1J78A

Crystallographic analysis of the human vitamin d binding protein
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
433
Chain Sequence
CKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCYDTRTSALSAKSCESNSPFPVHPGTAECCTKRKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for the unique binding features of the human vitamin D-binding protein.
pubmed doi rcsb
molecule keywords vitamin D binding protein
molecule tags Transport, ligand binding protein
total genus 161
structure length 433
sequence length 445
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00273 Serum_albumin Serum albumin family
A PF09164 VitD-bind_III Vitamin D binding protein, domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1j78A02
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1j78A03
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1j78A01
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1j78A04
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1j78A05
2BXLA 4K71A 1E7EA 5DQFA 1N5UA 3CX9A 4L9KA 4Z69A 4E99A 5IFOA 4EMXA 1HK3A 4N0UD 5FUOA 2XVVA 4F5VA 1E7CA 2VDBA 2BXCA 4G03A 1O9XA 2BXGA 2BXFA 3LU8A 1BJ5A 1E7AA 4ZBRA 3JRYA 2XW1A 5IJ5A 1E7FA 4IW2A 1E7HA 3V09A 5IIXA 1UORA 2I2ZA 4OR0A 2BXNA 5IIHA 4BKEA 1H9ZA 4F5SA 1J7EA 1HK1A 4F5UA 2XVUA 2XSIA 4IW1A 4LUHA 4N0FD 5ID7A 3B9MA 2BXBA 1KXPD 1HK2A 3V03A 5IIUA 3V08A 5IJEA 1E78A 2BXPA 2XVWA 2BXIA 2XW0A 2I30A 5HOZA 5DBYA 1MA9A 5ID9A 4LB2A 3JQZA 4PO0A 4G04A 1LOTA 1AO6A 3B9LA 4HGKA 2BXAA 2VUEA 2BXKA 1GNJA 4HGMB 3SQJA 4LB9A 3UIVA 1E7BA 2BXEA 2XVQA 2BX8A 1BM0A 2BXDA 2BXMA 3TDLA 3A73A 4LA0A 1HA2A 2YDFA 4K2CA 4LUFA 4S1YA 4L8UA 1HK4A 1KW2A 1E7IA 1GNIA 1E7GA 2BXHA 3LU6A 3LU7A 4F5TA 4JK4A 4L9QA 5GHKA 2BXOA 4J2VA 1HK5A 1BKEA 1J78A 4OT2A 4ZBQA 2VUFA 5IJFA 1TF0A 2BXQA
chains in the Genus database with same CATH superfamily
