1J6WA

Crystal structure of haemophilus influenzae luxs
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
161
structure length
161
Chain Sequence
LLDSFKVDHTKMNAPAVRIAKTMLTPKGDNITVFDLRFCIPNKEILSPKGIHTLEHLFAGFMRDHLNGDSIEIIDISPMGCRTGFYMSLIGTPNEQKVSEAWLASMQDVLGVQDQASIPELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKNEDLSLDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Signaling protein
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
total genus 41
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j6wA00
1J98A 4XCHA 1VGXA 1YCLA 2FQTA 1J6XA 1J6WA 1JOEA 5E68A 1J6VA 1VH2A 1JVIA 1INNA 2FQOA 1JQWA 1IE0A 1VJEA
chains in the Genus database with same CATH superfamily
2YU9A 3PO3C 3BUEA 3S1RK 3GTLA 4QJVB 4QIWD 3CQZA 1HQMA 3AH5A 4A3MK 4G0VA 4AYBL 1O24A 1IBAA 4BBSC 1O27A 3LAPA 2ZUFA 1EQRA 2A68A 3FKIC 3OPFA 3HOYK 5D4DA 1VLOA 1R9TA 5M5XK 2XCRB 2VUMK 1B4BA 2JA8K 3AQOA 4KAWX 3DXJA 4Y52K 5L46A 4KB2A 1J6WA 3JSTA 5E68A 1X31C 3AD9C 1YCLA 1ZBSA 1DD5A 1Y1VC 3L4KA 5IOTA 2GAHC 4A3IC 4BY1C 4C3IK 1EI6A 3VA7A 4A3LK 1TWAK 4GT9A 4LLGA 4YFKA 5C44K 4KASA 1O28A 1G51A 4GTLA 3S2DK 1WORA 4BXXK 3I4NC 2R93K 2VUMA 1IQ0A 3GTMK 2E2JK 2R92C 3LPXA 1IS1A 4A3LC 1JOEA 5C3EK 2PMZD 1XZQA 2A6HA 2JA7C 4YG2A 5IP9K 3FKIA 4A3JK 4G7OA 4GTBA 3M4OC 4O2DA 1XXAA 1I3QC 3I4MC 3GTGC 4Y52C 5IYDC 1XXBA 4M1XA 3T01A 4PABA 2GSNA 2GAGC 3S1MC 4X6AC 5C4XC 4RMFA 1F7UA 1K83A 1I6HK 1O29A 1IE0A 3WODA 1VJEA 4A93C 2XCQA 3FOFA 3L4JA 1EK8A 4KATA 1O26A 3M3YC 3HKZD 3S1NC 5IYCC 5IYBC 4MEXA 1O2AA 4A3EK 1J6XA 3H0GK 4XSXA 3G4AA 3GEHA 4A3GC 5TJ3A 1BDFA 1I6VA 2Y0SL 4Y7NK 2R92A 2R7ZA 4ZH4A 1VH2A 2BE5A 2V6TA 4LJZA 2Y0SD 5FLMK 1Y1WK 3GTPK 4PAAA 4A3DC 4OIPA 1C0AA 3A8IA 2NVXA 3GTOK 3V4GA 2JH3A 1YX2A 5C44C 2JA5C 4XCHA 3GTMC 1I6HC 4MQ9A 2E2HC 3S2HK 4KB4A 2NVQC 3GTQC 2NVYC 5IOQA 2PHCB 1UV7A 2WB1L 1O25A 1I50C 3GTJA 1USMA 1WQHA 4C2MK 2O5IA 1SFOA 2NVXK 5M5YK 2W7VA 4KC6A 3GTLK 2WB1D 3RZOC 3SZZA 2P5MA 4LK1A 4ILDA 4Q5SA 5CHPA 4A3KK 4FM9A 3PO2C 1V5VA 2B63A 4A3CK 5TMCA 1F9NA 1VRQC 