1J78A

Crystallographic analysis of the human vitamin d binding protein
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
433
Chain Sequence
CKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCYDTRTSALSAKSCESNSPFPVHPGTAECCTKRKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vitamin D binding protein
publication title A structural basis for the unique binding features of the human vitamin D-binding protein.
pubmed doi rcsb
molecule tags Transport, ligand binding protein
total genus 161
structure length 433
sequence length 445
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00273 Serum_albumin Serum albumin family
A PF09164 VitD-bind_III Vitamin D binding protein, domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1j78A02
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1j78A03
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1j78A01
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1j78A04
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1j78A05
4HGKA 4F5UA 1O9XA 2BXKA 2I30A 2BXOA 4J2VA 3LU7A 4OR0A 1KXPD 1HK1A 1HK3A 1E7BA 3JQZA 2VDBA 4F5SA 4LB2A 2BXCA 4K2CA 4E99A 5IIHA 1UORA 3B9LA 1BJ5A 1E7EA 2BX8A 5IIXA 1GNJA 4ZBRA 4OT2A 4LB9A 1E78A 1HK5A 4S1YA 2VUFA 3LU6A 5IFOA 4L8UA 4N0UD 4ZBQA 4PO0A 2XSIA 2BXNA 1E7IA 3SQJA 1KW2A 2BXFA 5IJEA 1H9ZA 2BXEA 4LUHA 3V09A 4K71A 1BKEA 4LA0A 3UIVA 2XVWA 1HK2A 2BXIA 5DBYA 1MA9A 4F5TA 1E7FA 4IW2A 2BXQA 2BXMA 5GHKA 2XVQA 5IIUA 1AO6A 2XVVA 2XW1A 4N0FD 2BXBA 3V03A 1TF0A 4IW1A 4L9QA 1LOTA 2BXAA 1HA2A 1N5UA 4G03A 5IJ5A 3V08A 2I2ZA 3LU8A 1E7AA 5FUOA 2BXDA 1BM0A 1J7EA 1J78A 3A73A 3B9MA 5ID7A 2BXLA 3JRYA 2VUEA 2XW0A 1E7HA 2BXHA 2XVUA 4G04A 4F5VA 4JK4A 1HK4A 4BKEA 5ID9A 4L9KA 5HOZA 1E7CA 2BXPA 2BXGA 3TDLA 4LUFA 5IJFA 1GNIA 5DQFA 4Z69A 4EMXA 2YDFA 4HGMB 3CX9A 1E7GA
chains in the Genus database with same CATH superfamily