2BXLA 4K71A 1E7EA 1KDXA 5DQFA 1JNBA 2Z8IA 1N5UA 3CX9A 3GA9L 3WHRA 2JUHA 4L9KA 1FOUA 3M99C 3WHSA 4Z69A 4E99A 4DM0A 5IFOA 4EMXA 1HK3A 4N0UD 5FUOA 2LXTA 2XVVA 1VZSA 2EFEA 3VQIA 1MUHA 1LNSA 3NVIA 4F5VA 1E7CA 3MHHB 2DYOA 2BXCA 2E0XA 2VDBA 3FNMA 4G03A 1O9XA 3NMUA 2BXGA 4NAWB 4Z9OA 2BXFA 4ZBKA 3LU8A 1BJ5A 1E7AA 4FK5B 4I9OA 4ZBRA 3JRYA 2XW1A 5IJ5A 1E7FA 4IW2A 2EFHA 1E7HA 3V09A 5IIXA 2XMOA 1UORA 1H5WA 2I2ZA 2E0YA 1MIYA 5GIOA 4OR0A 2BXNA 5IIHA 4BKEA 1MM8A 1NT2B 1H9ZA 4F5SA 1J7EA 1HK1A 4F5UA 2XVUA 2XSIA 4IW1A 4LUHA 4N0FD 5ID7A 3B9MA 2BXBA 2LQHA 4ZUXV 1KXPD 4FIPB 2OT3A 1HK2A 3SIVB 2Z8JA 3V03A 5GIPA 5D7GA 5IIUA 3SIUB 3V08A 4C31B 5IJEA 3KIKA 1E78A 2BXPA 2XVWA 2DBWA 2BXIA 2XW0A 2I30A 4WA6B 1MUSA 2KWFA 4W4UB 5DBYA 1MA9A 5HOZA 5ID9A 2LXSA 3FWCC 4LB2A 2NNWA 3JQZA 4N3ZA 4PO0A 2GUTA 4OTTA 2QM6A 4G04A 1LOTA 4M70B 3B9LA 3G9KD 2NQOA 3H37A 2AJEA 4HGKA 1AO6A 5GINA 2BXAA 2VUEA 2AGHB 1GNJA 2BXKA 2LQIA 4HGMB 3SQJA 2DBXA 3WHQA 3A75A 4LB9A 3UIVA 2Z8KA 1E7BA 2EFDA 4G01A 3ICXA 2DG5A 3NVKA 2BXEA 2XVQA 2BX8A 1BM0A 2BXDA 2BXMA 3TDLA 2CKXA 3MHSB 3A73A 4LA0A 3GQXA 3KJLA 3GQUA 1HA2A 2V36A 2YDFA 3NVMA 4K2CA 4LUFA 4S1YA 4L8UA 4GDLB 3W1SA 1HK4A 4ZCGA 1MIWA 4FJCB 1KW2A 1SB0A 4OTUA 4BY9C 2QHBA 1E7IA 3H3AA 1GNIA 4GG2A 1E7GA 1IJGA 4D7XA 3ECPA 2BXHA 3LU6A 4ZC6A 3LU7A 4F5TA 4JK4A 4L9QA 5B5TA 5GHKA 2OZBB 2BXOA 1TXUA 1MIVA 2EFCA 2K0NA 2QMCA 4J2VA 4MBEC 1HK5A 1BKEA 1J78A 4OT2A 4ZBQA 4DHXB 3PLAA 2LOQA 2VUFA 3BPJA 4GDKB 4TQ0A 4TQ1A 3FWBC 2ROHA 2DYMA 2KBZA 2DBUA 4GDXA 5BPKA 1VFIA 5IJFA 1TF0A 2BXQA
chains in the Genus database with same CATH topology
2BXLA 4K71A 1E7EA 5DQFA 1JNBA 2Z8IA 1N5UA 3CX9A 3GA9L 3WHRA 2JUHA 4L9KA 1FOUA 3M99C 3WHSA 4Z69A 4E99A 5IFOA 4EMXA 1HK3A 4N0UD 5FUOA 2XVVA 1VZSA 2EFEA 3VQIA 3NVIA 1LNSA 4F5VA 1E7CA 3MHHB 2DYOA 2BXCA 2E0XA 2VDBA 3FNMA 4G03A 1O9XA 3NMUA 2BXGA 4NAWB 4Z9OA 2BXFA 4ZBKA 3LU8A 1BJ5A 1E7AA 4FK5B 4ZBRA 3JRYA 2XW1A 5IJ5A 1E7FA 4IW2A 2EFHA 1E7HA 3V09A 5IIXA 2XMOA 1UORA 1H5WA 2I2ZA 2E0YA 1MIYA 5GIOA 4OR0A 2BXNA 5IIHA 4BKEA 1NT2B 1H9ZA 4F5SA 1J7EA 1HK1A 4F5UA 2XVUA 2XSIA 4IW1A 4LUHA 4N0FD 5ID7A 3B9MA 2BXBA 4ZUXV 1KXPD 4FIPB 2OT3A 1HK2A 3SIVB 2Z8JA 3V03A 5GIPA 5D7GA 5IIUA 3SIUB 3V08A 4C31B 5IJEA 3KIKA 1E78A 2BXPA 2XVWA 2DBWA 2BXIA 2XW0A 2I30A 4WA6B 4W4UB 5HOZA 5DBYA 1MA9A 5ID9A 3FWCC 4LB2A 2NNWA 3JQZA 4N3ZA 4PO0A 4OTTA 2QM6A 4G04A 1LOTA 4M70B 3B9LA 3G9KD 2NQOA 3H37A 2AJEA 4HGKA 1AO6A 5GINA 2BXAA 