4G7ZA 3CQZC 5TMFA 3S1NK 3H0GA 1ZVUA 4Q4ZA 5C4JK 4GTDA 4A3EC 3GIRA 4GTAA 4BY1K 4WILA 2RH6A 4XLPA 3ADAC 4OIQA 1R9TC 1GE9A 5IYDK 4A3BC 4FZBA 1EH1A 1WCMC 3I4MK 4C3JK 2CFAA 4KN7A 3S15K 1RU0A 1DCPA 3A8KA 2PPBA 4LR2A 4BLAA 4BBRK 1WIHA 3RZOK 3GTKA 4BLBA 1F7VA 3BP3A 5IYCK 3M4OK 2JA5K 3TFIA 3N0CA 4A3MC 4P9SA 3OEPA 4C45A 4KDDA 4OINA 3FOEA 1ISEA 1AB4A 3AD7C 3S16K 1J6VA 1TWAA 3HOXK 3ERED 2WAQL 3G4CA 3HOUK 2R93C 3S17K 4YFXA 4KN4A 1TWHA 1J98A 2KWAA 4C3HK 1O2FB 2ZUEA 2R7ZK 1B4AA 4WJ4A 5EGHA 1HI9A 2CFAB 4J3NA 1PJ5A 4AYBD 1K83C 4WJ3M 1EFWA 2NVYK 1DCHA 4GTCA 2O5JA 1TWCK 2YU9C 5FJ8K 3PO3K 4A93K 1YNNA 2PA8L 3GEIA 4AH6A 4OIOA 1WOOA 2E2JC 1WSRA 4BKWA 3GTOC 4QIWL 4KMAA 1JVIA 2JA6C 3S16C 3CAGA 3S15C 2PA8D 3K7AK 3S0XA 3GTGK 3S1QK 1TWAC 4C3IC 1SFOK 3HOUC 2RGRA 5C4XK 4X6AK 2NVXC 3GTJC 4BY7K 5EGEA 4OIRA 1PJ6A 3TFJA 4KMUA 1Y1VA 4A3BK 3Q3QA 4A3DK 5M5WK 2NVTC 3HOZK 1ZYRA 2PMZL 2B63C 1TWCC 2YU9K 4QJVA 2ZFZA 5C4JC 2JA7A 1VGXA 3S2HC 2FQTA 1I3QK 1ZXOA 1INNA 1IW7A 1WSVA 3FKIK 2D6FC 4P5AA 4C2MC 4MEYA 2R92K 1I50K 4GTEA 2A69A 4KMDA 1R9TK 1TWGC 3RZDK 3BP8C 3HXAA 4BBRC 3GTGA 3GDZA 3H0GC 3PO2K 1USOA 4GFQA 3LAJA 1L0WA 3CQZK 3QX3A 2FQOA 2V6UA 4NOIA 4BXXC 3GTKK 4G0WA 3HOVK 2EBBA 2E2IK 1PJ7A 5IP7C 1TWCA 4A3KC 1DCOA 5IORA 3HKZL 1BGWA 1WCMK 1Y1VK 1O2BA 2XCOA 3S1RC 4C3JC 3FHZA 2JA5A 4XLNA 4A3FC 3TFHA 1WQFA 3GEEA 3HOWK 4Y7NC 2R93A 1WOSA 2JA6K 2E2IA 4DDQA 3HOYC 2GSUA 4KM8A 3S1MK 5IOSA 2GSOA 1XZQB 1TWHK 3H3VD 3GSIA 2E2HA 3HOWC 3GTQA 2A6EA 3M3YK 1YNJA 3T02A 3HOXC 1TWHC 4YFNA 4A3CC 3H3VL 3S14C 4LOWA 3T00A 4A3IK 4A3GK 3GTOA 2JA8C 3I4NK 1I3QA 2VUMC 2Y3PA 4A3FK 4KMHA 2B63K 1TWFC 3EQLA 1XXCA 5C3EC 3OREA 1XZPA 3N0BA 2E2IC 4LQYA 5IP9C 5M3MK 1WQGA 5M3FK 3GTPA 1Y1WA 3NUHA 5HL8A 3AQPA 4G7HA 3S17C 3GTJK 4BY7C 2JA6A 3MMLB 4KM9A 5IP7K 4GZYA 1TWGK 3RZDC 5JFEA 2NVTK 4P5BA 3K7AC 1WCMA 2R7ZC 1JQWA 3A8JA 4KARA 4G0UA 1KQ4A 2V6SA 3GTLC 3TTGA 3GTKC 3SZYA 1WOPA 2NVQK 3GTQK 4A3JC 1BS2A 5IYBK 1TWFK 1XPPA 1SMYA 1TWFA 2WAQD 4BBSK 4XSZA 1F93A 5JVOA 1BJTA 4JK1A 3IPJA 2NVYA 1XZPB 3AD8C 3HOZC 3S14K 5FLMC 1Y1WC 3GTPC 3S2DC 4C3HC 3S1QC 1I50A 4LK0A 3HOVC 4GTFA 2CW0A 1SFOC 3N3YA 5CJ9A 3GTMA 1K83K 2P8TA 1IL2A 2E2HK 1TWGA 2JA7K 1ZQ1C