4HGKA 4FIPB 2OT3A 4ZCGA 3H3AA 4F5UA 1O9XA 2BXKA 2I30A 2K0NA 5GINA 3CX9A 2BXOA 4J2VA 3LU7A 4ZC6A 4OR0A 1KXPD 2Z8JA 1HK1A 1FOUA 2DYOA 1HK3A 3WHQA 3A75A 3G9KD 1E7BA 3JQZA 2VDBA 4F5SA 4LB2A 2BXCA 4GG2A 5B5TA 2E0XA 4K2CA 4E99A 5IIHA 2E0YA 1UORA 3B9LA 1BJ5A 1E7EA 2BX8A 2LXTA 5IIXA 1GNJA 2LQIA 4ZBRA 2V36A 4OT2A 4C31B 4LB9A 4TQ1A 4TQ0A 1E78A 1HK5A 3VQIA 1MIYA 4S1YA 3KIKA 3BPJA 1MIVA 2VUFA 2EFCA 3LU6A 5IFOA 4L8UA 3W1SA 4FJCB 4N0UD 4ZBQA 1IJGA 4PO0A 2XSIA 2ROHA 2BXNA 1E7IA 4MBEC 3SQJA 1KW2A 2BXFA 5BPKA 5D7GA 3WHSA 5IJEA 1MM8A 4GDKB 1H9ZA 2BXEA 2DG5A 4M70B 4LUHA 4OTUA 1VZSA 3V09A 1LNSA 2DBXA 3NVKA 3GQUA 4K71A 3ICXA 2LXSA 1BKEA 4LA0A 3WHRA 4Z9OA 3UIVA 2XVWA 3SIUB 1HK2A 2BXIA 5DBYA 1MA9A 4F5TA 2LQHA 3GQXA 2DBUA 1E7FA 4I9OA 3ECPA 3PLAA 2BXQA 2QM6A 2BXMA 2GUTA 2XMOA 2EFEA 2CKXA 2Z8KA 4IW2A 2DBWA 5GHKA 4ZBKA 4DHXB 2NNWA 1SB0A 2XVQA 5IIUA 2XVVA 2XW1A 4N0FD 1AO6A 2BXBA 3V03A 1KDXA 4GDXA 1TF0A 4IW1A 2Z8IA 4L9QA 1LOTA 3MHSB 1VFIA 2BXAA 1JNBA 1HA2A 1TXUA 2EFDA 1N5UA 4G03A 4N3ZA 3FWBC 4G01A 2AGHB 3NVIA 2KWFA 3GA9L 5IJ5A 4D7XA 3V08A 2I2ZA 2NQOA 3LU8A 1E7AA 3KJLA 2DYMA 1MUSA 4FK5B 5FUOA 3MHHB 4OTTA 2BXDA 1BM0A 1J7EA 4WA6B 1J78A 3A73A 3B9MA 5ID7A 2EFHA 2BXLA 3JRYA 2VUEA 2XW0A 4W4UB 1E7HA 1NT2B 2BXHA 2XVUA 3H37A 4G04A 1MIWA 4F5VA 2QHBA 4DM0A 3NVMA 1HK4A 4JK4A 4BKEA 5GIOA 2AJEA 5ID9A 4L9KA 5HOZA 1E7CA 4NAWB 2BXPA 2BXGA 3TDLA 5GIPA 4LUFA 5IJFA 4BY9C 1GNIA 3SIVB 5DQFA 4Z69A 4EMXA 4GDLB 2OZBB 1H5WA 2LOQA 4ZUXV 3M99C 2JUHA 3FWCC 2KBZA 3NMUA 2YDFA 1MUHA 4HGMB 3FNMA 2QMCA 1E7GA
chains in the Genus database with same CATH topology
4HGKA 4FIPB 2OT3A 4ZCGA 3H3AA 4F5UA 1O9XA 2BXKA 2I30A 5GINA 3CX9A 2BXOA 4J2VA 3LU7A 4ZC6A 4OR0A 1KXPD 2Z8JA 1HK1A 1FOUA 2DYOA 1HK3A 3WHQA 3A75A 3G9KD 1E7BA 3JQZA 2VDBA 4F5SA 4LB2A 2BXCA 4GG2A 5B5TA 2E0XA 4K2CA 4E99A 5IIHA 2E0YA 1UORA 3B9LA 1BJ5A 1E7EA 2BX8A 5IIXA 1GNJA 4ZBRA 2V36A 4OT2A 4C31B 4LB9A 4TQ1A 4TQ0A 1E78A 1HK5A 3VQIA 1MIYA 4S1YA 3KIKA 1MIVA 2VUFA 2EFCA 3LU6A 5IFOA 4L8UA 3W1SA 4FJCB 4N0UD 4ZBQA 1IJGA 4PO0A 2XSIA 2ROHA 2BXNA 1E7IA 4MBEC 3SQJA 1KW2A 2BXFA 5BPKA 5D7GA 3WHSA 5IJEA 4GDKB 1H9ZA 2BXEA 2DG5A 4M70B 4LUHA 4OTUA 1VZSA 3V09A 1LNSA 2DBXA 3NVKA 3GQUA 4K71A 3ICXA 1BKEA 4LA0A 3WHRA 4Z9OA 3UIVA 2XVWA 3SIUB 1HK2A 2BXIA 5DBYA 1MA9A 4F5TA 3GQXA 2DBUA 1E7FA 3PLAA 2BXQA 2QM6A 2BXMA 2XMOA 2Z8KA 2EFEA 2CKXA 4IW2A 2DBWA 5GHKA 4ZBKA 4DHXB 2NNWA 2XVQA 5IIUA 1AO6A 2XVVA 