2VUEA 2BXKA 1GNJA 4HGMB 3SQJA 2DBXA 3WHQA 3A75A 4LB9A 3UIVA 2Z8KA 1E7BA 2EFDA 4G01A 3ICXA 2DG5A 3NVKA 2BXEA 2XVQA 2BX8A 1BM0A 2BXDA 2BXMA 3TDLA 2CKXA 3MHSB 3A73A 4LA0A 3GQXA 3KJLA 3GQUA 1HA2A 2V36A 2YDFA 3NVMA 4K2CA 4LUFA 4S1YA 4L8UA 4GDLB 3W1SA 1HK4A 4ZCGA 1MIWA 4FJCB 1KW2A 4OTUA 4BY9C 2QHBA 1E7IA 3H3AA 1GNIA 4GG2A 1E7GA 1IJGA 2BXHA 3LU6A 4ZC6A 3LU7A 4F5TA 4JK4A 4L9QA 5B5TA 5GHKA 2OZBB 2BXOA 1TXUA 1MIVA 2EFCA 2QMCA 4J2VA 4MBEC 1HK5A 1BKEA 1J78A 4OT2A 4ZBQA 4DHXB 3PLAA 2LOQA 2VUFA 4TQ0A 4GDKB 4TQ1A 3FWBC 2ROHA 2DYMA 2KBZA 2DBUA 4GDXA 5BPKA 1VFIA 5IJFA 1TF0A 2BXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BXL A;  4K71 A;  1E7E A;  5DQF A;  1N5U A;  3CX9 A;  4L9K A;  4Z69 A;  4E99 A;  5IFO A;  4EMX A;  1HK3 A;  4N0U D;  5FUO A;  2XVV A;  4F5V A;  1E7C A;  2VDB A;  2BXC A;  4G03 A;  1O9X A;  2BXG A;  2BXF A;  3LU8 A;  1BJ5 A;  1E7A A;  4ZBR A;  3JRY A;  2XW1 A;  5IJ5 A;  1E7F A;  4IW2 A;  1E7H A;  3V09 A;  5IIX A;  1UOR A;  2I2Z A;  4OR0 A;  2BXN A;  5IIH A;  4BKE A;  1H9Z A;  4F5S A;  1J7E A;  1HK1 A;  4F5U A;  2XVU A;  2XSI A;  4IW1 A;  4LUH A;  4N0F D;  5ID7 A;  3B9M A;  2BXB A;  1KXP D;  1HK2 A;  3V03 A;  5IIU A;  3V08 A;  5IJE A;  1E78 A;  2BXP A;  2XVW A;  2BXI A;  2XW0 A;  2I30 A;  5HOZ A;  5DBY A;  1MA9 A;  5ID9 A;  4LB2 A;  3JQZ A;  4PO0 A;  4G04 A;  1LOT A;  1AO6 A;  3B9L A;  4HGK A;  2BXA A;  2VUE A;  2BXK A;  1GNJ A;  4HGM B;  3SQJ A;  4LB9 A;  3UIV A;  1E7B A;  2BXE A;  2XVQ A;  2BX8 A;  1BM0 A;  2BXD A;  2BXM A;  3TDL A;  3A73 A;  4LA0 A;  1HA2 A;  2YDF A;  4K2C A;  4LUF A;  4S1Y A;  4L8U A;  1HK4 A;  1KW2 A;  1E7I A;  1GNI A;  1E7G A;  2BXH A;  3LU6 A;  3LU7 A;  4F5T A;  4JK4 A;  4L9Q A;  5GHK A;  2BXO A;  4J2V A;  1HK5 A;  1BKE A;  1J78 A;  4OT2 A;  4ZBQ A;  2VUF A;  5IJF A;  1TF0 A;  2BXQ A; 
#chains in the Genus database with same CATH topology