chains in the Genus database with same CATH topology
1J98A 4XCHA 1VGXA 1YCLA 2FQTA 1J6XA 1J6WA 1JOEA 5E68A 1J6VA 1VH2A 1JVIA 1INNA 2FQOA 1JQWA 1IE0A 1VJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J98 A;  4XCH A;  1VGX A;  1YCL A;  2FQT A;  1J6X A;  1J6W A;  1JOE A;  5E68 A;  1J6V A;  1VH2 A;  1JVI A;  1INN A;  2FQO A;  1JQW A;  1IE0 A;  1VJE A; 
#chains in the Genus database with same CATH topology
 2YU9 A;  3PO3 C;  3BUE A;  3S1R K;  3GTL A;  4QJV B;  4QIW D;  3CQZ A;  1HQM A;  3AH5 A;  4A3M K;  4G0V A;  4AYB L;  1O24 A;  1IBA A;  4BBS C;  1O27 A;  3LAP A;  2ZUF A;  1EQR A;  2A68 A;  3FKI C;  3OPF A;  3HOY K;  5D4D A;  1VLO A;  1R9T A;  5M5X K;  2XCR B;  2VUM K;  1B4B A;  2JA8 K;  3AQO A;  4KAW X;  3DXJ A;  4Y52 K;  5L46 A;  4KB2 A;  1J6W A;  3JST A;  5E68 A;  1X31 C;  3AD9 C;  1YCL A;  1ZBS A;  1DD5 A;  1Y1V C;  3L4K A;  5IOT A;  2GAH C;  4A3I C;  4BY1 C;  4C3I K;  1EI6 A;  3VA7 A;  4A3L K;  1TWA K;  4GT9 A;  4LLG A;  4YFK A;  5C44 K;  4KAS A;  1O28 A;  1G51 A;  4GTL A;  3S2D K;  1WOR A;  4BXX K;  3I4N C;  2R93 K;  2VUM A;  1IQ0 A;  3GTM K;  2E2J K;  2R92 C;  3LPX A;  1IS1 A;  4A3L C;  1JOE A;  5C3E K;  2PMZ D;  1XZQ A;  2A6H A;  2JA7 C;  4YG2 A;  5IP9 K;  3FKI A;  4A3J K;  4G7O A;  4GTB A;  3M4O C;  4O2D A;  1XXA A;  1I3Q C;  3I4M C;  3GTG C;  4Y52 C;  5IYD C;  1XXB A;  4M1X A;  3T01 A;  4PAB A;  2GSN A;  2GAG C;  3S1M C;  4X6A C;  5C4X C;  4RMF A;  1F7U A;  1K83 A;  1I6H K;  1O29 A;  1IE0 A;  3WOD A;  1VJE A;  4A93 C;  2XCQ A;  3FOF A;  3L4J A;  1EK8 A;  4KAT A;  1O26 A;  3M3Y C;  3HKZ D;  3S1N C;  5IYC C;  5IYB C;  4MEX A;  1O2A A;  4A3E K;  1J6X A;  3H0G K;  4XSX A;  3G4A A;  3GEH A;  4A3G C;  5TJ3 A;  1BDF A;  1I6V A;  2Y0S L;  4Y7N K;  2R92 A;  2R7Z A;  4ZH4 A;  1VH2 A;  2BE5 A;  2V6T A;  4LJZ A;  2Y0S D;  5FLM K;  1Y1W K;  3GTP K;  4PAA A;  