2XW1A 4N0FD 2BXBA 3V03A 4GDXA 1TF0A 4IW1A 2Z8IA 4L9QA 1LOTA 3MHSB 1VFIA 2BXAA 1JNBA 1HA2A 1TXUA 2EFDA 1N5UA 4G03A 4N3ZA 3FWBC 4G01A 3NVIA 3GA9L 5IJ5A 3V08A 2I2ZA 2NQOA 3LU8A 1E7AA 3KJLA 2DYMA 4FK5B 5FUOA 3MHHB 4OTTA 2BXDA 1BM0A 1J7EA 4WA6B 1J78A 3A73A 3B9MA 5ID7A 2EFHA 2BXLA 3JRYA 2VUEA 2XW0A 4W4UB 1E7HA 1NT2B 2BXHA 2XVUA 3H37A 4G04A 1MIWA 4F5VA 2QHBA 3NVMA 1HK4A 4JK4A 4BKEA 5GIOA 2AJEA 5ID9A 4L9KA 5HOZA 1E7CA 4NAWB 2BXPA 2BXGA 3TDLA 5GIPA 4LUFA 5IJFA 4BY9C 1GNIA 3SIVB 5DQFA 4Z69A 4EMXA 4GDLB 2OZBB 1H5WA 2LOQA 4ZUXV 3M99C 2JUHA 3FWCC 2KBZA 3NMUA 2YDFA 4HGMB 3FNMA 2QMCA 1E7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HGK A;  4F5U A;  1O9X A;  2BXK A;  2I30 A;  2BXO A;  4J2V A;  3LU7 A;  4OR0 A;  1KXP D;  1HK1 A;  1HK3 A;  1E7B A;  3JQZ A;  2VDB A;  4F5S A;  4LB2 A;  2BXC A;  4K2C A;  4E99 A;  5IIH A;  1UOR A;  3B9L A;  1BJ5 A;  1E7E A;  2BX8 A;  5IIX A;  1GNJ A;  4ZBR A;  4OT2 A;  4LB9 A;  1E78 A;  1HK5 A;  4S1Y A;  2VUF A;  3LU6 A;  5IFO A;  4L8U A;  4N0U D;  4ZBQ A;  4PO0 A;  2XSI A;  2BXN A;  1E7I A;  3SQJ A;  1KW2 A;  2BXF A;  5IJE A;  1H9Z A;  2BXE A;  4LUH A;  3V09 A;  4K71 A;  1BKE A;  4LA0 A;  3UIV A;  2XVW A;  1HK2 A;  2BXI A;  5DBY A;  1MA9 A;  4F5T A;  1E7F A;  4IW2 A;  2BXQ A;  2BXM A;  5GHK A;  2XVQ A;  5IIU A;  1AO6 A;  2XVV A;  2XW1 A;  4N0F D;  2BXB A;  3V03 A;  1TF0 A;  4IW1 A;  4L9Q A;  1LOT A;  2BXA A;  1HA2 A;  1N5U A;  4G03 A;  5IJ5 A;  3V08 A;  2I2Z A;  3LU8 A;  1E7A A;  5FUO A;  2BXD A;  1BM0 A;  1J7E A;  1J78 A;  3A73 A;  3B9M A;  5ID7 A;  2BXL A;  3JRY A;  2VUE A;  2XW0 A;  1E7H A;  2BXH A;  2XVU A;  4G04 A;  4F5V A;  4JK4 A;  1HK4 A;  4BKE A;  5ID9 A;  4L9K A;  5HOZ A;  1E7C A;  2BXP A;  2BXG A;  3TDL A;  4LUF A;  5IJF A;  1GNI A;  5DQF A;  4Z69 A;  4EMX A;  2YDF A;  4HGM B;  3CX9 A;  1E7G A; 
#chains in the Genus database with same CATH topology