 2BXL A;  4K71 A;  1E7E A;  1KDX A;  5DQF A;  1JNB A;  2Z8I A;  1N5U A;  3CX9 A;  3GA9 L;  3WHR A;  2JUH A;  4L9K A;  1FOU A;  3M99 C;  3WHS A;  4Z69 A;  4E99 A;  4DM0 A;  5IFO A;  4EMX A;  1HK3 A;  4N0U D;  5FUO A;  2LXT A;  2XVV A;  1VZS A;  2EFE A;  3VQI A;  1MUH A;  1LNS A;  3NVI A;  4F5V A;  1E7C A;  3MHH B;  2DYO A;  2BXC A;  2E0X A;  2VDB A;  3FNM A;  4G03 A;  1O9X A;  3NMU A;  2BXG A;  4NAW B;  4Z9O A;  2BXF A;  4ZBK A;  3LU8 A;  1BJ5 A;  1E7A A;  4FK5 B;  4I9O A;  4ZBR A;  3JRY A;  2XW1 A;  5IJ5 A;  1E7F A;  4IW2 A;  2EFH A;  1E7H A;  3V09 A;  5IIX A;  2XMO A;  1UOR A;  1H5W A;  2I2Z A;  2E0Y A;  1MIY A;  5GIO A;  4OR0 A;  2BXN A;  5IIH A;  4BKE A;  1MM8 A;  1NT2 B;  1H9Z A;  4F5S A;  1J7E A;  1HK1 A;  4F5U A;  2XVU A;  2XSI A;  4IW1 A;  4LUH A;  4N0F D;  5ID7 A;  3B9M A;  2BXB A;  2LQH A;  4ZUX V;  1KXP D;  4FIP B;  2OT3 A;  1HK2 A;  3SIV B;  2Z8J A;  3V03 A;  5GIP A;  5D7G A;  5IIU A;  3SIU B;  3V08 A;  4C31 B;  5IJE A;  3KIK A;  1E78 A;  2BXP A;  2XVW A;  2DBW A;  2BXI A;  2XW0 A;  2I30 A;  4WA6 B;  1MUS A;  2KWF A;  4W4U B;  5DBY A;  1MA9 A;  5HOZ A;  5ID9 A;  2LXS A;  3FWC C;  4LB2 A;  2NNW A;  3JQZ A;  4N3Z A;  4PO0 A;  2GUT A;  4OTT A;  2QM6 A;  4G04 A;  1LOT A;  4M70 B;  3B9L A;  3G9K D;  2NQO A;  3H37 A;  2AJE A;  4HGK A;  1AO6 A;  5GIN A;  2BXA A;  2VUE A;  2AGH B;  1GNJ A;  2BXK A;  2LQI A;  4HGM B;  3SQJ A;  2DBX A;  3WHQ A;  3A75 A;  4LB9 A;  3UIV A;  2Z8K A;  1E7B A;  2EFD A;  4G01 A;  3ICX A;  2DG5 A;  3NVK A;  2BXE A;  2XVQ A;  2BX8 A;  1BM0 A;  2BXD A;  2BXM A;  3TDL A;  2CKX A;  3MHS B;  3A73 A;  4LA0 A;  3GQX A;  3KJL A;  3GQU A;  1HA2 A;  2V36 A;  2YDF A;  3NVM A;  4K2C A;  4LUF A;  4S1Y A;  4L8U A;  4GDL B;  3W1S A;  1HK4 A;  4ZCG A;  1MIW A;  4FJC B;  1KW2 A;  1SB0 A;  4OTU A;  4BY9 C;  2QHB A;  1E7I A;  3H3A A;  1GNI A;  4GG2 A;  1E7G A;  1IJG A;  4D7X A;  3ECP A;  2BXH A;  3LU6 A;  4ZC6 A;  3LU7 A;  4F5T A;  4JK4 A;  4L9Q A;  5B5T A;  5GHK A;  2OZB B;  2BXO A;  1TXU A;  1MIV A;  2EFC A;  2K0N A;  2QMC A;  4J2V A;  4MBE C;  1HK5 A;  1BKE A;  1J78 A;  4OT2 A;  4ZBQ A;  4DHX B;  3PLA A;  2LOQ A;  2VUF A;  3BPJ A;  4GDK B;  4TQ0 A;  4TQ1 A;  3FWB C;  2ROH A;  2DYM A;  2KBZ A;  2DBU A;  4GDX A;  5BPK A;  1VFI A;  5IJF A;  1TF0 A;  2BXQ A; 
#chains in the Genus database with same CATH homology