4A3D C;  4OIP A;  1C0A A;  3A8I A;  2NVX A;  3GTO K;  3V4G A;  2JH3 A;  1YX2 A;  5C44 C;  2JA5 C;  4XCH A;  3GTM C;  1I6H C;  4MQ9 A;  2E2H C;  3S2H K;  4KB4 A;  2NVQ C;  3GTQ C;  2NVY C;  5IOQ A;  2PHC B;  1UV7 A;  2WB1 L;  1O25 A;  1I50 C;  3GTJ A;  1USM A;  1WQH A;  4C2M K;  2O5I A;  1SFO A;  2NVX K;  5M5Y K;  2W7V A;  4KC6 A;  3GTL K;  2WB1 D;  3RZO C;  3SZZ A;  2P5M A;  4LK1 A;  4ILD A;  4Q5S A;  5CHP A;  4A3K K;  4FM9 A;  3PO2 C;  1V5V A;  2B63 A;  4A3C K;  5TMC A;  1F9N A;  1VRQ C;  4G7Z A;  3CQZ C;  5TMF A;  3S1N K;  3H0G A;  1ZVU A;  4Q4Z A;  5C4J K;  4GTD A;  4A3E C;  3GIR A;  4GTA A;  4BY1 K;  4WIL A;  2RH6 A;  4XLP A;  3ADA C;  4OIQ A;  1R9T C;  1GE9 A;  5IYD K;  4A3B C;  4FZB A;  1EH1 A;  1WCM C;  3I4M K;  4C3J K;  2CFA A;  4KN7 A;  3S15 K;  1RU0 A;  1DCP A;  3A8K A;  2PPB A;  4LR2 A;  4BLA A;  4BBR K;  1WIH A;  3RZO K;  3GTK A;  4BLB A;  1F7V A;  3BP3 A;  5IYC K;  3M4O K;  2JA5 K;  3TFI A;  3N0C A;  4A3M C;  4P9S A;  3OEP A;  4C45 A;  4KDD A;  4OIN A;  3FOE A;  1ISE A;  1AB4 A;  3AD7 C;  3S16 K;  1J6V A;  1TWA A;  3HOX K;  3ERE D;  2WAQ L;  3G4C A;  3HOU K;  2R93 C;  3S17 K;  4YFX A;  4KN4 A;  1TWH A;  1J98 A;  2KWA A;  4C3H K;  1O2F B;  2ZUE A;  2R7Z K;  1B4A A;  4WJ4 A;  5EGH A;  1HI9 A;  2CFA B;  4J3N A;  1PJ5 A;  4AYB D;  1K83 C;  4WJ3 M;  1EFW A;  2NVY K;  1DCH A;  4GTC A;  2O5J A;  1TWC K;  2YU9 C;  5FJ8 K;  3PO3 K;  4A93 K;  1YNN A;  2PA8 L;  3GEI A;  4AH6 A;  4OIO A;  1WOO A;  2E2J C;  1WSR A;  4BKW A;  3GTO C;  4QIW L;  4KMA A;  1JVI A;  2JA6 C;  3S16 C;  3CAG A;  3S15 C;  2PA8 D;  3K7A K;  3S0X A;  3GTG K;  3S1Q K;  1TWA C;  4C3I C;  1SFO K;  3HOU C;  2RGR A;  5C4X K;  4X6A K;  2NVX C;  3GTJ C;  4BY7 K;  5EGE A;  4OIR A;  1PJ6 A;  3TFJ A;  4KMU A;  1Y1V A;  4A3B K;  3Q3Q A;  4A3D K;  5M5W K;  2NVT C;  3HOZ K;  1ZYR A;  2PMZ L;  2B63 C;  1TWC C;  2YU9 K;  4QJV A;  2ZFZ A;  5C4J C;  2JA7 A;  1VGX A;  3S2H C;  2FQT A;  1I3Q K;  1ZXO A;  1INN A;  1IW7 A;  1WSV A;  3FKI K;  2D6F C;  4P5A