 4HGK A;  4FIP B;  2OT3 A;  4ZCG A;  3H3A A;  4F5U A;  1O9X A;  2BXK A;  2I30 A;  2K0N A;  5GIN A;  3CX9 A;  2BXO A;  4J2V A;  3LU7 A;  4ZC6 A;  4OR0 A;  1KXP D;  2Z8J A;  1HK1 A;  1FOU A;  2DYO A;  1HK3 A;  3WHQ A;  3A75 A;  3G9K D;  1E7B A;  3JQZ A;  2VDB A;  4F5S A;  4LB2 A;  2BXC A;  4GG2 A;  5B5T A;  2E0X A;  4K2C A;  4E99 A;  5IIH A;  2E0Y A;  1UOR A;  3B9L A;  1BJ5 A;  1E7E A;  2BX8 A;  2LXT A;  5IIX A;  1GNJ A;  2LQI A;  4ZBR A;  2V36 A;  4OT2 A;  4C31 B;  4LB9 A;  4TQ1 A;  4TQ0 A;  1E78 A;  1HK5 A;  3VQI A;  1MIY A;  4S1Y A;  3KIK A;  3BPJ A;  1MIV A;  2VUF A;  2EFC A;  3LU6 A;  5IFO A;  4L8U A;  3W1S A;  4FJC B;  4N0U D;  4ZBQ A;  1IJG A;  4PO0 A;  2XSI A;  2ROH A;  2BXN A;  1E7I A;  4MBE C;  3SQJ A;  1KW2 A;  2BXF A;  5BPK A;  5D7G A;  3WHS A;  5IJE A;  1MM8 A;  4GDK B;  1H9Z A;  2BXE A;  2DG5 A;  4M70 B;  4LUH A;  4OTU A;  1VZS A;  3V09 A;  1LNS A;  2DBX A;  3NVK A;  3GQU A;  4K71 A;  3ICX A;  2LXS A;  1BKE A;  4LA0 A;  3WHR A;  4Z9O A;  3UIV A;  2XVW A;  3SIU B;  1HK2 A;  2BXI A;  5DBY A;  1MA9 A;  4F5T A;  2LQH A;  3GQX A;  2DBU A;  1E7F A;  4I9O A;  3ECP A;  3PLA A;  2BXQ A;  2QM6 A;  2BXM A;  2GUT A;  2XMO A;  2EFE A;  2CKX A;  2Z8K A;  4IW2 A;  2DBW A;  5GHK A;  4ZBK A;  4DHX B;  2NNW A;  1SB0 A;  2XVQ A;  5IIU A;  2XVV A;  2XW1 A;  4N0F D;  1AO6 A;  2BXB A;  3V03 A;  1KDX A;  4GDX A;  1TF0 A;  4IW1 A;  2Z8I A;  4L9Q A;  1LOT A;  3MHS B;  1VFI A;  2BXA A;  1JNB A;  1HA2 A;  1TXU A;  2EFD A;  1N5U A;  4G03 A;  4N3Z A;  3FWB C;  4G01 A;  2AGH B;  3NVI A;  2KWF A;  3GA9 L;  5IJ5 A;  4D7X A;  3V08 A;  2I2Z A;  2NQO A;  3LU8 A;  1E7A A;  3KJL A;  2DYM A;  1MUS A;  4FK5 B;  5FUO A;  3MHH B;  4OTT A;  2BXD A;  1BM0 A;  1J7E A;  4WA6 B;  1J78 A;  3A73 A;  3B9M A;  5ID7 A;  2EFH A;  2BXL A;  3JRY A;  2VUE A;  2XW0 A;  4W4U B;  1E7H A;  1NT2 B;  2BXH A;  2XVU A;  3H37 A;  4G04 A;  1MIW A;  4F5V A;  2QHB A;  4DM0 A;  3NVM A;  1HK4 A;  4JK4 A;  4BKE A;  5GIO A;  2AJE A;  5ID9 A;  4L9K A;  5HOZ A;  1E7C A;  4NAW B;  2BXP A;  2BXG A;  3TDL A;  5GIP A;  4LUF A;  5IJF A;  4BY9 C;  1GNI A;  3SIV B;  5DQF A;  4Z69 A;  4EMX A;  4GDL B;  2OZB B;  1H5W A;  2LOQ A;  4ZUX V;  3M99 C;  2JUH A;  3FWC C;  2KBZ A;  3NMU A;  2YDF A;  1MUH A;  4HGM B;  3FNM A;  2QMC A;  1E7G A; 
#chains in the Genus database with same CATH homology
