2E2HC 1DCOA 3S14K 5EGEA 5FJ8K 4G7HA 4M1XA 2CFAA 3GTKK 4AYBD 3HOUC 1I6HC 4KN7A 1DD5A
chains in the Genus database with same CATH topology
1VJEA 4XCHA 5E68A 1YCLA 1J6XA 1JQWA 2FQOA 2FQTA 1JVIA 1JOEA 1IE0A 1J98A 1J6WA 1VH2A 1J6VA 1VGXA 1INNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJE A;  4XCH A;  5E68 A;  1YCL A;  1J6X A;  1JQW A;  2FQO A;  2FQT A;  1JVI A;  1JOE A;  1IE0 A;  1J98 A;  1J6W A;  1VH2 A;  1J6V A;  1VGX A;  1INN A; 
#chains in the Genus database with same CATH topology
 4G7Z A;  5EGH A;  1WQH A;  3GTM K;  2Y0S L;  1C0A A;  1JOE A;  4RMF A;  1ZQ1 C;  3DXJ A;  4C3H C;  4C3J C;  3HOY C;  4FM9 A;  4P5A A;  5IP7 C;  4YG2 A;  3GTP A;  2P8T A;  4A93 K;  1USM A;  3GTJ C;  3A8J A;  4BBR C;  2NVT K;  3S17 K;  3S1M C;  1ZYR A;  1I3Q C;  3N3Y A;  4A3L K;  1YNN A;  1O27 A;  3FHZ A;  1ISE A;  1BJT A;  2R7Z C;  3HOX K;  2V6S A;  4YFX A;  2XCO A;  3ERE D;  4G7O A;  4KMA A;  3EQL A;  4PAB A;  3GTG K;  3GTK A;  4LK1 A;  3AQP A;  2GAG C;  4YFK A;  4A3J C;  3T00 A;  4A3K K;  1K83 K;  4A3M K;  3BP8 C;  2A6E A;  3GTM A;  4BY7 K;  3SZZ A;  4KB2 A;  3HOV K;  1DCP A;  3GTO A;  2ZUE A;  1VRQ C;  4BLB A;  2B63 A;  3Q3Q A;  1YNJ A;  3T01 A;  1XZQ B;  1IW7 A;  5IP9 C;  1X31 C;  5IOS A;  5TJ3 A;  3PO3 K;  3GTP C;  4A3B C;  3K7A C;  2A69 A;  4NOI A;  3I4N K;  3S1Q K;  5FLM C;  4XCH A;  3GTG A;  3PO2 C;  4BXX C;  4X6A K;  3AQO A;  5D4D A;  4GTL A;  3RZO C;  4BKW A;  3A8K A;  1EQR A;  1O2F B;  2BE5 A;  4QIW D;  3VA7 A;  1K83 A;  3CAG A;  3FOE A;  3S14 C;  3GTK C;  2Y3P A;  1HQM A;  3G4C A;  4KC6 A;  2CW0 A;  3S1R K;  3GTM C;  4QIW L;  3HOW K;  4XLN A;  2JA6 K;  4LR2 A;  1YX2 A;  2VUM K;  2R92 K;  4A93 C;  4MQ9 A;  2B63 C;  1I6V A;  4AH6 A;  3L4K A;  2RH6 A;  4A3G K;  2NVT C;  3S17 C;  4G0W A;  1WOR A;  5M3F K;  3GTP K;  4A3L C;  3HXA A;  2ZUF A;  5C4X K;  2WB1 D;  2GAH C;  3HOX C;  4QJV B;  1WSR A;  3GTG C;  2O5I A;  5C4J K;  1TWC K;  1SMY A;  2PHC B;  4A3K C;  1F7V A;  2JA8 K;  5C3E K;  1K83 C;  4A3M C;  4KAS A;  4XSZ A;  5M5Y K;  3S16 K;  2WB1 L;  3S2H K;  4BY7 C;  2JA6 A;  3HOV C;  2VUM A;  2R92 A;  2NVQ K;  2NVY K;  4KDD A;  3S1N K;  5CJ9 A;  5M5X K;  1BDF A;  1WQF A;  4GTE A;  4AYB L;  3GTO K;  1WOO A;  4J3N A;  2CFA B;  4MEY A;  3PO3 C;  2B63 K;  1J6X A;  3I4N C;  3S1Q C;  1XXC A;  3V4G A;  3N0B A;  1TWC A;  1IS1 A;  2PA8 D;  4X6A C;  3RZD K;  1TWF K;  3M4O K;  3WOD A;  3AD9 C;  4PAA A;  4A3D K;  1VGX A;  4GTD A;  3FKI K;  2JA7 K;  1AB4 A;  4LK0 A;  2P5M A;  5IYD K;  2NVX K;  4BBS K;  4Q5S A;  2A68 A;  2PA8 L;  3S1R C;  2YU9 K;  2E2J K;  4GTC A;  2NVY A;  5IYB K;  3HOW C;  5IYC K;  2JA6 C;  4A3C K;  4DDQ A;  2VUM C;  3AD8 C;  3H0G K;  1BGW A;  4P9S A;  2R92 C;  4G0V A;  1WOS A;  3JST A;  3A8I A;  1XZQ A;  4A3G C;  1G51 A;  1TWF A;  1PJ6 A;  4BLA A;  1L0W A;  2W7V A;  5C4X C;  1WQG A;  1PJ5 A;  3IPJ A;  2FQO A;  1XZP B;  2JH3 A;  2XCR B;  3FKI A;  1Y1W K;  2JA7 A;  5C4J C;  1TWC C;  3AH5 A;  3HOZ K;  2NVX A;  2JA8 C;  2YU9 A;  4GTA