A;  4C2M C;  4MEY A;  2R92 K;  1I50 K;  4GTE A;  2A69 A;  4KMD A;  1R9T K;  1TWG C;  3RZD K;  3BP8 C;  3HXA A;  4BBR C;  3GTG A;  3GDZ A;  3H0G C;  3PO2 K;  1USO A;  4GFQ A;  3LAJ A;  1L0W A;  3CQZ K;  3QX3 A;  2FQO A;  2V6U A;  4NOI A;  4BXX C;  3GTK K;  4G0W A;  3HOV K;  2EBB A;  2E2I K;  1PJ7 A;  5IP7 C;  1TWC A;  4A3K C;  1DCO A;  5IOR A;  3HKZ L;  1BGW A;  1WCM K;  1Y1V K;  1O2B A;  2XCO A;  3S1R C;  4C3J C;  3FHZ A;  2JA5 A;  4XLN A;  4A3F C;  3TFH A;  1WQF A;  3GEE A;  3HOW K;  4Y7N C;  2R93 A;  1WOS A;  2JA6 K;  2E2I A;  4DDQ A;  3HOY C;  2GSU A;  4KM8 A;  3S1M K;  5IOS A;  2GSO A;  1XZQ B;  1TWH K;  3H3V D;  3GSI A;  2E2H A;  3HOW C;  3GTQ A;  2A6E A;  3M3Y K;  1YNJ A;  3T02 A;  3HOX C;  1TWH C;  4YFN A;  4A3C C;  3H3V L;  3S14 C;  4LOW A;  3T00 A;  4A3I K;  4A3G K;  3GTO A;  2JA8 C;  3I4N K;  1I3Q A;  2VUM C;  2Y3P A;  4A3F K;  4KMH A;  2B63 K;  1TWF C;  3EQL A;  1XXC A;  5C3E C;  3ORE A;  1XZP A;  3N0B A;  2E2I C;  4LQY A;  5IP9 C;  5M3M K;  1WQG A;  5M3F K;  3GTP A;  1Y1W A;  3NUH A;  5HL8 A;  3AQP A;  4G7H A;  3S17 C;  3GTJ K;  4BY7 C;  2JA6 A;  3MML B;  4KM9 A;  5IP7 K;  4GZY A;  1TWG K;  3RZD C;  5JFE A;  2NVT K;  4P5B A;  3K7A C;  1WCM A;  2R7Z C;  1JQW A;  3A8J A;  4KAR A;  4G0U A;  1KQ4 A;  2V6S A;  3GTL C;  3TTG A;  3GTK C;  3SZY A;  1WOP A;  2NVQ K;  3GTQ K;  4A3J C;  1BS2 A;  5IYB K;  1TWF K;  1XPP A;  1SMY A;  1TWF A;  2WAQ D;  4BBS K;  4XSZ A;  1F93 A;  5JVO A;  1BJT A;  4JK1 A;  3IPJ A;  2NVY A;  1XZP B;  3AD8 C;  3HOZ C;  3S14 K;  5FLM C;  1Y1W C;  3GTP C;  3S2D C;  4C3H C;  3S1Q C;  1I50 A;  4LK0 A;  3HOV C;  4GTF A;  2CW0 A;  1SFO C;  3N3Y A;  5CJ9 A;  3GTM A;  1K83 K;  2P8T A;  1IL2 A;  2E2H K;  1TWG A;  2JA7 K;  1ZQ1 C; 
#chains in the Genus database with same CATH homology
 1J98 A;  4XCH A;  1VGX A;  1YCL A;  2FQT A;  1J6X A;  1J6W A;  1JOE A;  5E68 A;  1J6V A;  1VH2 A;  1JVI A;  1INN A;  2FQO A;  1JQW A;  1IE0 A;  1VJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...