 4HGK A;  4FIP B;  2OT3 A;  4ZCG A;  3H3A A;  4F5U A;  1O9X A;  2BXK A;  2I30 A;  5GIN A;  3CX9 A;  2BXO A;  4J2V A;  3LU7 A;  4ZC6 A;  4OR0 A;  1KXP D;  2Z8J A;  1HK1 A;  1FOU A;  2DYO A;  1HK3 A;  3WHQ A;  3A75 A;  3G9K D;  1E7B A;  3JQZ A;  2VDB A;  4F5S A;  4LB2 A;  2BXC A;  4GG2 A;  5B5T A;  2E0X A;  4K2C A;  4E99 A;  5IIH A;  2E0Y A;  1UOR A;  3B9L A;  1BJ5 A;  1E7E A;  2BX8 A;  5IIX A;  1GNJ A;  4ZBR A;  2V36 A;  4OT2 A;  4C31 B;  4LB9 A;  4TQ1 A;  4TQ0 A;  1E78 A;  1HK5 A;  3VQI A;  1MIY A;  4S1Y A;  3KIK A;  1MIV A;  2VUF A;  2EFC A;  3LU6 A;  5IFO A;  4L8U A;  3W1S A;  4FJC B;  4N0U D;  4ZBQ A;  1IJG A;  4PO0 A;  2XSI A;  2ROH A;  2BXN A;  1E7I A;  4MBE C;  3SQJ A;  1KW2 A;  2BXF A;  5BPK A;  5D7G A;  3WHS A;  5IJE A;  4GDK B;  1H9Z A;  2BXE A;  2DG5 A;  4M70 B;  4LUH A;  4OTU A;  1VZS A;  3V09 A;  1LNS A;  2DBX A;  3NVK A;  3GQU A;  4K71 A;  3ICX A;  1BKE A;  4LA0 A;  3WHR A;  4Z9O A;  3UIV A;  2XVW A;  3SIU B;  1HK2 A;  2BXI A;  5DBY A;  1MA9 A;  4F5T A;  3GQX A;  2DBU A;  1E7F A;  3PLA A;  2BXQ A;  2QM6 A;  2BXM A;  2XMO A;  2Z8K A;  2EFE A;  2CKX A;  4IW2 A;  2DBW A;  5GHK A;  4ZBK A;  4DHX B;  2NNW A;  2XVQ A;  5IIU A;  1AO6 A;  2XVV A;  2XW1 A;  4N0F D;  2BXB A;  3V03 A;  4GDX A;  1TF0 A;  4IW1 A;  2Z8I A;  4L9Q A;  1LOT A;  3MHS B;  1VFI A;  2BXA A;  1JNB A;  1HA2 A;  1TXU A;  2EFD A;  1N5U A;  4G03 A;  4N3Z A;  3FWB C;  4G01 A;  3NVI A;  3GA9 L;  5IJ5 A;  3V08 A;  2I2Z A;  2NQO A;  3LU8 A;  1E7A A;  3KJL A;  2DYM A;  4FK5 B;  5FUO A;  3MHH B;  4OTT A;  2BXD A;  1BM0 A;  1J7E A;  4WA6 B;  1J78 A;  3A73 A;  3B9M A;  5ID7 A;  2EFH A;  2BXL A;  3JRY A;  2VUE A;  2XW0 A;  4W4U B;  1E7H A;  1NT2 B;  2BXH A;  2XVU A;  3H37 A;  4G04 A;  1MIW A;  4F5V A;  2QHB A;  3NVM A;  1HK4 A;  4JK4 A;  4BKE A;  5GIO A;  2AJE A;  5ID9 A;  4L9K A;  5HOZ A;  1E7C A;  4NAW B;  2BXP A;  2BXG A;  3TDL A;  5GIP A;  4LUF A;  5IJF A;  4BY9 C;  1GNI A;  3SIV B;  5DQF A;  4Z69 A;  4EMX A;  4GDL B;  2OZB B;  1H5W A;  2LOQ A;  4ZUX V;  3M99 C;  2JUH A;  3FWC C;  2KBZ A;  3NMU A;  2YDF A;  4HGM B;  3FNM A;  2QMC A;  1E7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...