 2BXL A;  4K71 A;  1E7E A;  5DQF A;  1JNB A;  2Z8I A;  1N5U A;  3CX9 A;  3GA9 L;  3WHR A;  2JUH A;  4L9K A;  1FOU A;  3M99 C;  3WHS A;  4Z69 A;  4E99 A;  5IFO A;  4EMX A;  1HK3 A;  4N0U D;  5FUO A;  2XVV A;  1VZS A;  2EFE A;  3VQI A;  3NVI A;  1LNS A;  4F5V A;  1E7C A;  3MHH B;  2DYO A;  2BXC A;  2E0X A;  2VDB A;  3FNM A;  4G03 A;  1O9X A;  3NMU A;  2BXG A;  4NAW B;  4Z9O A;  2BXF A;  4ZBK A;  3LU8 A;  1BJ5 A;  1E7A A;  4FK5 B;  4ZBR A;  3JRY A;  2XW1 A;  5IJ5 A;  1E7F A;  4IW2 A;  2EFH A;  1E7H A;  3V09 A;  5IIX A;  2XMO A;  1UOR A;  1H5W A;  2I2Z A;  2E0Y A;  1MIY A;  5GIO A;  4OR0 A;  2BXN A;  5IIH A;  4BKE A;  1NT2 B;  1H9Z A;  4F5S A;  1J7E A;  1HK1 A;  4F5U A;  2XVU A;  2XSI A;  4IW1 A;  4LUH A;  4N0F D;  5ID7 A;  3B9M A;  2BXB A;  4ZUX V;  1KXP D;  4FIP B;  2OT3 A;  1HK2 A;  3SIV B;  2Z8J A;  3V03 A;  5GIP A;  5D7G A;  5IIU A;  3SIU B;  3V08 A;  4C31 B;  5IJE A;  3KIK A;  1E78 A;  2BXP A;  2XVW A;  2DBW A;  2BXI A;  2XW0 A;  2I30 A;  4WA6 B;  4W4U B;  5HOZ A;  5DBY A;  1MA9 A;  5ID9 A;  3FWC C;  4LB2 A;  2NNW A;  3JQZ A;  4N3Z A;  4PO0 A;  4OTT A;  2QM6 A;  4G04 A;  1LOT A;  4M70 B;  3B9L A;  3G9K D;  2NQO A;  3H37 A;  2AJE A;  4HGK A;  1AO6 A;  5GIN A;  2BXA A;  2VUE A;  2BXK A;  1GNJ A;  4HGM B;  3SQJ A;  2DBX A;  3WHQ A;  3A75 A;  4LB9 A;  3UIV A;  2Z8K A;  1E7B A;  2EFD A;  4G01 A;  3ICX A;  2DG5 A;  3NVK A;  2BXE A;  2XVQ A;  2BX8 A;  1BM0 A;  2BXD A;  2BXM A;  3TDL A;  2CKX A;  3MHS B;  3A73 A;  4LA0 A;  3GQX A;  3KJL A;  3GQU A;  1HA2 A;  2V36 A;  2YDF A;  3NVM A;  4K2C A;  4LUF A;  4S1Y A;  4L8U A;  4GDL B;  3W1S A;  1HK4 A;  4ZCG A;  1MIW A;  4FJC B;  1KW2 A;  4OTU A;  4BY9 C;  2QHB A;  1E7I A;  3H3A A;  1GNI A;  4GG2 A;  1E7G A;  1IJG A;  2BXH A;  3LU6 A;  4ZC6 A;  3LU7 A;  4F5T A;  4JK4 A;  4L9Q A;  5B5T A;  5GHK A;  2OZB B;  2BXO A;  1TXU A;  1MIV A;  2EFC A;  2QMC A;  4J2V A;  4MBE C;  1HK5 A;  1BKE A;  1J78 A;  4OT2 A;  4ZBQ A;  4DHX B;  3PLA A;  2LOQ A;  2VUF A;  4TQ0 A;  4GDK B;  4TQ1 A;  3FWB C;  2ROH A;  2DYM A;  2KBZ A;  2DBU A;  4GDX A;  5BPK A;  1VFI A;  5IJF A;  1TF0 A;  2BXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...