A;  2EBB A;  5C3E C;  2ZFZ A;  4KAT A;  3CQZ K;  4KB4 A;  4A3F K;  3S16 C;  2GSU A;  3L4J A;  3S2H C;  1WSV A;  3AD7 C;  1V5V A;  3M3Y K;  1TWH K;  5IOQ A;  4P5B A;  3H0G A;  2E2I K;  2R93 K;  3GTL A;  2NVQ C;  3I4M K;  4A3I K;  2NVY C;  3S1N C;  1KQ4 A;  5IOR A;  2E2H A;  3GIR A;  3GTO C;  5L46 A;  4WJ4 A;  3HKZ D;  4ZH4 A;  4KM9 A;  2A6H A;  4OIP A;  2RGR A;  4A3E K;  4BY1 K;  4GT9 A;  3OEP A;  3S2D K;  1Y1W A;  3FOF A;  4XLP A;  3LPX A;  1IQ0 A;  1WIH A;  3GEE A;  5JFE A;  1TWF C;  3RZD C;  1F93 A;  4KM8 A;  1I50 K;  3M4O C;  2WAQ D;  3CQZ A;  4QJV A;  4LOW A;  4A3D C;  1J6W A;  3GEI A;  2V6U A;  4KMH A;  3FKI C;  2JA7 C;  1VLO A;  5IYD C;  1TWH A;  1RU0 A;  2NVX C;  4BBS C;  4YFN A;  2YU9 C;  2E2I A;  2E2J C;  4C45 A;  2R93 A;  1R9T K;  3BUE A;  5IYB C;  3ORE A;  1ZBS A;  5IYC C;  4A3C C;  1IBA A;  3H0G C;  3GTL C;  4Q4Z A;  4XSX A;  4KMU A;  1ZXO A;  1O26 A;  1TWA K;  4WJ3 M;  5CHP A;  3S0X A;  4OIQ A;  1I50 A;  3OPF A;  3TFJ A;  1B4B A;  4C2M K;  1O25 A;  4ILD A;  5HL8 A;  4Y52 K;  1Y1W C;  2JA5 K;  3HOZ C;  1O2B A;  3TFI A;  5TMF A;  3BP3 A;  5C44 K;  1R9T A;  1IL2 A;  1J6V A;  3CQZ C;  1WCM K;  4A3F C;  2O5J A;  3LAJ A;  4KAR A;  1UV7 A;  1O24 A;  2GSN A;  4OIR A;  3M3Y C;  1TWH C;  2GSO A;  3QX3 A;  3S15 C;  1HI9 A;  4Y7N K;  4FZB A;  2E2I C;  1GE9 A;  2R93 C;  1ZVU A;  1TWG K;  3I4M C;  4A3I C;  2KWA A;  3GTQ K;  1Y1V K;  1TWA A;  4MEX A;  4C3I K;  1SFO K;  3GTL K;  4G0U A;  3LAP A;  4LJZ A;  1JVI A;  4A3E C;  4BY1 C;  2E2H K;  3S2D C;  3T02 A;  5JVO A;  2JA5 A;  4O2D A;  3MML B;  3HOU K;  1I50 C;  5E68 A;  1I6H K;  1WCM A;  1XXA A;  1IE0 A;  1XZP A;  1PJ7 A;  4WIL A;  1USO A;  4OIN A;  3H3V D;  1O2A A;  2V6T A;  4C3J K;  2PMZ D;  4C3H K;  4KAW X;  1R9T C;  3HOY K;  1TWG A;  4JK1 A;  3TTG A;  5IP7 K;  1DCH A;  5TMC A;  1J98 A;  3GTQ A;  1Y1V A;  3GTJ K;  3S15 K;  4BBR K;  1F7U A;  5M5W K;  3S1M K;  3G4A A;  1XXB A;  1SFO A;  3GEH A;  3H3V L;  1VH2 A;  4KMD A;  4KN4 A;  1INN A;  1I3Q K;  5IOT A;  2PMZ L;  1WOP A;  4LQY A;  2D6F C;  2R7Z K;  1B4A A;  1TWA C;  1VJE A;  3NUH A;  2XCQ A;  4OIO A;  4C2M C;  4A3J K;  3N0C A;  1YCL A;  4Y52 C;  5M3M K;  2PPB A;  1O29 A;  4GTF A;  2JA5 C;  1EI6 A;  1F9N A;  2FQT A;  3HKZ L;  5C44 C;  4GZY A;  1WCM C;  3TFH A;  1EFW A;  3GTJ A;  3GSI A;  3GDZ A;  1O28 A;  3ADA C;  4Y7N C;  1JQW A;  5IP9 K;  1I3Q A;  1TWG C;  4A3B K;  2WAQ L;  3SZY A;  2R7Z A;  3GTQ C;  3K7A K;  1Y1V C;  1XPP A;  5FLM K;  4C3I C;  3PO2 K;  4BXX K;  1EH1 A;  1SFO C;  4GTB A;  3RZO K;  1EK8 A;  1BS2 A;  4GFQ A;  2Y0S D;  4LLG A;  2E2H C;  1DCO A;  3S14 K;  5EGE A;  5FJ8 K;  4G7H A;  4M1X A;  2CFA A;  3GTK K;  4AYB D;  3HOU C;  1I6H C;  4KN7 A;  1DD5 A; 
#chains in the Genus database with same CATH homology
 1VJE A;  4XCH A;  5E68 A;  1YCL A;  1J6X A;  1JQW A;  2FQO A;  2FQT A;  1JVI A;  1JOE A;  1IE0 A;  1J98 A;  1J6W A;  1VH2 A;  1J6V A;  1VGX A;  1INN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...